2OR4A

A high resolution crystal structure of human glutamate carboxypeptidase ii in complex with quisqualic acid
Total Genus 264
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
264
sequence length
696
structure length
689
Chain Sequence
KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFDKSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Glutamate carboxypeptidase 2
publication title Structural insight into the pharmacophore pocket of human glutamate carboxypeptidase II.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 264
structure length 689
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2007-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 2or4A03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2or4A01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 2or4A02
2ZEDA 1Z5RA 2CIJA 4P4BA 4C8CA 3SJXA 2C1CA 3FVLA 4P4JA 3KI9A 4C84A 1TF9A 1CP7A 2ABZA 4P4FA 3NH8A 3ICUA 2G9DA 2C6PA 3WC5A 2PJ2A 5LRGA 1CP6A 4F9UA 1F2OA 1TKHA 5THWA 3BI0A 2PCUA 1Y7EA 2AFSA 2AFZA 2PJ4A 4NGRA 3SI0A 2PRQA 4TWEA 4KSIA 3D7GA 2JBJA 2PJ9A 4C8TA 1CPSA 1EE3P 2POKA 3TX8A 1YSJA 4K3NA 3LWUA 1AYEA 1Z2LA 4YWYA 3KQZA 4MMOA 3D7HA 3MRUA 1QMUA 3PB9X 1YMEA 3SJFA 2V8DA 4X2TA 4OP4A 3V7ZA 2GU2A 4ZX9A 3I6SA 2F7VA 4UEEA 2O4HA 3I1UA 4NJRA 4P45A 4R76A 1LANA 2V8HA 5D29A 1PCAA 4P4IA 1JQGA 3WC6A 5K8MA 1CBXA 5ELYA 5LYFA 2XEIA 1WVMA 3RBUA 6CPAA 5HVGA 3TC8A 4PXBA 2ZOFA 5JH9A 4C8PA 1Y0RA 2ZEHA 3B3TA 3SI2A 4O23A 1XBUA 2V8GA 2PIZA 3B3CA 4CPAA 7CPAA 3FEDA 4MHPA 4OC1A 1VGYA 4DJLA 4ZY0A 1F2PA 4WWVA 1BAVA 2QYVA 3IFEA 4Z65A 3VTAA 3NA6A 3VARA 2EK9A 4MXUA 1Y9ZA 4TJVA 4UF4A 2PJ6A 4ZX8A 2AFOA 4UIAA 3MN8A 1ELMP 2PJ3A 4H2KA 1ZLIA 1LFWA 4OIWA 3RZAA 5LYDA 3KHZA 5I4MA 4P6YA 3PFEA 1NSAA 3PFOA 2CTCA 2WZNA 3D7FA 3IWWA 1TXRA 4IAVA 4P4EA 3H8EA 2AFWA 1FT7A 2Q4ZA 4JZ0A 1VIXA 1XF1A 1OBRA 3DGVA 4P4DA 4LQGA 2GLJA 3PB8X 2JBKA 2EWBA 2OR4A 3JRUA 1ARMA 2PJCA 2BOAA 2QJ8A 5K8OA 3I74A 5J1QA 4C8UA 3KL9A 3K2KA 3PB7X 4MHNA 3VH9A 3KGQA 4OC3A 4B6ZA 3KR5A 2IMOA 3L2NA 1ZLHA 4W9YA 2AFMA 2C6GA 1XJOA 4TJXA 4DUKA 3WABA 4ZY2A 3BXMA 4NGSA 4OMEA 4MHZA 5JM6A 1PYTB 3PRTA 1UWYA 1IGBA 2PVWA 5HXDA 1ARLA 1V6CA 2AFXA 3IC1A 1VHEA 4EWTA 1LOKA 1CG2A 5CPAA 5HVFA 4R8FA 4C9RA 3QNVA 4ZI6A 4MRIA 3FECA 4Q7AA 4BD9A 1XMBA 4C8FA 2DEAA 3S9NA 4CDJA 1YW6A 4NGMA 3GB0A 3B3WA 3NH4A 4UEFA 3LMSA 4EFDA 3D7DA 2QVPA 4PXCA 1BPNA 4TNUA 5F09A 4X8IA 3FMCA 5DS0A 2PJ5A 4OC4A 4FAIA 1BLLE 4ZY1A 4FBEA 4C9AA 3B7IA 4UIBA 1CX8A 4R6TA 3PBEA 4F8ZA 4YN3A 4OC0A 4AXVA 4C86A 3IEHA 3B3VA 2PJAA 3T8WA 4RUHA 2ZOGA 1HEEA 1M4LA 2O53A 1R3NA 3WT4A 4G1PA 4IHMA 1AMPA 4MCRA 4NGTA 1DE4C 5K8PA 2ZEEA 3GLJA 1Z8LA 3SJEA 1TF8A 3NFZA 2GLFA 1IY7A 2C6CA 4F9VA 2FVGA 2XEJA 3CPAA 3FJUA 3HLPA 2EK8A 2XEFA 3IIBA 1KWMA 3KQXA 3PEIA 3SI1A 1ELLP 4P10A 2WYRA 2BCOA 2ZEFA 3ISZA 3IO1A 2ZEGA 1XRYA 4NJQA 4C99A 2PVVA 4MCPA 2OOTA 2HB6A 4GM5A 1BPMA 5IB9A 2PJ7A 1VHOA 5D8NA 1ZG8A 4EMEA 5LYIA 2PJ0A 3IJ3A 1H8LA 3PB4X 2PJ8A 3KHXA 1FNOA 1GYTA 4P44A 4DYOA 1HDUA 5LRKA 1Q7LA 3B3SA 2ZENA 4JYWA 4FWUA 4NFRA 8CPAA 3RAMA 2ZEMA 1HDQA 4C8AA 4OC5A 3NH5A 2JEWA 3BHXA 5LYLA 3HUVA 3BI1A 4MCSA 2AFUA 2NYQA 3FH4A 2ZELA 3S9LA 4PXEA 1ZG7A 2NSMA 3D66A 2I3CA 4ONWA 2PE3A 4UEZA 1RTQA 1QQ9A 2Q43A 2ZEPA 4C9UA 5K8NA 3KZWA 4YU9A 1TKJA 4OIDA 3H8FA 3GUXA 3DLJA 4MCQA 1DTDA 3VATA 4NGQA 4PQAA 5JGFA 3FX6A 2CTBA 3S9MA 3KASA 3K9TA 2PIYA 4R7MA 2CF4A 4ZYQA 2RFHA 4MHYA 2PJBA 2HC9A 2V77A 3WC7A 4CDKA 3FF3A 4NGPA 1F57A 2J9AA 2Q51A 4A94A 4C85A 4NGNA 2ZEOA 2PJ1A 4IK2A 4PXDA 4PPZA 4FUUA 2V8VA 1ZG9A 4WJBA 3V38A 3SJGA 3B35A 2F8HA 4A39A 3EIFA 5HVHA 1Y0YA 4A38A 5LRJA 1R43A 4A37A 2IJZA 4X3RA 4KNGE 3B2YA 2IQ6A 3N5FA 4OC2A 2XEGA 3CT9A 1TKFA 1XFOA 1YW4A 4OKOA 3FEEA 2ANPA 3CPXA 3H8GA 2RB7A 3CDXA 3PBBA 2BO9A 1CPXA 3D68A 3KR4A 2GREA 5CBMA 4C9VA 3D4UA 3ISXA 2VL1A 3D67A 1LAMA 3PB6X 1YLOA 1LCPA 1LAPA 4C9EA
chains in the Genus database with same CATH superfamily
2N3AB 2ZEDA 3R9GA 3IU1A 1Z5RA 2BEIA 2FS5A 2CIJA 4P4BA 1MJAA 3TTHA 1VI4A 4C8CA 3SJXA 3TO9A 2EBJA 2VI7A 2FL4A 2C1CA 3FVLA 4IUSA 4P4JA 1BOBA 1IICA 3KI9A 4E5SA 4C84A 1TF9A 2BSWA 1CP7A 2ABZA 2J8RA 4P4FA 3NH8A 5H84A 3ICUA 3OAKA 2G9DA 2C6PA 2CNTA 2OH1A 3WC5A 4CGLA 2PJ2A 5LRGA 2OB0A 4CGMA 4R9MA 1CP6A 4F9UA 1F2OA 1TKHA 5THWA 3W91A 3ZZIA 3BI0A 1YX0A 2Y1MA 2J8NA 2PCUA 1Y7EA 2AFSA 2AFZA 2PJ4A 2PR1A 4XPDB 4Q36A 2EO8A 4NGRA 2OU2A 2CNSA 3QAHA 3JVNA 2C5QA 2Z11A 3OB1B 4KVME 4MHDA 3SI0A 2OZHA 4HNYB 1ZYMA 4UBRA 1VHSA 2PRQA 3EY5A 4CAEA 4TWEA 4KSIA 4X5KA 3GY9A 3D7GA 2JBJA 2OLSA 5JYBA 2PJ9A 2F5IA 4C8TA 4ZY2A 4OAEA 1CPSA 1EE3P 4C7HA 4B10A 2POKA 3TX8A 4KSFA 2HUZA 1YSJA 2FIWA 2YNCA 4K3NA 1KZFA 2EVNA 4KORA 1XMTA 3S6GA 4KOWA 4AB7A 1KEEB 2AUNA 3SXOA 3BJ8A 3VRRA 1XEBA 1AYEA 2Q04A 3LWUA 4KOXA 1V0CA 1Z2LA 4YWYA 3KQZA 4JXQA 1T36B 4MMOA 3D7HA 3GJZA 2R98A 1QMUA 3MRUA 3PB9X 1YMEA 3SJFA 2V8DA 3CXQA 5EC4A 3FXTA 4OP4A 3GYAA 4X2TA 3V7ZA 2GU2A 4ZX9A 5J8FA 3I6SA 2GE3A 2F7VA 4Q38A 1LRZA 4UEEA 2O4HA 3BUOB 2GP4A 2XPPA 3I1UA 4NJRA 4OADA 4IIXA 4P45A 3RO0A 2D0PA 4B14A 3K9UA 4R76A 2HQYA 3R1KA 5F47A 4EYSA 3EZEA 1LANA 2V8HA 4M6GA 5D29A 2B5GA 4B11A 1PCAA 1NMTA 3BUNB 4M3SA 4P4IA 4CRYB 1JQGA 3WC6A 2NMTA 5C82A 5K8MA 1CBXA 5ELYA 1Q2DA 4RI1A 5LYFA 2XEIA 5FD8A 3ZJ0A 1WVMA 5F49A 3RBUA 4BTFA 4CYNA 2VXKA 6CPAA 5HVGA 3TT2A 3TC8A 4PXBA 2ZOFA 5JH9A 4C8PA 4DNCA 1Y0RA 2QECA 4MBUA 4KOSA 2ZEHA 5A28A 3B3TA 4A32A 3QB8A 4CAFA 3HMJG 3SI2A 1J3LA 5J3XA 2ATRA 4O23A 1XBUA 2V8GA 3WR7A 4E94A 5HKZA 1B47A 2PIZA 3D8PA 3H5ZA 4Y49C 3B3CA 3PP9A 4B13A 4CPAA 7CPAA 4UCPA 2I79A 4KUBA 4U9ZA 3UY5A 3FEDA 4MHPA 4BMHA 1WJTA 3VRPA 1Z8XA 5HKYA 4OC1A 1VGYA 3B8GA 4FD4A 4H6UA 5HMNA 4M6IA 3TYXA 2WPWA 4DJLA 4ZY0A 4UFVA 1F2PA 1IU8A 2Q0YA 4WWVA 4YRHA 1BAVA 4QVTA 4BPXB 2QYVA 3IFEA 4Z65A 3NA6A 3TE4A 4KSAA 3VARA 5KTCA 3VTAA 5F1YA 1YREA 2EK9A 4MXUA 3R9EA 4JWPA 3I9SA 1Y9ZA 4TJVA 4UF4A 2PJ6A 4ZX8A 4GS4A 2AFOA 4UIAA 2FSRA 3MN8A 2DIKA 1MK4A 4UFWA 2B5GB 2R7HA 1ELMP 2PJ3A 4H2KA 4IF5A 1ZLIA 2B4JC 2K5TA 2E28A 2PCNA 4RS2A 1LFWA 4M6HA 2X7BA 4OIWA 1IOIA 3RZAA 1NXJA 2PR8A 4CYOA 5LYDA 3BJ7A 4HKFA 3KHZA 4B5PB 5I4MA 4C2ZA 4P6YA 2YJTA 5F48A 3PFEA 1NSAA 3PFOA 1YLEA 1M1DA 1QSTA 3FNCA 3R96A 2CTCA 2FIAA 2WZNA 3D7FA 3IWWA 1U6MA 2B4BA 2Q4VA 1MJBA 1TXRA 4KZTA 4IAVA 5F5XA 2Q7SA 4P4EA 2PC1A 4H6ZA 3H8EA 4L8AA 2XPOA 2AFWA 1FT7A 2FCKA 4AVAA 4M8DA 1Z4RA 2DPTA 4A95A 2QMLA 2YNCC 3F8KA 2Q4ZA 3CZXA 1XF8A 4JZ0A 1ZO0A 2G3TA 1VIXA 2VBQA 1OBRA 1XF1A 2YNDA 3DGVA 3R95A 1S7NA 4P4DA 2Q44A 3TLBA 2VEZA 2P6GA 2VKZG 4LQGA 4YGOA 4UFXA 3FIXA 3G3SA 2C27A 2GLJA 3D2MA 4GPLB 3PB8X 1PU9A 2JBKA 4KS9A 2EWBA 1NE9A 4CYQA 2OR4A 2OZGA 4NF1A 3S6HA 3JRUA 4CAXA 2H5MA 1R61A 5J8CA 5JQ4A 1ARMA 2O28A 2Q7BA 2PJCA 1VKCA 4UWIA 4E0AA 2BOAA 2HROA 4FD7A 2QJ8A 4PK3A 5K8OA 3T0TA 5JPHA 4U9YA 5ISVA 3I74A 5J1QA 4C8UA 4JVOA 2ZW4A 3G8WA 4YFJA 3KL9A 3FB3A 5G21A 3NOJA 3K2KA 3PB7X 4MHNA 2RC4A 3VH9A 4U5YA 1KC7A 4MY3A 2VZZA 3KGQA 4OC3A 4B6ZA 3KR5A 4ZBGA 2B0AA 2R82A 2CXAA 2VQYA 1R57A 2YGWA 2IMOA 2P0WA 2DPSA 2D4OA 3L2NA 1ZLHA 1KBLA 1XOVA 4W9YA 2AFMA 2C6GA 1XJOA 3SR3A 2BL1A 3S6KA 1I12A 5A27A 4TJXA 2REFA 4KLVA 4MY0A 1BO4A 2D4PA 1N71A 1JWQA 4XNHB 4DUKA 3NFQA 4CGPA 3WABA 3SXNA 3DSBA 1YQEA 3BXMA 4NGSA 4OMEA 3JUWA 4JJXA 4MFQA 4MHZA 5AGEA 5DWMA 5F46A 5JM6A 3CXSA 1DIKA 3PT1A 1PYTB 5IR2A 3PRTA 1Z4EA 2VZYA 1UWYA 4QC6A 2J8MA 4RR2B 2PVWA 1IGBA 5HXDA 4KLWA 5EMIA 5BY0A 1JDEA 1Q2YA 1FBVA 3I3GA 1C3OB 1P0HA 1ARLA 1B87A 1NSLA 1BXRB 1V6CA 1IOFA 2AFXA 3IC1A 1M4GA 1VHEA 2Z0ZA 3T5MA 4EWTA 5C88A 1LOKA 3TLGA 2EUIA 1CG2A 5CPAA 5HVFA 4R8FA 4C9RA 3QNVA 4MFJA 2XPLA 4B12A 4JD6A 2OZUA 4ZI6A 1YR0A 2REEA 1Z9UA 4MRIA 3FECA 4Q7AA 4XPDC 4BD9A 4IIYA 1XMBA 4PSXA 4C8FA 2DEAA 2ZW7A 4B5PA 3S9NA 4CDJA 1YW6A 4NGMA 4NCZA 3V8IA 3TOAA 2DLAA 2P6FA 3GB0A 3B3WA 2B4DA 3NH4A 3LODA 1YVHA 4UEFA 4L89A 3LMSA 2B3UA 4EFDA 5FVJA 3D7DA 2QVPA 4MJ8A 5H86A 2B58A 4JXRA 1AUGA 4OLLA 1BPNA 4PXCA 4TNUA 4CAVA 4CS0B 5F09A 4X8IA 3P2FA 1YGHA 2EZAA 1PUAA 3FMCA 4I49A 3TLZA 3TLYA 3TO7A 5DS0A 5HH1A 4CO9A 5K99A 2PJ5A 4OC4A 1S60A 2GANA 2Q4YA 5DWNA 4FAIA 1BLLE 2ARHA 4ZY1A 4FBEA 3IGRA 4C9AA 2KCWA 5E96A 3B7IA 1OZPA 1YK3A 4UIBA 1CX8A 2JDCA 4R6TA 2D0OA 3PBEA 4F8ZA 2PRBA 4XPKA 4YN3A 4F0YA 4OC0A 1Z8TA 5IB0A 5F13A 4AXVA 4ORFA 4C86A 2FM4A 3IWGA 2R1IA 4PSWA 4QUSA 5EBVA 1A2ZA 4AG7A 4KOVA 3IEHA 2GIVA 3BUMB 3B3VA 3TLGB 1YVKA 1EZBA 1FY7A 2PJAA 3P2HA 3T8WA 4RUHA 3PFVA 2ZOGA 3U88C 1HEEA 1EO0A 1M4LA 1R3NA 2O53A 3TLCA 3WT4A 3BLNA 4KOTA 4LQ6A 5F9MA 3TFYA 4AVBA 2IL4A 4G1PA 4IHMA 1AMPA 1KUXA 4CGOA 4MCRA 4NGTA 3C26A 1YVOA 2AJ6A 2Z3KA 5CNPA 1DE4C 5K8PA 4C68A 2B4DB 2ZEEA 3GLJA 4A31A 4CRZB 1RO5A 1Z8LA 3SJEA 3BUWB 1TF8A 3NFZA 4COGA 2Y1NA 3VGOA 2GLFA 1IY7A 2C6CA 1J4JA 4F9VA 4CYPA 2FVGA 2XEJA 2Y0MA 3CPAA 4HPSA 3FJUA 3HLPA 4BBHA 2EK8A 4A33A 2XEFA 3VRQA 5KTAA 1M6VB 4GXHA 3IIBA 3R9FA 2JEVA 4F6AA 4BPUB 1KWMA 2A4NA 3KQXA 3PEIA 4KOYA 4KUAA 1ELLP 4P10A 3SI1A 3LACA 2WYRA 1CJWA 3RNZA 4INJA 4KVOE 2BCOA 2GFQA 2Z3NA 2ZEFA 2Z3LA 3IO1A 3ISZA 3OWCA 2ZEGA 3PGPA 1XRYA 4NJQA 4C99A 4PV6A 1CM0A 4COBA 2PVVA 4MCPA 2OOTA 4MFZA 2HB6A 4GM5A 1BPMA 5IB9A 1I1DA 2PJ7A 4H89A 4HNXB 3D3SA 1VHOA 2MP0A 4CZ1A 1Z8WA 1WK4A 3DNSA 1MJ9A 5D8NA 5GCNA 4ZGYB 3G23A 1ZG8A 2WPXA 5AXIA 4EMEA 1S7FA 5LYIA 2PJ0A 3A9LA 3IJ3A 3PLFB 1H8LA 1Q5XA 3PB4X 3RYOA 3NE7A 2PJ8A 4A4CA 5G22A 3KKWA 3KHXA 1FNOA 1GHEA 1KUVA 1QSMA 5IX3A 1GYTA 4H1HA 4P44A 2R8VA 1Y7RA 3IWEA 4DYOA 1HDUA 5LRKA 1Q7LA 2DXQA 3B3SA 2ZENA 4JYWA 2Z10A 2CNMA 3U1BA 2B3VA 3HPGG 1IYKA 3EFAA 3BUXB 1RXTA 4FWUA 4NFRA 3VWEA 1TIQA 3KRVA 2ODFA 3F9KC 3EC4A 4C2XA 2Z3OA 8CPAA 1IYLA 3RAMA 3VWDA 2ZEMA 4E8OA 2WUUA 1HDQA 4ONUA 1VBGA 2HWGA 4C8AA 3T9YA 3N7ZA 4OC5A 3NH5A 2JEWA 1KUYA 3BHXA 1QSRA 1UFHA 2HV2A 4RN7A 5LYLA 3HUVA 2FE7A 3OP0A 4C2YA 3VROA 3EXNA 4MJXA 3BI1A 4MCSA 2AFUA 5I0CA 2NYQA 2PSWA 3FH4A 2ZELA 3S9LA 4PXEA 4Y49B 1ZG7A 1M4IA 3FRMA 2NSMA 4CGNA 3D66A 2I3CA 4ONWA 4BINA 5BWAB 1L0CA 2PE3A 1Z9EA 2Z3PA 4UEZA 1A9XB 1GGOA 1RTQA 1S3ZA 1WWZA 5AG5A 1QQ9A 4QBJA 2Q43A 2ZEPA 4FD5A 4II9A 4R87A 4C9UA 1NBWA 1M44A 5K8NA 2X0SA 3FBUA 4UCNA 3KZWA 4YU9A 1Q2CA 3HPHE 1TKJA 4OIDA 3H8FA 2YJVA 4MI1A 4UCMA 4A2ZA 3GUXA 3JTKA 3DLJA 4R3LA 4MCQA 1DTDA 4B5OA 3VATA 2ZPAA 1XE4A 2FT0A 3T90A 4NGQA 4MI4A 3EO4A 3PZJA 4PQAA 4C7IA 1JDBC 5JGFA 3E0KA 3FX6A 2CTBA 4MFPA 3S9MA 2FXFA 4NEXA 2QIRA 3KASA 1CE8B 3K9TA 5AG7A 2PIYA 4R7MA 3SHPA 4R3KA 3TOBA 3EZAA 2CF4A 2CBLA 2PQ8A 4ZYQA 2P6EA 1QSOA 4K30A 2RFHA 1Y9WA 2PJBA 2HC9A 2V77A 2AE6A 2PDOA 2YNEA 4MHYA 5G1ZA 3W6XA 3WC7A 3FF3A 1S5KA 3EZBA 4CDKA 4NGPA 1F57A 1I21A 3T07A 1QSNA 2J9AA 3TO6A 2HI6A 2Q51A 4A94A 4C85A 1Y9KA 4NGNA 4BPWB 4JLYA 1SQHA 2ZW5A 2ZXVA 1XIXA 1P4NA 4XPLA 2Z3MA 3DR8A 3LD2A 2ZEOA 2PJ1A 4CAWA 4IK2A 1ZRSA 4XNHC 4PXDA 3QAYA 1K4JA 4PPZA 4R57A 3TLAA 4J0NA 4FUUA 4EVYA 3MGDA 2V8VA 2EZCA 3OB2B 4AVCA 3GIUA 1ZG9A 4A30A 4J3GA 4WJBA 1C30B 1S7LA 2BUEA 3TLEA 3F0AA 2G3AA 4QB9A 1IB1E 3V38A 3W6SA 1B6BA 1IIDA 3SJGA 1CS0B 3DR6A 3B35A 2F8HA 3T05A 3VRNA 3S6FA 4A39A 3EIFA 5HVHA 4AG9A 4MFKA 1Y0YA 4A38A 4KVXA 5LRJA 4NXYA 3TCVA 2I00A 1R43A 4A37A 2IJZA 4A4BA 4E2AA 1S7KA 4X3RA 2WSAA 3GKRA 4KNGE 5KTDA 3O8ZA 3B2YA 2IQ6A 3N5FA 4OC2A 4M85A 2XEGA 4FD6A 3CT9A 2XPNA 1TKFA 1XFOA 1YW4A 5G20A 4OKOA 3FEEA 1VBHA 2ANPA 2DF5A 4HNWB 1X10A 3CPXA 3DDDA 3H8GA 2RB7A 5AG6A 4LX9A 3K4IA 3CDXA 3PBBA 4PK2A 3D2PA 2BO9A 1CPXA 5IV0A 1X12A 3FYNA 3D68A 4F0XA 3KR4A 2GREA 2ZW6A 5CBMA 3CXPA 3IU2A 2AUMA 3C8OA 3F5BA 2JLMA 3NE8A 4C9VA 4UWJA 4MFLA 4NSQA 2UV8G 3D4UA 3ZNIA 3ISXA 2VL1A 3D67A 1LAMA 2G0BA 4KOUA 4UA3A 1M4DA 1EZAA 3PB6X 1YLOA 1LCPA 2CY2A 1ZL0A 2EZBA 5HKWA 3H4QA 1ON0A 5JVLA 4LUAA 1LAPA 4C9EA 2JDDA 5AG4A
chains in the Genus database with same CATH topology
2ZEDA 1Z5RA 2CIJA 4P4BA 4C8CA 3SJXA 2C1CA 3FVLA 4P4JA 3KI9A 4C84A 1TF9A 1CP7A 2ABZA 4P4FA 3NH8A 3ICUA 2G9DA 2C6PA 3WC5A 2PJ2A 5LRGA 1CP6A 4F9UA 1F2OA 1TKHA 5THWA 3BI0A 2PCUA 1Y7EA 2AFSA 2AFZA 2PJ4A 4NGRA 2C5QA 3SI0A 2PRQA 4TWEA 4KSIA 3D7GA 2JBJA 2PJ9A 4C8TA 1CPSA 1EE3P 2POKA 3TX8A 1YSJA 4K3NA 3LWUA 1AYEA 1Z2LA 4YWYA 3KQZA 4MMOA 3D7HA 3MRUA 1QMUA 3PB9X 1YMEA 3SJFA 2V8DA 4X2TA 4OP4A 3V7ZA 2GU2A 4ZX9A 3I6SA 2F7VA 4UEEA 2O4HA 2GP4A 3I1UA 4NJRA 4P45A 4R76A 1LANA 2V8HA 5D29A 1PCAA 4P4IA 1JQGA 3WC6A 5K8MA 1CBXA 5ELYA 5LYFA 2XEIA 1WVMA 3RBUA 6CPAA 5HVGA 3TC8A 4PXBA 2ZOFA 5JH9A 4C8PA 1Y0RA 2ZEHA 3B3TA 3SI2A 4O23A 1XBUA 2V8GA 2PIZA 3B3CA 4CPAA 7CPAA 3FEDA 4MHPA 4OC1A 1VGYA 4DJLA 4ZY0A 1F2PA 4WWVA 1BAVA 2QYVA 3IFEA 4Z65A 3VTAA 3NA6A 3VARA 2EK9A 4MXUA 1Y9ZA 4TJVA 4UF4A 2PJ6A 4ZX8A 2AFOA 4UIAA 3MN8A 1ELMP 2PJ3A 4H2KA 1ZLIA 1LFWA 4OIWA 3RZAA 5LYDA 3KHZA 5I4MA 4P6YA 3PFEA 1NSAA 3PFOA 2CTCA 2WZNA 3D7FA 3IWWA 1TXRA 4IAVA 4P4EA 3H8EA 2AFWA 1FT7A 2Q4ZA 4JZ0A 1VIXA 1XF1A 1OBRA 3DGVA 4P4DA 4LQGA 2GLJA 3PB8X 2JBKA 2EWBA 2OR4A 3JRUA 1ARMA 2PJCA 2BOAA 2QJ8A 5K8OA 3I74A 5J1QA 4C8UA 3KL9A 3K2KA 3PB7X 4MHNA 3VH9A 3KGQA 4OC3A 4B6ZA 3KR5A 2IMOA 3L2NA 1ZLHA 4W9YA 2AFMA 2C6GA 1XJOA 4TJXA 4DUKA 3WABA 4ZY2A 3BXMA 4NGSA 4OMEA 4MHZA 5JM6A 1PYTB 5IR2A 3PRTA 1UWYA 1IGBA 2PVWA 5HXDA 1ARLA 1V6CA 2AFXA 3IC1A 1VHEA 4EWTA 1LOKA 1CG2A 5CPAA 5HVFA 4R8FA 4C9RA 3QNVA 4ZI6A 4MRIA 3FECA 4Q7AA 4BD9A 1XMBA 4C8FA 2DEAA 3S9NA 4CDJA 1YW6A 4NGMA 3GB0A 3B3WA 3NH4A 4UEFA 3LMSA 4EFDA 3D7DA 2QVPA 4PXCA 1BPNA 4TNUA 5F09A 4X8IA 3FMCA 5DS0A 2PJ5A 4OC4A 4FAIA 1BLLE 4ZY1A 4FBEA 4C9AA 3B7IA 4UIBA 1CX8A 4R6TA 3PBEA 4F8ZA 4YN3A 4OC0A 4AXVA 4C86A 3IEHA 3B3VA 2PJAA 3T8WA 4RUHA 2ZOGA 1HEEA 1M4LA 2O53A 1R3NA 3WT4A 4G1PA 4IHMA 1AMPA 4MCRA 4NGTA 1DE4C 5K8PA 2ZEEA 3GLJA 1Z8LA 3SJEA 1TF8A 3NFZA 2GLFA 1IY7A 2C6CA 4F9VA 2FVGA 2XEJA 3CPAA 3FJUA 3HLPA 2EK8A 2XEFA 3IIBA 1KWMA 3KQXA 3PEIA 3SI1A 1ELLP 4P10A 2WYRA 2BCOA 2ZEFA 3ISZA 3IO1A 2ZEGA 1XRYA 4NJQA 4C99A 2PVVA 4MCPA 2OOTA 2HB6A 4GM5A 1BPMA 5IB9A 2PJ7A 1VHOA 5D8NA 1ZG8A 4EMEA 5LYIA 2PJ0A 3IJ3A 1H8LA 3PB4X 2PJ8A 3KHXA 1FNOA 1GYTA 4P44A 4DYOA 1HDUA 5LRKA 1Q7LA 3B3SA 2ZENA 4JYWA 4FWUA 4NFRA 8CPAA 3RAMA 2ZEMA 1HDQA 4C8AA 4OC5A 3NH5A 2JEWA 3BHXA 5LYLA 3HUVA 3BI1A 4MCSA 2AFUA 2NYQA 3FH4A 2ZELA 3S9LA 4PXEA 1ZG7A 2NSMA 3D66A 2I3CA 4ONWA 2PE3A 4UEZA 1RTQA 1QQ9A 2Q43A 2ZEPA 4C9UA 5K8NA 3KZWA 4YU9A 1TKJA 4OIDA 3H8FA 3GUXA 3DLJA 4MCQA 1DTDA 3VATA 4NGQA 4PQAA 5JGFA 3FX6A 2CTBA 3S9MA 3KASA 3K9TA 2PIYA 4R7MA 2CF4A 4ZYQA 2RFHA 4MHYA 2PJBA 2HC9A 2V77A 3WC7A 4CDKA 3FF3A 4NGPA 1F57A 2J9AA 2Q51A 4A94A 4C85A 4NGNA 2ZEOA 2PJ1A 4IK2A 4PXDA 4PPZA 4FUUA 2V8VA 1ZG9A 4WJBA 3V38A 3SJGA 3B35A 2F8HA 4A39A 3EIFA 5HVHA 1Y0YA 4A38A 5LRJA 1R43A 4A37A 2IJZA 4X3RA 4KNGE 3B2YA 2IQ6A 3N5FA 4OC2A 2XEGA 3CT9A 1TKFA 1XFOA 1YW4A 4OKOA 3FEEA 2ANPA 3CPXA 3H8GA 2RB7A 3CDXA 3PBBA 2BO9A 1CPXA 3D68A 3KR4A 2GREA 5CBMA 4C9VA 3D4UA 3ISXA 2VL1A 3D67A 1LAMA 3PB6X 1YLOA 1LCPA 1LAPA 4C9EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZED A;  1Z5R A;  2CIJ A;  4P4B A;  4C8C A;  3SJX A;  2C1C A;  3FVL A;  4P4J A;  3KI9 A;  4C84 A;  1TF9 A;  1CP7 A;  2ABZ A;  4P4F A;  3NH8 A;  3ICU A;  2G9D A;  2C6P A;  3WC5 A;  2PJ2 A;  5LRG A;  1CP6 A;  4F9U A;  1F2O A;  1TKH A;  5THW A;  3BI0 A;  2PCU A;  1Y7E A;  2AFS A;  2AFZ A;  2PJ4 A;  4NGR A;  3SI0 A;  2PRQ A;  4TWE A;  4KSI A;  3D7G A;  2JBJ A;  2PJ9 A;  4C8T A;  1CPS A;  1EE3 P;  2POK A;  3TX8 A;  1YSJ A;  4K3N A;  3LWU A;  1AYE A;  1Z2L A;  4YWY A;  3KQZ A;  4MMO A;  3D7H A;  3MRU A;  1QMU A;  3PB9 X;  1YME A;  3SJF A;  2V8D A;  4X2T A;  4OP4 A;  3V7Z A;  2GU2 A;  4ZX9 A;  3I6S A;  2F7V A;  4UEE A;  2O4H A;  3I1U A;  4NJR A;  4P45 A;  4R76 A;  1LAN A;  2V8H A;  5D29 A;  1PCA A;  4P4I A;  1JQG A;  3WC6 A;  5K8M A;  1CBX A;  5ELY A;  5LYF A;  2XEI A;  1WVM A;  3RBU A;  6CPA A;  5HVG A;  3TC8 A;  4PXB A;  2ZOF A;  5JH9 A;  4C8P A;  1Y0R A;  2ZEH A;  3B3T A;  3SI2 A;  4O23 A;  1XBU A;  2V8G A;  2PIZ A;  3B3C A;  4CPA A;  7CPA A;  3FED A;  4MHP A;  4OC1 A;  1VGY A;  4DJL A;  4ZY0 A;  1F2P A;  4WWV A;  1BAV A;  2QYV A;  3IFE A;  4Z65 A;  3VTA A;  3NA6 A;  3VAR A;  2EK9 A;  4MXU A;  1Y9Z A;  4TJV A;  4UF4 A;  2PJ6 A;  4ZX8 A;  2AFO A;  4UIA A;  3MN8 A;  1ELM P;  2PJ3 A;  4H2K A;  1ZLI A;  1LFW A;  4OIW A;  3RZA A;  5LYD A;  3KHZ A;  5I4M A;  4P6Y A;  3PFE A;  1NSA A;  3PFO A;  2CTC A;  2WZN A;  3D7F A;  3IWW A;  1TXR A;  4IAV A;  4P4E A;  3H8E A;  2AFW A;  1FT7 A;  2Q4Z A;  4JZ0 A;  1VIX A;  1XF1 A;  1OBR A;  3DGV A;  4P4D A;  4LQG A;  2GLJ A;  3PB8 X;  2JBK A;  2EWB A;  2OR4 A;  3JRU A;  1ARM A;  2PJC A;  2BOA A;  2QJ8 A;  5K8O A;  3I74 A;  5J1Q A;  4C8U A;  3KL9 A;  3K2K A;  3PB7 X;  4MHN A;  3VH9 A;  3KGQ A;  4OC3 A;  4B6Z A;  3KR5 A;  2IMO A;  3L2N A;  1ZLH A;  4W9Y A;  2AFM A;  2C6G A;  1XJO A;  4TJX A;  4DUK A;  3WAB A;  4ZY2 A;  3BXM A;  4NGS A;  4OME A;  4MHZ A;  5JM6 A;  1PYT B;  3PRT A;  1UWY A;  1IGB A;  2PVW A;  5HXD A;  1ARL A;  1V6C A;  2AFX A;  3IC1 A;  1VHE A;  4EWT A;  1LOK A;  1CG2 A;  5CPA A;  5HVF A;  4R8F A;  4C9R A;  3QNV A;  4ZI6 A;  4MRI A;  3FEC A;  4Q7A A;  4BD9 A;  1XMB A;  4C8F A;  2DEA A;  3S9N A;  4CDJ A;  1YW6 A;  4NGM A;  3GB0 A;  3B3W A;  3NH4 A;  4UEF A;  3LMS A;  4EFD A;  3D7D A;  2QVP A;  4PXC A;  1BPN A;  4TNU A;  5F09 A;  4X8I A;  3FMC A;  5DS0 A;  2PJ5 A;  4OC4 A;  4FAI A;  1BLL E;  4ZY1 A;  4FBE A;  4C9A A;  3B7I A;  4UIB A;  1CX8 A;  4R6T A;  3PBE A;  4F8Z A;  4YN3 A;  4OC0 A;  4AXV A;  4C86 A;  3IEH A;  3B3V A;  2PJA A;  3T8W A;  4RUH A;  2ZOG A;  1HEE A;  1M4L A;  2O53 A;  1R3N A;  3WT4 A;  4G1P A;  4IHM A;  1AMP A;  4MCR A;  4NGT A;  1DE4 C;  5K8P A;  2ZEE A;  3GLJ A;  1Z8L A;  3SJE A;  1TF8 A;  3NFZ A;  2GLF A;  1IY7 A;  2C6C A;  4F9V A;  2FVG A;  2XEJ A;  3CPA A;  3FJU A;  3HLP A;  2EK8 A;  2XEF A;  3IIB A;  1KWM A;  3KQX A;  3PEI A;  3SI1 A;  1ELL P;  4P10 A;  2WYR A;  2BCO A;  2ZEF A;  3ISZ A;  3IO1 A;  2ZEG A;  1XRY A;  4NJQ A;  4C99 A;  2PVV A;  4MCP A;  2OOT A;  2HB6 A;  4GM5 A;  1BPM A;  5IB9 A;  2PJ7 A;  1VHO A;  5D8N A;  1ZG8 A;  4EME A;  5LYI A;  2PJ0 A;  3IJ3 A;  1H8L A;  3PB4 X;  2PJ8 A;  3KHX A;  1FNO A;  1GYT A;  4P44 A;  4DYO A;  1HDU A;  5LRK A;  1Q7L A;  3B3S A;  2ZEN A;  4JYW A;  4FWU A;  4NFR A;  8CPA A;  3RAM A;  2ZEM A;  1HDQ A;  4C8A A;  4OC5 A;  3NH5 A;  2JEW A;  3BHX A;  5LYL A;  3HUV A;  3BI1 A;  4MCS A;  2AFU A;  2NYQ A;  3FH4 A;  2ZEL A;  3S9L A;  4PXE A;  1ZG7 A;  2NSM A;  3D66 A;  2I3C A;  4ONW A;  2PE3 A;  4UEZ A;  1RTQ A;  1QQ9 A;  2Q43 A;  2ZEP A;  4C9U A;  5K8N A;  3KZW A;  4YU9 A;  1TKJ A;  4OID A;  3H8F A;  3GUX A;  3DLJ A;  4MCQ A;  1DTD A;  3VAT A;  4NGQ A;  4PQA A;  5JGF A;  3FX6 A;  2CTB A;  3S9M A;  3KAS A;  3K9T A;  2PIY A;  4R7M A;  2CF4 A;  4ZYQ A;  2RFH A;  4MHY A;  2PJB A;  2HC9 A;  2V77 A;  3WC7 A;  4CDK A;  3FF3 A;  4NGP A;  1F57 A;  2J9A A;  2Q51 A;  4A94 A;  4C85 A;  4NGN A;  2ZEO A;  2PJ1 A;  4IK2 A;  4PXD A;  4PPZ A;  4FUU A;  2V8V A;  1ZG9 A;  4WJB A;  3V38 A;  3SJG A;  3B35 A;  2F8H A;  4A39 A;  3EIF A;  5HVH A;  1Y0Y A;  4A38 A;  5LRJ A;  1R43 A;  4A37 A;  2IJZ A;  4X3R A;  4KNG E;  3B2Y A;  2IQ6 A;  3N5F A;  4OC2 A;  2XEG A;  3CT9 A;  1TKF A;  1XFO A;  1YW4 A;  4OKO A;  3FEE A;  2ANP A;  3CPX A;  3H8G A;  2RB7 A;  3CDX A;  3PBB A;  2BO9 A;  1CPX A;  3D68 A;  3KR4 A;  2GRE A;  5CBM A;  4C9V A;  3D4U A;  3ISX A;  2VL1 A;  3D67 A;  1LAM A;  3PB6 X;  1YLO A;  1LCP A;  1LAP A;  4C9E A; 
#chains in the Genus database with same CATH topology
 2N3A B;  2ZED A;  3R9G A;  3IU1 A;  1Z5R A;  2BEI A;  2FS5 A;  2CIJ A;  4P4B A;  1MJA A;  3TTH A;  1VI4 A;  4C8C A;  3SJX A;  3TO9 A;  2EBJ A;  2VI7 A;  2FL4 A;  2C1C A;  3FVL A;  4IUS A;  4P4J A;  1BOB A;  1IIC A;  3KI9 A;  4E5S A;  4C84 A;  1TF9 A;  2BSW A;  1CP7 A;  2ABZ A;  2J8R A;  4P4F A;  3NH8 A;  5H84 A;  3ICU A;  3OAK A;  2G9D A;  2C6P A;  2CNT A;  2OH1 A;  3WC5 A;  4CGL A;  2PJ2 A;  5LRG A;  2OB0 A;  4CGM A;  4R9M A;  1CP6 A;  4F9U A;  1F2O A;  1TKH A;  5THW A;  3W91 A;  3ZZI A;  3BI0 A;  1YX0 A;  2Y1M A;  2J8N A;  2PCU A;  1Y7E A;  2AFS A;  2AFZ A;  2PJ4 A;  2PR1 A;  4XPD B;  4Q36 A;  2EO8 A;  4NGR A;  2OU2 A;  2CNS A;  3QAH A;  3JVN A;  2C5Q A;  2Z11 A;  3OB1 B;  4KVM E;  4MHD A;  3SI0 A;  2OZH A;  4HNY B;  1ZYM A;  4UBR A;  1VHS A;  2PRQ A;  3EY5 A;  4CAE A;  4TWE A;  4KSI A;  4X5K A;  3GY9 A;  3D7G A;  2JBJ A;  2OLS A;  5JYB A;  2PJ9 A;  2F5I A;  4C8T A;  4ZY2 A;  4OAE A;  1CPS A;  1EE3 P;  4C7H A;  4B10 A;  2POK A;  3TX8 A;  4KSF A;  2HUZ A;  1YSJ A;  2FIW A;  2YNC A;  4K3N A;  1KZF A;  2EVN A;  4KOR A;  1XMT A;  3S6G A;  4KOW A;  4AB7 A;  1KEE B;  2AUN A;  3SXO A;  3BJ8 A;  3VRR A;  1XEB A;  1AYE A;  2Q04 A;  3LWU A;  4KOX A;  1V0C A;  1Z2L A;  4YWY A;  3KQZ A;  4JXQ A;  1T36 B;  4MMO A;  3D7H A;  3GJZ A;  2R98 A;  1QMU A;  3MRU A;  3PB9 X;  1YME A;  3SJF A;  2V8D A;  3CXQ A;  5EC4 A;  3FXT A;  4OP4 A;  3GYA A;  4X2T A;  3V7Z A;  2GU2 A;  4ZX9 A;  5J8F A;  3I6S A;  2GE3 A;  2F7V A;  4Q38 A;  1LRZ A;  4UEE A;  2O4H A;  3BUO B;  2GP4 A;  2XPP A;  3I1U A;  4NJR A;  4OAD A;  4IIX A;  4P45 A;  3RO0 A;  2D0P A;  4B14 A;  3K9U A;  4R76 A;  2HQY A;  3R1K A;  5F47 A;  4EYS A;  3EZE A;  1LAN A;  2V8H A;  4M6G A;  5D29 A;  2B5G A;  4B11 A;  1PCA A;  1NMT A;  3BUN B;  4M3S A;  4P4I A;  4CRY B;  1JQG A;  3WC6 A;  2NMT A;  5C82 A;  5K8M A;  1CBX A;  5ELY A;  1Q2D A;  4RI1 A;  5LYF A;  2XEI A;  5FD8 A;  3ZJ0 A;  1WVM A;  5F49 A;  3RBU A;  4BTF A;  4CYN A;  2VXK A;  6CPA A;  5HVG A;  3TT2 A;  3TC8 A;  4PXB A;  2ZOF A;  5JH9 A;  4C8P A;  4DNC A;  1Y0R A;  2QEC A;  4MBU A;  4KOS A;  2ZEH A;  5A28 A;  3B3T A;  4A32 A;  3QB8 A;  4CAF A;  3HMJ G;  3SI2 A;  1J3L A;  5J3X A;  2ATR A;  4O23 A;  1XBU A;  2V8G A;  3WR7 A;  4E94 A;  5HKZ A;  1B47 A;  2PIZ A;  3D8P A;  3H5Z A;  4Y49 C;  3B3C A;  3PP9 A;  4B13 A;  4CPA A;  7CPA A;  4UCP A;  2I79 A;  4KUB A;  4U9Z A;  3UY5 A;  3FED A;  4MHP A;  4BMH A;  1WJT A;  3VRP A;  1Z8X A;  5HKY A;  4OC1 A;  1VGY A;  3B8G A;  4FD4 A;  4H6U A;  5HMN A;  4M6I A;  3TYX A;  2WPW A;  4DJL A;  4ZY0 A;  4UFV A;  1F2P A;  1IU8 A;  2Q0Y A;  4WWV A;  4YRH A;  1BAV A;  4QVT A;  4BPX B;  2QYV A;  3IFE A;  4Z65 A;  3NA6 A;  3TE4 A;  4KSA A;  3VAR A;  5KTC A;  3VTA A;  5F1Y A;  1YRE A;  2EK9 A;  4MXU A;  3R9E A;  4JWP A;  3I9S A;  1Y9Z A;  4TJV A;  4UF4 A;  2PJ6 A;  4ZX8 A;  4GS4 A;  2AFO A;  4UIA A;  2FSR A;  3MN8 A;  2DIK A;  1MK4 A;  4UFW A;  2B5G B;  2R7H A;  1ELM P;  2PJ3 A;  4H2K A;  4IF5 A;  1ZLI A;  2B4J C;  2K5T A;  2E28 A;  2PCN A;  4RS2 A;  1LFW A;  4M6H A;  2X7B A;  4OIW A;  1IOI A;  3RZA A;  1NXJ A;  2PR8 A;  4CYO A;  5LYD A;  3BJ7 A;  4HKF A;  3KHZ A;  4B5P B;  5I4M A;  4C2Z A;  4P6Y A;  2YJT A;  5F48 A;  3PFE A;  1NSA A;  3PFO A;  1YLE A;  1M1D A;  1QST A;  3FNC A;  3R96 A;  2CTC A;  2FIA A;  2WZN A;  3D7F A;  3IWW A;  1U6M A;  2B4B A;  2Q4V A;  1MJB A;  1TXR A;  4KZT A;  4IAV A;  5F5X A;  2Q7S A;  4P4E A;  2PC1 A;  4H6Z A;  3H8E A;  4L8A A;  2XPO A;  2AFW A;  1FT7 A;  2FCK A;  4AVA A;  4M8D A;  1Z4R A;  2DPT A;  4A95 A;  2QML A;  2YNC C;  3F8K A;  2Q4Z A;  3CZX A;  1XF8 A;  4JZ0 A;  1ZO0 A;  2G3T A;  1VIX A;  2VBQ A;  1OBR A;  1XF1 A;  2YND A;  3DGV A;  3R95 A;  1S7N A;  4P4D A;  2Q44 A;  3TLB A;  2VEZ A;  2P6G A;  2VKZ G;  4LQG A;  4YGO A;  4UFX A;  3FIX A;  3G3S A;  2C27 A;  2GLJ A;  3D2M A;  4GPL B;  3PB8 X;  1PU9 A;  2JBK A;  4KS9 A;  2EWB A;  1NE9 A;  4CYQ A;  2OR4 A;  2OZG A;  4NF1 A;  3S6H A;  3JRU A;  4CAX A;  2H5M A;  1R61 A;  5J8C A;  5JQ4 A;  1ARM A;  2O28 A;  2Q7B A;  2PJC A;  1VKC A;  4UWI A;  4E0A A;  2BOA A;  2HRO A;  4FD7 A;  2QJ8 A;  4PK3 A;  5K8O A;  3T0T A;  5JPH A;  4U9Y A;  5ISV A;  3I74 A;  5J1Q A;  4C8U A;  4JVO A;  2ZW4 A;  3G8W A;  4YFJ A;  3KL9 A;  3FB3 A;  5G21 A;  3NOJ A;  3K2K A;  3PB7 X;  4MHN A;  2RC4 A;  3VH9 A;  4U5Y A;  1KC7 A;  4MY3 A;  2VZZ A;  3KGQ A;  4OC3 A;  4B6Z A;  3KR5 A;  4ZBG A;  2B0A A;  2R82 A;  2CXA A;  2VQY A;  1R57 A;  2YGW A;  2IMO A;  2P0W A;  2DPS A;  2D4O A;  3L2N A;  1ZLH A;  1KBL A;  1XOV A;  4W9Y A;  2AFM A;  2C6G A;  1XJO A;  3SR3 A;  2BL1 A;  3S6K A;  1I12 A;  5A27 A;  4TJX A;  2REF A;  4KLV A;  4MY0 A;  1BO4 A;  2D4P A;  1N71 A;  1JWQ A;  4XNH B;  4DUK A;  3NFQ A;  4CGP A;  3WAB A;  3SXN A;  3DSB A;  1YQE A;  3BXM A;  4NGS A;  4OME A;  3JUW A;  4JJX A;  4MFQ A;  4MHZ A;  5AGE A;  5DWM A;  5F46 A;  5JM6 A;  3CXS A;  1DIK A;  3PT1 A;  1PYT B;  5IR2 A;  3PRT A;  1Z4E A;  2VZY A;  1UWY A;  4QC6 A;  2J8M A;  4RR2 B;  2PVW A;  1IGB A;  5HXD A;  4KLW A;  5EMI A;  5BY0 A;  1JDE A;  1Q2Y A;  1FBV A;  3I3G A;  1C3O B;  1P0H A;  1ARL A;  1B87 A;  1NSL A;  1BXR B;  1V6C A;  1IOF A;  2AFX A;  3IC1 A;  1M4G A;  1VHE A;  2Z0Z A;  3T5M A;  4EWT A;  5C88 A;  1LOK A;  3TLG A;  2EUI A;  1CG2 A;  5CPA A;  5HVF A;  4R8F A;  4C9R A;  3QNV A;  4MFJ A;  2XPL A;  4B12 A;  4JD6 A;  2OZU A;  4ZI6 A;  1YR0 A;  2REE A;  1Z9U A;  4MRI A;  3FEC A;  4Q7A A;  4XPD C;  4BD9 A;  4IIY A;  1XMB A;  4PSX A;  4C8F A;  2DEA A;  2ZW7 A;  4B5P A;  3S9N A;  4CDJ A;  1YW6 A;  4NGM A;  4NCZ A;  3V8I A;  3TOA A;  2DLA A;  2P6F A;  3GB0 A;  3B3W A;  2B4D A;  3NH4 A;  3LOD A;  1YVH A;  4UEF A;  4L89 A;  3LMS A;  2B3U A;  4EFD A;  5FVJ A;  3D7D A;  2QVP A;  4MJ8 A;  5H86 A;  2B58 A;  4JXR A;  1AUG A;  4OLL A;  1BPN A;  4PXC A;  4TNU A;  4CAV A;  4CS0 B;  5F09 A;  4X8I A;  3P2F A;  1YGH A;  2EZA A;  1PUA A;  3FMC A;  4I49 A;  3TLZ A;  3TLY A;  3TO7 A;  5DS0 A;  5HH1 A;  4CO9 A;  5K99 A;  2PJ5 A;  4OC4 A;  1S60 A;  2GAN A;  2Q4Y A;  5DWN A;  4FAI A;  1BLL E;  2ARH A;  4ZY1 A;  4FBE A;  3IGR A;  4C9A A;  2KCW A;  5E96 A;  3B7I A;  1OZP A;  1YK3 A;  4UIB A;  1CX8 A;  2JDC A;  4R6T A;  2D0O A;  3PBE A;  4F8Z A;  2PRB A;  4XPK A;  4YN3 A;  4F0Y A;  4OC0 A;  1Z8T A;  5IB0 A;  5F13 A;  4AXV A;  4ORF A;  4C86 A;  2FM4 A;  3IWG A;  2R1I A;  4PSW A;  4QUS A;  5EBV A;  1A2Z A;  4AG7 A;  4KOV A;  3IEH A;  2GIV A;  3BUM B;  3B3V A;  3TLG B;  1YVK A;  1EZB A;  1FY7 A;  2PJA A;  3P2H A;  3T8W A;  4RUH A;  3PFV A;  2ZOG A;  3U88 C;  1HEE A;  1EO0 A;  1M4L A;  1R3N A;  2O53 A;  3TLC A;  3WT4 A;  3BLN A;  4KOT A;  4LQ6 A;  5F9M A;  3TFY A;  4AVB A;  2IL4 A;  4G1P A;  4IHM A;  1AMP A;  1KUX A;  4CGO A;  4MCR A;  4NGT A;  3C26 A;  1YVO A;  2AJ6 A;  2Z3K A;  5CNP A;  1DE4 C;  5K8P A;  4C68 A;  2B4D B;  2ZEE A;  3GLJ A;  4A31 A;  4CRZ B;  1RO5 A;  1Z8L A;  3SJE A;  3BUW B;  1TF8 A;  3NFZ A;  4COG A;  2Y1N A;  3VGO A;  2GLF A;  1IY7 A;  2C6C A;  1J4J A;  4F9V A;  4CYP A;  2FVG A;  2XEJ A;  2Y0M A;  3CPA A;  4HPS A;  3FJU A;  3HLP A;  4BBH A;  2EK8 A;  4A33 A;  2XEF A;  3VRQ A;  5KTA A;  1M6V B;  4GXH A;  3IIB A;  3R9F A;  2JEV A;  4F6A A;  4BPU B;  1KWM A;  2A4N A;  3KQX A;  3PEI A;  4KOY A;  4KUA A;  1ELL P;  4P10 A;  3SI1 A;  3LAC A;  2WYR A;  1CJW A;  3RNZ A;  4INJ A;  4KVO E;  2BCO A;  2GFQ A;  2Z3N A;  2ZEF A;  2Z3L A;  3IO1 A;  3ISZ A;  3OWC A;  2ZEG A;  3PGP A;  1XRY A;  4NJQ A;  4C99 A;  4PV6 A;  1CM0 A;  4COB A;  2PVV A;  4MCP A;  2OOT A;  4MFZ A;  2HB6 A;  4GM5 A;  1BPM A;  5IB9 A;  1I1D A;  2PJ7 A;  4H89 A;  4HNX B;  3D3S A;  1VHO A;  2MP0 A;  4CZ1 A;  1Z8W A;  1WK4 A;  3DNS A;  1MJ9 A;  5D8N A;  5GCN A;  4ZGY B;  3G23 A;  1ZG8 A;  2WPX A;  5AXI A;  4EME A;  1S7F A;  5LYI A;  2PJ0 A;  3A9L A;  3IJ3 A;  3PLF B;  1H8L A;  1Q5X A;  3PB4 X;  3RYO A;  3NE7 A;  2PJ8 A;  4A4C A;  5G22 A;  3KKW A;  3KHX A;  1FNO A;  1GHE A;  1KUV A;  1QSM A;  5IX3 A;  1GYT A;  4H1H A;  4P44 A;  2R8V A;  1Y7R A;  3IWE A;  4DYO A;  1HDU A;  5LRK A;  1Q7L A;  2DXQ A;  3B3S A;  2ZEN A;  4JYW A;  2Z10 A;  2CNM A;  3U1B A;  2B3V A;  3HPG G;  1IYK A;  3EFA A;  3BUX B;  1RXT A;  4FWU A;  4NFR A;  3VWE A;  1TIQ A;  3KRV A;  2ODF A;  3F9K C;  3EC4 A;  4C2X A;  2Z3O A;  8CPA A;  1IYL A;  3RAM A;  3VWD A;  2ZEM A;  4E8O A;  2WUU A;  1HDQ A;  4ONU A;  1VBG A;  2HWG A;  4C8A A;  3T9Y A;  3N7Z A;  4OC5 A;  3NH5 A;  2JEW A;  1KUY A;  3BHX A;  1QSR A;  1UFH A;  2HV2 A;  4RN7 A;  5LYL A;  3HUV A;  2FE7 A;  3OP0 A;  4C2Y A;  3VRO A;  3EXN A;  4MJX A;  3BI1 A;  4MCS A;  2AFU A;  5I0C A;  2NYQ A;  2PSW A;  3FH4 A;  2ZEL A;  3S9L A;  4PXE A;  4Y49 B;  1ZG7 A;  1M4I A;  3FRM A;  2NSM A;  4CGN A;  3D66 A;  2I3C A;  4ONW A;  4BIN A;  5BWA B;  1L0C A;  2PE3 A;  1Z9E A;  2Z3P A;  4UEZ A;  1A9X B;  1GGO A;  1RTQ A;  1S3Z A;  1WWZ A;  5AG5 A;  1QQ9 A;  4QBJ A;  2Q43 A;  2ZEP A;  4FD5 A;  4II9 A;  4R87 A;  4C9U A;  1NBW A;  1M44 A;  5K8N A;  2X0S A;  3FBU A;  4UCN A;  3KZW A;  4YU9 A;  1Q2C A;  3HPH E;  1TKJ A;  4OID A;  3H8F A;  2YJV A;  4MI1 A;  4UCM A;  4A2Z A;  3GUX A;  3JTK A;  3DLJ A;  4R3L A;  4MCQ A;  1DTD A;  4B5O A;  3VAT A;  2ZPA A;  1XE4 A;  2FT0 A;  3T90 A;  4NGQ A;  4MI4 A;  3EO4 A;  3PZJ A;  4PQA A;  4C7I A;  1JDB C;  5JGF A;  3E0K A;  3FX6 A;  2CTB A;  4MFP A;  3S9M A;  2FXF A;  4NEX A;  2QIR A;  3KAS A;  1CE8 B;  3K9T A;  5AG7 A;  2PIY A;  4R7M A;  3SHP A;  4R3K A;  3TOB A;  3EZA A;  2CF4 A;  2CBL A;  2PQ8 A;  4ZYQ A;  2P6E A;  1QSO A;  4K30 A;  2RFH A;  1Y9W A;  2PJB A;  2HC9 A;  2V77 A;  2AE6 A;  2PDO A;  2YNE A;  4MHY A;  5G1Z A;  3W6X A;  3WC7 A;  3FF3 A;  1S5K A;  3EZB A;  4CDK A;  4NGP A;  1F57 A;  1I21 A;  3T07 A;  1QSN A;  2J9A A;  3TO6 A;  2HI6 A;  2Q51 A;  4A94 A;  4C85 A;  1Y9K A;  4NGN A;  4BPW B;  4JLY A;  1SQH A;  2ZW5 A;  2ZXV A;  1XIX A;  1P4N A;  4XPL A;  2Z3M A;  3DR8 A;  3LD2 A;  2ZEO A;  2PJ1 A;  4CAW A;  4IK2 A;  1ZRS A;  4XNH C;  4PXD A;  3QAY A;  1K4J A;  4PPZ A;  4R57 A;  3TLA A;  4J0N A;  4FUU A;  4EVY A;  3MGD A;  2V8V A;  2EZC A;  3OB2 B;  4AVC A;  3GIU A;  1ZG9 A;  4A30 A;  4J3G A;  4WJB A;  1C30 B;  1S7L A;  2BUE A;  3TLE A;  3F0A A;  2G3A A;  4QB9 A;  1IB1 E;  3V38 A;  3W6S A;  1B6B A;  1IID A;  3SJG A;  1CS0 B;  3DR6 A;  3B35 A;  2F8H A;  3T05 A;  3VRN A;  3S6F A;  4A39 A;  3EIF A;  5HVH A;  4AG9 A;  4MFK A;  1Y0Y A;  4A38 A;  4KVX A;  5LRJ A;  4NXY A;  3TCV A;  2I00 A;  1R43 A;  4A37 A;  2IJZ A;  4A4B A;  4E2A A;  1S7K A;  4X3R A;  2WSA A;  3GKR A;  4KNG E;  5KTD A;  3O8Z A;  3B2Y A;  2IQ6 A;  3N5F A;  4OC2 A;  4M85 A;  2XEG A;  4FD6 A;  3CT9 A;  2XPN A;  1TKF A;  1XFO A;  1YW4 A;  5G20 A;  4OKO A;  3FEE A;  1VBH A;  2ANP A;  2DF5 A;  4HNW B;  1X10 A;  3CPX A;  3DDD A;  3H8G A;  2RB7 A;  5AG6 A;  4LX9 A;  3K4I A;  3CDX A;  3PBB A;  4PK2 A;  3D2P A;  2BO9 A;  1CPX A;  5IV0 A;  1X12 A;  3FYN A;  3D68 A;  4F0X A;  3KR4 A;  2GRE A;  2ZW6 A;  5CBM A;  3CXP A;  3IU2 A;  2AUM A;  3C8O A;  3F5B A;  2JLM A;  3NE8 A;  4C9V A;  4UWJ A;  4MFL A;  4NSQ A;  2UV8 G;  3D4U A;  3ZNI A;  3ISX A;  2VL1 A;  3D67 A;  1LAM A;  2G0B A;  4KOU A;  4UA3 A;  1M4D A;  1EZA A;  3PB6 X;  1YLO A;  1LCP A;  2CY2 A;  1ZL0 A;  2EZB A;  5HKW A;  3H4Q A;  1ON0 A;  5JVL A;  4LUA A;  1LAP A;  4C9E A;  2JDD A;  5AG4 A; 
#chains in the Genus database with same CATH homology
 2ZED A;  1Z5R A;  2CIJ A;  4P4B A;  4C8C A;  3SJX A;  2C1C A;  3FVL A;  4P4J A;  3KI9 A;  4C84 A;  1TF9 A;  1CP7 A;  2ABZ A;  4P4F A;  3NH8 A;  3ICU A;  2G9D A;  2C6P A;  3WC5 A;  2PJ2 A;  5LRG A;  1CP6 A;  4F9U A;  1F2O A;  1TKH A;  5THW A;  3BI0 A;  2PCU A;  1Y7E A;  2AFS A;  2AFZ A;  2PJ4 A;  4NGR A;  2C5Q A;  3SI0 A;  2PRQ A;  4TWE A;  4KSI A;  3D7G A;  2JBJ A;  2PJ9 A;  4C8T A;  1CPS A;  1EE3 P;  2POK A;  3TX8 A;  1YSJ A;  4K3N A;  3LWU A;  1AYE A;  1Z2L A;  4YWY A;  3KQZ A;  4MMO A;  3D7H A;  3MRU A;  1QMU A;  3PB9 X;  1YME A;  3SJF A;  2V8D A;  4X2T A;  4OP4 A;  3V7Z A;  2GU2 A;  4ZX9 A;  3I6S A;  2F7V A;  4UEE A;  2O4H A;  2GP4 A;  3I1U A;  4NJR A;  4P45 A;  4R76 A;  1LAN A;  2V8H A;  5D29 A;  1PCA A;  4P4I A;  1JQG A;  3WC6 A;  5K8M A;  1CBX A;  5ELY A;  5LYF A;  2XEI A;  1WVM A;  3RBU A;  6CPA A;  5HVG A;  3TC8 A;  4PXB A;  2ZOF A;  5JH9 A;  4C8P A;  1Y0R A;  2ZEH A;  3B3T A;  3SI2 A;  4O23 A;  1XBU A;  2V8G A;  2PIZ A;  3B3C A;  4CPA A;  7CPA A;  3FED A;  4MHP A;  4OC1 A;  1VGY A;  4DJL A;  4ZY0 A;  1F2P A;  4WWV A;  1BAV A;  2QYV A;  3IFE A;  4Z65 A;  3VTA A;  3NA6 A;  3VAR A;  2EK9 A;  4MXU A;  1Y9Z A;  4TJV A;  4UF4 A;  2PJ6 A;  4ZX8 A;  2AFO A;  4UIA A;  3MN8 A;  1ELM P;  2PJ3 A;  4H2K A;  1ZLI A;  1LFW A;  4OIW A;  3RZA A;  5LYD A;  3KHZ A;  5I4M A;  4P6Y A;  3PFE A;  1NSA A;  3PFO A;  2CTC A;  2WZN A;  3D7F A;  3IWW A;  1TXR A;  4IAV A;  4P4E A;  3H8E A;  2AFW A;  1FT7 A;  2Q4Z A;  4JZ0 A;  1VIX A;  1XF1 A;  1OBR A;  3DGV A;  4P4D A;  4LQG A;  2GLJ A;  3PB8 X;  2JBK A;  2EWB A;  2OR4 A;  3JRU A;  1ARM A;  2PJC A;  2BOA A;  2QJ8 A;  5K8O A;  3I74 A;  5J1Q A;  4C8U A;  3KL9 A;  3K2K A;  3PB7 X;  4MHN A;  3VH9 A;  3KGQ A;  4OC3 A;  4B6Z A;  3KR5 A;  2IMO A;  3L2N A;  1ZLH A;  4W9Y A;  2AFM A;  2C6G A;  1XJO A;  4TJX A;  4DUK A;  3WAB A;  4ZY2 A;  3BXM A;  4NGS A;  4OME A;  4MHZ A;  5JM6 A;  1PYT B;  5IR2 A;  3PRT A;  1UWY A;  1IGB A;  2PVW A;  5HXD A;  1ARL A;  1V6C A;  2AFX A;  3IC1 A;  1VHE A;  4EWT A;  1LOK A;  1CG2 A;  5CPA A;  5HVF A;  4R8F A;  4C9R A;  3QNV A;  4ZI6 A;  4MRI A;  3FEC A;  4Q7A A;  4BD9 A;  1XMB A;  4C8F A;  2DEA A;  3S9N A;  4CDJ A;  1YW6 A;  4NGM A;  3GB0 A;  3B3W A;  3NH4 A;  4UEF A;  3LMS A;  4EFD A;  3D7D A;  2QVP A;  4PXC A;  1BPN A;  4TNU A;  5F09 A;  4X8I A;  3FMC A;  5DS0 A;  2PJ5 A;  4OC4 A;  4FAI A;  1BLL E;  4ZY1 A;  4FBE A;  4C9A A;  3B7I A;  4UIB A;  1CX8 A;  4R6T A;  3PBE A;  4F8Z A;  4YN3 A;  4OC0 A;  4AXV A;  4C86 A;  3IEH A;  3B3V A;  2PJA A;  3T8W A;  4RUH A;  2ZOG A;  1HEE A;  1M4L A;  2O53 A;  1R3N A;  3WT4 A;  4G1P A;  4IHM A;  1AMP A;  4MCR A;  4NGT A;  1DE4 C;  5K8P A;  2ZEE A;  3GLJ A;  1Z8L A;  3SJE A;  1TF8 A;  3NFZ A;  2GLF A;  1IY7 A;  2C6C A;  4F9V A;  2FVG A;  2XEJ A;  3CPA A;  3FJU A;  3HLP A;  2EK8 A;  2XEF A;  3IIB A;  1KWM A;  3KQX A;  3PEI A;  3SI1 A;  1ELL P;  4P10 A;  2WYR A;  2BCO A;  2ZEF A;  3ISZ A;  3IO1 A;  2ZEG A;  1XRY A;  4NJQ A;  4C99 A;  2PVV A;  4MCP A;  2OOT A;  2HB6 A;  4GM5 A;  1BPM A;  5IB9 A;  2PJ7 A;  1VHO A;  5D8N A;  1ZG8 A;  4EME A;  5LYI A;  2PJ0 A;  3IJ3 A;  1H8L A;  3PB4 X;  2PJ8 A;  3KHX A;  1FNO A;  1GYT A;  4P44 A;  4DYO A;  1HDU A;  5LRK A;  1Q7L A;  3B3S A;  2ZEN A;  4JYW A;  4FWU A;  4NFR A;  8CPA A;  3RAM A;  2ZEM A;  1HDQ A;  4C8A A;  4OC5 A;  3NH5 A;  2JEW A;  3BHX A;  5LYL A;  3HUV A;  3BI1 A;  4MCS A;  2AFU A;  2NYQ A;  3FH4 A;  2ZEL A;  3S9L A;  4PXE A;  1ZG7 A;  2NSM A;  3D66 A;  2I3C A;  4ONW A;  2PE3 A;  4UEZ A;  1RTQ A;  1QQ9 A;  2Q43 A;  2ZEP A;  4C9U A;  5K8N A;  3KZW A;  4YU9 A;  1TKJ A;  4OID A;  3H8F A;  3GUX A;  3DLJ A;  4MCQ A;  1DTD A;  3VAT A;  4NGQ A;  4PQA A;  5JGF A;  3FX6 A;  2CTB A;  3S9M A;  3KAS A;  3K9T A;  2PIY A;  4R7M A;  2CF4 A;  4ZYQ A;  2RFH A;  4MHY A;  2PJB A;  2HC9 A;  2V77 A;  3WC7 A;  4CDK A;  3FF3 A;  4NGP A;  1F57 A;  2J9A A;  2Q51 A;  4A94 A;  4C85 A;  4NGN A;  2ZEO A;  2PJ1 A;  4IK2 A;  4PXD A;  4PPZ A;  4FUU A;  2V8V A;  1ZG9 A;  4WJB A;  3V38 A;  3SJG A;  3B35 A;  2F8H A;  4A39 A;  3EIF A;  5HVH A;  1Y0Y A;  4A38 A;  5LRJ A;  1R43 A;  4A37 A;  2IJZ A;  4X3R A;  4KNG E;  3B2Y A;  2IQ6 A;  3N5F A;  4OC2 A;  2XEG A;  3CT9 A;  1TKF A;  1XFO A;  1YW4 A;  4OKO A;  3FEE A;  2ANP A;  3CPX A;  3H8G A;  2RB7 A;  3CDX A;  3PBB A;  2BO9 A;  1CPX A;  3D68 A;  3KR4 A;  2GRE A;  5CBM A;  4C9V A;  3D4U A;  3ISX A;  2VL1 A;  3D67 A;  1LAM A;  3PB6 X;  1YLO A;  1LCP A;  1LAP A;  4C9E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...