2OQQA

Crystal structure of hy5 leucine zipper homodimer from arabidopsis thaliana
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
42
structure length
42
Chain Sequence
GSAYLSELENRVKDLENKNSELEERLSTLQNENQMLRHILKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcription factor HY5
publication title Structural basis for the conformational integrity of the Arabidopsis thaliana HY5 Ieucine zipper homodimer
rcsb
source organism Arabidopsis thaliana
molecule tags Transcription
total genus 19
structure length 42
sequence length 42
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-02-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.490 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 2oqqA00
1R8EA 1EXIA 3D71A 3Q2YA 3Q5SA 3D70A 1DIPA 3D6ZA 3G9RA 2OQQA 2J5UA 3Q5PA 3IAOA 3Q3DA 3D6YA 4R4MA 4R4LA 3T97B 1EXJA 3Q5RA 3Q1MA
chains in the Genus database with same CATH superfamily
2A06E 3HE5B 1Z56A 2XV5A 1YITP 3RBXA 3H1JD 3H1JG 3PTZA 1GK6A 1BGYE 3TGUE 1LWUA 3LIEA 3M9BA 1GK4A 3GLMA 1PIXA 2BCCJ 3RL0B 1AQ5A 2D2CB 4H0LD 3BCCD 4EOTA 3BCCG 5TISH 2QE7H 2KOGA 4M3LA 1JM0A 1GL2B 1BE3J 1VQMP 5AVZB 2IBZE 2HODB 3OJAB 3O6QB 1KB9D 4H44C 5APSA 1FJKA 2OYHA 1NU1D 2YMKA 1FE6A 1NU1G 1SQBJ 1SVFA 1Q81Q 3KZIE 1N8RQ 3AEBC 4RESB 1T2KD 3C9IA 2WSSH 1SQPJ 2FYUE 2P2UA 1Y47A 2P1JA 1JY3N 3CX5D 4U3FJ 2HPCB 3VMAA 1Q90D 1KMIZ 1KB9H 3GHGB 2ZYGA 2AXTE 3C1LA 1SQXJ 4R4LA 1YJ9P 3Q5RA 1SQQD 1X79B 3CCMP 1SQQG 5GTHH 1VQ8P 1Q82Q 2WPRA 1NVOA 3L35A 1NTZE 1R5SA 1KC8Q 1IFNA 1KQGB 2FXMA 3CX5H 3SWFA 3P8CD 4JYBA 3AE4C 3AECC 1KILC 1IFDA 1BGYD 4WVZA 3CCLP 1UIXA 3A3YB 1JUNA 2GUVA 2ITAA 2WPSA 1RE3A 4L74A 1OW7A 2ZAEB 1OWAA 3L75D 3MGNA 3L75G 3L74J 2QJKC 2IBZD 4WWIA 1QEXA 5APWA 3VP8A 5KKZB 2QRXA 3PLNA 1BSHA 1KILB 1FZCC 3PHLA 2L5GB 2Y9YA 3HUSA 3B5NC 4BXLA 1AVYA 3V5BA 3P32A 5KLIC 1R8EA 5KJ7C 2WITA 3R4YA 1M1JA 2K9YA 3M0AA 1YTZT 2N1TC 2QJKB 3JC22 2KP8A 4XE5B 4PV1C 4OWFA 3T97A 2ZYDA 1FZCB 3R2PA 4BRYA 2QM7A 3M0DA 3L72D 3B5NB 3L71E 3L72G 3MTUE 1OIPA 2POHA 1JTHB 1PV3A 2UWJE 5KLIB 3WUTA 1GD2E 3NTNA 3HRNA 2AXTH 2WVRA 3HE4A 1ZR4A 2N1TB 1RQUA 3II6A 3D6ZA 5H2FH 5AW2B 2OTJP 4U3FG 3FWLA 1VF5C 3ZDMA 4PV1B 4OGQD 4KJMA 1S72P 1VQNP 5KAFE 3I55P 1K73Q 1SP4A 2IZ0A 1KQFB 2OYHC 4YPCA 1FAVA 3L36A 1BCCJ 3IFMA 4OH8B 1LT9A 1SQBK 1G1IA 1JMMA 5BU5A 2WSCH 2W8ZA 1RE4A 5CCGD 4C7NB 1VF5B 1SQPK 2OQQA 2BASA 1N7SD 3A0BE 5GTIH 3CMAP 1N73C 2OYHB 5APQA 1QGKB 3H1HD 2FXOA 3H1HG 1EDKA 2KNCA 4PD4D 1URQD 5AW1B 3H1IE 4PJ0E 3CCEP 3LW5J 3CXHE 2D2CD 1IJDB 3W68A 3H1KJ 1JCDA 3VYIA 3L71D 3L71G 1NTKE 1LTJA 1N73B 4PD4H 3GF3A 2KS1A 3MIWA 4D6TE 1OXZA 2OYIC 1PGOA 5AVRB 1EC5A 5BU8B 1X8YA 2N9BA 2FKWB 1NTMD 1NTMG 3TNUA 1L0LK 3BASA 3L70D 2BEZF 3L70G 3D6YA 2E42A 4LGDE 1IK9A 1BSNA 3B4SA 3AE1C 5TISE 1XTGB 4HJGH 4IFMA 2QM8A 4O9BA 2IDBA 4H44D 3KDPB 3H1JE 3HUSC 3N7NA 1JY2P 3WU2H 2OYOA 3CCRP 2C0XA 2R3SA 1U57A 3QH9A 2XNDH 2H8PD 1IFJA 3CD6P 3FXDA 1JCCA 1OX3A 3HD7C 3JSVC 3BCCE 3NXSA 3AE9C 4NPEA 3P7KA 4RO0A 3H32B 3AEEC 1L4AA 5BVZA 1OVRA 1QLED 1KB9E 5AVWB 2E74C 3KHUA 5KLVJ 3H1ID 2WWWA 1T3JA 3HUSB 2L91A 3CXHD 1L0NJ 3MUDA 2JWDA 4JF7A 5GTHE 1GW3A 2KLUA 1PP9J 3EFGA 2LKMA 2W6BA 4JYCA 1KYOD 1RF1C 3A0BH 2V7QJ 3CCUP 3HD7B 3RK2C 3A0HH 3GMAA 4GT1A 1WRGA 3CX5E 3L4FA 3L73J 4GIFA 2E75C 3T97B 4NPFX 4D6TD 4D6TG 3P8MC 4L75A 1HJBA 2E74B 1SFCD 2YKPA 1SQQE 2QIWA 3CXHH 3RK3C 3TGUJ 4CPGA 2P7JA 3AE2C 1KYOH 1LT9C 1RF1B 1GZLA 3HE4B 3VN0A 4WY4D 3RK2B 5E79E 2NPSD 1S9KD 3KPEA 1MUUA 1HGVA 3P8CE 3FWNA 1T6AA 2G3AA 3CC2P 1CSBA 1JY3P 4ZKPA 2E75B 1FDIA 1VQ9P 2N9YB 1Q7YQ 3G3ZA 2NZ2A 5AW4B 2PRRA 1JY2O 3RK3B 2WQYC 2Q9IA 4N78D 4BWNA 1KZUB 1M8OB 4HB1A 3V2PA 1YTZI 1Q2NA 1VQKP 1LT9B 3L75E 4H13D 1G1JA 3BRVB 2FYUJ 3GHGC 1VQ5P 4LLHA 2JP3A 2KLVA 5KTBA 3B8EB 3TDKA 2WTYA 4Y28J 2WSFJ 3H1LD 2PFXA 3H1LG 3G9RA 3VOPA 1OFCX 4GOFA 1JMBA 2RKLA 2WZ7A 2Q6QA 1M57D 2B87A 1ZR2A 2E76D 2R3CA 3C8VA 3E7KA 1NTZJ 2KI7B 2O01J 1KTMA 1DD4A 2B88A 1IFPA 1SLQA 5AW8B 2FBWC 2H43A 2ZFCA 4DJGA 5H2FE 1G2CB 3U59A 1Y9BA 3OA7A 1VQ4P 2E5TA 2IYPA 1DIPA 4AQRD 1N2DC 4KT0J 2RN0A 2Q5UA 3Q5PA 3L72E 2Q3EA 2YO3A 4L73A 3CWBD 3CWBG 2AEJA 1KB9I 1LTIC 5KKZC 2RH0A 1AA0A 3TNUB 1MV8A 4YTPC 3QWOC 4U3FE 2P10A 5CCHC 3HTKA 2RMZA 1SQXE 2DW3A 1ZXGA 1L4AC 2HR3A 1L0LJ 1M7LA 4A7PA 1USEA 4C46A 4UB6E 2JKVA 2KB7P 5GTIE 3CX5I 5E79H 4K35A 2E5YA 4ASWA 2OARA 2K9JB 2KYVA 2FFDA 4DT0A 5KLVK 2I1KA 4GODA 2XKMA 1X0TA 3E1IA 1L0NK 4ZMDA 1FZGA 4C7RA 2IFNA 1VQPP 1HUCA 3AE5C 3NMDA 1M1KQ 1LP1B 1L4AB 1SQVJ 5AVQB 3PP5A 3AEFC 2BCCD 3CC4P 4XA4A 2BCCG 2Q7CA 5AVVB 3S9OA 3H1HE 2E43A 4PD4E 3PRJA 1CI6A 1PL5A 1L2PA 3L74E 1BE3D 3CLQA 1VQ7P 1BE3G 3BVHA 3RL0g 5APUA 1KV4A 2LR2A 2IPPA 2W6JH 3OAKA 1SQBD 1FS0E 1SQBG 2ZVNB 2B89A 1NH4A 2JO1A 1LWUC 2IBZI 3BRTB 3UIAA 1SQPD 3EQ2A 1SQPG 1RH5B 1IK7A 3WU2E 2QJPC 1KFMA 4U3FD 2W27A 5CCGA 1NTME 1FBMA 1ZRTD 1AJYA 1SQXD 3L70E 5AVXB 1SQXG 3MHVA 3AE8C 5AW6B 5L8RJ 1N7SA 3V2RA 1VQ6P 3GW6A 2FYUK 4I1LA 2W90A 1K9MQ 1GTWA 5AW7B 5AVTB 4W80A 2H89C 1URQA 4YXDC 1LWUB 1KD1Q 2YIUC 2OTLP 2QG4A 2JDIH 2M5AA 2WSEJ 5APTA 3TYYA 2K3RA 1QX8A 2QJPB 3RGUA 1QVFO 3CCJP 1J1DC 1FZEA 2CPSA 1M56D 1NTZK 4UB6H 1KN7A 1R5LA 2HODA 3RK2D 3SWKA 1EQ7A 2AXCA 4WB4A 3A0HE 3MZWB 1NTKJ 1TU3F 1LGHB 3E1RA 1OMIA 4EYYQ 1EZVD 1D7MA 1S1CX 2YIUB 1EZVG 3I5CA 3L74D 2ZVOB 3RL0D 3L74G 3RK3D 1PGJA 3VP9A 3TF5A 2Z5IA 2QJYC 1J1DB 1S5LX 1KYOE 1RHZB 1AFOA 3H6PA 4WBAA 2CK3H 1GL2D 3WUUA 2Q3IA 1S5LE 2JEEA 1EXJA 1KILE 2C0WA 1YHQP 1RE3C 3H1JJ 1FOSE 2ZXXA 1NKNA 4EIJA 1GU4A 5KAIH 1A02F 1HVVA 1T8ZA 1LT1A 2QJYB 4N3YB 2IZ1A 1PFIA 2HFED 3BCCJ 5DJTB 2KXPB 3TSIA 3EWKA 1S9KE 4PD4I 3FXEA 2ZXEB 5B66E 3I56P 2FY8A 1WT6A 1MFTA 4IOIH 1NU1J 2A45G 2FYZA 2H88C 2XNXA 4W7YA 4I6MC 5CBNA 1SQVK 1GU5A 1M1JC 3G4SP 4N78E 1H0TA 2O1JA 1HBWA 2FFDB 2XU6A 1P84D 1PPJE 2BEQD 2AEMA 1IFIA 2YMYA 2M8RA 4OGQC 2VRSA 1W2BO 1KILA 5AW9B 1IC2A 3LIDA 1NJIQ 1S2EA 1SFCA 5CJ4A 3OW2O 2A45H 1YJWP 3M0DC 1DEEG 2JJLA 3H1LE 1NKZB 1VPCA 2K37A 1BCCD 1K8AQ 1BCCG 1NGMB 2W6AA 1SQQJ 1OZHA 1ZN5A 2CPBA 1HTLC 2O01N 3CMEP 4HYTB 3D71A 1M1JB 2M0BA 1P84H 2WMMA 4WY4A 2NPSA 1NAYA 1MZ9A 4Y99C 3U1AA 4I2LC 1YQ4C 2ZT9C 5K5GB 1HF9A 3IN6A 4TLFA 1KILD 3S1KA 4OGQB 2K88A 1ZV8A 1N7SC 2LXBA 3Q2YA 5CCHD 4BRYB 1JY2N 1BGYJ 1LTAC 3B5NA 3W67A 1JTHA 2P58A 1HJ0A 1E5WA 1URQC 2MKVA 1H88A 1LNQA 4MN4C 2KIKA 1S5LH 3CWBE 1K05A 3H1KD 1PP9E 2N1TA 3JCUH 1RE4C 3H1KG 3L75J 3VMYA 4Y99B 3F89A 2QVAA 2ZT9B 3G6EP 1LTGC 3L73E 1Y8AA 3CXHI 2YO2A 1N7SB 1LTSC 3AEAC 3B5ND 4HH2A 1KYOI 3IF4A 2QSIA 3LW5H 3M91A 1URQB 1PPJD 1NTKK 5KJ7D 1PPJG 2M5AB 5AVYB 1DX7A 2N1TD 1W5CE 1GDTA 5B66H 4C7NA 2FYNC 1K04A 3M9HA 4PV1D 4DCKA 3U1CA 2ZJSE 1GW4A 1CZQA 2WPVB 1LTJC 3A2AA 1H8AA 3N4XA 2B9BA 1RY3A 4JQ0D 4N6JA 2G8YA 3L72J 2KNCB 1H89A 2Z4EA 2BCCE 1HH0A 3V4WA 1VQLP 3S4RA 3AE6C 5C39A 4I7ZC 1ZLLA 1ZW0A 3VMZA 2OGUA 3AEDC 1NOHA 3MD0A 1ZMEC 4AUWA 3Q1MA 1M90Q 1BE3E 1FU1A 2FYNB 1U7MA 1VF5D 1FDOA 1N7LA 3AE7C 1EDIA 2LXCB 2WSCJ 5B5EE 5KLVD 3IR9A 1SQBE 4IL6H 5KLVG 1LTJB 2W83C 3CPWO 2MJZA 4JBZA 4JPZB 4H44B 1N73A 2GUSA 1L0ND 1L0NG 4GKGA 2KS1B 1PP9D 4W7ZA 1BDCA 4UB8H 2XZRA 1PP9G 2JR8A 3RBZA 2KUBA 1SQPE 4I7ZB 4EI2A 2OTKE 1NU1K 3L73D 2GA1A 3L73G 2A06D 1ZRTE 2A06G 1HWTC 1JY3O 1YJNP 1UIIA 5DJUB 3TGUD 2PGDA 2KK7A 1BGYG 3TGUG 1SFCC 1OW6A 3AEGC 2WT7A 2R32A 2V7QH 2K1AA 3MUDC 2J59M 1RF0A 2OYIA 3H1HJ 1E79H 4U7JA 2SPZA 2YKOA 1SQQK 2HLOA 1H0TB 2KZIA 1IFMA 4WY4C 2NPSC 1YQ3C 5TJHA 3FGAD 2YXQB 2IBZG 4ZKUA 2Y0EA 3H32A 5APXA 3USSA 1WMKA 1X9VA 2AEFA 4Z1MH 4ASVA 1KQSO 1PZQA 3L71J 2WPQA 1JNMA 3CC7P 1L0LE 1SFCB 2Y0CA 1RQVA 4GOEA 5CMZA 2JWAA 4LC1A 3V2NA 4H0LC 1EZVE 2FYUD 2J58A 2HG5D 3KYQA 2FYUG 3RK3E 4H13C 1DH3A 1NTMJ 3HD7A 2R5DA 4WY4B 2NPSB 2M3EA 5KAIE 3AE3C 3L70J 4L76A 3VTPC 2IFMA 5APVA 2IYOA 3M06A 5EFWB 2Z5HA 3KZIH 2C9LY 4K3AA 2QEXP 1SQVE 1ZOYC 1YBKA 2V4HA 1T2KC 3MP7B 1NTZD 1GMJA 1NTZG 1S4XA 2E76C 4KHXA 4H0LB 3SFDC 3TK1A 3SWYA 5B5EH 1X22A 1JEKA 4H13B 3CI9A 2P67A 2WSFH 1NO4A 5CHXA 1RF1A 3HD7D 3HE5A 4TT3H 1KFNA 2XDJA 3SFEC 4YXWH 1MFZA 1QL2A 5AVUB 5AW0B 3EFFK 3KXDA 4IFFA 1J2JB 1PGQA 1FZFA 2Y9ZA 2Q1KA 2E74D 3NFQA 1OVUA 2O01H 3CL3D 1FDMA 3CCQP 3H1IJ 2I1JA 2YNYA 2E76B 3SSUA 2KSEA 4GDOA 2YKQA 3PJSK 3V2QA 1S3JA 1KORA 4DZOA 1BDDA 2C9NY 1GL2A 4QMAA 1P84E 3O6QA 1FZBA 1AQTA 1L0LD 1L0LG 4NPDA 2ZT9D 1IZNB 4B86A 2E75D 1FC2C 1N86A 2O1KA 1CW5A 1BCCE 4D6TJ 1AV1A 1SS1A 2B87B 1SQXK 1W2EA 4RKUJ 1EDJA 1JO5A 3A5TA 5AW5B 2HPCA 2I8DA 1VDFA 2PAJA 3GHGA 4DOJA 1FOSF 2R44A 3JCUE 2FXPA 1SQVD 1G2CA 1VL2A 1SQVG 2IX7C 2NRGA 3FX0A 1A02J 3A7OA 1PGPA 1YIJP 5APYA 1NYHA 5AVSB 1DD3A 3VMXA 2FFDC 1RF0C 2ZYAA 4AYCA 3B71A 3V6IA 2Y0DA 1J1EC 3H1KE 3KQGA 3L37A 1ZP0C 3GG2A 3HTKB 1EZVI 1NHLA 2YXRB 1LTTC 5CJ0A 1IO4A 3CCSP 3H1LJ 3D70A 1DEBA 3CCVP 3BATA 2GM4A 2O3JA 1XTCC 2J5UA 1QVGO 3Q3DA 2WT7B 1EDLA 2R5BA 2K9JA 2KSJA 2OYIB 1J1EB 3Q5SA 4HKZH 5KAFH 3GF7A 1YYCA 2M3BA 2HYNA 5CCHA 1NAFA 1LJ2A 1LP1A 2KZJA 1NTMK 4IL6X 3WUVA 3ABVC 3F5HA 3H25A 1VQOP 1JOCA 1FZAA 5CBOA 3V4QA 4IL6E 1NU1E 3H1IG 2QA4P 1CI6B 3PH0A 5CCGC 4UB8E 4R4MA 3CWBJ 5M1BA 1KQLA 1FZCA 1YI2P 2A45I 1USDA 2PP6A 4XFJA 4OVNF 1HGZA 4IFDK 1QL1A 1NTKD 1FJPA 1LTBC 1NTKG 3WMM0 5AW3B 2WSEH 1OW8A 3K5BA 1L4AD 5KLVE 1NWQA 1Q86Q 3G71P 1U7JA 4PJ0H 1P84I 5KJ7A 1L0NE 1T3UA 1EXIA 3RL0C 4ZNCA 3O8ZA 3M9QA 2D2CC 3ITKA 4EDFA 1JB0J 3IAOA 1AVOA 1MKMA 4RJTA 2H7HA 1GL2C 1OVVA
chains in the Genus database with same CATH topology
5L8RJ 3AE1C 1KILE 1R8EA 1ZOYC 2E74B 2E76D 3R4YA 4RKUJ 3C8VA 3D71A 2QIWA 2K9YA 3Q5SA 2FYNC 1K04A 3GF7A 1GMJA 1VF5B 4PV1D 2O01J 2IDBA 1KTMA 2OQQA 2E76C 3AE5C 1DD4A 3AE2C 4H44D 1OW6A 2H89C 4H0LB 2WPVB 4YXDC 3SFDC 1YQ4C 3AEGC 1KQGB 2ZT9C 4IL6X 1HF9A 3ABVC 2FBWC 2YIUC 4PV1C 3IN6A 4H13B 2WSEJ 3GLMA 3H25A 2FXPA 1PIXA 3AEFC 4OGQB 1VL2A 1U57A 1Y9BA 2D2CB 4U7JA 2G8YA 3AE4C 3AECC 4TT3H 3Q2YA 3S9OA 1DIPA 4H0LD 3SFEC 3EWKA 2G3AA 4KT0J 3AE6C 3Q5PA 4I7ZC 1HJ0A 1YQ3C 1NYHA 1UIXA 3FGAD 1PV3A 2E75B 1FDIA 3AE9C 2MKVA 3AEDC 1PL5A 1ZMEC 3LW5J 4R4MA 1DD3A 3AEEC 2D2CD 1WMKA 2E74D 2NZ2A 5M1BA 4H44C 3Q1MA 3RL0g 3B71A 2WQYC 4Z1MH 2H88C 4XFJA 2YMKA 1K05A 1VF5D 5KKZC 1FDOA 2E74C 1OW7A 1TU3F 1RQUA 3D6ZA 3AE7C 2E76B 2WSCJ 1OMIA 4YTPC 1RQVA 1OW8A 2ZT9B 4GDOA 1VF5C 1S1CX 2QJKC 1KORA 2P10A 4H13D 4PV1B 3AEBC 4OGQD 4H44B 1ZP0C 4H0LC 2JO1A 3GF3A 2BEQD 2JP3A 3O6QA 3RK3E 1KQFB 4H13C 3AEAC 4OGQC 1EXIA 2V7QJ 2QJYC 3D70A 1IK7A 1S5LX 2D2CC 2ZT9D 2WSFJ 4Y28J 2QSIA 3GMAA 2QJPC 4I7ZB 1Q90D 1KMIZ 2E75D 3AE3C 3G9RA 1JB0J 2J5UA 2BEZF 3IAOA 3Q3DA 1AJYA 3D6YA 1MKMA 1ZRTE 4R4LA 1NGMB 2E75C 3T97B 3AE8C 1EXJA 3Q5RA 5KLIC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R8E A;  1EXI A;  3D71 A;  3Q2Y A;  3Q5S A;  3D70 A;  1DIP A;  3D6Z A;  3G9R A;  2OQQ A;  2J5U A;  3Q5P A;  3IAO A;  3Q3D A;  3D6Y A;  4R4M A;  4R4L A;  3T97 B;  1EXJ A;  3Q5R A;  3Q1M A; 
#chains in the Genus database with same CATH topology
 2A06 E;  3HE5 B;  1Z56 A;  2XV5 A;  1YIT P;  3RBX A;  3H1J D;  3H1J G;  3PTZ A;  1GK6 A;  1BGY E;  3TGU E;  1LWU A;  3LIE A;  3M9B A;  1GK4 A;  3GLM A;  1PIX A;  2BCC J;  3RL0 B;  1AQ5 A;  2D2C B;  4H0L D;  3BCC D;  4EOT A;  3BCC G;  5TIS H;  2QE7 H;  2KOG A;  4M3L A;  1JM0 A;  1GL2 B;  1BE3 J;  1VQM P;  5AVZ B;  2IBZ E;  2HOD B;  3OJA B;  3O6Q B;  1KB9 D;  4H44 C;  5APS A;  1FJK A;  2OYH A;  1NU1 D;  2YMK A;  1FE6 A;  1NU1 G;  1SQB J;  1SVF A;  1Q81 Q;  3KZI E;  1N8R Q;  3AEB C;  4RES B;  1T2K D;  3C9I A;  2WSS H;  1SQP J;  2FYU E;  2P2U A;  1Y47 A;  2P1J A;  1JY3 N;  3CX5 D;  4U3F J;  2HPC B;  3VMA A;  1Q90 D;  1KMI Z;  1KB9 H;  3GHG B;  2ZYG A;  2AXT E;  3C1L A;  1SQX J;  4R4L A;  1YJ9 P;  3Q5R A;  1SQQ D;  1X79 B;  3CCM P;  1SQQ G;  5GTH H;  1VQ8 P;  1Q82 Q;  2WPR A;  1NVO A;  3L35 A;  1NTZ E;  1R5S A;  1KC8 Q;  1IFN A;  1KQG B;  2FXM A;  3CX5 H;  3SWF A;  3P8C D;  4JYB A;  3AE4 C;  3AEC C;  1KIL C;  1IFD A;  1BGY D;  4WVZ A;  3CCL P;  1UIX A;  3A3Y B;  1JUN A;  2GUV A;  2ITA A;  2WPS A;  1RE3 A;  4L74 A;  1OW7 A;  2ZAE B;  1OWA A;  3L75 D;  3MGN A;  3L75 G;  3L74 J;  2QJK C;  2IBZ D;  4WWI A;  1QEX A;  5APW A;  3VP8 A;  5KKZ B;  2QRX A;  3PLN A;  1BSH A;  1KIL B;  1FZC C;  3PHL A;  2L5G B;  2Y9Y A;  3HUS A;  3B5N C;  4BXL A;  1AVY A;  3V5B A;  3P32 A;  5KLI C;  1R8E A;  5KJ7 C;  2WIT A;  3R4Y A;  1M1J A;  2K9Y A;  3M0A A;  1YTZ T;  2N1T C;  2QJK B;  3JC2 2;  2KP8 A;  4XE5 B;  4PV1 C;  4OWF A;  3T97 A;  2ZYD A;  1FZC B;  3R2P A;  4BRY A;  2QM7 A;  3M0D A;  3L72 D;  3B5N B;  3L71 E;  3L72 G;  3MTU E;  1OIP A;  2POH A;  1JTH B;  1PV3 A;  2UWJ E;  5KLI B;  3WUT A;  1GD2 E;  3NTN A;  3HRN A;  2AXT H;  2WVR A;  3HE4 A;  1ZR4 A;  2N1T B;  1RQU A;  3II6 A;  3D6Z A;  5H2F H;  5AW2 B;  2OTJ P;  4U3F G;  3FWL A;  1VF5 C;  3ZDM A;  4PV1 B;  4OGQ D;  4KJM A;  1S72 P;  1VQN P;  5KAF E;  3I55 P;  1K73 Q;  1SP4 A;  2IZ0 A;  1KQF B;  2OYH C;  4YPC A;  1FAV A;  3L36 A;  1BCC J;  3IFM A;  4OH8 B;  1LT9 A;  1SQB K;  1G1I A;  1JMM A;  5BU5 A;  2WSC H;  2W8Z A;  1RE4 A;  5CCG D;  4C7N B;  1VF5 B;  1SQP K;  2OQQ A;  2BAS A;  1N7S D;  3A0B E;  5GTI H;  3CMA P;  1N73 C;  2OYH B;  5APQ A;  1QGK B;  3H1H D;  2FXO A;  3H1H G;  1EDK A;  2KNC A;  4PD4 D;  1URQ D;  5AW1 B;  3H1I E;  4PJ0 E;  3CCE P;  3LW5 J;  3CXH E;  2D2C D;  1IJD B;  3W68 A;  3H1K J;  1JCD A;  3VYI A;  3L71 D;  3L71 G;  1NTK E;  1LTJ A;  1N73 B;  4PD4 H;  3GF3 A;  2KS1 A;  3MIW A;  4D6T E;  1OXZ A;  2OYI C;  1PGO A;  5AVR B;  1EC5 A;  5BU8 B;  1X8Y A;  2N9B A;  2FKW B;  1NTM D;  1NTM G;  3TNU A;  1L0L K;  3BAS A;  3L70 D;  2BEZ F;  3L70 G;  3D6Y A;  2E42 A;  4LGD E;  1IK9 A;  1BSN A;  3B4S A;  3AE1 C;  5TIS E;  1XTG B;  4HJG H;  4IFM A;  2QM8 A;  4O9B A;  2IDB A;  4H44 D;  3KDP B;  3H1J E;  3HUS C;  3N7N A;  1JY2 P;  3WU2 H;  2OYO A;  3CCR P;  2C0X A;  2R3S A;  1U57 A;  3QH9 A;  2XND H;  2H8P D;  1IFJ A;  3CD6 P;  3FXD A;  1JCC A;  1OX3 A;  3HD7 C;  3JSV C;  3BCC E;  3NXS A;  3AE9 C;  4NPE A;  3P7K A;  4RO0 A;  3H32 B;  3AEE C;  1L4A A;  5BVZ A;  1OVR A;  1QLE D;  1KB9 E;  5AVW B;  2E74 C;  3KHU A;  5KLV J;  3H1I D;  2WWW A;  1T3J A;  3HUS B;  2L91 A;  3CXH D;  1L0N J;  3MUD A;  2JWD A;  4JF7 A;  5GTH E;  1GW3 A;  2KLU A;  1PP9 J;  3EFG A;  2LKM A;  2W6B A;  4JYC A;  1KYO D;  1RF1 C;  3A0B H;  2V7Q J;  3CCU P;  3HD7 B;  3RK2 C;  3A0H H;  3GMA A;  4GT1 A;  1WRG A;  3CX5 E;  3L4F A;  3L73 J;  4GIF A;  2E75 C;  3T97 B;  4NPF X;  4D6T D;  4D6T G;  3P8M C;  4L75 A;  1HJB A;  2E74 B;  1SFC D;  2YKP A;  1SQQ E;  2QIW A;  3CXH H;  3RK3 C;  3TGU J;  4CPG A;  2P7J A;  3AE2 C;  1KYO H;  1LT9 C;  1RF1 B;  1GZL A;  3HE4 B;  3VN0 A;  4WY4 D;  3RK2 B;  5E79 E;  2NPS D;  1S9K D;  3KPE A;  1MUU A;  1HGV A;  3P8C E;  3FWN A;  1T6A A;  2G3A A;  3CC2 P;  1CSB A;  1JY3 P;  4ZKP A;  2E75 B;  1FDI A;  1VQ9 P;  2N9Y B;  1Q7Y Q;  3G3Z A;  2NZ2 A;  5AW4 B;  2PRR A;  1JY2 O;  3RK3 B;  2WQY C;  2Q9I A;  4N78 D;  4BWN A;  1KZU B;  1M8O B;  4HB1 A;  3V2P A;  1YTZ I;  1Q2N A;  1VQK P;  1LT9 B;  3L75 E;  4H13 D;  1G1J A;  3BRV B;  2FYU J;  3GHG C;  1VQ5 P;  4LLH A;  2JP3 A;  2KLV A;  5KTB A;  3B8E B;  3TDK A;  2WTY A;  4Y28 J;  2WSF J;  3H1L D;  2PFX A;  3H1L G;  3G9R A;  3VOP A;  1OFC X;  4GOF A;  1JMB A;  2RKL A;  2WZ7 A;  2Q6Q A;  1M57 D;  2B87 A;  1ZR2 A;  2E76 D;  2R3C A;  3C8V A;  3E7K A;  1NTZ J;  2KI7 B;  2O01 J;  1KTM A;  1DD4 A;  2B88 A;  1IFP A;  1SLQ A;  5AW8 B;  2FBW C;  2H43 A;  2ZFC A;  4DJG A;  5H2F E;  1G2C B;  3U59 A;  1Y9B A;  3OA7 A;  1VQ4 P;  2E5T A;  2IYP A;  1DIP A;  4AQR D;  1N2D C;  4KT0 J;  2RN0 A;  2Q5U A;  3Q5P A;  3L72 E;  2Q3E A;  2YO3 A;  4L73 A;  3CWB D;  3CWB G;  2AEJ A;  1KB9 I;  1LTI C;  5KKZ C;  2RH0 A;  1AA0 A;  3TNU B;  1MV8 A;  4YTP C;  3QWO C;  4U3F E;  2P10 A;  5CCH C;  3HTK A;  2RMZ A;  1SQX E;  2DW3 A;  1ZXG A;  1L4A C;  2HR3 A;  1L0L J;  1M7L A;  4A7P A;  1USE A;  4C46 A;  4UB6 E;  2JKV A;  2KB7 P;  5GTI E;  3CX5 I;  5E79 H;  4K35 A;  2E5Y A;  4ASW A;  2OAR A;  2K9J B;  2KYV A;  2FFD A;  4DT0 A;  5KLV K;  2I1K A;  4GOD A;  2XKM A;  1X0T A;  3E1I A;  1L0N K;  4ZMD A;  1FZG A;  4C7R A;  2IFN A;  1VQP P;  1HUC A;  3AE5 C;  3NMD A;  1M1K Q;  1LP1 B;  1L4A B;  1SQV J;  5AVQ B;  3PP5 A;  3AEF C;  2BCC D;  3CC4 P;  4XA4 A;  2BCC G;  2Q7C A;  5AVV B;  3S9O A;  3H1H E;  2E43 A;  4PD4 E;  3PRJ A;  1CI6 A;  1PL5 A;  1L2P A;  3L74 E;  1BE3 D;  3CLQ A;  1VQ7 P;  1BE3 G;  3BVH A;  3RL0 g;  5APU A;  1KV4 A;  2LR2 A;  2IPP A;  2W6J H;  3OAK A;  1SQB D;  1FS0 E;  1SQB G;  2ZVN B;  2B89 A;  1NH4 A;  2JO1 A;  1LWU C;  2IBZ I;  3BRT B;  3UIA A;  1SQP D;  3EQ2 A;  1SQP G;  1RH5 B;  1IK7 A;  3WU2 E;  2QJP C;  1KFM A;  4U3F D;  2W27 A;  5CCG A;  1NTM E;  1FBM A;  1ZRT D;  1AJY A;  1SQX D;  3L70 E;  5AVX B;  1SQX G;  3MHV A;  3AE8 C;  5AW6 B;  5L8R J;  1N7S A;  3V2R A;  1VQ6 P;  3GW6 A;  2FYU K;  4I1L A;  2W90 A;  1K9M Q;  1GTW A;  5AW7 B;  5AVT B;  4W80 A;  2H89 C;  1URQ A;  4YXD C;  1LWU B;  1KD1 Q;  2YIU C;  2OTL P;  2QG4 A;  2JDI H;  2M5A A;  2WSE J;  5APT A;  3TYY A;  2K3R A;  1QX8 A;  2QJP B;  3RGU A;  1QVF O;  3CCJ P;  1J1D C;  1FZE A;  2CPS A;  1M56 D;  1NTZ K;  4UB6 H;  1KN7 A;  1R5L A;  2HOD A;  3RK2 D;  3SWK A;  1EQ7 A;  2AXC A;  4WB4 A;  3A0H E;  3MZW B;  1NTK J;  1TU3 F;  1LGH B;  3E1R A;  1OMI A;  4EYY Q;  1EZV D;  1D7M A;  1S1C X;  2YIU B;  1EZV G;  3I5C A;  3L74 D;  2ZVO B;  3RL0 D;  3L74 G;  3RK3 D;  1PGJ A;  3VP9 A;  3TF5 A;  2Z5I A;  2QJY C;  1J1D B;  1S5L X;  1KYO E;  1RHZ B;  1AFO A;  3H6P A;  4WBA A;  2CK3 H;  1GL2 D;  3WUU A;  2Q3I A;  1S5L E;  2JEE A;  1EXJ A;  1KIL E;  2C0W A;  1YHQ P;  1RE3 C;  3H1J J;  1FOS E;  2ZXX A;  1NKN A;  4EIJ A;  1GU4 A;  5KAI H;  1A02 F;  1HVV A;  1T8Z A;  1LT1 A;  2QJY B;  4N3Y B;  2IZ1 A;  1PFI A;  2HFE D;  3BCC J;  5DJT B;  2KXP B;  3TSI A;  3EWK A;  1S9K E;  4PD4 I;  3FXE A;  2ZXE B;  5B66 E;  3I56 P;  2FY8 A;  1WT6 A;  1MFT A;  4IOI H;  1NU1 J;  2A45 G;  2FYZ A;  2H88 C;  2XNX A;  4W7Y A;  4I6M C;  5CBN A;  1SQV K;  1GU5 A;  1M1J C;  3G4S P;  4N78 E;  1H0T A;  2O1J A;  1HBW A;  2FFD B;  2XU6 A;  1P84 D;  1PPJ E;  2BEQ D;  2AEM A;  1IFI A;  2YMY A;  2M8R A;  4OGQ C;  2VRS A;  1W2B O;  1KIL A;  5AW9 B;  1IC2 A;  3LID A;  1NJI Q;  1S2E A;  1SFC A;  5CJ4 A;  3OW2 O;  2A45 H;  1YJW P;  3M0D C;  1DEE G;  2JJL A;  3H1L E;  1NKZ B;  1VPC A;  2K37 A;  1BCC D;  1K8A Q;  1BCC G;  1NGM B;  2W6A A;  1SQQ J;  1OZH A;  1ZN5 A;  2CPB A;  1HTL C;  2O01 N;  3CME P;  4HYT B;  3D71 A;  1M1J B;  2M0B A;  1P84 H;  2WMM A;  4WY4 A;  2NPS A;  1NAY A;  1MZ9 A;  4Y99 C;  3U1A A;  4I2L C;  1YQ4 C;  2ZT9 C;  5K5G B;  1HF9 A;  3IN6 A;  4TLF A;  1KIL D;  3S1K A;  4OGQ B;  2K88 A;  1ZV8 A;  1N7S C;  2LXB A;  3Q2Y A;  5CCH D;  4BRY B;  1JY2 N;  1BGY J;  1LTA C;  3B5N A;  3W67 A;  1JTH A;  2P58 A;  1HJ0 A;  1E5W A;  1URQ C;  2MKV A;  1H88 A;  1LNQ A;  4MN4 C;  2KIK A;  1S5L H;  3CWB E;  1K05 A;  3H1K D;  1PP9 E;  2N1T A;  3JCU H;  1RE4 C;  3H1K G;  3L75 J;  3VMY A;  4Y99 B;  3F89 A;  2QVA A;  2ZT9 B;  3G6E P;  1LTG C;  3L73 E;  1Y8A A;  3CXH I;  2YO2 A;  1N7S B;  1LTS C;  3AEA C;  3B5N D;  4HH2 A;  1KYO I;  3IF4 A;  2QSI A;  3LW5 H;  3M91 A;  1URQ B;  1PPJ D;  1NTK K;  5KJ7 D;  1PPJ G;  2M5A B;  5AVY B;  1DX7 A;  2N1T D;  1W5C E;  1GDT A;  5B66 H;  4C7N A;  2FYN C;  1K04 A;  3M9H A;  4PV1 D;  4DCK A;  3U1C A;  2ZJS E;  1GW4 A;  1CZQ A;  2WPV B;  1LTJ C;  3A2A A;  1H8A A;  3N4X A;  2B9B A;  1RY3 A;  4JQ0 D;  4N6J A;  2G8Y A;  3L72 J;  2KNC B;  1H89 A;  2Z4E A;  2BCC E;  1HH0 A;  3V4W A;  1VQL P;  3S4R A;  3AE6 C;  5C39 A;  4I7Z C;  1ZLL A;  1ZW0 A;  3VMZ A;  2OGU A;  3AED C;  1NOH A;  3MD0 A;  1ZME C;  4AUW A;  3Q1M A;  1M90 Q;  1BE3 E;  1FU1 A;  2FYN B;  1U7M A;  1VF5 D;  1FDO A;  1N7L A;  3AE7 C;  1EDI A;  2LXC B;  2WSC J;  5B5E E;  5KLV D;  3IR9 A;  1SQB E;  4IL6 H;  5KLV G;  1LTJ B;  2W83 C;  3CPW O;  2MJZ A;  4JBZ A;  4JPZ B;  4H44 B;  1N73 A;  2GUS A;  1L0N D;  1L0N G;  4GKG A;  2KS1 B;  1PP9 D;  4W7Z A;  1BDC A;  4UB8 H;  2XZR A;  1PP9 G;  2JR8 A;  3RBZ A;  2KUB A;  1SQP E;  4I7Z B;  4EI2 A;  2OTK E;  1NU1 K;  3L73 D;  2GA1 A;  3L73 G;  2A06 D;  1ZRT E;  2A06 G;  1HWT C;  1JY3 O;  1YJN P;  1UII A;  5DJU B;  3TGU D;  2PGD A;  2KK7 A;  1BGY G;  3TGU G;  1SFC C;  1OW6 A;  3AEG C;  2WT7 A;  2R32 A;  2V7Q H;  2K1A A;  3MUD C;  2J59 M;  1RF0 A;  2OYI A;  3H1H J;  1E79 H;  4U7J A;  2SPZ A;  2YKO A;  1SQQ K;  2HLO A;  1H0T B;  2KZI A;  1IFM A;  4WY4 C;  2NPS C;  1YQ3 C;  5TJH A;  3FGA D;  2YXQ B;  2IBZ G;  4ZKU A;  2Y0E A;  3H32 A;  5APX A;  3USS A;  1WMK A;  1X9V A;  2AEF A;  4Z1M H;  4ASV A;  1KQS O;  1PZQ A;  3L71 J;  2WPQ A;  1JNM A;  3CC7 P;  1L0L E;  1SFC B;  2Y0C A;  1RQV A;  4GOE A;  5CMZ A;  2JWA A;  4LC1 A;  3V2N A;  4H0L C;  1EZV E;  2FYU D;  2J58 A;  2HG5 D;  3KYQ A;  2FYU G;  3RK3 E;  4H13 C;  1DH3 A;  1NTM J;  3HD7 A;  2R5D A;  4WY4 B;  2NPS B;  2M3E A;  5KAI E;  3AE3 C;  3L70 J;  4L76 A;  3VTP C;  2IFM A;  5APV A;  2IYO A;  3M06 A;  5EFW B;  2Z5H A;  3KZI H;  2C9L Y;  4K3A A;  2QEX P;  1SQV E;  1ZOY C;  1YBK A;  2V4H A;  1T2K C;  3MP7 B;  1NTZ D;  1GMJ A;  1NTZ G;  1S4X A;  2E76 C;  4KHX A;  4H0L B;  3SFD C;  3TK1 A;  3SWY A;  5B5E H;  1X22 A;  1JEK A;  4H13 B;  3CI9 A;  2P67 A;  2WSF H;  1NO4 A;  5CHX A;  1RF1 A;  3HD7 D;  3HE5 A;  4TT3 H;  1KFN A;  2XDJ A;  3SFE C;  4YXW H;  1MFZ A;  1QL2 A;  5AVU B;  5AW0 B;  3EFF K;  3KXD A;  4IFF A;  1J2J B;  1PGQ A;  1FZF A;  2Y9Z A;  2Q1K A;  2E74 D;  3NFQ A;  1OVU A;  2O01 H;  3CL3 D;  1FDM A;  3CCQ P;  3H1I J;  2I1J A;  2YNY A;  2E76 B;  3SSU A;  2KSE A;  4GDO A;  2YKQ A;  3PJS K;  3V2Q A;  1S3J A;  1KOR A;  4DZO A;  1BDD A;  2C9N Y;  1GL2 A;  4QMA A;  1P84 E;  3O6Q A;  1FZB A;  1AQT A;  1L0L D;  1L0L G;  4NPD A;  2ZT9 D;  1IZN B;  4B86 A;  2E75 D;  1FC2 C;  1N86 A;  2O1K A;  1CW5 A;  1BCC E;  4D6T J;  1AV1 A;  1SS1 A;  2B87 B;  1SQX K;  1W2E A;  4RKU J;  1EDJ A;  1JO5 A;  3A5T A;  5AW5 B;  2HPC A;  2I8D A;  1VDF A;  2PAJ A;  3GHG A;  4DOJ A;  1FOS F;  2R44 A;  3JCU E;  2FXP A;  1SQV D;  1G2C A;  1VL2 A;  1SQV G;  2IX7 C;  2NRG A;  3FX0 A;  1A02 J;  3A7O A;  1PGP A;  1YIJ P;  5APY A;  1NYH A;  5AVS B;  1DD3 A;  3VMX A;  2FFD C;  1RF0 C;  2ZYA A;  4AYC A;  3B71 A;  3V6I A;  2Y0D A;  1J1E C;  3H1K E;  3KQG A;  3L37 A;  1ZP0 C;  3GG2 A;  3HTK B;  1EZV I;  1NHL A;  2YXR B;  1LTT C;  5CJ0 A;  1IO4 A;  3CCS P;  3H1L J;  3D70 A;  1DEB A;  3CCV P;  3BAT A;  2GM4 A;  2O3J A;  1XTC C;  2J5U A;  1QVG O;  3Q3D A;  2WT7 B;  1EDL A;  2R5B A;  2K9J A;  2KSJ A;  2OYI B;  1J1E B;  3Q5S A;  4HKZ H;  5KAF H;  3GF7 A;  1YYC A;  2M3B A;  2HYN A;  5CCH A;  1NAF A;  1LJ2 A;  1LP1 A;  2KZJ A;  1NTM K;  4IL6 X;  3WUV A;  3ABV C;  3F5H A;  3H25 A;  1VQO P;  1JOC A;  1FZA A;  5CBO A;  3V4Q A;  4IL6 E;  1NU1 E;  3H1I G;  2QA4 P;  1CI6 B;  3PH0 A;  5CCG C;  4UB8 E;  4R4M A;  3CWB J;  5M1B A;  1KQL A;  1FZC A;  1YI2 P;  2A45 I;  1USD A;  2PP6 A;  4XFJ A;  4OVN F;  1HGZ A;  4IFD K;  1QL1 A;  1NTK D;  1FJP A;  1LTB C;  1NTK G;  3WMM 0;  5AW3 B;  2WSE H;  1OW8 A;  3K5B A;  1L4A D;  5KLV E;  1NWQ A;  1Q86 Q;  3G71 P;  1U7J A;  4PJ0 H;  1P84 I;  5KJ7 A;  1L0N E;  1T3U A;  1EXI A;  3RL0 C;  4ZNC A;  3O8Z A;  3M9Q A;  2D2C C;  3ITK A;  4EDF A;  1JB0 J;  3IAO A;  1AVO A;  1MKM A;  4RJT A;  2H7H A;  1GL2 C;  1OVV A; 
#chains in the Genus database with same CATH homology
 5L8R J;  3AE1 C;  1KIL E;  1R8E A;  1ZOY C;  2E74 B;  2E76 D;  3R4Y A;  4RKU J;  3C8V A;  3D71 A;  2QIW A;  2K9Y A;  3Q5S A;  2FYN C;  1K04 A;  3GF7 A;  1GMJ A;  1VF5 B;  4PV1 D;  2O01 J;  2IDB A;  1KTM A;  2OQQ A;  2E76 C;  3AE5 C;  1DD4 A;  3AE2 C;  4H44 D;  1OW6 A;  2H89 C;  4H0L B;  2WPV B;  4YXD C;  3SFD C;  1YQ4 C;  3AEG C;  1KQG B;  2ZT9 C;  4IL6 X;  1HF9 A;  3ABV C;  2FBW C;  2YIU C;  4PV1 C;  3IN6 A;  4H13 B;  2WSE J;  3GLM A;  3H25 A;  2FXP A;  1PIX A;  3AEF C;  4OGQ B;  1VL2 A;  1U57 A;  1Y9B A;  2D2C B;  4U7J A;  2G8Y A;  3AE4 C;  3AEC C;  4TT3 H;  3Q2Y A;  3S9O A;  1DIP A;  4H0L D;  3SFE C;  3EWK A;  2G3A A;  4KT0 J;  3AE6 C;  3Q5P A;  4I7Z C;  1HJ0 A;  1YQ3 C;  1NYH A;  1UIX A;  3FGA D;  1PV3 A;  2E75 B;  1FDI A;  3AE9 C;  2MKV A;  3AED C;  1PL5 A;  1ZME C;  3LW5 J;  4R4M A;  1DD3 A;  3AEE C;  2D2C D;  1WMK A;  2E74 D;  2NZ2 A;  5M1B A;  4H44 C;  3Q1M A;  3RL0 g;  3B71 A;  2WQY C;  4Z1M H;  2H88 C;  4XFJ A;  2YMK A;  1K05 A;  1VF5 D;  5KKZ C;  1FDO A;  2E74 C;  1OW7 A;  1TU3 F;  1RQU A;  3D6Z A;  3AE7 C;  2E76 B;  2WSC J;  1OMI A;  4YTP C;  1RQV A;  1OW8 A;  2ZT9 B;  4GDO A;  1VF5 C;  1S1C X;  2QJK C;  1KOR A;  2P10 A;  4H13 D;  4PV1 B;  3AEB C;  4OGQ D;  4H44 B;  1ZP0 C;  4H0L C;  2JO1 A;  3GF3 A;  2BEQ D;  2JP3 A;  3O6Q A;  3RK3 E;  1KQF B;  4H13 C;  3AEA C;  4OGQ C;  1EXI A;  2V7Q J;  2QJY C;  3D70 A;  1IK7 A;  1S5L X;  2D2C C;  2ZT9 D;  2WSF J;  4Y28 J;  2QSI A;  3GMA A;  2QJP C;  4I7Z B;  1Q90 D;  1KMI Z;  2E75 D;  3AE3 C;  3G9R A;  1JB0 J;  2J5U A;  2BEZ F;  3IAO A;  3Q3D A;  1AJY A;  3D6Y A;  1MKM A;  1ZRT E;  4R4L A;  1NGM B;  2E75 C;  3T97 B;  3AE8 C;  1EXJ A;  3Q5R A;  5KLI C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...