2OR4A

A high resolution crystal structure of human glutamate carboxypeptidase ii in complex with quisqualic acid
Total Genus 264
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
264
sequence length
696
structure length
689
Chain Sequence
KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFDKSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Glutamate carboxypeptidase 2
publication title Structural insight into the pharmacophore pocket of human glutamate carboxypeptidase II.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 264
structure length 689
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2007-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 2or4A03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2or4A01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 2or4A02
2F7VA 3VTAA 3S9LA 1XJOA 4R76A 1Y0YA 1YLOA 3B3TA 1VIXA 4MCQA 4OC4A 5LYFA 4P4FA 1TF8A 1IGBA 4C8PA 4C86A 3GUXA 2CTCA 2F8HA 3TC8A 3CPAA 2PIZA 3NFZA 3ICUA 3FF3A 3PFEA 4ZI6A 2GREA 4OIDA 1BLLE 5LYIA 4DYOA 2PJBA 4F9UA 1F57A 3PB8X 4PXCA 3PB6X 3NA6A 2C6GA 4NGQA 3VATA 5HVFA 2AFUA 1Y9ZA 2V8HA 2PJ9A 3MRUA 1R43A 1QQ9A 5IB9A 5JM6A 2NSMA 4A39A 3FJUA 4P44A 1M4LA 1CPXA 1TKHA 3B3WA 2Q43A 3B35A 1KWMA 4A37A 5ELYA 2C6CA 3S9MA 2AFSA 1ZG9A 2IMOA 2PJ0A 1XF1A 1NSAA 2CIJA 1TXRA 4G1PA 4K3NA 2WYRA 2ZELA 4ZYQA 1FT7A 5JH9A 1ZLHA 1V6CA 4B6ZA 3I74A 2BOAA 4C8AA 4IK2A 4TJXA 4JYWA 2OOTA 1VGYA 2JBKA 4YU9A 3FEDA 3D67A 1HEEA 2Q51A 3FECA 3JRUA 4F8ZA 2IJZA 2PJ2A 1XRYA 3ISZA 4MCSA 3PFOA 4OKOA 4NGSA 2GLFA 4R8FA 4X3RA 3CDXA 4P6YA 3SI0A 3IFEA 2EK9A 4UEFA 4DJLA 2ZEFA 5CBMA 4UEZA 2XEJA 4P4JA 4W9YA 1XBUA 1CBXA 5HVGA 5D8NA 4EFDA 2ZEOA 3FVLA 1LAMA 3TX8A 2PVVA 2J9AA 4MHNA 2GU2A 3SJGA 5K8MA 1BPMA 3IEHA 4X2TA 2V77A 2VL1A 3DLJA 1ARMA 4YWYA 5CPAA 4ZY1A 4PQAA 2JBJA 4C8TA 4R7MA 4UEEA 3QNVA 3KASA 4OC3A 2ZENA 4MHZA 2ABZA 2AFMA 2V8VA 1ZLIA 2ZEEA 4UF4A 4X8IA 4C9UA 3D7GA 4C9RA 3D7FA 2C1CA 1Z2LA 2C6PA 4PXDA 2EWBA 4NGNA 1YW6A 3WC6A 4IAVA 3KR5A 3BI1A 3KQXA 2AFZA 4KNGE 3RZAA 4P4DA 3IWWA 4P45A 4A38A 1QMUA 1H8LA 1HDUA 1YSJA 3ISXA 2PJ4A 1Z8LA 4MHPA 2BCOA 3GB0A 4TJVA 4NJQA 3KZWA 4H2KA 4CDKA 3KGQA 4C9AA 3D7HA 5JGFA 4YN3A 4P4EA 3SI2A 1AMPA 4OC1A 2I3CA 3H8FA 2IQ6A 2ZOFA 1F2PA 3K2KA 3PBEA 4NGRA 4PPZA 1ELLP 6CPAA 1VHEA 3WC7A 1CX8A 1Z5RA 2PIYA 3D7DA 1R3NA 5D29A 5I4MA 5J1QA 3CPXA 4Z65A 3L2NA 4MCPA 5THWA 3B3CA 5LYDA 4O23A 4P4IA 2G9DA 3PB4X 1ZG7A 1GYTA 5DS0A 1BPNA 3RAMA 4LQGA 1YMEA 2PJ1A 4WWVA 2XEIA 4OC2A 2EK8A 2PJAA 4GM5A 4NGPA 4OC0A 2ZEGA 2AFXA 4ZX8A 4ZY2A 4CPAA 1BAVA 2PJ3A 3PB9X 3PBBA 1ARLA 3IIBA 2ZEPA 5LYLA 1Y0RA 2GLJA 3BHXA 4MCRA 2RB7A 3SI1A 3V38A 4R6TA 1YW4A 2ANPA 2HB6A 2DEAA 5LRJA 2WZNA 4EMEA 1HDQA 2FVGA 3H8GA 2V8GA 1LOKA 2QYVA 4C8UA 1LFWA 1XFOA 2PE3A 3PRTA 1Y7EA 3MN8A 4PXBA 1CPSA 3I6SA 2O4HA 3KHXA 8CPAA 4OMEA 4AXVA 3H8EA 2XEFA 1TKFA 4C84A 4C85A 4MXUA 1ZG8A 2ZEDA 4CDJA 3BXMA 3KHZA 1LCPA 3IJ3A 2XEGA 4EWTA 1PYTB 3FMCA 4A94A 3WC5A 2V8DA 3B3VA 4FAIA 1TF9A 3IC1A 2BO9A 2JEWA 3B3SA 2QVPA 2PJ5A 4TWEA 1OBRA 2CF4A 4C9EA 1AYEA 3RBUA 4IHMA 3EIFA 3CT9A 4C8FA 4NGMA 1ELMP 1VHOA 2RFHA 2ZEHA 4MHYA 1CP7A 4OIWA 5HXDA 7CPAA 5K8PA 2PVWA 2AFWA 2PRQA 3I1UA 4KSIA 4P4BA 4C9VA 3FX6A 1DTDA 1TKJA 1LAPA 3NH5A 3D4UA 1CP6A 3KI9A 2Q4ZA 3WABA 2QJ8A 3D66A 3KQZA 2PCUA 3LWUA 2NYQA 3NH8A 4JZ0A 3B2YA 4PXEA 3K9TA 4TNUA 3V7ZA 4C8CA 2PJCA 1LANA 4UIAA 2PJ8A 3S9NA 3B7IA 3SJFA 1Q7LA 3KR4A 3DGVA 3T8WA 1JQGA 3N5FA 2POKA 2PJ6A 2ZOGA 1CG2A 5F09A 4Q7AA 3VARA 4FWUA 1F2OA 2AFOA 4WJBA 4ZY0A 4C99A 4UIBA 4DUKA 3LMSA 4FUUA 3FH4A 3VH9A 3NH4A 2OR4A 3HUVA 1WVMA 5LRKA 3PEIA 1EE3P 2HC9A 4NJRA 1IY7A 2O53A 4MRIA 1FNOA 1PCAA 5K8OA 3SJXA 5HVHA 3PB7X 3BI0A 3KL9A 1XMBA 3GLJA 3IO1A 4ZX9A 4MMOA 5K8NA 2ZEMA 2PJ7A 4ONWA 5LRGA 3WT4A 3HLPA 3SJEA 3FEEA 4OP4A 1DE4C 4BD9A 4RUHA 4OC5A 3D68A 1RTQA 2CTBA 4FBEA 1UWYA 4P10A 4F9VA 4NFRA 4NGTA
chains in the Genus database with same CATH superfamily
5G22A 3ZZIA 1XIXA 2F7VA 3G3SA 3VTAA 4CYQA 3S9LA 2Z11A 3D3SA 2WPWA 2GE3A 4E94A 1XJOA 4XPLA 4R76A 1VI4A 1Y0YA 1YLOA 3BJ7A 1Y7RA 1P0HA 1VIXA 4MCQA 4OC4A 3B3TA 4P4FA 1TF8A 3QAHA 1IGBA 4C7HA 1Q2YA 4E5SA 2K5TA 4L89A 4RS2A 4C8PA 1QSRA 4C86A 2D4PA 3GUXA 2CTCA 2CNMA 2F8HA 1ZL0A 1ZYMA 3TC8A 3TLZA 1U6MA 3CPAA 2PIZA 2FL4A 4M3SA 4PV6A 4EVYA 3NFZA 5F13A 3T5MA 3LODA 3ICUA 2Y1NA 2JDDA 3FF3A 4XPDB 2NMTA 1DIKA 3PFEA 4UFVA 2EVNA 5C88A 4ZI6A 4E8OA 1YVOA 3SXOA 3HPHE 1IIDA 2GREA 4OIDA 1IYLA 3EO4A 3SR3A 5LYFA 5F5XA 5A28A 3T07A 4AG7A 1CJWA 4BMHA 4UFWA 1BLLE 5LYIA 4DYOA 2EZBA 2PJBA 3IGRA 3GYAA 4ONUA 4XPKA 4F9UA 5E96A 4KOSA 3NFQA 1F57A 4J0NA 4H6UA 4CYOA 2P0WA 3PB8X 4PXCA 3IU2A 4M6IA 3PB6X 3NA6A 4PK2A 2C6GA 2R8VA 5A27A 2BEIA 4NGQA 4MY0A 3VATA 2FT0A 5HVFA 2AFUA 2D4OA 1Y9ZA 2R82A 2V8HA 2PJ9A 1CE8B 3T05A 2J8RA 3SXNA 3MRUA 2OLSA 4U9YA 1M4DA 2XPOA 1R43A 1S7NA 5AG6A 1QQ9A 1BOBA 4UA3A 3VROA 4B13A 1S60A 3CZXA 5IB9A 5JM6A 3C8OA 2VZZA 2NSMA 4FD6A 4A39A 1XF8A 2H5MA 3FJUA 4P44A 4YRHA 1YQEA 1M4LA 2QMLA 1NE9A 1CPXA 1TKHA 3BUWB 3B3WA 4JXRA 1M44A 4UCPA 1BXRB 2Q43A 3B35A 1KWMA 4KUAA 4A37A 4JXQA 2A4NA 4NF1A 5ELYA 2C6CA 5HKWA 3S9MA 2AFSA 3VWEA 2P6FA 1ZG9A 3F9KC 2IMOA 1MK4A 4PSXA 2PJ0A 1XF1A 1NSAA 4R9MA 2CIJA 1TXRA 4G1PA 4K3NA 5HKYA 1RXTA 1XEBA 2IL4A 2WYRA 2ZELA 3DNSA 4ZYQA 1FT7A 1YVKA 2YJVA 5JH9A 4MI1A 2ZW5A 4FD5A 1ZLHA 2ZPAA 1V6CA 2PCNA 3BUNB 3FB3A 4ORFA 2VBQA 5KTDA 4B6ZA 2ZW6A 2D0OA 1PU9A 1Z4RA 3I74A 2JLMA 2G3TA 1V0CA 2BOAA 1ZO0A 2KCWA 4C8AA 3OWCA 4IK2A 2HQYA 1P4NA 4JYWA 1WWZA 4BPUB 2OOTA 3OAKA 1VGYA 3WR7A 4TJXA 1Z4EA 5IB0A 2JBKA 4M6HA 4YU9A 5AG4A 5JYBA 4BTFA 3FEDA 4A2ZA 4JJXA 3D67A 1I1DA 2EBJA 3VRNA 1YVHA 2YNCA 4CRZB 1HEEA 2Q51A 3FECA 3JRUA 3BUXB 5CNPA 3JUWA 4F8ZA 1L0CA 2IJZA 4CAWA 5HH1A 2PR1A 2VI7A 2PJ2A 2DLAA 1IOFA 1XRYA 3S6HA 3KKWA 3ISZA 4MCSA 1WK4A 3PFOA 4OKOA 4A4CA 4Y49C 3TE4A 4IUSA 2CNSA 4NGSA 4BPWB 4UWJA 2GLFA 3FNCA 4R8FA 4X3RA 2VQYA 3RO0A 3TO7A 1Q5XA 4CGLA 2J8MA 1EZAA 3CDXA 3PZJA 4P6YA 3SI0A 1S7KA 4PSWA 3IFEA 3R95A 3G23A 2WSAA 2EK9A 4OLLA 2Q4YA 4BBHA 4UEFA 3D2PA 2YGWA 4DJLA 4ZBGA 4C2XA 2ZEFA 3R9GA 5ISVA 5CBMA 4UEZA 2XEJA 4P4JA 4W9YA 1B6BA 1CBXA 1B47A 1XBUA 3R1KA 5D8NA 5HVGA 1Z8WA 4EFDA 4MJ8A 2ZEOA 2EZAA 2G0BA 2HROA 2Y0MA 2GIVA 1NMTA 3FVLA 3FXTA 1LAMA 3RNZA 3TX8A 2PVVA 2J9AA 2J8NA 4MHNA 2GU2A 3SJGA 5K8MA 1KZFA 1PUAA 2QECA 1BPMA 4FD4A 3GKRA 1NXJA 3P2FA 4XNHC 2GP4A 3IEHA 4X2TA 2V77A 3RYOA 2VL1A 3DLJA 4KS9A 2C27A 3NE7A 4MJXA 1ARMA 4B5PA 3TLCA 4YWYA 1K4JA 5CPAA 4R87A 4ZY1A 4PQAA 2JBJA 3FBUA 1M1DA 4C8TA 1A9XB 4KORA 4GS4A 2PRBA 3W91A 4R7MA 4UEEA 2BSWA 3D8PA 3QNVA 4NEXA 3KASA 2ZXVA 4OC3A 1QSMA 1X12A 4K30A 3DR8A 4LX9A 2ZENA 2YJTA 4H6ZA 4CGPA 4MHZA 2ABZA 4E2AA 2AUMA 3OB1B 2AFMA 2V8VA 1ZLIA 2ZEEA 4UF4A 5EBVA 4QB9A 4X8IA 4C9UA 3D7GA 4C9RA 3PGPA 3D7FA 2B5GA 2B0AA 1JWQA 4COBA 4MFZA 2C1CA 1Z2LA 2C6PA 3PT1A 4PXDA 5J8FA 1ZRSA 2EWBA 5GCNA 1IYKA 2CXAA 4NGNA 1YW6A 3HPGG 3WC6A 2B4DB 4IAVA 1KUXA 2G3AA 3KR5A 3BI1A 3KQXA 3NOJA 2EUIA 3FIXA 3I9SA 2YNEA 2FIWA 2AFZA 4JD6A 4KNGE 2FM4A 3RZAA 4NCZA 1YLEA 4P4DA 3BUMB 3QB8A 4EYSA 3IWWA 2Z0ZA 4P45A 4A38A 3D2MA 4KOTA 1RO5A 1QMUA 1H8LA 1HDUA 1YSJA 2FS5A 2I00A 3ISXA 2PJ4A 1Z8LA 4H1HA 4UCMA 1VBHA 4MHPA 5JQ4A 2BCOA 3GB0A 4OAEA 4HNWB 4TJVA 4NJQA 1IB1E 4B10A 3PFVA 3KZWA 4H2KA 1EO0A 1M6VB 4CS0B 2MP0A 4CDKA 1JDEA 4HNXB 3EZEA 1J4JA 2Z3LA 3KGQA 4C9AA 3D7HA 5JGFA 2R1IA 4YN3A 1WJTA 3TLGA 1OZPA 3TT2A 4P4EA 5G1ZA 4B11A 3SI2A 2YNCC 1AMPA 4UCNA 4B5PB 4OC1A 4J3GA 2I3CA 3H8FA 2DXQA 4KSAA 2IQ6A 2ZOFA 1F2PA 4JLYA 3K2KA 1NSLA 3V8IA 3TLBA 1C3OB 3PBEA 4NGRA 2XPNA 4PPZA 2XPPA 3O8ZA 1ELLP 3F8KA 4QC6A 2ATRA 4I49A 3K9UA 6CPAA 3CXQA 1VHEA 5FVJA 3CXPA 3T9YA 5DWNA 3GY9A 2ARHA 2DPSA 1CX8A 1Z5RA 2PIYA 2Q44A 3WC7A 3D7DA 1GHEA 1R3NA 5D29A 5I4MA 5J1QA 3IWEA 4MHDA 3TOBA 3CPXA 4A30A 3NE8A 2R98A 3VWDA 4DNCA 3L2NA 4Z65A 3TLEA 2JEVA 5K99A 4MCPA 5THWA 3B3CA 5LYDA 4O23A 4KSFA 1Y9KA 4P4IA 4JVOA 2G9DA 2JDCA 3PB4X 3H4QA 4QVTA 1SQHA 1ZG7A 4A33A 3BUOB 4RR2B 1GYTA 1VHSA 1X10A 4GXHA 5AXIA 5DS0A 4AVCA 4B14A 4CAXA 5JPHA 2Q7BA 2E28A 4HKFA 1BPNA 5I0CA 3JTKA 5IX3A 3FRMA 3RAMA 4LQGA 1YMEA 4AB7A 3DDDA 2PJ1A 1YX0A 4WWVA 5EMIA 2XEIA 4OC2A 2B3VA 1S3ZA 4C2YA 2EK8A 4KOXA 3HMJG 2GANA 5BY0A 1YREA 3U88C 1ON0A 4C7IA 4U5YA 2PJAA 4LUAA 5AG5A 3T90A 4ZGYB 4MFLA 4GM5A 4NGPA 4OC0A 2ZEGA 2AFXA 4ZX8A 4MFKA 4ZY2A 1YK3A 2F5IA 4CPAA 1BAVA 2PJ3A 4AVAA 3PB9X 2B4JC 2CY2A 1IICA 3PBBA 1ARLA 3IIBA 2VXKA 5IR2A 4A31A 2Z3OA 3DR6A 4KVME 4XPDC 1YGHA 3CXSA 5F47A 5KTAA 4CZ1A 2ZEPA 5LYLA 4BINA 3VGOA 3EC4A 1Y0RA 1LRZA 1AUGA 2D0PA 5F1YA 2GLJA 5C82A 3G8WA 3BHXA 4MCRA 2B4BA 2RB7A 3SI1A 3V38A 4R6TA 1YW4A 2ANPA 4KVXA 3LACA 2HB6A 2PDOA 4CYNA 2C5QA 2X7BA 2DEAA 2Z10A 3P2HA 5LRJA 4CRYB 2WZNA 4EMEA 7CPAA 1KBLA 4JWPA 1HDQA 2FVGA 3H8GA 3W6XA 2V8GA 3KRVA 2P6EA 1LOKA 2QYVA 4C8UA 4L8AA 4C2ZA 1LFWA 1XE4A 1XFOA 2PE3A 3PRTA 2CBLA 1R57A 1Y7EA 2PC1A 3MN8A 4PXBA 5EC4A 5F49A 1CPSA 3I6SA 4M8DA 4R3KA 1QSNA 1JDBC 5FD8A 2O4HA 3B8GA 1QSOA 3KHXA 4UBRA 3TFYA 1S7LA 5F9MA 3T0TA 4KOUA 3MGDA 1VKCA 4CO9A 3SHPA 3TLAA 4H89A 8CPAA 4OMEA 2BL1A 4QUSA 4AXVA 2OU2A 2XEFA 3H8EA 1IOIA 1MJAA 1TKFA 4C84A 4C85A 4MXUA 1ZG8A 2RC4A 1Q2DA 2ZEDA 4KVOE 4Y49B 4INJA 3VRPA 4CDJA 4A4BA 3BXMA 3QAYA 2Q0YA 3KHZA 4KOWA 4RN7A 4UWIA 3R9FA 1LCPA 2FSRA 2XEGA 3IJ3A 3PLFB 1M4GA 1PYTB 3FMCA 3N7ZA 2AE6A 3PP9A 4A94A 4F0YA 3WC5A 2FCKA 4U9ZA 4C68A 2WUUA 2V8DA 3B3VA 4FAIA 4NXYA 2HUZA 2PQ8A 2XPLA 1CM0A 4B12A 2HI6A 5AGEA 1KUVA 1TF9A 3IC1A 4NSQA 4AVBA 2BO9A 1FY7A 3EZBA 2AUNA 3VRQA 4CGOA 4EWTA 3EXNA 2R7HA 2JEWA 2ODFA 2QVPA 3B3SA 4OADA 4CGMA 2PJ5A 4TWEA 1OBRA 5HKZA 2WPXA 4KZTA 3LD2A 2Q7SA 2CF4A 4C9EA 5H84A 1AYEA 1KUYA 2B5GB 3RBUA 4IHMA 1R61A 3EIFA 3CT9A 4C8FA 5F46A 1XMTA 2OZHA 1J3LA 4NGMA 1ELMP 1VHOA 2Z3PA 2RFHA 2ZEHA 4XNHB 4RI1A 4MHYA 4COGA 1CP7A 2VKZG 2B58A 4KLWA 4OIWA 3TO6A 5HXDA 1I21A 2Z3MA 2BUEA 2Z3KA 3W6SA 2PVWA 1XOVA 2AFWA 2PRQA 3I1UA 4P4BA 4KSIA 4QBJA 5KTCA 1KC7A 3TCVA 4C9VA 1Z8TA 3FX6A 1DTDA 1NBWA 2VEZA 2B3UA 1TKJA 1LAPA 4CAEA 3NH5A 3D4UA 1CP6A 3KI9A 2Q4ZA 3WABA 2QIRA 4IIXA 2I79A 2QJ8A 2DPTA 4HNYB 4X5KA 3U1BA 2UV8G 2Q04A 3D66A 3H5ZA 1Z9EA 3ZNIA 3KQZA 2PCUA 4KOVA 1A2ZA 4MFJA 3C26A 4YGOA 3LWUA 1T36B 2NYQA 2OZGA 4BPXB 2DF5A 3NH8A 2REEA 4KOYA 4Q36A 5JVLA 5K8PA 3TLGB 2PSWA 1S7FA 2ZW7A 4JZ0A 4LQ6A 5J3XA 3FYNA 2PR8A 3EZAA 3VRRA 3B2YA 4PXEA 3K9TA 2YNDA 1IU8A 1Y9WA 4TNUA 1KEEB 2P6GA 3V7ZA 3ZJ0A 4C8CA 1TIQA 2PJCA 4IF5A 5G20A 1LANA 4UIAA 1FBVA 4AG9A 2PJ8A 4PK3A 2CNTA 4M85A 3S9NA 3B7IA 3S6FA 3SJFA 3F5BA 3A9LA 1Q7LA 4MBUA 3OB2B 4CAVA 3KR4A 3DGVA 5HMNA 4R57A 2FE7A 1JQGA 2OB0A 3T8WA 3EFAA 3N5FA 1N71A 2FXFA 2PJ6A 2POKA 1UFHA 2DIKA 2ZOGA 4MY3A 3TTHA 3JVNA 1CG2A 1MJBA 5H86A 5F09A 3TOAA 4A32A 4Q7AA 2REFA 4UFXA 3VARA 3E0KA 4FWUA 3TLYA 2X0SA 1Q2CA 2HV2A 5G21A 1F2OA 2AFOA 3GIUA 4WJBA 2N3AB 4FD7A 3R9EA 2Y1MA 4ZY0A 1VBGA 4C99A 2O28A 2OH1A 3EY5A 4UIBA 4DUKA 4KUBA 1EZBA 1Z8XA 3BLNA 5F48A 3LMSA 4FUUA 4R3LA 4Q38A 3FH4A 3VH9A 3NH4A 3OP0A 2OR4A 1MJ9A 3HUVA 1WVMA 1I12A 1QSTA 5LRKA 2Q4VA 2HWGA 3I3GA 3PEIA 4CGNA 4M6GA 1YR0A 4F0XA 3K4IA 2AJ6A 4F6AA 3TYXA 1EE3P 4MFPA 2HC9A 4II9A 4NJRA 1GGOA 5DWMA 3IWGA 3UY5A 1M4IA 3GJZA 1IY7A 1B87A 2O53A 4MRIA 1C30B 1FNOA 3S6GA 1PCAA 5K8OA 3S6KA 3SJXA 4MI4A 3BJ8A 3TO9A 3PB7X 4A95A 2Z3NA 3BI0A 3R96A 5HVHA 3F0AA 4GPLB 1Z9UA 3KL9A 5IV0A 4IIYA 2GFQA 2ZW4A 4B5OA 1CS0B 1XMBA 3DSBA 3GLJA 3IO1A 4CYPA 5J8CA 4ZX9A 4MMOA 1BO4A 5K8NA 2ZEMA 2PJ7A 4ONWA 5LRGA 2OZUA 3HLPA 3WT4A 2EZCA 2VZYA 4KLVA 3SJEA 3FEEA 2EO8A 4OP4A 1DE4C 4BD9A 4E0AA 2FIAA 4CAFA 4OC5A 4RUHA 3D68A 1S5KA 5BWAB 3IU1A 4YFJA 1RTQA 2CTBA 4MFQA 5AG7A 4FBEA 4HPSA 1UWYA 4P10A 2B4DA 4F9VA 4NFRA 4NGTA
chains in the Genus database with same CATH topology
2F7VA 3VTAA 3S9LA 1XJOA 4R76A 1Y0YA 1YLOA 3B3TA 1VIXA 4MCQA 4OC4A 5LYFA 4P4FA 1TF8A 1IGBA 4C8PA 4C86A 3GUXA 2CTCA 2F8HA 3TC8A 3CPAA 2PIZA 3NFZA 3ICUA 3FF3A 3PFEA 4ZI6A 2GREA 4OIDA 1BLLE 5LYIA 4DYOA 2PJBA 4F9UA 1F57A 3PB8X 4PXCA 3PB6X 3NA6A 2C6GA 4NGQA 3VATA 5HVFA 2AFUA 1Y9ZA 2V8HA 2PJ9A 3MRUA 1R43A 1QQ9A 5IB9A 5JM6A 2NSMA 4A39A 3FJUA 4P44A 1M4LA 1CPXA 1TKHA 3B3WA 2Q43A 3B35A 1KWMA 4A37A 5ELYA 2C6CA 3S9MA 2AFSA 1ZG9A 2IMOA 2PJ0A 1XF1A 1NSAA 2CIJA 1TXRA 4G1PA 4K3NA 2WYRA 2ZELA 4ZYQA 1FT7A 5JH9A 1ZLHA 1V6CA 4B6ZA 3I74A 2BOAA 4C8AA 4IK2A 4TJXA 4JYWA 2OOTA 1VGYA 2JBKA 4YU9A 3FEDA 3D67A 1HEEA 2Q51A 3FECA 3JRUA 4F8ZA 2IJZA 2PJ2A 1XRYA 3ISZA 4MCSA 3PFOA 4OKOA 4NGSA 2GLFA 4R8FA 4X3RA 3CDXA 4P6YA 3SI0A 3IFEA 2EK9A 4UEFA 4DJLA 2ZEFA 5CBMA 4UEZA 2XEJA 4P4JA 4W9YA 1XBUA 1CBXA 5HVGA 5D8NA 4EFDA 2ZEOA 3FVLA 1LAMA 3TX8A 2PVVA 2J9AA 4MHNA 2GU2A 3SJGA 5K8MA 1BPMA 2GP4A 3IEHA 4X2TA 2V77A 2VL1A 3DLJA 1ARMA 4YWYA 5CPAA 4ZY1A 4PQAA 2JBJA 4C8TA 4R7MA 4UEEA 3QNVA 3KASA 4OC3A 2ZENA 4MHZA 2ABZA 2AFMA 2V8VA 1ZLIA 2ZEEA 4UF4A 4X8IA 4C9UA 3D7GA 4C9RA 3D7FA 2C1CA 1Z2LA 2C6PA 4PXDA 2EWBA 4NGNA 1YW6A 3WC6A 4IAVA 3KR5A 3BI1A 3KQXA 2AFZA 4KNGE 3RZAA 4P4DA 3IWWA 4P45A 4A38A 1QMUA 1H8LA 1HDUA 1YSJA 3ISXA 2PJ4A 1Z8LA 4MHPA 2BCOA 3GB0A 4TJVA 4NJQA 3KZWA 4H2KA 4CDKA 3KGQA 4C9AA 3D7HA 5JGFA 4YN3A 4P4EA 3SI2A 1AMPA 4OC1A 2I3CA 3H8FA 2IQ6A 2ZOFA 1F2PA 3K2KA 3PBEA 4NGRA 4PPZA 1ELLP 6CPAA 1VHEA 3WC7A 1CX8A 1Z5RA 2PIYA 3D7DA 1R3NA 5D29A 5I4MA 5J1QA 3CPXA 4Z65A 3L2NA 4MCPA 5THWA 3B3CA 5LYDA 4O23A 4P4IA 2G9DA 3PB4X 1ZG7A 1GYTA 5DS0A 1BPNA 3RAMA 4LQGA 1YMEA 2PJ1A 4WWVA 2XEIA 4OC2A 2EK8A 2PJAA 4GM5A 4NGPA 4OC0A 2ZEGA 2AFXA 4ZX8A 4ZY2A 4CPAA 1BAVA 2PJ3A 3PB9X 3PBBA 1ARLA 3IIBA 5IR2A 2ZEPA 5LYLA 1Y0RA 2GLJA 3BHXA 4MCRA 2RB7A 3SI1A 3V38A 4R6TA 1YW4A 2ANPA 2HB6A 2C5QA 2DEAA 5LRJA 2WZNA 4EMEA 1HDQA 2FVGA 3H8GA 2V8GA 1LOKA 2QYVA 4C8UA 1LFWA 1XFOA 2PE3A 3PRTA 1Y7EA 3MN8A 4PXBA 1CPSA 3I6SA 2O4HA 3KHXA 8CPAA 4OMEA 4AXVA 3H8EA 2XEFA 1TKFA 4C84A 4C85A 4MXUA 1ZG8A 2ZEDA 4CDJA 3BXMA 3KHZA 1LCPA 3IJ3A 2XEGA 4EWTA 1PYTB 3FMCA 4A94A 3WC5A 2V8DA 3B3VA 4FAIA 1TF9A 3IC1A 2BO9A 2JEWA 3B3SA 2QVPA 2PJ5A 4TWEA 1OBRA 2CF4A 4C9EA 1AYEA 3RBUA 4IHMA 3EIFA 3CT9A 4C8FA 4NGMA 1ELMP 1VHOA 2RFHA 2ZEHA 4MHYA 1CP7A 4OIWA 5HXDA 7CPAA 5K8PA 2PVWA 2AFWA 2PRQA 3I1UA 4KSIA 4P4BA 4C9VA 3FX6A 1DTDA 1TKJA 1LAPA 3NH5A 3D4UA 1CP6A 3KI9A 2Q4ZA 3WABA 2QJ8A 3D66A 3KQZA 2PCUA 3LWUA 2NYQA 3NH8A 4JZ0A 3B2YA 4PXEA 3K9TA 4TNUA 3V7ZA 4C8CA 2PJCA 1LANA 4UIAA 2PJ8A 3S9NA 3B7IA 3SJFA 1Q7LA 3KR4A 3DGVA 3T8WA 1JQGA 3N5FA 2POKA 2PJ6A 2ZOGA 1CG2A 5F09A 4Q7AA 3VARA 4FWUA 1F2OA 2AFOA 4WJBA 4ZY0A 4C99A 4UIBA 4DUKA 3LMSA 4FUUA 3FH4A 3VH9A 3NH4A 2OR4A 3HUVA 1WVMA 5LRKA 3PEIA 1EE3P 2HC9A 4NJRA 1IY7A 2O53A 4MRIA 1FNOA 1PCAA 5K8OA 3SJXA 5HVHA 3PB7X 3BI0A 3KL9A 1XMBA 3GLJA 3IO1A 4ZX9A 4MMOA 5K8NA 2ZEMA 2PJ7A 4ONWA 5LRGA 3WT4A 3HLPA 3SJEA 3FEEA 4OP4A 1DE4C 4BD9A 4RUHA 4OC5A 3D68A 1RTQA 2CTBA 4FBEA 1UWYA 4P10A 4F9VA 4NFRA 4NGTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F7V A;  3VTA A;  3S9L A;  1XJO A;  4R76 A;  1Y0Y A;  1YLO A;  3B3T A;  1VIX A;  4MCQ A;  4OC4 A;  5LYF A;  4P4F A;  1TF8 A;  1IGB A;  4C8P A;  4C86 A;  3GUX A;  2CTC A;  2F8H A;  3TC8 A;  3CPA A;  2PIZ A;  3NFZ A;  3ICU A;  3FF3 A;  3PFE A;  4ZI6 A;  2GRE A;  4OID A;  1BLL E;  5LYI A;  4DYO A;  2PJB A;  4F9U A;  1F57 A;  3PB8 X;  4PXC A;  3PB6 X;  3NA6 A;  2C6G A;  4NGQ A;  3VAT A;  5HVF A;  2AFU A;  1Y9Z A;  2V8H A;  2PJ9 A;  3MRU A;  1R43 A;  1QQ9 A;  5IB9 A;  5JM6 A;  2NSM A;  4A39 A;  3FJU A;  4P44 A;  1M4L A;  1CPX A;  1TKH A;  3B3W A;  2Q43 A;  3B35 A;  1KWM A;  4A37 A;  5ELY A;  2C6C A;  3S9M A;  2AFS A;  1ZG9 A;  2IMO A;  2PJ0 A;  1XF1 A;  1NSA A;  2CIJ A;  1TXR A;  4G1P A;  4K3N A;  2WYR A;  2ZEL A;  4ZYQ A;  1FT7 A;  5JH9 A;  1ZLH A;  1V6C A;  4B6Z A;  3I74 A;  2BOA A;  4C8A A;  4IK2 A;  4TJX A;  4JYW A;  2OOT A;  1VGY A;  2JBK A;  4YU9 A;  3FED A;  3D67 A;  1HEE A;  2Q51 A;  3FEC A;  3JRU A;  4F8Z A;  2IJZ A;  2PJ2 A;  1XRY A;  3ISZ A;  4MCS A;  3PFO A;  4OKO A;  4NGS A;  2GLF A;  4R8F A;  4X3R A;  3CDX A;  4P6Y A;  3SI0 A;  3IFE A;  2EK9 A;  4UEF A;  4DJL A;  2ZEF A;  5CBM A;  4UEZ A;  2XEJ A;  4P4J A;  4W9Y A;  1XBU A;  1CBX A;  5HVG A;  5D8N A;  4EFD A;  2ZEO A;  3FVL A;  1LAM A;  3TX8 A;  2PVV A;  2J9A A;  4MHN A;  2GU2 A;  3SJG A;  5K8M A;  1BPM A;  3IEH A;  4X2T A;  2V77 A;  2VL1 A;  3DLJ A;  1ARM A;  4YWY A;  5CPA A;  4ZY1 A;  4PQA A;  2JBJ A;  4C8T A;  4R7M A;  4UEE A;  3QNV A;  3KAS A;  4OC3 A;  2ZEN A;  4MHZ A;  2ABZ A;  2AFM A;  2V8V A;  1ZLI A;  2ZEE A;  4UF4 A;  4X8I A;  4C9U A;  3D7G A;  4C9R A;  3D7F A;  2C1C A;  1Z2L A;  2C6P A;  4PXD A;  2EWB A;  4NGN A;  1YW6 A;  3WC6 A;  4IAV A;  3KR5 A;  3BI1 A;  3KQX A;  2AFZ A;  4KNG E;  3RZA A;  4P4D A;  3IWW A;  4P45 A;  4A38 A;  1QMU A;  1H8L A;  1HDU A;  1YSJ A;  3ISX A;  2PJ4 A;  1Z8L A;  4MHP A;  2BCO A;  3GB0 A;  4TJV A;  4NJQ A;  3KZW A;  4H2K A;  4CDK A;  3KGQ A;  4C9A A;  3D7H A;  5JGF A;  4YN3 A;  4P4E A;  3SI2 A;  1AMP A;  4OC1 A;  2I3C A;  3H8F A;  2IQ6 A;  2ZOF A;  1F2P A;  3K2K A;  3PBE A;  4NGR A;  4PPZ A;  1ELL P;  6CPA A;  1VHE A;  3WC7 A;  1CX8 A;  1Z5R A;  2PIY A;  3D7D A;  1R3N A;  5D29 A;  5I4M A;  5J1Q A;  3CPX A;  4Z65 A;  3L2N A;  4MCP A;  5THW A;  3B3C A;  5LYD A;  4O23 A;  4P4I A;  2G9D A;  3PB4 X;  1ZG7 A;  1GYT A;  5DS0 A;  1BPN A;  3RAM A;  4LQG A;  1YME A;  2PJ1 A;  4WWV A;  2XEI A;  4OC2 A;  2EK8 A;  2PJA A;  4GM5 A;  4NGP A;  4OC0 A;  2ZEG A;  2AFX A;  4ZX8 A;  4ZY2 A;  4CPA A;  1BAV A;  2PJ3 A;  3PB9 X;  3PBB A;  1ARL A;  3IIB A;  2ZEP A;  5LYL A;  1Y0R A;  2GLJ A;  3BHX A;  4MCR A;  2RB7 A;  3SI1 A;  3V38 A;  4R6T A;  1YW4 A;  2ANP A;  2HB6 A;  2DEA A;  5LRJ A;  2WZN A;  4EME A;  1HDQ A;  2FVG A;  3H8G A;  2V8G A;  1LOK A;  2QYV A;  4C8U A;  1LFW A;  1XFO A;  2PE3 A;  3PRT A;  1Y7E A;  3MN8 A;  4PXB A;  1CPS A;  3I6S A;  2O4H A;  3KHX A;  8CPA A;  4OME A;  4AXV A;  3H8E A;  2XEF A;  1TKF A;  4C84 A;  4C85 A;  4MXU A;  1ZG8 A;  2ZED A;  4CDJ A;  3BXM A;  3KHZ A;  1LCP A;  3IJ3 A;  2XEG A;  4EWT A;  1PYT B;  3FMC A;  4A94 A;  3WC5 A;  2V8D A;  3B3V A;  4FAI A;  1TF9 A;  3IC1 A;  2BO9 A;  2JEW A;  3B3S A;  2QVP A;  2PJ5 A;  4TWE A;  1OBR A;  2CF4 A;  4C9E A;  1AYE A;  3RBU A;  4IHM A;  3EIF A;  3CT9 A;  4C8F A;  4NGM A;  1ELM P;  1VHO A;  2RFH A;  2ZEH A;  4MHY A;  1CP7 A;  4OIW A;  5HXD A;  7CPA A;  5K8P A;  2PVW A;  2AFW A;  2PRQ A;  3I1U A;  4KSI A;  4P4B A;  4C9V A;  3FX6 A;  1DTD A;  1TKJ A;  1LAP A;  3NH5 A;  3D4U A;  1CP6 A;  3KI9 A;  2Q4Z A;  3WAB A;  2QJ8 A;  3D66 A;  3KQZ A;  2PCU A;  3LWU A;  2NYQ A;  3NH8 A;  4JZ0 A;  3B2Y A;  4PXE A;  3K9T A;  4TNU A;  3V7Z A;  4C8C A;  2PJC A;  1LAN A;  4UIA A;  2PJ8 A;  3S9N A;  3B7I A;  3SJF A;  1Q7L A;  3KR4 A;  3DGV A;  3T8W A;  1JQG A;  3N5F A;  2POK A;  2PJ6 A;  2ZOG A;  1CG2 A;  5F09 A;  4Q7A A;  3VAR A;  4FWU A;  1F2O A;  2AFO A;  4WJB A;  4ZY0 A;  4C99 A;  4UIB A;  4DUK A;  3LMS A;  4FUU A;  3FH4 A;  3VH9 A;  3NH4 A;  2OR4 A;  3HUV A;  1WVM A;  5LRK A;  3PEI A;  1EE3 P;  2HC9 A;  4NJR A;  1IY7 A;  2O53 A;  4MRI A;  1FNO A;  1PCA A;  5K8O A;  3SJX A;  5HVH A;  3PB7 X;  3BI0 A;  3KL9 A;  1XMB A;  3GLJ A;  3IO1 A;  4ZX9 A;  4MMO A;  5K8N A;  2ZEM A;  2PJ7 A;  4ONW A;  5LRG A;  3WT4 A;  3HLP A;  3SJE A;  3FEE A;  4OP4 A;  1DE4 C;  4BD9 A;  4RUH A;  4OC5 A;  3D68 A;  1RTQ A;  2CTB A;  4FBE A;  1UWY A;  4P10 A;  4F9V A;  4NFR A;  4NGT A; 
#chains in the Genus database with same CATH topology
 5G22 A;  3ZZI A;  1XIX A;  2F7V A;  3G3S A;  3VTA A;  4CYQ A;  3S9L A;  2Z11 A;  3D3S A;  2WPW A;  2GE3 A;  4E94 A;  1XJO A;  4XPL A;  4R76 A;  1VI4 A;  1Y0Y A;  1YLO A;  3BJ7 A;  1Y7R A;  1P0H A;  1VIX A;  4MCQ A;  4OC4 A;  3B3T A;  4P4F A;  1TF8 A;  3QAH A;  1IGB A;  4C7H A;  1Q2Y A;  4E5S A;  2K5T A;  4L89 A;  4RS2 A;  4C8P A;  1QSR A;  4C86 A;  2D4P A;  3GUX A;  2CTC A;  2CNM A;  2F8H A;  1ZL0 A;  1ZYM A;  3TC8 A;  3TLZ A;  1U6M A;  3CPA A;  2PIZ A;  2FL4 A;  4M3S A;  4PV6 A;  4EVY A;  3NFZ A;  5F13 A;  3T5M A;  3LOD A;  3ICU A;  2Y1N A;  2JDD A;  3FF3 A;  4XPD B;  2NMT A;  1DIK A;  3PFE A;  4UFV A;  2EVN A;  5C88 A;  4ZI6 A;  4E8O A;  1YVO A;  3SXO A;  3HPH E;  1IID A;  2GRE A;  4OID A;  1IYL A;  3EO4 A;  3SR3 A;  5LYF A;  5F5X A;  5A28 A;  3T07 A;  4AG7 A;  1CJW A;  4BMH A;  4UFW A;  1BLL E;  5LYI A;  4DYO A;  2EZB A;  2PJB A;  3IGR A;  3GYA A;  4ONU A;  4XPK A;  4F9U A;  5E96 A;  4KOS A;  3NFQ A;  1F57 A;  4J0N A;  4H6U A;  4CYO A;  2P0W A;  3PB8 X;  4PXC A;  3IU2 A;  4M6I A;  3PB6 X;  3NA6 A;  4PK2 A;  2C6G A;  2R8V A;  5A27 A;  2BEI A;  4NGQ A;  4MY0 A;  3VAT A;  2FT0 A;  5HVF A;  2AFU A;  2D4O A;  1Y9Z A;  2R82 A;  2V8H A;  2PJ9 A;  1CE8 B;  3T05 A;  2J8R A;  3SXN A;  3MRU A;  2OLS A;  4U9Y A;  1M4D A;  2XPO A;  1R43 A;  1S7N A;  5AG6 A;  1QQ9 A;  1BOB A;  4UA3 A;  3VRO A;  4B13 A;  1S60 A;  3CZX A;  5IB9 A;  5JM6 A;  3C8O A;  2VZZ A;  2NSM A;  4FD6 A;  4A39 A;  1XF8 A;  2H5M A;  3FJU A;  4P44 A;  4YRH A;  1YQE A;  1M4L A;  2QML A;  1NE9 A;  1CPX A;  1TKH A;  3BUW B;  3B3W A;  4JXR A;  1M44 A;  4UCP A;  1BXR B;  2Q43 A;  3B35 A;  1KWM A;  4KUA A;  4A37 A;  4JXQ A;  2A4N A;  4NF1 A;  5ELY A;  2C6C A;  5HKW A;  3S9M A;  2AFS A;  3VWE A;  2P6F A;  1ZG9 A;  3F9K C;  2IMO A;  1MK4 A;  4PSX A;  2PJ0 A;  1XF1 A;  1NSA A;  4R9M A;  2CIJ A;  1TXR A;  4G1P A;  4K3N A;  5HKY A;  1RXT A;  1XEB A;  2IL4 A;  2WYR A;  2ZEL A;  3DNS A;  4ZYQ A;  1FT7 A;  1YVK A;  2YJV A;  5JH9 A;  4MI1 A;  2ZW5 A;  4FD5 A;  1ZLH A;  2ZPA A;  1V6C A;  2PCN A;  3BUN B;  3FB3 A;  4ORF A;  2VBQ A;  5KTD A;  4B6Z A;  2ZW6 A;  2D0O A;  1PU9 A;  1Z4R A;  3I74 A;  2JLM A;  2G3T A;  1V0C A;  2BOA A;  1ZO0 A;  2KCW A;  4C8A A;  3OWC A;  4IK2 A;  2HQY A;  1P4N A;  4JYW A;  1WWZ A;  4BPU B;  2OOT A;  3OAK A;  1VGY A;  3WR7 A;  4TJX A;  1Z4E A;  5IB0 A;  2JBK A;  4M6H A;  4YU9 A;  5AG4 A;  5JYB A;  4BTF A;  3FED A;  4A2Z A;  4JJX A;  3D67 A;  1I1D A;  2EBJ A;  3VRN A;  1YVH A;  2YNC A;  4CRZ B;  1HEE A;  2Q51 A;  3FEC A;  3JRU A;  3BUX B;  5CNP A;  3JUW A;  4F8Z A;  1L0C A;  2IJZ A;  4CAW A;  5HH1 A;  2PR1 A;  2VI7 A;  2PJ2 A;  2DLA A;  1IOF A;  1XRY A;  3S6H A;  3KKW A;  3ISZ A;  4MCS A;  1WK4 A;  3PFO A;  4OKO A;  4A4C A;  4Y49 C;  3TE4 A;  4IUS A;  2CNS A;  4NGS A;  4BPW B;  4UWJ A;  2GLF A;  3FNC A;  4R8F A;  4X3R A;  2VQY A;  3RO0 A;  3TO7 A;  1Q5X A;  4CGL A;  2J8M A;  1EZA A;  3CDX A;  3PZJ A;  4P6Y A;  3SI0 A;  1S7K A;  4PSW A;  3IFE A;  3R95 A;  3G23 A;  2WSA A;  2EK9 A;  4OLL A;  2Q4Y A;  4BBH A;  4UEF A;  3D2P A;  2YGW A;  4DJL A;  4ZBG A;  4C2X A;  2ZEF A;  3R9G A;  5ISV A;  5CBM A;  4UEZ A;  2XEJ A;  4P4J A;  4W9Y A;  1B6B A;  1CBX A;  1B47 A;  1XBU A;  3R1K A;  5D8N A;  5HVG A;  1Z8W A;  4EFD A;  4MJ8 A;  2ZEO A;  2EZA A;  2G0B A;  2HRO A;  2Y0M A;  2GIV A;  1NMT A;  3FVL A;  3FXT A;  1LAM A;  3RNZ A;  3TX8 A;  2PVV A;  2J9A A;  2J8N A;  4MHN A;  2GU2 A;  3SJG A;  5K8M A;  1KZF A;  1PUA A;  2QEC A;  1BPM A;  4FD4 A;  3GKR A;  1NXJ A;  3P2F A;  4XNH C;  2GP4 A;  3IEH A;  4X2T A;  2V77 A;  3RYO A;  2VL1 A;  3DLJ A;  4KS9 A;  2C27 A;  3NE7 A;  4MJX A;  1ARM A;  4B5P A;  3TLC A;  4YWY A;  1K4J A;  5CPA A;  4R87 A;  4ZY1 A;  4PQA A;  2JBJ A;  3FBU A;  1M1D A;  4C8T A;  1A9X B;  4KOR A;  4GS4 A;  2PRB A;  3W91 A;  4R7M A;  4UEE A;  2BSW A;  3D8P A;  3QNV A;  4NEX A;  3KAS A;  2ZXV A;  4OC3 A;  1QSM A;  1X12 A;  4K30 A;  3DR8 A;  4LX9 A;  2ZEN A;  2YJT A;  4H6Z A;  4CGP A;  4MHZ A;  2ABZ A;  4E2A A;  2AUM A;  3OB1 B;  2AFM A;  2V8V A;  1ZLI A;  2ZEE A;  4UF4 A;  5EBV A;  4QB9 A;  4X8I A;  4C9U A;  3D7G A;  4C9R A;  3PGP A;  3D7F A;  2B5G A;  2B0A A;  1JWQ A;  4COB A;  4MFZ A;  2C1C A;  1Z2L A;  2C6P A;  3PT1 A;  4PXD A;  5J8F A;  1ZRS A;  2EWB A;  5GCN A;  1IYK A;  2CXA A;  4NGN A;  1YW6 A;  3HPG G;  3WC6 A;  2B4D B;  4IAV A;  1KUX A;  2G3A A;  3KR5 A;  3BI1 A;  3KQX A;  3NOJ A;  2EUI A;  3FIX A;  3I9S A;  2YNE A;  2FIW A;  2AFZ A;  4JD6 A;  4KNG E;  2FM4 A;  3RZA A;  4NCZ A;  1YLE A;  4P4D A;  3BUM B;  3QB8 A;  4EYS A;  3IWW A;  2Z0Z A;  4P45 A;  4A38 A;  3D2M A;  4KOT A;  1RO5 A;  1QMU A;  1H8L A;  1HDU A;  1YSJ A;  2FS5 A;  2I00 A;  3ISX A;  2PJ4 A;  1Z8L A;  4H1H A;  4UCM A;  1VBH A;  4MHP A;  5JQ4 A;  2BCO A;  3GB0 A;  4OAE A;  4HNW B;  4TJV A;  4NJQ A;  1IB1 E;  4B10 A;  3PFV A;  3KZW A;  4H2K A;  1EO0 A;  1M6V B;  4CS0 B;  2MP0 A;  4CDK A;  1JDE A;  4HNX B;  3EZE A;  1J4J A;  2Z3L A;  3KGQ A;  4C9A A;  3D7H A;  5JGF A;  2R1I A;  4YN3 A;  1WJT A;  3TLG A;  1OZP A;  3TT2 A;  4P4E A;  5G1Z A;  4B11 A;  3SI2 A;  2YNC C;  1AMP A;  4UCN A;  4B5P B;  4OC1 A;  4J3G A;  2I3C A;  3H8F A;  2DXQ A;  4KSA A;  2IQ6 A;  2ZOF A;  1F2P A;  4JLY A;  3K2K A;  1NSL A;  3V8I A;  3TLB A;  1C3O B;  3PBE A;  4NGR A;  2XPN A;  4PPZ A;  2XPP A;  3O8Z A;  1ELL P;  3F8K A;  4QC6 A;  2ATR A;  4I49 A;  3K9U A;  6CPA A;  3CXQ A;  1VHE A;  5FVJ A;  3CXP A;  3T9Y A;  5DWN A;  3GY9 A;  2ARH A;  2DPS A;  1CX8 A;  1Z5R A;  2PIY A;  2Q44 A;  3WC7 A;  3D7D A;  1GHE A;  1R3N A;  5D29 A;  5I4M A;  5J1Q A;  3IWE A;  4MHD A;  3TOB A;  3CPX A;  4A30 A;  3NE8 A;  2R98 A;  3VWD A;  4DNC A;  3L2N A;  4Z65 A;  3TLE A;  2JEV A;  5K99 A;  4MCP A;  5THW A;  3B3C A;  5LYD A;  4O23 A;  4KSF A;  1Y9K A;  4P4I A;  4JVO A;  2G9D A;  2JDC A;  3PB4 X;  3H4Q A;  4QVT A;  1SQH A;  1ZG7 A;  4A33 A;  3BUO B;  4RR2 B;  1GYT A;  1VHS A;  1X10 A;  4GXH A;  5AXI A;  5DS0 A;  4AVC A;  4B14 A;  4CAX A;  5JPH A;  2Q7B A;  2E28 A;  4HKF A;  1BPN A;  5I0C A;  3JTK A;  5IX3 A;  3FRM A;  3RAM A;  4LQG A;  1YME A;  4AB7 A;  3DDD A;  2PJ1 A;  1YX0 A;  4WWV A;  5EMI A;  2XEI A;  4OC2 A;  2B3V A;  1S3Z A;  4C2Y A;  2EK8 A;  4KOX A;  3HMJ G;  2GAN A;  5BY0 A;  1YRE A;  3U88 C;  1ON0 A;  4C7I A;  4U5Y A;  2PJA A;  4LUA A;  5AG5 A;  3T90 A;  4ZGY B;  4MFL A;  4GM5 A;  4NGP A;  4OC0 A;  2ZEG A;  2AFX A;  4ZX8 A;  4MFK A;  4ZY2 A;  1YK3 A;  2F5I A;  4CPA A;  1BAV A;  2PJ3 A;  4AVA A;  3PB9 X;  2B4J C;  2CY2 A;  1IIC A;  3PBB A;  1ARL A;  3IIB A;  2VXK A;  5IR2 A;  4A31 A;  2Z3O A;  3DR6 A;  4KVM E;  4XPD C;  1YGH A;  3CXS A;  5F47 A;  5KTA A;  4CZ1 A;  2ZEP A;  5LYL A;  4BIN A;  3VGO A;  3EC4 A;  1Y0R A;  1LRZ A;  1AUG A;  2D0P A;  5F1Y A;  2GLJ A;  5C82 A;  3G8W A;  3BHX A;  4MCR A;  2B4B A;  2RB7 A;  3SI1 A;  3V38 A;  4R6T A;  1YW4 A;  2ANP A;  4KVX A;  3LAC A;  2HB6 A;  2PDO A;  4CYN A;  2C5Q A;  2X7B A;  2DEA A;  2Z10 A;  3P2H A;  5LRJ A;  4CRY B;  2WZN A;  4EME A;  7CPA A;  1KBL A;  4JWP A;  1HDQ A;  2FVG A;  3H8G A;  3W6X A;  2V8G A;  3KRV A;  2P6E A;  1LOK A;  2QYV A;  4C8U A;  4L8A A;  4C2Z A;  1LFW A;  1XE4 A;  1XFO A;  2PE3 A;  3PRT A;  2CBL A;  1R57 A;  1Y7E A;  2PC1 A;  3MN8 A;  4PXB A;  5EC4 A;  5F49 A;  1CPS A;  3I6S A;  4M8D A;  4R3K A;  1QSN A;  1JDB C;  5FD8 A;  2O4H A;  3B8G A;  1QSO A;  3KHX A;  4UBR A;  3TFY A;  1S7L A;  5F9M A;  3T0T A;  4KOU A;  3MGD A;  1VKC A;  4CO9 A;  3SHP A;  3TLA A;  4H89 A;  8CPA A;  4OME A;  2BL1 A;  4QUS A;  4AXV A;  2OU2 A;  2XEF A;  3H8E A;  1IOI A;  1MJA A;  1TKF A;  4C84 A;  4C85 A;  4MXU A;  1ZG8 A;  2RC4 A;  1Q2D A;  2ZED A;  4KVO E;  4Y49 B;  4INJ A;  3VRP A;  4CDJ A;  4A4B A;  3BXM A;  3QAY A;  2Q0Y A;  3KHZ A;  4KOW A;  4RN7 A;  4UWI A;  3R9F A;  1LCP A;  2FSR A;  2XEG A;  3IJ3 A;  3PLF B;  1M4G A;  1PYT B;  3FMC A;  3N7Z A;  2AE6 A;  3PP9 A;  4A94 A;  4F0Y A;  3WC5 A;  2FCK A;  4U9Z A;  4C68 A;  2WUU A;  2V8D A;  3B3V A;  4FAI A;  4NXY A;  2HUZ A;  2PQ8 A;  2XPL A;  1CM0 A;  4B12 A;  2HI6 A;  5AGE A;  1KUV A;  1TF9 A;  3IC1 A;  4NSQ A;  4AVB A;  2BO9 A;  1FY7 A;  3EZB A;  2AUN A;  3VRQ A;  4CGO A;  4EWT A;  3EXN A;  2R7H A;  2JEW A;  2ODF A;  2QVP A;  3B3S A;  4OAD A;  4CGM A;  2PJ5 A;  4TWE A;  1OBR A;  5HKZ A;  2WPX A;  4KZT A;  3LD2 A;  2Q7S A;  2CF4 A;  4C9E A;  5H84 A;  1AYE A;  1KUY A;  2B5G B;  3RBU A;  4IHM A;  1R61 A;  3EIF A;  3CT9 A;  4C8F A;  5F46 A;  1XMT A;  2OZH A;  1J3L A;  4NGM A;  1ELM P;  1VHO A;  2Z3P A;  2RFH A;  2ZEH A;  4XNH B;  4RI1 A;  4MHY A;  4COG A;  1CP7 A;  2VKZ G;  2B58 A;  4KLW A;  4OIW A;  3TO6 A;  5HXD A;  1I21 A;  2Z3M A;  2BUE A;  2Z3K A;  3W6S A;  2PVW A;  1XOV A;  2AFW A;  2PRQ A;  3I1U A;  4P4B A;  4KSI A;  4QBJ A;  5KTC A;  1KC7 A;  3TCV A;  4C9V A;  1Z8T A;  3FX6 A;  1DTD A;  1NBW A;  2VEZ A;  2B3U A;  1TKJ A;  1LAP A;  4CAE A;  3NH5 A;  3D4U A;  1CP6 A;  3KI9 A;  2Q4Z A;  3WAB A;  2QIR A;  4IIX A;  2I79 A;  2QJ8 A;  2DPT A;  4HNY B;  4X5K A;  3U1B A;  2UV8 G;  2Q04 A;  3D66 A;  3H5Z A;  1Z9E A;  3ZNI A;  3KQZ A;  2PCU A;  4KOV A;  1A2Z A;  4MFJ A;  3C26 A;  4YGO A;  3LWU A;  1T36 B;  2NYQ A;  2OZG A;  4BPX B;  2DF5 A;  3NH8 A;  2REE A;  4KOY A;  4Q36 A;  5JVL A;  5K8P A;  3TLG B;  2PSW A;  1S7F A;  2ZW7 A;  4JZ0 A;  4LQ6 A;  5J3X A;  3FYN A;  2PR8 A;  3EZA A;  3VRR A;  3B2Y A;  4PXE A;  3K9T A;  2YND A;  1IU8 A;  1Y9W A;  4TNU A;  1KEE B;  2P6G A;  3V7Z A;  3ZJ0 A;  4C8C A;  1TIQ A;  2PJC A;  4IF5 A;  5G20 A;  1LAN A;  4UIA A;  1FBV A;  4AG9 A;  2PJ8 A;  4PK3 A;  2CNT A;  4M85 A;  3S9N A;  3B7I A;  3S6F A;  3SJF A;  3F5B A;  3A9L A;  1Q7L A;  4MBU A;  3OB2 B;  4CAV A;  3KR4 A;  3DGV A;  5HMN A;  4R57 A;  2FE7 A;  1JQG A;  2OB0 A;  3T8W A;  3EFA A;  3N5F A;  1N71 A;  2FXF A;  2PJ6 A;  2POK A;  1UFH A;  2DIK A;  2ZOG A;  4MY3 A;  3TTH A;  3JVN A;  1CG2 A;  1MJB A;  5H86 A;  5F09 A;  3TOA A;  4A32 A;  4Q7A A;  2REF A;  4UFX A;  3VAR A;  3E0K A;  4FWU A;  3TLY A;  2X0S A;  1Q2C A;  2HV2 A;  5G21 A;  1F2O A;  2AFO A;  3GIU A;  4WJB A;  2N3A B;  4FD7 A;  3R9E A;  2Y1M A;  4ZY0 A;  1VBG A;  4C99 A;  2O28 A;  2OH1 A;  3EY5 A;  4UIB A;  4DUK A;  4KUB A;  1EZB A;  1Z8X A;  3BLN A;  5F48 A;  3LMS A;  4FUU A;  4R3L A;  4Q38 A;  3FH4 A;  3VH9 A;  3NH4 A;  3OP0 A;  2OR4 A;  1MJ9 A;  3HUV A;  1WVM A;  1I12 A;  1QST A;  5LRK A;  2Q4V A;  2HWG A;  3I3G A;  3PEI A;  4CGN A;  4M6G A;  1YR0 A;  4F0X A;  3K4I A;  2AJ6 A;  4F6A A;  3TYX A;  1EE3 P;  4MFP A;  2HC9 A;  4II9 A;  4NJR A;  1GGO A;  5DWM A;  3IWG A;  3UY5 A;  1M4I A;  3GJZ A;  1IY7 A;  1B87 A;  2O53 A;  4MRI A;  1C30 B;  1FNO A;  3S6G A;  1PCA A;  5K8O A;  3S6K A;  3SJX A;  4MI4 A;  3BJ8 A;  3TO9 A;  3PB7 X;  4A95 A;  2Z3N A;  3BI0 A;  3R96 A;  5HVH A;  3F0A A;  4GPL B;  1Z9U A;  3KL9 A;  5IV0 A;  4IIY A;  2GFQ A;  2ZW4 A;  4B5O A;  1CS0 B;  1XMB A;  3DSB A;  3GLJ A;  3IO1 A;  4CYP A;  5J8C A;  4ZX9 A;  4MMO A;  1BO4 A;  5K8N A;  2ZEM A;  2PJ7 A;  4ONW A;  5LRG A;  2OZU A;  3HLP A;  3WT4 A;  2EZC A;  2VZY A;  4KLV A;  3SJE A;  3FEE A;  2EO8 A;  4OP4 A;  1DE4 C;  4BD9 A;  4E0A A;  2FIA A;  4CAF A;  4OC5 A;  4RUH A;  3D68 A;  1S5K A;  5BWA B;  3IU1 A;  4YFJ A;  1RTQ A;  2CTB A;  4MFQ A;  5AG7 A;  4FBE A;  4HPS A;  1UWY A;  4P10 A;  2B4D A;  4F9V A;  4NFR A;  4NGT A; 
#chains in the Genus database with same CATH homology
 2F7V A;  3VTA A;  3S9L A;  1XJO A;  4R76 A;  1Y0Y A;  1YLO A;  3B3T A;  1VIX A;  4MCQ A;  4OC4 A;  5LYF A;  4P4F A;  1TF8 A;  1IGB A;  4C8P A;  4C86 A;  3GUX A;  2CTC A;  2F8H A;  3TC8 A;  3CPA A;  2PIZ A;  3NFZ A;  3ICU A;  3FF3 A;  3PFE A;  4ZI6 A;  2GRE A;  4OID A;  1BLL E;  5LYI A;  4DYO A;  2PJB A;  4F9U A;  1F57 A;  3PB8 X;  4PXC A;  3PB6 X;  3NA6 A;  2C6G A;  4NGQ A;  3VAT A;  5HVF A;  2AFU A;  1Y9Z A;  2V8H A;  2PJ9 A;  3MRU A;  1R43 A;  1QQ9 A;  5IB9 A;  5JM6 A;  2NSM A;  4A39 A;  3FJU A;  4P44 A;  1M4L A;  1CPX A;  1TKH A;  3B3W A;  2Q43 A;  3B35 A;  1KWM A;  4A37 A;  5ELY A;  2C6C A;  3S9M A;  2AFS A;  1ZG9 A;  2IMO A;  2PJ0 A;  1XF1 A;  1NSA A;  2CIJ A;  1TXR A;  4G1P A;  4K3N A;  2WYR A;  2ZEL A;  4ZYQ A;  1FT7 A;  5JH9 A;  1ZLH A;  1V6C A;  4B6Z A;  3I74 A;  2BOA A;  4C8A A;  4IK2 A;  4TJX A;  4JYW A;  2OOT A;  1VGY A;  2JBK A;  4YU9 A;  3FED A;  3D67 A;  1HEE A;  2Q51 A;  3FEC A;  3JRU A;  4F8Z A;  2IJZ A;  2PJ2 A;  1XRY A;  3ISZ A;  4MCS A;  3PFO A;  4OKO A;  4NGS A;  2GLF A;  4R8F A;  4X3R A;  3CDX A;  4P6Y A;  3SI0 A;  3IFE A;  2EK9 A;  4UEF A;  4DJL A;  2ZEF A;  5CBM A;  4UEZ A;  2XEJ A;  4P4J A;  4W9Y A;  1XBU A;  1CBX A;  5HVG A;  5D8N A;  4EFD A;  2ZEO A;  3FVL A;  1LAM A;  3TX8 A;  2PVV A;  2J9A A;  4MHN A;  2GU2 A;  3SJG A;  5K8M A;  1BPM A;  2GP4 A;  3IEH A;  4X2T A;  2V77 A;  2VL1 A;  3DLJ A;  1ARM A;  4YWY A;  5CPA A;  4ZY1 A;  4PQA A;  2JBJ A;  4C8T A;  4R7M A;  4UEE A;  3QNV A;  3KAS A;  4OC3 A;  2ZEN A;  4MHZ A;  2ABZ A;  2AFM A;  2V8V A;  1ZLI A;  2ZEE A;  4UF4 A;  4X8I A;  4C9U A;  3D7G A;  4C9R A;  3D7F A;  2C1C A;  1Z2L A;  2C6P A;  4PXD A;  2EWB A;  4NGN A;  1YW6 A;  3WC6 A;  4IAV A;  3KR5 A;  3BI1 A;  3KQX A;  2AFZ A;  4KNG E;  3RZA A;  4P4D A;  3IWW A;  4P45 A;  4A38 A;  1QMU A;  1H8L A;  1HDU A;  1YSJ A;  3ISX A;  2PJ4 A;  1Z8L A;  4MHP A;  2BCO A;  3GB0 A;  4TJV A;  4NJQ A;  3KZW A;  4H2K A;  4CDK A;  3KGQ A;  4C9A A;  3D7H A;  5JGF A;  4YN3 A;  4P4E A;  3SI2 A;  1AMP A;  4OC1 A;  2I3C A;  3H8F A;  2IQ6 A;  2ZOF A;  1F2P A;  3K2K A;  3PBE A;  4NGR A;  4PPZ A;  1ELL P;  6CPA A;  1VHE A;  3WC7 A;  1CX8 A;  1Z5R A;  2PIY A;  3D7D A;  1R3N A;  5D29 A;  5I4M A;  5J1Q A;  3CPX A;  4Z65 A;  3L2N A;  4MCP A;  5THW A;  3B3C A;  5LYD A;  4O23 A;  4P4I A;  2G9D A;  3PB4 X;  1ZG7 A;  1GYT A;  5DS0 A;  1BPN A;  3RAM A;  4LQG A;  1YME A;  2PJ1 A;  4WWV A;  2XEI A;  4OC2 A;  2EK8 A;  2PJA A;  4GM5 A;  4NGP A;  4OC0 A;  2ZEG A;  2AFX A;  4ZX8 A;  4ZY2 A;  4CPA A;  1BAV A;  2PJ3 A;  3PB9 X;  3PBB A;  1ARL A;  3IIB A;  5IR2 A;  2ZEP A;  5LYL A;  1Y0R A;  2GLJ A;  3BHX A;  4MCR A;  2RB7 A;  3SI1 A;  3V38 A;  4R6T A;  1YW4 A;  2ANP A;  2HB6 A;  2C5Q A;  2DEA A;  5LRJ A;  2WZN A;  4EME A;  1HDQ A;  2FVG A;  3H8G A;  2V8G A;  1LOK A;  2QYV A;  4C8U A;  1LFW A;  1XFO A;  2PE3 A;  3PRT A;  1Y7E A;  3MN8 A;  4PXB A;  1CPS A;  3I6S A;  2O4H A;  3KHX A;  8CPA A;  4OME A;  4AXV A;  3H8E A;  2XEF A;  1TKF A;  4C84 A;  4C85 A;  4MXU A;  1ZG8 A;  2ZED A;  4CDJ A;  3BXM A;  3KHZ A;  1LCP A;  3IJ3 A;  2XEG A;  4EWT A;  1PYT B;  3FMC A;  4A94 A;  3WC5 A;  2V8D A;  3B3V A;  4FAI A;  1TF9 A;  3IC1 A;  2BO9 A;  2JEW A;  3B3S A;  2QVP A;  2PJ5 A;  4TWE A;  1OBR A;  2CF4 A;  4C9E A;  1AYE A;  3RBU A;  4IHM A;  3EIF A;  3CT9 A;  4C8F A;  4NGM A;  1ELM P;  1VHO A;  2RFH A;  2ZEH A;  4MHY A;  1CP7 A;  4OIW A;  5HXD A;  7CPA A;  5K8P A;  2PVW A;  2AFW A;  2PRQ A;  3I1U A;  4KSI A;  4P4B A;  4C9V A;  3FX6 A;  1DTD A;  1TKJ A;  1LAP A;  3NH5 A;  3D4U A;  1CP6 A;  3KI9 A;  2Q4Z A;  3WAB A;  2QJ8 A;  3D66 A;  3KQZ A;  2PCU A;  3LWU A;  2NYQ A;  3NH8 A;  4JZ0 A;  3B2Y A;  4PXE A;  3K9T A;  4TNU A;  3V7Z A;  4C8C A;  2PJC A;  1LAN A;  4UIA A;  2PJ8 A;  3S9N A;  3B7I A;  3SJF A;  1Q7L A;  3KR4 A;  3DGV A;  3T8W A;  1JQG A;  3N5F A;  2POK A;  2PJ6 A;  2ZOG A;  1CG2 A;  5F09 A;  4Q7A A;  3VAR A;  4FWU A;  1F2O A;  2AFO A;  4WJB A;  4ZY0 A;  4C99 A;  4UIB A;  4DUK A;  3LMS A;  4FUU A;  3FH4 A;  3VH9 A;  3NH4 A;  2OR4 A;  3HUV A;  1WVM A;  5LRK A;  3PEI A;  1EE3 P;  2HC9 A;  4NJR A;  1IY7 A;  2O53 A;  4MRI A;  1FNO A;  1PCA A;  5K8O A;  3SJX A;  5HVH A;  3PB7 X;  3BI0 A;  3KL9 A;  1XMB A;  3GLJ A;  3IO1 A;  4ZX9 A;  4MMO A;  5K8N A;  2ZEM A;  2PJ7 A;  4ONW A;  5LRG A;  3WT4 A;  3HLP A;  3SJE A;  3FEE A;  4OP4 A;  1DE4 C;  4BD9 A;  4RUH A;  4OC5 A;  3D68 A;  1RTQ A;  2CTB A;  4FBE A;  1UWY A;  4P10 A;  4F9V A;  4NFR A;  4NGT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...