2OSLA

Crystal structure of rituximab fab in complex with an epitope peptide
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
221
structure length
221
Chain Sequence
QVQLQQPGAELVKPGASVKMSCKASGYTFTSYNMHWVKQTPGRGLEWIGAIYPGNGDTSYNQKFKGKATLTADKSSSTAYMQLSSLTSEDSAVYYCARSTYYGGDWYFNVWGAGTTVTVSAASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords light chain of the Rituximab Fab fragment
publication title Structural basis for recognition of CD20 by therapeutic antibody Rituximab
pubmed doi rcsb
source organism Homo sapiens, mus musculus
molecule tags Immune system
total genus 42
structure length 221
sequence length 221
chains with identical sequence H
ec nomenclature
pdb deposition date 2007-02-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2oslA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2oslA02
4LCWD 5BV7H 3WBDA 4Q7DA 2NXZD 4P4KC 4G9FB 2I9LB 1AKJA 1FO0H 1KNOA 3SE4A 3IFOB 3A6BL 3T2NL 1KJVB 2QSCH 1IGTA 1CG9A 3EKCA 5FYKD 4I18A 3ROLB 2X5PA 4GMTL 1DBJL 4LHUB 5DVKA 5I8OH 4AEFA 1B0GB 1WIPA 5HHOA 3KVQA 1U95A 3O3EB 3VFPA 5BS0D 5T33L 3GMPA 3NPSC 1JNLH 3D3VD 3MFFA 2PO6A 4PJCB 1Z0NA 1R5WA 3ZE2E 1LO2H 1G7JB 3SDAD 5E0QA 4JPWH 3MFGB 4L8DA 4GBXA 4Y19A 3RNQA 1NEUA 2FJHA 4ODTH 5KSBA 1PKOA 1XAUA 1MJ8H 4ZFGH 1HHHB 3RIAF 4G7YL 3S36X 4XB8A 4JRYB 3CK0H 4X0KB 3RDTD 3T0AA 1N6VA 1S7TB 5KBNC 5D70L 4S11A 3QDME 2BC4B 1TQCC 1OWWA 3TBYA 5CINL 4FFZH 4G6FD 5ID1A 3BUYB 4MQ7B 3TJEL 4G9DB 2EXWC 4MSWB 4C56A 2A73B 1IKNA 4Q74A 1W0VA 5IBTL 3RPIB 5F88A 2YA2A 3T2NH 1SYVA 5FM8A 1M7IB 4PTUA 3P0VH 1NFDB 3I3EA 1G7PB 5JUEH 4L3EE 4AEIH 5E1HB 4Y4FD 3W9DB 1N5YL 1W2KT 1D5ZA 5GGVY 3FO0H 3U46B 1HNGA 2I25N 1CD1A 5GGRY 1YDPA 8CGTA 1JNNH 1YEDA 2OQJB 2DQCL 3QUYB 2MQCA 2OZ4L 1ZANL 3GGWA 3SCMC 3GJEB 1BP3B 1FL6A 1W0WB 3IRPX 1XGRA 5HHVL 3IS0X 1RPQA 4X6BA 4NQSA 5F6IC 3S96B 3EOTL 5ECJE 5GIRA 3GSQB 3QDJE 1G0DA 2XNAA 5D70H 5HGDA 4LSTH 5EIIA 1V3KA 3HNTL 4MAYA 3E3QE 4M3KB 1EFXA 3TJEH 4DN3H 5E8DH 4LCWA 1FZMB 3BSZH 3S5LG 3OG4B 2R2CA 1JYWA 4QRRE 4OT1H 1A2YB 3EOBB 4KKAD 3FRUB 5EU5B 5DJDA 4E41D 5FKPA 4PJDA 4QYOA 5CJXA 3VMNA 1VHPA 3LDBB 3UXFA 4AM0A 3RWGB 4EN3B 1MRDL 3HAEH 3L5XL 4U1KB 4HEPG 2P43B 1AR1C 3LOWA 3VFNB 3NFNB 3QUXD 4ZFOL 5BS0A 4TUJB 1B0WA 3GMMA 5DZLA 3D3VA 2OZ4H 4JN1L 1S5HA 1LEGA 3QQ4B 4YHKL 2ILLA 4IIQA 3SDAA 4ZUVA 4M7LT 1CXKA 2DLGA 1RMFH 1CD0A 2AQ2A 5CEYA 4NN6C 1I7RA 2GT9B 5C0CD 5JZ7D 4FXGB 5DK3A 2V2TB 3D1MC 2PR4H 4Z7OF 1J0ZA 4PJEA 3RDTA 2VRAA 3RRQA 5IOPA 3L7FA 3FB7A 3OGCA 3CVHL 2VDPH 3NCYP 1VADA 4I77L 4JDVB 1LP9E 3ZYOA 4RFNC 4JZJB 5AWNH 4NNYB 4KI5F 2VISA 5D7LE 2A9MH 2B1HH 3E6FA 1YEGH 4UOW0 2D7NA 3BRDA 1A7QH 4N90D 3TV3H 4ZS6C 4FQ2L 4ENEC 4IRJC 5C0JA 4NO5B 1TXKA 1WBYA 4QXWA 4Y4FA 2XKSA 5FGSA 3S35X 5EU4B 1IMHC 3O4LE 5HVHB 5DRNB 1B4JH 4X8JA 4FQ1L 4LK4A 1INEL 3R0NA 5FB8B 1KGCE 4JN1H 5D1QB 2XY2A 2EKJA 4RAHA 4IRZH 2XFXA 3PDOB 4X9HA 3OKYA 4O2CB 5CHNA 4ELME 1I1FA 5ALBH 4MD5B 1DSFL 3X12B 1MFDL 4XNQA 4MJIE 3EYSH 1WTLA 2A6JB 3FT4B 4M7JL 4LSVL 1OAQL 2ZPKH 4XX1E 4QF1B 3GSUA 5E2UH 5JPMA 1ZVYA 4HAGA 4TVPH 4ZMAT 1QBML 5ID0B 1X5YA 3H0TB 5KG9A 1DTUA 2IG2L 3AUVA 1J1PL 5C6TL 5ISZB 5FGBA 5DUBA 1XGYH 4RFEA 1UACL 5DMKB 1KIPB 4KJWD 4E41A 4H8WL 4M7KL 3U0PB 2Y07H 2VSDA 3UDWA 3ZDXF 4TRPL 2VDNH 4EEEA 4MD0B 2EH7L 1A1NA 4QWWC 1WICA 1ZLWH 3TESA 3D48R 4XPGH 3VFTB 5DEFA 4K3DL 1XF4B 3HB3D 1U8OA 3W5MA 4OM0H 2X4UB 3VFWA 3QUXA 2PTVA 4FQ1H 1INEH 3FB5A 4RMSA 5K9QI 2N7AA 4X7FC 3QDHA 1KB5H 1Q9WA 4P3WA 3WUWG 4APQD 3QPQD 3IB4A 1L0QA 2WUCL 5C0CA 2BVPB 5DMIL 1KJ3L 2E6JA 3JTTA 3M1BA 5HY9B 1IE5A 3P0YL 5TGBB 3CPLA 4M7JH 2X4QB 4LSVH 4GRWF 3O3AB 2R23A 4H5SA 4NRXB 1TJGL 4M4RA 2ID5A 3BUTA 3WO4C 4TQEL 4KTYA 3L3GB 3OKKB 3QDMB 3LKNB 2ZSWA 4E9LA 1DBMH 4KI1A 1OF2B 3PV6A 1JTTA 2XZQL 1FV1B 1FAIL 1FFNB 3M07A 1BQLL 4AEHH 1RUMH 4FOMA 1G9NL 1YPZE 3D2UB 5CJ5A 2DKMA 3QEHB 1F8TL 3WDIA 5A1AA 3V4UL 1MQKL 3NMEA 3KYAA 4L3EB 2WBJC 1SJVA 3HPJB 3M17A 4Y2DD 4F3FA 4OFYD 3QIWD 4OFDA 2P48B 1JK8B 2W65A 4JQVA 3LZFH 4XP5H 2R1XA 3MZTA 2Y36L 4YXKL 3MPCA 4Y16A 1CDJA 1QRNB 4P5TD 5HI5D 2WUCH 3QG6B 1KIUA 5HHPA 4PJ8C 5DJ0A 3TF7C 3NABH 3P0YH 4P46C 1FRGL 1DQML 1GPOL 5CGYD 1MI5E 2VLMD 1KN4L 2ATPA 2P5WD 3QDJB 4X4ME 5I1JL 3QDAA 2DQDL 1H3WM 4HUUA 1YJDC 1CFNA 4OLZL 1NGQH 2GQHA 4PGEB 4KY1L 3GSXA 3RY4A 3O41A 1YUHA 1GC1C 1Q0YL 5F3HB 1F13A 2AGJL 4Q2ZB 4CRPA 1SBBA 4QRRB 3HPLA 3QEQE 3CDCA 3GBLA 5MEPA 5DMGC 3HE6D 1MQKH 5DFVC 4IHOB 1SM3H 5J12B 4P99A 1CLOH 1CZ8L 1HKLL 1PZUB 3T1FB 4J1UA 4HIJB 4MVBC 2XA3A 5FHAL 1J88A 2X7LA 1W72B 4YPGA 1DUZB 4X6EB 3C5JB 4Z95H 4CDHA 1KULA 4ODUA 3JWDH 4F7MB 2IH3A 2Y36H 4G80B 1AXTL 4APQA 3S4SG 3MRBA 1HXYA 3UC0L 3ILPA 5ERWA 3MV01 3ARBB 5DC4B 1A9BB 4KJQC 2DQTL 3F7VA 4A6YH 2JB5H 1DQMH 4L9LA 4GKZB 3ZTJG 4WGVB 2MQ3A 4KKBD 2AJVL 1ZS8B 4PTTB 2E7LA 2IPTH 2BNQE 3CSGA 3GBNL 2BP3A 1I8MB 1A5FL 5C8JB 4IDJH 3KPLB 3MLXH 1F4XL 3TH4T 2R0LL 1KN2H 2VABA 1V7NL 3CLFH 3P73B 2AGJH 3N1PC 1OT2A 2V9RA 1TJHL 4N9GB 4NC2B 4ZPVA 1U8JA 2VQTA 2VLKE 4WTZA 4HAFA 3KPNB 2NY4C 5B39B 4OCSL 1IAIH 3L95B 1NMCC 3WJJC 4YDKL 4LIQE 1DEEA 3QBTB 1U2CA 1VSCA 4LVHC 5FHAH 4U6VL 4Y2DA 5IVXE 4OFYA 1UM4H 3QIWA 2DQFB 3O4LB 4H1LA 1CU4H 1AXTH 1ZEAL 1ZVSA 1MAML 5IEKB 5F96H 2AJXL 2NYYC 3UC0H 4XPHL 3B3IA 4ELMB 2DYPB 3QXUA 4UBDC 5F89B 3CZJA 4GAGL 5J6HA 1DQTA 5E00A 5GZNC 5DF0A 1A02N 1ADQH 4PREB 1S7UB 4MJIB 4WI6A 1FO0A 3SGKA 3MNZB 4KK9C 4JPVH 1WSST 4EI5B 2P5WA 5KZCD 3TBWA 1A7PL 1FQ9C 1F4XH 3ULVC 2Z0BA 2IPKB 3RIFK 1V7NH 2R2EA 2V6HA 4OLXH 3W11C 1KELH 4D9RD 5IMOA 3FT2B 4CDGC 4G6KL 4Z0XB 2IMMA 2ZKHL 3VMPA 2BSRB 3T0XA 1JYXA 3ARGC 5GJTH 5CAYB 4ISVB 1CIUA 4NC1C 1XGQA 5DQJA 4YK4B 3V5DA 5GGVH 3SEPA 1QR1B 2F5BL 4U6TA 1IGIL 1P7HL 3RWDB 4IOFD 4U6VH 4GLRH 5SWQA 1JFQL 4EUPA 4PRID 1ZA6B 5I76A 4EDWL 2W38A 5E8NA 5IVOA 1GH7A 3WIIL 3MV7D 2AJXH 3KPSB 1CXHA 5KN5A 5HD8D 3AY4A 1Y6NR 3T1WA 5IR1B 2NXYD 3DETC 4GKNB 5F9DC 1A7NL 4GAGH 4ODSH 1JL8A 5MEOA 4ELKB 2VN7A 3TPKA 4XP1L 3M45A 5E6IA 1A6WL 3S37X 5HYSG 1L7TH 1T5XB 5KVFL 1UCBH 4Y5VB 1S9WB 3ZKNC 1E28B 2Z8SA 1BECA 2F8VA 5IW3A 2JIXB 4RA3A 5H35B 3WUZA 3RUGF 3SKOB 2DS4A 4YDVA 3IGAB 2K9UA 2VXTL 2ZKHH 1VFBA 5KJRL 1T89C 2VKXA 3O2VL 2W9DH 4L5FL 1SEBB 5KVDL 1N26A 4RMWA 5C0BD 2K3TA 4ZUWA 5GGTL 1YPZB 2OP4H 1AD9B 3U4AA 4FG6C 2F5BH 2RHEA 2EO1A 1DUYB 4HJ0D 4JN2B 3SPVA 2BOBB 4JPKL 4MWFA 4WUUD 1S9VB 3B9VA 2I27N 3LPFA 5EA0L 3OKMB 4AEEA 3WIIH 1S5IH 3RTQC 4JFFE 4Y5XA 4XHJD 1OAZH 5DJ8A 1G7LB 4PLNC 2P8LA 2HH0L 4JM2C 5JR1H 1A7NH 4RGNC 4WW2A 4CVZA 5EUOE 5C6PB 1NGYA 2EE9A 1A6WH 1V3LA 3O6FC 4PJGB 1T1WB 1GRWA 2CKBL 4PJ7F 3ECBA 3BN9C 5JA9A 4PYHA 4KZDL 4HBCL 4DVBA 3MV9E 3WL9A 3P4OB 4L8CB 5ITFB 1K6QH 4KXZH 4LCCC 2CMRL 3HAEA 1MCBA 4PV9B 4JFPB 3P9MA 3VRIA 2ED9A 4GS7C 3QPXH 3D85B 5KJRH 1OB1B 2W9LA 3O2VH 4LARH 4Y5YA 5L2JA 2R69H 1IC4L 4ZSOB 3E2HB 2OZ4A 5GXBB 4OD3L 1PG7W 3T8XA 5JDSB 5DC0A 5C0NC 1G7HB 3QEQB 1JUFA 5CWSB 1UZ6E 4EZMA 4XRCA 4HG4K 3IFLL 4ONHA 5HDBF 1CGTA 1QUNA 2VDML 4JPKH 4OCYH 5D2LF 4L1HA 4PP2A 3KLHC 2OTUB 4XNXL 3SGJA 3P9LB 2BJML 4PRIA 3WS6A 4N68A 3SDCD 5BVJB 2ED8A 3MV7A 1QSEE 3MV8E 4YXHL 1JWUA 4BK4A 3EO9H 1BX2A 1BFSA 3OL2A 1QQDA 5EOQH 5DYOA 2NZ9D 4PGZA 1RUKL 3DTXB 4I8DA 3EDKA 2R1WA 3I6GB 5DJAB 2CKBH 3U7YH 4KZDH 2H3NB 2W0FB 4OD2B 3GHEH 4HBCH 4KDWA 5BOPA 4OZIE 1K3IA 1U91B 2CMRH 2BNQB 4PRNB 4U6XA 1CFSA 5D7IF 1LILA 4PLKD 3UJJH 1MWAH 5I1AA 1DANU 4ZFOA 5KS9F 3SE3A 1CGXA 2VERN 2FEEL 1K4DA 4XMPL 1F58L 4OD3H 2XTJB 5C0BA 3DROA 2DWDA 4MS8D 1ONQA 4CMHC 2ZUTA 4C55A 4J3WA 2X70A 4K2UL 1UZ8B 1YEFH 4X7SH 2VLKB 3BHBA 1XGPB 2PW2A 1YECL 4ZXBD 1FNEA 4P49A 5JHDE 4XNXH 3HE7B 4HKXA 1ZVHA 4RISL 2DTMH 1XGTA 2LE9A 4RDQG 5T1KB 2MPAL 1CLZL 2CKNA 1I1YB 1NGPH 3EHBC 1A3LL 1QSZA 4N0UA 5M94B 3C8KA 3GIVB 2O61A 4R96A 3GMOA 3VXUE 4YBLC 1RUKH 4OJFH 2CO7B 2SEBA 2V2WA 5F7HA 3IVKA 1MUJB 3V95A 1FH5H 1CXEA 2I9TA 2QEJA 5AG9A 1B0RA 4RSVA 4HUXA 2QADC 5ITBL 1CGUA 3I3DA 4R6UA 4F7EB 4Z76A 2VL5B 4N8CH 1EJOL 1M4KA 4MD4A 5I1CL 2AJUL 3OPZL 1DQDL 4I3RL 4LU5L 1PAMA 3X14B 4AQ1B 4OBRA 4XMPH 2X1OA 2GK0B 1KB5A 1VA9A 5EZIL 1SEQL 3LV3A 4BM7A 1G7IA 1HILA 3G6JF 4NWUH 1GSMA 3W82A 2QQQA 1CE1L 1R3JB 3DMMB 3IDGB 4NZDA 5D7KD 4D9LL 2FR4B 2C26A 3M8OL 4HCRH 5IBLD 4XC1H 1WFNA 1GGIH 4WI7A 2CLVA 4RMVA 1RK0A 2EDKA 3SDCA 2MPAH 1CLZH 4D9QD 4J3OC 2Z8WC 1Z5LB 4UNTA 5F7UA 4PJ5B 4LFHD 1TQBC 4ZFZA 2EYTB 4U1NB 1UQSA 4EVNA 4PJAA 3QUZC 1C7TA 4PUBL 4K9EC 5L9DL 5B3JE 1F3JB 1VFUA 4R26L 2F53B 3OAUL 1JPFB 3TYGH 1QSFE 3U6RA 4X83A 1YN6B 5ITBH 4W68A 4FXLA 4CNIA 4RGOL 3GO1H 4RIRB 2XG4A 5IK3A 3AMLA 4MJ5B 5I1CH 3VFRB 4UAOC 4Z7WA 5DTFB 2HLFC 2MMXA 1FL5B 1SJEA 3DURA 1URLA 1HXMB 2BVQA 5HDOA 4AIXA 1G1CA 3FB6A 3FO2B 3L3KA 3ROOB 3U82B 4IOSD 1IAOA 3BZEB 1D9KD 3V6BR 3MLRH 5HI3C 5BRZE 1RFDL 1VGEL 2VDRL 3BDYH 4ZXBA 1K2DB 3A6OA 3UTTA 5EIQA 4DKEH 4PRBA 4F9LA 3WHXA 2AK4E 1HSAA 4Y4KD 3ZSSA 5IUSA 1X5IA 1OAYL 4H0GA 5TDPB 1FYTE 1V3JA 2WNGA 4ZUTA 3RL1A 4FMFA 3P77B 4AT6A 1S9XB 1CWVA 4JFFB 5ACLA 2CRIA 4QRSA 3TZVD 3TH2T 1BD2E 5J1AB 3MBEC 4DZBB 1NDGB 4M93C 5H2BB 4YZFE 1BF8A 1CFQB 5ANME 5EUOB 4R26H 2BFVL 3VXOA 2B20A 3OAUH 5IFJB 4LEXH 1BOGA 2OJZL 5F7FA 1R3IL 4NOBA 3QJHB 2EDOA 1GGTA 3MZGB 2H6PB 3H9SE 5DRXA 1JZ4A 4ODXA 1UM5H 3FFCE 4X99B 4CW1B 3DX9B 3MLYL 2QSTA 3QFDA 4YHZL 3EFFB 5CBAB 5MERB 1EMTH 3MRKB 5HJ3B 4XPTL 4G6AC 3LCYA 2WM0A 4WO4C 2CJUH 3NOIA 2B2XL 5IKCB 1JNJA 4D3CH 3WFZA 1D5MA 1EAPB 2FX7L 2VDRH 1WWBX 2MFNA 5SV3A 5KTEL 3VFUA 4J12A 5E9DD 3CLEH 4A6YA 4WWKD 1OAYH 1P1ZB 3OAZH 5JIPA 3G04A 2VKWA 2EDLA 3Q1SL 3UZVB 1YJDL 4C54A 4LL9A 2VZOA 3U0TB 1EBPA 4DKDC 3PDDA 2CH8A 4XI5D 1GC1L 3MV8B 4PJIA 2BFVH 3TT1L 1ZT7B 3QH3B 1T04A 4KRNA 5C2BH 3I2CL 4RMQA 3MRDB 4NDMA 2ICWJ 3EYFA 4OIIL 4CU7A 3DSNA 4ALAL 3VWJD 3LN9A 1F6LL 2AEIT 3WS3B 2G75A 4JFED 1NGZB 3CSYB 3MOBL 5SWZE 3MJ7A 3V0AC 4OZIB 3PGFL 4N5ED 1QBAA 3WKML 2KQMA 4XCNB 3ARFC 1NCUA 4PJXF 4XPTH 4Z78A 2P8MA 4UB0H 1WWWX 3NAAH 3TIEA 2B2XH 4QNPF 4NNXA 3OJDB 3BQUD 1C8PA 4GG6F 5IJKA 4R7NB 2AEPL 1G1YA 3X11A 5JPNA 1D9KA 2J8UB 2FZ3A 1DBAH 3EDEA 4XWOD 5KTEH 4P4KD 4OGXH 5C0FA 4NPYB 1ADQA 2EECA 4I4WB 4Y4KA 3RNKA 1NEZG 1A6PA 2IH1A 1KIRB 4JFHD 5JHDB 2YSSB 1WQVT 2E6PA 3C6SA 1NBZB 1AI1L 3Q1SH 5CUSL 4GXUN 3TA3B 1T22A 1QHPA 5L6YH 4BSVB 3TZVA 1GC1H 2O5YH 5HPMA 4EOWH 1KV3A 2Q8BL 4D0DB 3TT1H 5JQ6H 2RFXA 4UUJB 3VXNB 4YH6A 3I6LD 3WFDL 1E4KA 5IIEA 2GAZB 1F4WL 4PJBE 4OIIH 3AB0B 5GJSL 2BVYA 3MOBH 2Y25A 3P4LA 4QT5B 1N7MH 5E5UB 1NBYB 1BFOA 1IEAB 5GGRA 4G42B 4M8QB 2COQA 2VITB 4O5LH 4UT9H 2B0SL 2WLYA 2VLJE 4X7TB 3FOLA 1H15B 2AEPH 5E70A 1YZZA 2FL5A 1WEJL 1LD9A 3MNWA 2ADFL 3IU4L 4GQPH 1GOGA 3EOYG 1CN4A 4WFFE 3PIQA 4M1GH 2ADIA 5E9DA 5MEQB 5JA8B 4IS6A 5KVMC 2PCPA 4WWKA 1JYVA 3FQWA 5IFHH 5DGRA 1RJYB 1NCTA 1C08B 4ETYA 4NQDE 3ARXA 3DRQA 3ULVL 5JOFA 4U1LB 3QA3B 3BJLA 1EXUB 1ZT4B 4XCYB 3T65B 3WD5L 3MROA 1BVZA 3HUJE 2E7CA 4MNQD 2J6EL 4DAGL 2AJ3B 4HIEB 4PGDB 4MAUL 1RZJC 4DFHA 5IM7A 1LNUA 2F58H 3MMEA 2FH6A 4N0YL 1N64L 2D31A 1QSFB 4JFEA 1N8ZA 3BIKB 3Q6GL 2Q86A 4K7PX 1PQZA 3VJ6B 1X9QA 5SV4A 2Z4QA 1RHFA 4PGJA 3LEVL 4PV8A 2B0SH 3FQTB 1IBGL 1CVSC 1DDHB 3F5WB 2A6IA 3NCBB 2AAVA 3IXAA 3QFJD 4KI5D 3BQUA 2VNCA 1FNGB 3KPMA 4I0PB 5ADOL 3G5YA 5ELIA 3IU4H 1MSPA 5C0AE 4JY4B 4WY7H 3WUWB 1RJZA 4P4KA 3RVXD 5FUCE 3INUH 3UBXA 4NQTA 1E6JL 4PG9B 4Z7VE 4FABL 4P4RA 1LK3L 2AK4B 4HS6A 4XH2A 1UXWA 2Z35A 5IF0B 1FYTB 2Q8AH 1AR1D 4BZ2L 3MUJA 1PD6A 4ZO7A 5ICXA 1H3PH 1EX0A 4FTVD 2J6EH 4WI8A 1J05B 1BD2B 4MAUH 3RAJL 4G8IB 4N0YH 5ANMB 3L7EB 1IQDB 4HS3B 3AXLA 4C59B 1AD0A 3U48A 4CJ1A 4Z6AT 3EJJX 3Q6GH 3H9SB 5T3XE 4PD4K 4NP4H 3FFCB 4GOSA 4JHWL 3IFNL 2YKLH 4NN5B 4OBSA 2VLRE 4LLYA 5CD3B 4A2MA 3HCVA 2VYRE 5IB2B 1IBGH 1XFPA 4JFQA 2EKSA 1RU9L 1CL7H 1NCAL 5CLWA 1MCCA 2UWEE 4BUGA 4XVTL 4X80H 1INDL 1ORQB 1UFUA 1MFEH 3QRGH 5HDLA 3S36H 2CKBA 1ZA3A 4X4YB 1N3NA 3DO7A 1T3FB 1OT1A 2FLRT 1JHTB 3OXRB 4HIHA 4JFXA 5IVNA 4ZS6D 2ICEB 2LU3A 3JWOH 4ENED 4IRJD 5MI0C 3VW3L 5I71B 2CLRB 1JZ3A 5LKNA 4YE4H 4GRLB 2XQYK 1OOAA 3E6HB 5DD5H 4MNQA 1MWAA 1UENA 3RAJH 5SX5H 5CP7B 2HJKA 4YIQA 1N0XL 4MXVF 2V17L 4U1GB 2XQBH 1P4IL 3HZKB 4ACPA 5IGXH 1OGTB 5D1ZB 5EBMB 1AXIB 1X4ZA 1MEXL 2FGZA 4WFGE 2YEZB 2B1AH 4KH2A 1RURL 2PKDA 3QUKB 3T2PA 5SWZB 1A6TA 5CMAB 1S7QB 1JJUA 5DA4A 3SBWC 1VPOL 1QFWH 5ESQA 1XGUB 3NFPA 2ADJA 4CN4A 3JSSA 1FNSL 2CIIB 3MUZ1 3MJ8B 5IWLC 2APWA 4PJCF 4K23L 3QFJA 1WFTA 3JV6A 2NR6C 3VI3F 2JJSC 3IKCB 3LRSB 4UNUA 3PGDA 5FYJE 1ZLWK 1XH3B 1FNHA 4LMQI 1PVHA 1QZ1A 2E7MA 3PL6C 4HSQA 4I3SL 4CMMA 4RZCB 1GXEA 3EYOA 2VDQL 4AJ0A 1G7QA 1NAMB 4O2EB 1YY8A 3LDBC 4KV5F 4JVPA 1T5WA 1CDUA 5L8KB 2FX9H 5H94A 2X4SB 2ZG2A 3H3KA 3PXJA 1Y0LA 3GIZL 4OGAD 3S34L 1G0XA 4OCMC 3U30C 5JQHC 1F02I 1J1OL 4JO4H 1T1YA 4MA8L 3LEYH 1H5BC 1LO5A 1OM3H 1C12A 5GS1B 3Q48A 4HCRA 1JIBA 1FNSH 2PYED 3TBVA 3EJYC 5JW3L 2V9TA 1MRCH 2VLJB 1AE6L 5ACZA 3D9AH 5D6DC 4UDTB 4LLVB 4M00A 1QEWA 5J06A 4H26B 1MFBL 3QYCA 5KANI 2DKSA 3V6OE 2HT3C 1AGBB 3ARDD 4I3SH 2AJSL 3MLTA 5ESAB 4P3DA 3ZE1F 1M05B 2IF7A 3JXAA 2YWYA 3C9NB 1CTNA 1AIFB 4IRJA 1IL1A 2VE6B 2WBJD 4YHLH 1JNHA 1EAJA 3SHSA 2GCYB 1HI6A 1T1XB 2G2RB 2HN7B 3VD5A 4KROB 1RZFH 1PX3A 5ETUB 4LCUA 1OHQA 3T0EC 4NNPH 1GZPA 1U3HB 3DRTB 2JJUA 3O11B 4QXTA 4Q9CA 1VFAA 2Z92A 1RZ8A 2FX8L 3BPCA 3KPQB 3LKPA 3VI4F 2BSSB 3HR5B 3EGSA 5I1IL 5HYJE 1Y18A 4P46D 2P5EE 3S35H 1M7DA 1FBIL 1ZHNA 2VOTA 4LHQB 2GUOA 2ZUYA 4MA7H 2VAAA 2NY1C 1QBBA 4P2OC 3FAWA 6FABL 1JGDB 2XN9D 1K9TA 3BT2L 3HR6A 4K9EL 5T5FH 4H1LG 5C0AB 1A6ZA 4U1HA 4U1JA 2VN4A 4HMCA 1S78D 2A38A 2HLAA 2QLVB 4NFCA 4Z7VB 5EBWB 5F9JB 5DHYB 2VQ1A 5DMGD 5DFVD 3CZFB 5EU6D 5HYSB 2FWOB 1X3DA 5IB1A 1HSBA 4MVBD 2IBBA 2PUQT 5DRWB 5T1LD 3PNWB 5I6XC 1WAAE 5GS3A 3PQYE 2Z91B 2CLZB 4X9IA 1TVBA 1DBBL 2FX8H 1YNLL 3KPRD 4KJQD 3REVB 5I1IH 4HPYH 4OZFH 4GRMB 4H0HB 3O81A 4HGMA 4IMLB 2EE3A 3WKNA 4R0LC 2P24A 1RIHL 3L9RB 4TSBH 2VLRB 3TVMC 3CFJA 2PYEA 3EZJB 3QZWA 2WMPA 3WLBB 4QRUA 3HZVB 3ZHDA 2FECI 3WHE1 3OKNA 4U7SA 1IARB 4HLJA 4K9EH 5IFAL 1U0QA 1FIEA 4X5WA 3U9UA 4EUPG 3JUZA 4UIKH 1A4KA 3EFDL 4QHMA 3RJQB 1TNMA 5E4EB 2D03H 1IAII 3ARDA 2QQNH 4TSCL 3ZHKA 3JVGC 4P59H 1C1EL 4EI6B 4NO2B 4KK8C 1J8KA 3PABB 2GIYA 2WBJA 4NBYB 3KPPA 5HBBA 2JLLA 1JPTL 1ZHBB 4OF3A 4ESKA 1CR9L 4XNZB 3OMZA 4UI2A 4MDIA 2ZOKA 5JLZB 3L3OA 5EWIH 2NYYD 5CEZH 4NBXB 3SGDH 3BDXA 1YNLH 5F3BB 1JGVL 1LO0L 4UBDD 4OKVA 4PJ8A 1XR8B 3T4YB 5HHOE 5GZND 4BH7B 3F65A 4P46A 2AV1A 1QO3B 5JW5B 4KK9D 1DFBL 1T0NB 1H9VA 1PGRB 2ZSVA 1H8NA 2H32B 3EO0A 5FO9A 4MMZC 1OTTC 2XN9A 1FGVH 4LAJH 4ZNEA 4ZTOH 1BQHA 2V5SA 3I6KA 3G9VA 3W11D 1G6RB 3ZE2F 4L3CA 1MLBA 1DLFH 4NZTL 5IQ7H 2CRZA 5D1XB 3BP6A 3EFDH 5DLMH 1MH5A 5LVEA 4PS4H 5IROC 4HKJA 4YFEA 3K7UA 3O4OB 3MV11 4HKBB 1ETZA 4Y7MA 1MFCL 5LXGL 1U92A 4HXBL 4TYUA 4GLRI 3HC0B 1ZHKA 3OQ3B 1IGJA 2Q20A 2KDGA 3D0LA 2NLJA 2R1YA 5T1LA 2XZCL 4XXDA 3WXVL 3B43A 1WIUA 2XPGA 2IBGA 3DETD 3KPRA 1ODAA 1AY1L 3F12A 4HGWA 4DTGL 7FABL 2Y9RT 4TUKL 2NTFB 4OLYL 2DIBA 2PW1A 1UVQA 5E24E 3IDXL 5HHME 3TN0B 2C1PB 5HSFA 1MCOH 1BAFL 3ZKND 4M1DL 1JV5A 4YR6B 5B38A 3D0VA 5K9JL 2NW2B 2WBWB 5J9PA 3MRHB 1JHKL 2JB6B 2VDLL 3EOAA 3PWJB 5GGSB 5I1LB 3T3PF 3SDYL 5F7WC 1TZHB 3G6AB 4JY5H 4F7CA 4WTWA 3WE6A 1MFCH 4HZLA 3VXSD 4C58B 4PRPD 2NX5E 2FD6H 1I8KB 4ZPTA 4FG6D 3WJJA 4QTIL 1A14H 3CFCH 4FP8L 1KJ2B 1CS6A 2OL3H 4F8QA 5IQ9B 4LSUL 4XAWL 2VXSL 2XZCH 3GSVA 4HUNB 4PJDE 3RTQD 2RCSL 5JMOC 2NY3C 1GZQA 2HWZL 1A6VL 1AGDA 2BNUA 3O6LL 4JM2D 3TPUA 3UBXI 4RGND 1AY1H 5E5MA 1TPXC 2GJ6E 3C6LB 3U9PL 3GI8H 4YUEH 4OLYH 2P4AB 3O6FD 4HDIB 4DOHE 4X4ZA 4GAYB 2P5EB 5DJ2B 3RUGA 3D3VE 3HG1E 1P7QB 4KXZI 4M1DH 5T1DH 1IC7L 3NFSL 1LDPH 2D3VA 2PXYD 4MQTB 2R2BB 5J7CC 3DV6A 5JORB 5D72L 1KPRB 3LN4A 4TULH 4JFYB 3VH8A 3MA9H 4YNYB 1BIHA 4HUVB 1RZJL 4MJ6A 4WV1C 3LAFA 2J6EA 4L8SC 4JFOA 4M43L 5DVNA 3ARGA 3S37L 2I07B 3BP7A 5IHZA 1NUGA 1X5KA 5EUKB 3QNYB 5FK9A 4AIOA 3IAGC 1VDGA 5EC1A 1XCTA 3QQ9C 5H37H 1U93B 5TQ2H 2EIZB 3KYOA 3IDNB 4BKLA 1FVDA 5EC2A 1PZ5B 1XF2A 1DVFC 1FFPA 5BZDA 3KLHD 3AAZA 1A6AA 4NUJA 3GSNL 3NN8A 4Y4HB 3X13B 3FONB 1FC1A 3HRPA 1JZ5A 2IMNA 5CIPB 4IRSC 1A6VH 4NYLA 3PQYB 1Q9KA 2O5XL 1J8HD 2X1QA 3RQ3A 1R3KA 4N0CC 1T1ZA 2C4XA 4QOKB 2W92A 3QDGD 1IC7H 4GRWE 5B8CB 2BERA 3AREC 1QPXA 4RWHA 4H25B 3AM8C 3PWPD 2FJFB 5JW4R 32C2A 2AABL 3LPWA 3MLSL 3AU1B 3MR9B 1M71B 1T89A 1RZJH 1C5DA 3FTGA 4Y5VC 3CUPA 1SY6L 4M43H 4YGVA 1Q9LB 1AJ7L 3A67L 3KNBA 5FYLL 5BMFL 1B6DA 3S37H 3MNVA 2E9WA 5E94B 3WFBL 3ARVA 2X89D 5TDOB 3HMWH 2AKRB 2OR8A 3VXSA 3OG6B 4PRPA 3OHXA 3SQOH 4XXCC 3UTPE 1B4RA 8FABA 4GUPA 1MCJA 4L4TD 2HVJB 4HZAA 4LLDA 4GW4B 3QIBB 2BXYA 4NQEE 1VGKB 2QV2A 3GSNH 5D93B 4FFVC 4LLQA 4X9GA 1AKJB 3BIBX 3RTQA 4B53A 3IFPA 3EHBD 3QSKB 4PRAB 4JM2A 1IGTB 1CG9B 3RWIB 4I18B 1MFAL 5BO1H 4HIXL 1RK1A 5F7EL 5EZJA 1U6AH 3SE4C 3DI3B 1P69B 4CGTA 3FZUC 3O6FA 3ZLQC 4GW1A 5HHOB 1U95B 1DQJA 3VFPB 3CAFA 5J89A 3ES6A 5DT1L 3QO0A 5TF1L 5EO9B 3VWKC 5BXFA 2QADD 4JO1L 2PO6B 4PG2A 1R5WB 4LCCA 3MLSH 4JJ5B 1S7VB 3VDBA 1KC5H 4KVCL 5D6CA 4R8WL 3HNSH 4AL8L 4Y19B 2NY0C 2ENSA 3DUHA 5BMFH 2FJHB 4LCIH 2AJYL 3WFBH 2VWEC 1CXFA 1HHIB 2ZNXA 5TH2A 3MQIA 3DUUA 3TBYB 4K7PY 2D7TL 5ID1B 4WGWB 4OGYH 3B6SA 1OPGH 3BN3B 4C56B 5GRUH 3PWLA 3F7RA 1X4YA 1I3UA 2CDGA 1W0VB 1EUTA 2F74A 4MX7A 3CFKA 2XKNB 4O9HL 4LPTA 1AQDA 1UA6L 2QQKH 4IJ3B 4TPRL 1OP3H 1KBGH 4W4NA 5DQ9A 5F7EH 1J8HA 1YPZF 4HK0B 5C09E 3QUZD 2K7QA 2FRGP 1Z9SA 1D5ZB 4KQ3L 4HWBH 4LASH 5DS8B 1CD1B 1YDPB 5DT1H 5TF1H 4ODWB 3QDGA 5HHMB 3KHQA 4WHCA 2UZIL 4G43A 2BY2A 2ZG1A 3T04D 4ZUSB 1LWRA 2X9WA 1FL6B 4LPCA 2X4TA 2HLFD 5I1KH 2Z31C 1K85A 4R8WH 1WT5C 1XGRB 2CDFA 2F5AL 4NQSB 4R4FH 4TVSa 3SDXA 4PJGF 5GIRB 5FV1L 2X89A 2YD1A 4KVNL 2QR0B 4M7ZB 3Q6FA 5CEZD 4NUGL 4OB5L 4W6YB 4X6CA 1OGAE 2XNAB 4HWZA 5D7JC 5HI3D 1U8HA 1PYWA 2NX5B 2OJEA 5D5MA 2DIAA 2PYFA 4KRLB 4L4TA 3GUTB 4WFED 4XVJL 1EFXB 1YMMD 1JPGA 5HYIA 3IDJA 1TMCB 4LCWB 4Z7UE 1TVHA 4JANA 5C08D 4IEFB 2NXZB 2XI9A 4XP4H 4MAYC 4DKFH 4O9HH 5MP6L 5DJDB 1MIEH 4PJDB 4QYOB 3ZTNL 1PFCA 5JW4M 2WIIB 3B2UC 3MBED 3HE7C 2DQJL 3RL2A 5I1EH 4P2RA 5BS0B 4DOHB 1MCFA 3GMMB 4JLRA 2DMCA 2LAAA 2J5LC 1RUAL 3D3VB 2UZIH 3HC3H 3HG1B 1S5HB 2EXYC 1YEJH 5JHLL 3ULUF 4IIQB 3SDAB 4ZO8A 4ZUVB 3K3QA 5MHSD 1UB6B 2WWKO 1I7RB 1C5CL 3C5ZB 4G6AD 2B39A 2Q87A 5FYKU 3UTQB 3VXME 5HXMA 4NM8L 3QXDA 5CD5D 3RDTB 1TZIB 4D0CA 2BVOA 3L7FB 2IADA 3OAZK 4PY7A 1PW3A 1NMBH 4JREB 3GSRA 3FB7B 2Q6WB 4OTXL 1LVEA 1FFOA 1VADB 4M9OA 2HP4A 1PX4A 4OZFA 5DUPL 4G6FB 3KR3L 4P48A 1LO3H 4XVUC 3HNVH 5KSAB 5JW4N 2VISB 4NKOA 5MP6H 4S1QH 1FGNL 3S3PA 2Y06L 2ZCLL 3N9GH 4RWYH 4DCQA 3ZTNH 1P2CA 3PHSA 4WU5A 3E6FB 4JPIA 4FQJH 5GSRA 1CICB 4DEPC 4LBEB 1A7OL 3QUZA 2J4WL 2DQJH 4Y4FB 4LP4A 4QRQA 3F7PC 3VD3A 4X8JB 4EQ3A 2OS7A 3RI5F 4S2SA 3N1QC 3G6DH 5T3ZE 2XFXB 3MOAH 4HUWA 1BIIA 2DJSA 1I1FB 4LAQL 3ARFD 3LQAL 3O2DL 4XNQB 2XRAH 2FO1A 1S8DA 1PKQA 4TOYH 2APFA 4XB7A 4HQQL 3IF1B 3TM6A 3VE0A 4HH8A 4HXAH 4YJZL 1N2RB 4Q0XH 1F6FB 1A64A 2HG5A 3QUML 3VXRD 1DP0A 1GL4B 5JPMB 5L88L 5I16B 5KG9B 1YMMA 1FDLH 4N0RA 1N6QH 5C08A 1NJ9B 4NQEB 2CGRL 2FEDC 4G8GD 5DUBB 3QWQB 3OJMB 5EU7E 1UH3A 2VXUH 3P40A 4OLWH 4V1DD 5FGBC 1A1NB 1T80A 1A7OH 2HMIC 4KKAC 3MBEA 3AS3A 1FG9C 1BEYL 2CUIA 5KSVA 2ICES 1XCQA 2G5BA 3RA7H 1U8NB 1U8OB 1TNNA 2J7LA 3VFWB 3FB5B 3HMXL 1IGFH 4F37F 4PJ7E 2JCCA 2B8OT 3EYVB 5DR5H 1Q9WB 2CK0L 4ZYKA 5I8KL 4FQIH 1BBDL 4LAQH 5ALCH 3KYMB 3SKMA 2MNUA 3O2DH 4OGZA 3M1BB 4WO4A 5C70A 1T7WA 1JWMA 1OAKH 3L1OL 3CPLB 3F58L 2RR3A 3MLZH 5DHVH 2GHWB 5JZ7C 4GT7A 1RZKH 1CFBA 2MJWA 4R2GB 5J6GB 3V7AG 2DTSA 3O45A 4LRIC 5FHBL 3NGBC 4HMEA 1YYLH 5I75C 1SJXA 5HDBE 1RJCA 3PV6B 1SQ2N 1OSPL 4UV7H 3OZ9H 1F4HA 4PJFE 4DW2L 1AGCA 5E4IA 1QD0A 5BQ7A 2NY6D 4MNHA 3UYPA 3GKWH 5C09B 3SJVD 4MNGE 3M17B 4F3FB 4R9HA 35C8H 2R1XB 2CK0H 3GMQA 4Y16B 4BFEA 3C08L 2UVEA 1BBDH 1KLUB 3V8CA 3ARFA 3LEXB 1CLCA 3CCHA 5DI8A 2OL3A 5DJ0B 1NC2D 4WHDA 3L1OH 5KS9E 5EUOF 2EDRA 5E03A 4DJMA 2ATPB 3O6ML 5GISL 1DL7L 3VXRA 2V7HA 4OSUL 3JTSA 3OB0K 1OGAB 3KLDA 5EFIB 4CJ0A 4AMKL 4D9RE 3WSQL 3B9EA 5C0RH 5F6HJ 5T5NG 3GSXB 4I1NB 1YUHB 5D96B 1UWEH 3CC5A 4NCC2 4Z7UB 2HAZA 4G8GA 4PLJC 1HHJB 3HPLB 2GFBB 1EZVX 1QFWM 4HFUL 3RX5A 4ZO6A 5CSZA 3VMOA 5MEPB 4V1DA 2EYRA 4OF8A 4WWID 6CGTA 4BQCA 4KJWC 1UZ6F 3RVWC 1IM3A 3LKSA 4J1UB 2QTEA 3F7YA 3U1SL 4NFDA 5JO5A 2X7LB 3TA3C 4YPGB 3X3GL 3RWHA 4L4VD 2EH8H 1MCEA 1YN7A 3EDDA 4ODUB 2H2SC 2IH3B 2OYPA 3WNKA 3C08H 3MRBB 4YO0A 5ERWB 4YHNB 4BSJA 5CZVL 5DO2C 1Z3GL 5EO0B 2WBKA 4MDJA 1FSKB 1CL7I 1CGSH 4XZUA 5LWYH 1GOFA 3F7VB 3QPQC 3MUGA 3ZL4L 1ND0B 2CQVA 1YEEL 3VXMB 1W72H 3OR6B 3PWUA 4XNMA 2BRRL 2AV7A 3C8DA 4L9LC 4XAKE 4JRYD 4LNRA 4OZIF 4FXKA 2VABB 2R56L 1MHCA 1OLLA 2E7HA 5EZOL 1T21B 5SX5K 1JRHI 3IDIA 4GQ9L 4UDUA 4ZPVB 1R0AL 1U8JB 3TO2A 1UWXH 1Z9MA 2R39A 3SKUD 4ZTPH 4TNWK 1HH6B 2J8UF 4OD1L 2OI9B 4FFYL 3SJVA 3VFVA 4I48A 3QB7C 5GS2H 4Y0GA 3QIWB 4NIKB 2G9HA 4H1LB 1ZVSB 3NIGF 1NSNL 1RIVL 1EEUA 2B5IC 1QFWI 1MCQA 3WEXA 4F57H 4XBEL 1IFHH 1UH2A 1IJ9A 5CZVH 5HHNA 1T7ZA 3B3IB 4FQQA 1RAMA 5J6HB 1NC2A 3GSNA 4P5TC 5F7LB 3ZL4H 1IEBB 1RJLB 3W9EA 4MLIA 1DJSA 1P4BL 2Y4SA 5F9OH 4H88L 2MKWA 3Q3GA 1FO0B 2NR6D 2A77H 3ALWA 1RIUL 2P5WB 3TBWB 5ICYA 1AGEA 1FCCA 4K7PH 4U2YA 5BV7C 5DDHA 4AENA 3PHQB 1UM6H 4GKSA 1MPAL 1Q94A 2R2EB 5E8PB 3MUHL 3PL6D 4MJ4A 4CBPA 4HLZH 4U0QB 5IMOB 5EBLA 2Q7YA 2RB8A 3EUUA 3NACL 1NL0H 1MJ7L 1MJUH 1I3RB 3EBAA 5IT2L 2I9LA 1XGQB 4KFZC 2X44D 4NJAH 3V6ZA 4RBPH 4FFYH 3GM0A 2J1KA 1BZ7B 3HE6C 1T2QL 1QFUH 1ITBB 1RSFA 4X6DA 3HTLX 4L4VA 4EUPB 5I76B 3MUY1 5E8NB 2QHLA 4PJ7B 2OX5A 3GBML 3CSPA 1EGJH 5KN5B 4LQFL 2G60H 1FLRH 3LPGA 4P3CH 1W8OA 1D7FA 4PJAE 4M5YL 4XBGA 3GRWH 4BQ9A 4MHHI 1MCPL 3KJ6L 1I9IH 1QNZL 4NQVA 5E6IB 4H88H 5HYQA 3I02A 5DGQA 5CBEB 2FNBA 1HWHB 4NN5C 1HHHA 2NQCA 1I4FB 4KKBC 4Z7WE 4GAJH 4KK6C 3V5KA 1S7TA 5TQ0H 1MPAH 1HIMH 2HT3D 1TTGA 5C0GA 4YDVB 2YUWA 4HWBA 5IHBA 3BZ4B 3TJHD 3NACH 3FRPG 4WEUD 4YHML 4G9DA 3J7HA 4POZC 5F71A 2A73A 3JV5A 4PJFB 5IT2H 4UOJA 2X9YA 4ZUWB 1EA9C 3KXFD 1HZHL 2EDHA 1M7IA 3UTTE 3UYOD 1PSKL 1NFDA 4O58H 4ZODA 3MACL 3SPVB 4MWFB 3MRJB 2DLFH 3Q5OA 4MNGB 4LRNH 2C1OA 5IMMA 3GBMH 5E99L 1QR4A 5DJ8B 3MODL 2P8LB 1BGXL 2FB4H 3GSWA 4U0RC 4WW2B 3SBWA 3UPRA 4CVZB 2FIKA 1QNZH 1NGYB 3S6CA 1EEQA 4HF5H 5D1ZC 1QBLL 4PJXE 5DD6A 5JXAL 5D2NC 5IWLA 1CD8A 1T2XA 1T7VA 4P2OD 1NCBL 4YZFF 5KS9B 3ECBB 3TBSA 2JJSA 4QNPE 2BY0A 1NC4D 4ODBD 4GKOA 4DVBB 2ZCKL 3RFZC 3WL9B 4JDZA 4H20H 3GSQA 4KHTL 3HAEB 4PRHD 3VRIB 4OZGA 3PL6A 4KJPC 4B50A 3ZMRA 3F6IA 1NDMB 4Y5YB 5L2JB 1PG7X 3QJFB 1FZMA 2DB8A 4Y2OA 1U9KA 1A7RL 2R4RL 4NRYB 3T8XB 3DUSA 1JUFB 3DVNB 4MXWH 4DFIA 1Q0XH 4LEOA 2WSKA 4XRCB 3O6KL 4NN7B 1DE4A 2BY1A 4ONHB 3FKUS 2KZ1B 3H3PL 4U1KA 5J13B 4PRIB 4C83A 5E99H 4L4JA 3RVVC 3DOSA 3LHPH 1EHNA 1HQ4A 4ONOA 1H5BA 1BGXH 2NXYB 4IOIB 1QHOA 4AG4L 1BX2B 4U1SB 3TVMD 5DYOB 3BKYL 3RWFA 5HD8C 1BVKB 2R1WB 4QRPE 1T03L 4PR5A 1A21A 4R97B 4KHTH 4U6XB 3K1KC 3MYJA 5I2IA 1CFSB 5FYKL 5L8LB 3DVFA 3I50L 4J3VA 3RZCB 5I1AB 4ZFOB 4TTDC 4J6RL 4HWUA 3QDMD 4AQOA 2OK0L 4KK8D 4YDJA 4DGVH 5C0BB 4UINL 1SBSH 2DWDB 1ONQB 4KWUA 4PB0H 2MQ0A 3I9GH 2OCFD 2X70B 3KXFA 3BHBB 3O6KH 4W6WB 4KKLC 2PW2B 1MIMH 1ZGLP 2V5MA 1FNEB 5CGTA 5TPWL 4M6OL 4UU9A 3GB7A 4KTEL 4HKXB 1J0KA 1XGTB 1HYSC 1FYHB 1IAMA 4GO6B 1ZV5A 4Z7QE 4N0UB 4DK6A 2JJTC 3ZKXB 3AFLA 2O61B 5IESL 1FIGL 3GMOB 4ORGA 2SEBB 2V2WB 3IVKB 3X12A 5LCVH 1EERB 4P2OA 4EJ1C 1OTTD 5F9WB 3NA9L 2I9TB 1SJHA 3ZKMC 1B0RB 1NC4A 5B39G 3FT4A 1E4XH 4HUXB 1PLGL 4KRPC 4Z76B 4Z0BL 3BP4A 4ONGL 1IAKB 1YY9C 1G0YR 2Q7NA 3VD4A 4MD4B 4PRHA 4XMLL 2AEWA 3V6FB 3RWJB 5DK2B 1A0QL 3H0TA 3DPBA 1A22B 5TFSL 4W6XB 3VRJA 1G7IB 1HILB 3CH8A 5DMKA 5FCUH 4E0RA 4B0MM 4QRRD 1XIWB 4JM4H 3U0PA 2CK2A 1SVCP 3O2DA 1G9MC 5TPWH 1S3KH 4M6OH 3NH7H 4P2QE 1VERA 4KTEH 5I1HL 2E9BA 1XF4A 5DHVA 2CLVB 1RK0B 3PP4H 2EC9U 4NZRL 3SDCB 2VL4A 3VH8G 3P30L 1JE6A 3QUMA 2J88L 1NFIA 4R0LA 1UQSB 4PJAB 4LVNB 3TVMA 3R8QA 2LU4A 4U7KA 3ARYA 2WIMA 4LHJB 3F6LA 3NA9H 4UTBL 5TGBA 4CNIB 3O3AA 4Z0BH 2P46B 5ENWA 5DJXA 3KPOB 5IK3B 1IT9L 5CP3H 4Z7WB 3BPOB 5C2UB 4D0BA 2AXFA 1SJEB 1A0QH 3DURB 3EO1A 3OKKA 1KXQE 3JVGA 3QDMA 5GS2D 5TFSH 3UJIH 5IG7A 1OF2A 1II4E 4L8BA 2BVQB 4PLKC 1QRKA 1NUFA 4LCYA 3L3KB 2VZ3A 1IAOB 2YPKA 3B9KC 2BZDA 5D7LD 1OLZA 2H41A 1IGMH 1OTUC 1XF3A 2HFFB 3I75A 3UTTB 1JZ2A 1MREH 3BH8A 4PRBB 3T2OA 1HSAB 4WI4A 4JFHE 3NCJL 4MXVE 4G9FE 1IKFL 2MCPH 1IM9B 4FZ8H 4ZXBC 4ZUTB 3RL1B 4PJHE 3V7AE 2DRUA 4YDIH 1KGCD 4QRSB 3HFMH 4JKPL 3I6LE 2HKFL 3BZFA 4ZS7H 3HRZB 2DYPD 1GGBH 2EEAA 3VXOB 1BOGB 2ZNWA 2BCKA 3HN3A 4LSDA 4M48H 5KVEH 5DRXB 4ODXB 4MJID 2BHUA 3VI3E 2DIJA 3BKML 2GYSA 3UJTH 3I85A 3QFDB 1L7IH 5IROA 2R0KH 2F9BT 3GMLA 4G3YL 2R8SH 1FORL 1R5IA 3RWCA 5J0BA 4JFDE 3QQ9D 5F3HA 2P1YA 1X5JA 1DVFD 4QRRA 1E27B 4R7DA 4WFHE 1EFQA 5CJOL 3JWDC 1LE5A 4BSWB 3JV0A 2IGFL 2C9AA 2X4OB 1WUNT 3SE8H 4A6YB 4IRSD 3UTOA 1P84J 3O2WL 3T1FA 4RGMC 1OTSC 3C09C 1T20B 1W72A 1KACB 3G04B 1DUZA 4N0CD 3C5JA 3H9YA 2FCBA 4MNQE 2HKFH 4YX2H 3L3JA 4MA1C 5L0QB 4QTHA 4PJIB 1KYOJ 3Q0HA 1A9BA 5L2KE 4JZOB 4NDMB 3EYFB 3H9ZA 4XNYL 3MXWH 4GKZA 3WFCL 3LN5A 2G75B 15C8L 1ZS8A 3MJ7B 5EH1A 3ZDZE 2JIXD 1I8MA 4BUHA 4GH7B 4HJGA 25C8H 4JVUA 3KPLA 4L29B 4Z78B 2VSCA 2P8MB 3HC4L 5K93A 3TIEB 1LP9A 4NNXB 3P73A 4NO3A 1NH6A 1RVFH 1C5BL 4U3XA 3BPLB 3CFDA 3GM8A 4N9GA 5IBUG 1D9KB 5JPNB 2FZ3B 3V6OC 5D7LA 3MGTA 1A1MA 5J11C 1NCCL 2HJFA 5IJKC 3ORJA 5C0FB 3E8UL 5EPMA 4Y4KB 3RNKB 1S7XA 1EDQA 2IH1B 1DCLA 3U4BL 3C6SB 4P9ML 5TE6L 1T22B 5LGHL 3WFHA 5IEKA 3FZUD 4LLAA 2BXZA 3TZVB 5HPMB 2YPLE 3VWKD 2X4PA 4ELMA 2DYPA 3L5IA 2DL9A 2C5DC 5IIEB 1BHGA 2DM7A 5C3TA 3C6LC 3VDCA 1X6LA 5GGQL 1S7UA 4MJIA 4FQCL 1TTUA 1N4XH 1T83C 1EJ6A 4WV1A 4L8SA 1WF5A 1MI5D 1B9ZA 1A7BA 1DR9A 1BFOB 3BZDA 5EO1A 5GGRB 1ES0B 4F58H 3VG9C 1JPSH 5HHXH 5IVZB 4ORZC 4W70A 2DAVA 3FT2A 3FOLB 4N8PA 4OZHA 2BSRA 2DQEH 1EGJA 2GJZA 1DVFA 1OP3K 3MNWB 4RDQF 2H2PC 3GRWA 3QEQD 3PIQB 1H3XA 2ADIB 2E7BA 1QA9A 4IRSA 4IS6B 2PCPB 4WWKB 4RRPA 1P6AB 4P2QB 3FQWB 3C60C 5BV7L 1INQA 4GW5A 3VXPA 3TC9A 2X42A 1B6UA 5CSBA 1ZA6A 5JOFB 4Q6IC 2VAJA 2QSCL 5CILL 3MROB 5DUMH 3FCTB 4UT7H 4KHXH 2AK1H 3MLPA 5I8OL 3QRFM 4MCYA 1LNUB 3MMEB 3VU2A 1GHFH 3BMWA 3OXSA 4S1DD 4OZFG 3L6FA 4YHOL 2W9EH 1JNLL 1N8ZB 3VGGA 1UEMA 1QFPA 1GGYA 4Y5VA 3GHBL 2HVKA 1E28A 2ZUUA 2DI7A 3VWJC 4DQOH 2DWEB 1WK0A 2BNQD 2JIXA 2YPVH 3L3DB 3MRMA 2Q3ZA 4PV8B 4CKVX 4XXCA 1Q8MA 3IGAA 5D7JD 5A2IH 2A6IB 1QACA 3IXAB 3V52H 3BQUB 3KPMB 1MJ8L 4ZFGL 2L0DA 5DMJB 1FL3A 2OM5A 2ZUQC 3CK0L 1SEBA 1J0HA 3SKJL 3OTTA 3B8YA 1RJZB 3OR7A 4P4KB 2LABA 2VLKD 2MTPA 4FFZL 5ISZE 3MGOA 1FNLA 4GSDH 4P4RB 4O51A 2VH5H 4XWOC 1DBKH 2R15A 4HS6B 3B2UD 2AXHA 4XH2B 4ERSL 1UXWB 2YUVA 3HE7D 1X5GA 3CFBB 3OKMA 5CILH 4PJHB 5ICXB 2BNRD 3P0VL 3FN3A 2YOCA 1G7LA 2WP3T 5JUEL 3NPSB 3VWKA 4AEIL 3LIZH 1VKXA 4BZYA 5FF6A 2EXYD 5BW7C 2C3XA 3FO0L 1WAAF 2NY7L 2EICA 4AK1A 3TYFB 4YFLI 1KTLA 4YHOH 3GI9L 1JNNL 4N1CA 4JR9H 3GHBH 5EN2A 1MI5A 2BK8A 1AQKH 4L8CA 3EIFA 3HCVB 1T7XA 4PV9A 5B21A 2CDEA 3OAYH 4JFQB 2IEPA 2EKSB 4JFDB 1BZ9A 3LSOA 3MA7A 1TQCB 3A0OA 1IZJA 4QRTB 2D4FA 3SKJH 4XVUD 2EYSA 2Z93B 2W0LA 3MX0A 3QEQA 4LSTL 5CWSA 3MRIB 4R3SA 5E2WH 5EZLB 2R0WH 3CMOH 4DN3L 2CKBB 1OAXL 5E8DL 1N3NB 5CCKL 2X10A 3BSZL 1JN6A 1FNFA 4HIHB 1FAKT 4JFXB 4ERSH 2OTUA 4OT1L 2PNDA 3FQUA 4AH2A 3MJ6A 3BPNC 5C07E 1BREA 4MNQB 4IJ3C 1MWAB 2HJKB 4YIQB 5DVLA 2NY7H 3GZKA 4PJ9C 5HDQH 3SCMB 4HWEH 5L2KB 1CBVH 1EIBA 3GI9H 3TIDA 2Z31A 3FB8A 5M7QA 1WT5A 1QRNE 3QHFH 4WHTA 4R4BA 4OD2A 2D0HA 1A6TB 1OARL 5I74C 1RMFL 3MBXH 1I3GH 2BNQA 4PRNA 5ESQB 5C0DA 3T3PE 1MVUB 3NFPB 1NUDA 3DX7A 4QY8B 5D7JA 3PUCA 4NGHH 2PR4L 3BEVA 3QFJB 1ZXQA 2EE2A 4X4XA 3PGDB 3RIFF 5GHWH 3STLA 3W0WE 4OLUL 1U8KA 4M7ZC 4KI5C 4LKCA 1UZ8A 2CXGA 2FEDD 2VDPL 3V8OA 3MJ9L 1UB5B 4LSQH 4DUVA 4JO2H 1OAXH 3BJ91 5CCKH 2AP2A 5DSCA 1N59A 3RVXC 5AWNL 2HMID 3HE7A 4CMMB 5IVXA 2A9ML 2IPUG 2B1HL 4JGUA 3STBA 1YEGL 2BNRA 4YHYC 1A7QL 3TV3L 4LLMA 1YY8B 2YPLB 3GIVA 1T5WB 2XIDA 5H94B 1UCTA 3KPRE 1B4JL 1Y0LB 3BO8A 4NN6B 1LK2A 3CDYA 5B4MC 1BFVL 3T4AA 4IRZL 1T1YB 3DX6A 3ZTJH 5CJQH 1OARH 1LO5B 3K4ZA 1C12B 1I8IB 3BP5A 2VL5A 3FT3A 3ELAT 3MV9D 5ALBL 4BELD 4WTXA 5C71A 2L4OA 4D8PA 1NAMH 4M8VA 3BVNA 4YPJA 3EYSL 3RZWA 1MCWW 3BE1H 3X14A 5AAMA 5ACZB 1Q72H 1QEWB 2CIKB 4NQUA 2ZPKL 3FN9A 4OLUH 5C7XH 5CEXA 1I9RL 1AHWB 5E2UL 3VGEA 4WU7B 3MJ9H 3NZ8A 3RY6C 4TVPL 4DUXA 4JREC 3QCUH 3IDGA 2BSED 2W60A 1MHHA 2WQRA 2FR4A 5D71H 3IJHA 3AROA 1DLHB 1XGYL 1U8PA 4IRJB 1U58A 1IL1B 4UZGA 5KSAC 1JNHB 2R29L 2Y07L 5CP3A 1WLHA 2VDNL 2VZVA 1HI6B 3OKOB 1FZOB 1BQSA 5K9OA 4XPGL 1U8MB 3TBTA 1D6EB 1CICC 4LCUB 1QSED 3WNPA 4I9WE 1TZGH 4OM0L 2BHYA 4PJDF 3K8MA 1FFRA 1ZSDB 1GVIA 2XYCA 4QXTB 1VFAB 3KYKH 1RZ8B 3BPCB 3LKPB 3HI1B 1KB5L 1BFVH 4U7MA 2X6MA 1G9ML 1YN6A 4G6ML 4FQHA 2H26A 4FFWC 1M7DB 1FNAA 1ZHNB 1V05A 5DTFA 1EEYB 2GUOB 4MQXC 2VAAB 3ULVE 2P7TA 2QSVA 1L6XA 1CK0L 1LEKA 4X9FA 1TLKA 1I9RH 3S3SA 3FO2A 2EDYA 1A6ZB 3WN5C 4PLJD 4U1HB 4U1JB 3SGEI 5I15L 2NNAA 1UKQA 2CPCA 4DGIH 1DBML 2ERJC 2ARWA 1K2DA 4PJEF 2J3SA 1HQRA 3ZO0A 2OTWB 1KOAA 3G5XA 4AEHL 5JHDD 4OCWH 2R29H 3RVWD 1RUML 4N8VA 5IB1B 1VACA 4ZDHB 3LRGA 4CAGA 3MRFB 1CF8H 2FYYA 3TA3D 4WEBL 4EBQL 2H2SD 4CADA 1XF5B 5J1AA 4DZBA 1F2XK 1A47A 5H2BA 43C9A 1XF1A 1QPPA 3VXUD 1TVBB 4NCDA 5DO2D 3KPSE 4XP5L 3LZFL 1G9MH 4G6MH 4KDTC 5D8JH 3GJFH 4OGAC 5IJVA 4X99A 3LS4H 4RMRA 3MV9A 2P24B 4MB3A 2DM2A 3CFJB 2PYEB 5CBAA 5MERA 3NABL 4FMKA 4QRUB 4LRIA 2BDNL 3WO4B 4WI5A 4JY6B 1CK0H 4QHLB 2XA8H 1UWXK 3OKNB 1L0XA 3KJ4C 5IKCA 1D6VH 4X5WB 2Y72A 3BEWA 2D9QB 1A4KB 5T3XH 1KFAH 5I15H 4UTAL 4OCNC 1IGCH 2ZG3A 1NGQL 2HT4D 1ROWA 2PTTB 4MXQC 3OSKA 4XNUH 3EYUH 1QVOA 1ACYH 1SYSA 1P1ZA 1CDCA 4F15C 2FSEA 2WBJB 3ARDC 3ME0A 1I8LC 4WEBH 2UY6A 5C07B 2PF6A 4EBQH 4FQLL 1SM3L 4MDIB 1CLOL 2WK2A 2ZOKB 4NT6A 4U1MB 1QSEA 3L3OB 4J4PC 5CGMA 4RGNE 5EB9A 2N7BA 4NM4H 4RAUA 4Z95L 2VDKH 3JWDL 2XWJA 5DURD 4OKVB 4PJ8B 3S5LA 3DLQR 1QSFD 4GG8A 1NGZA 3DWTA 1MLCB 3VFMA 4J2XA 3O9WC 1CXLA 5I66A 4PJGE 5HGBA 3C5SA 5EOTA 4A6YL 2JB5L 4I0KA 2BDNH 3EO0B 3HS0A 5FO9B 4NKIH 1KCLA 3JV4A 4YHIA 1UC6A 4HX1B 2IPTL 1AGFA 3I6KB 1WBXB 4L3CB 5KW9L 4NJ9H 1JTPA 4Y89A 1MLBB 4I0PD 3AS0A 3BP6B 4R7NA 4RBPK 3W0WB 1EVUA 4UTAH 4IDJL 3MLXL 4HKJB 2E9JA 1TJIL 2NY5H 5I0DA 1KN2L 1XZ0A 5BRZD 4DWHA 1ETZB 1BQUA 3CLFL 2CR6A 2ORBH 2FECL 4ZSOE 4NPYA 1U92B 5F7NC 2DQHL 4I4WA 3IJSB 3BX7C 1KENL 2YD3A 5FKAB 3UTSD 1EK3A 2AK4D 5JHDA 1KIRA 1ZHKB 1S78C 2H32H 5LGKA 3D0LB 1GYAA 5ADPL 2NLJB 2R1YB 3TA3A 2FO4A 1IAIL 2Y6SC 3ARRA 2XZAH 4FQLH 5T1LB 3UP1A 2YR3A 3I3BA 4OM1H 4OAWA 1QG3A 1X5HA 3CDFA 1WZLA 4XTRC 3SO3C 4D0DA 1L0YA 1E4WL 3DARA 1BD2D 2D7OA 2XPGB 3UTZB 1UM4L 3VXUA 2RAMA 5E2VH 3ULUE 5AZ2L 1CU4L 3KPRB 3F12B 4HGWB 4JKLA 2IWGA 5F96L 3H9SD 2I60H 3U79A 1CFVH 3QDGE 2PW1B 3FFCD 5HVGB 1NBVL 5DEZA 3VFSB 5MEND 1JV5B 1ADQL 5B38B 3D0VB 5I8EA 4KK6D 5KW9H 3PP3H 1J5OH 2HTKD 2N56A 4JPVL 1H15A 4M3JA 1B90A 4OUOA 3GNMH 3EOAB 1U42A 5DJ6A 3SDXE 1TJIH 2OMBA 5DJYA 5INCA 5INDA 3U7WH 3DVGA 4POZD 3C87A 4F7CB 3WE6B 4OLXL 4HZLB 1KELL 3S98A 2NY4B 2DQHH 4XT1C 1OQOA 1KENH 4OKDA 1R3HA 2XTJE 1NMCB 5F7MC 4U1IB 5GJTL 1ZT1B 5FCSH 4LVHB 5FO8A 2MWCA 5ADPH 4H0IA 4U1LA 4XP9H 3WO3B 4NQCE 2JE8A 5GGVL 1ZT4A 3GSVB 4K07A 4Z7UF 1E4WH 1AGDB 3OKLA 2DDQH 2OSLB 2BNUB 2YD4A 5AZ2H 3TPUB 4XCCH 3VA6A 4EDXA 3P11L 5E5MB 4NZUH 5D1ZD 1QSFA 4P2RE 4P5TA 5IHUL 3VJ6A 3DYPA 2AI0L 3SDDC 1KJ2H 4EIZC 1NBVH 1I7ZA 4ODSL 5DA0B 5SWZD 4LVOC 3UYRH 5CZXC 5C0EA 4GAFB 4KUCF 1P5UA 4YDLC 4HW6A 1FVCA 3DV6B 1L7TL 3LN4B 4PGBA 1UCBL 4OZ4B 4KJPD 4I0PA 3VH8B 2VIRA 5DQDH 1F4YH 4JFOB 3O8XC 5I9QC 3ARGB 4HC1H 5BRZA 5IHZB 3ARZA 3K81A 4PBVC 4P9HC 3VGBA 1F3DJ 5I1GH 1YEKH 2FGWH 2V5RA 2W9DL 1WTGT 3UTSA 3K74B 4BKLB 3QWRD 4JZNB 5EC2B 4WIQA 1XF2B 1FFPB 3QULA 5BZDB 3HE6A 5IF0A 3UZQA 5K33A 3AAZB 2KKQA 1A6AB 2HRPH 2GTZA 2OP4L 3NN8B 4NUJB 4YAQA 5EU7C 5JIHA 3RVVD 5F7YC 1KTRL 3NPZB 4NYLB 4XP6H 5A16A 1G7MA 4HS8H 3P11H 4HIIB 1F90H 1S5IL 4PJ5E 3EJZC 1OAZL 5IHUH 3W81A 3H9SA 1T1ZB 2AI0H 3V2AR 3K8LA 2Z8VC 5JR1L 3FFCA 1UH4A 2YXFA 1ACZA 1LO4H 5TF0A 2F53E 4UT6H 5GRJH 3TT3H 5MENA 3LKRB 3WHE0 3WIHH 2VLJD 4F7TA 4YHPB 3GKZA 4TTDD 1PKQE 1C5DB 3FTGB 4HPOH 5A2JH 1K6QL 3CUPB 4YGVB 3JWOC 3GSOA 2NY2C 3QAZC 3MNVB 3QPXL 3VXSB 5F6HI 4E5XA 4LARL 4WFFD 4PRPB 3OHXB 2R69L 1A9EA 2ZUXA 3FN0H 3QEGH 4WFEE 2XZZA 4GUPB 4KKLD 8FABB 3CDGA 3LH2L 4ZQKA 2ARJA 2ICEA 4OLVL 5E6ZA 4NQDD 1U41A 1HWGB 4MB4A 2ZOLA 4LLQB 3RTQB 1HYSD 4OCYL 4KROD 3KGRA 4JM2B 3KDMB 5A40E 3V0WL 4RGNB 4WNQB 5EZJB 1JMZA 4XPBH 1OGTA 5D1ZA 3S8WA 2V5YA 4UV4H 5D2NA 1E4XI 1DQJB 1I85C 3CU1A 4TVPD 3B4NA 4YQXH 3QI9B 2JCCE 3EO9L 3ZKMD 3QO0B 1FN4A 2E6QA 5EOQL 3Q2CA 3DXAD 4KRPD 1XGUA 4I13B 4LCCB 2CIIA 1YY9D 2P42B 3MJ8A 4GS7B 3U7YL 4DVRH 3ZT6A 4Y1AE 3GHEL 5GS0C 2PXYC 4PG2C 3EDFA 3LRSA 5LGJA 2A74B 3DX8A 5E08H 4DZ8A 3S4SA 4X7CC 4AIZB 1CD9B 5C0AD 3CVIL 3UJJL 1MWAL 1GGCH 1XMWA 4LSSH 5TH2B 4I5BB 5DVOA 5A3IC 3DUUB 3LH2H 1KLFA 3MCLH 3QWRA 4OLVH 2P8PB 4X7SL 3S97C 1YEFL 4K3JH 2J8OA 2Y5EA 2XV6B 2MSPA 1NAMA 4MX7B 1PG7H 4G6JH 2ICWB 1Z9OA 1HHGA 2VXVH 4PJFF 3AS1A 3V0WH 1X5ZA 4M7LH 5DQ9B 5FO7A 2DTML 1J8HB 4PJBA 5FAAA 2WUBH 1NGPL 3PXHA 4KPHH 5T3XD 3MJ9A 5IBUB 2PN5A 3QDGB 3TFKC 1J1XH 4OJFL 4G43B 5F70A 1FH5L 3UO1H 4OCXH 1XT5A 3MCKA 1XR9A 3MYZA 5K9QG 3Q5TA 2X4TB 3G08A 3QXVA 4NC0B 1WCBA 2VLJA 2CDFB 1G6VK 2QBWA 4WW2F 2DMKA 4KKNA 2R2HA 3S7GA 1HDMA 4N8CL 4POYA 3BAEH 3BGMB 1NGWA 3SDXB 1B2WL 3CVIH 4JAMA 4CMHB 3CJJA 3GFUA 3Q6FB 5IHLB 3VXRE 1AGBA 1F11A 3RZCC 4HWZB 3B9KD 3RX8A 1U8HB 1PYWB 2OJEB 1OTUD 2PYFB 3N85H 1M05A 3NCFB 1AFVL 1WFOA 2J8UE 3C9NA 1OP9A 1JPGB 4IDLA 4NQDA 4NWUL 4ONFH 3IDJB 4JANB 1WZ1L 1MCLA 4NQCB 1KXTB 1F42A 3OJVC 5GQBA 5LQBH 4HCRL 5HVWA 4XC1L 1JF1A 3OGOE 3NIGE 3HUJA 3CH1A 4WUUA 4LPUA 1GGIL 2JJTA 3IXTB 4JRXE 1V5JA 4YBLB 4KAQL 3KWWA 3RL2B 3UAJC 1NAKH 1RY7B 4P2RB 1NUNB 3NBNA 4F80A 2DLHA 4NQXA 1IC1A 4JLRB 2DQUH 2QADB 3DXAA 4OF0A 3IAPA 1MY5A 4S0SD 3TYGL 3G9AB 5I73C 1A3RH 5K9KA 1JGDA 3GO1L 1ZTXH 4XC3H 5F97E 3VCLA 2J2ZA 3TNMB 3RWEB 3BW9A 1B2WH 5D1XD 3QHTC 5C0AA 5C86A 3QXDB 5HI4D 4WCYH 1JGLL 3GK8L 4JB9H 4PY7B 2IADB 3GSRB 4Z7VA 4XHQA 3LKOA 4HLZG 5F9JA 1AFVH 2Z8RA 4J3UA 3VD9A 4OZFB 5HYSA 2FWOA 1NMAH 3GJFA 1D3CA 1OTSD 1WZ1H 3MLRL 3CD4A 3AMKA 3BDYL 4NKOB 1XIWC 1ED3A 1FZKA 1MJJB 4QCIB 3PNWA 4DKEL 2A83A 4DCQB 3DBXA 4WU5B 4DKAA 1AP2B 1I9EA 1CT8A 4JPIB 1TQBB 3S88H 5I8CB 4M6NH 3DHMA 5DJCA 3QUZB 4KAQH 4CN1A 1X5FA 5F72S 4J8RA 4GMSL 2A0LC 2A9NH 4RCAA 4UQ2A 4IMLA 4WHYH 4M61B 4S2SB 3TN0D 4LEXL 2YD7A 4HUWB 5AG8A 2DQIH 3B9AA 4UAOB 2I5YH 4OUUA 5GRVL 2NPLX 1UM5L 1BM3L 3HZVA 2D9CA 3RGVC 4Q6YA 1PKQB 4E42A 2GITA 3VE0B 1KIQB 2UWEA 5E7BA 1EMTL 4OQTH 3LMJL 1JGLH 3GK8H 4CU8A 2YMXH 3B9KA 2CJUL 4BH8B 3W39B 4GRWH 3TO4B 1BVLB 4EI6A 5EULV 4Z77A 4YC2C 4D3CL 1TVDA 3TNNB 5E2JA 5AUMA 2EDDA 4HT1L 3VFOB 3MRLA 5ILTH 2HA1A 4UILL 3CLEL 3VGAC 1F3DH 3MO1A 4TUOB 4LKXA 3RU8H 5DD1L 1WZMA 4OFPA 3MBEB 4M93B 4P23C 5KSVB 1XCQB 3T0WA 2G5BB 5FYLE 1H0DA 1D5BA 5EG6C 4L4VE 4GMSH 3C6LD 2CRYA 5EOCJ 1YYMH 5HYJD 2JCCB 5C2BL 1P7QD 2DBLH 4ZOAA 5C92A 1BM3H 4PY8J 2GSIA 3SKMB 2Q76B 4Y1AB 3D25A 1G9NC 4PJAF 3D6GA 4WO4B 4Q9RH 4M6AA 1JWMB 3G5ZA 3H2WA 4HH9A 3LMJH 2X41A 4UB0L 3NAAL 3FQRB 2H2PD 1B3JA 3MLVH 5CD5C 3B5HA 4Z7WF 3HC0A 4KMQA 4RNRB 1VFMA 4HT1H 1DBAL 3C60D 3U0WH 3KAAA 1MHEA 4UILH 1AGCB 4FRWA 4OGXL 4U2ZA 4Y4HD 1IZKA 4K94H 4JKWA 4JE4B 5BQ7B 1BJ1J 1OCWH 5DD1H 3DGCR 4MNHB 3PQYD 1CLYH 1UYWH 2K7PA 2R4SL 3K1DA 3JWNC 5KOVC 5L6YL 3LRHA 3ULSB 2O5YL 4YWGH 4EOWL 4GXUM 5JQ6L 2XWTB 1NLBH 3TN0A 2C1PA 4RQQA 4MB5A 3ARFB 2NW2A 5DI8B 2OL3B 1TCRA 4YGAB 3HI6L 5AAWA 1Q9OA 1QFHA 1OD7A 1N7ML 3CNKA 4ZOCA 4BZ1H 3BXNA 4XPFH 5E2TH 3SKNA 4JRWA 4RA0C 3HZYA 1TCMA 2EDBA 4O5LL 4UT9L 4JQIH 3IDMA 3V6OA 3VXRB 2V7HB 3QIUB 3DSFH 3QCTH 4OZGE 5DD3H 1I8KA 4O02L 5SWSD 1KG0A 5F7DA 2VC2L 5IQ9A 3CC5B 3SOBL 1YNTA 5DWUL 4M1GL 1Q1JH 2P44B 1EEZA 5CSZB 3FQXA 5IFHL 3VG0H 1UJTA 2EYRB 3SE9H 1RZGA 2K1MA 2Y5TA 1CCZA 2R4SH 4JRXB 1IM3B 1ZWIA 3LKSB 2A6KB 5HGAA 4R90H 1J0YA 3IJYA 1GOHA 3C6LA 4NWTL 5JO5B 2LU7A 4LF3A 4HC1A 5HHOD 1YN7B 5HYJA 3OAYK 4M5ZL 2B7DT 3NCEB 1QLFA 2XACC 1T83A 3UMTA 2DKUA 1P7QA 3DIFA 2F54D 3EZ8A 2F58L 1LMKA 4YO0B 4BFIA 3QHZH 1AC0A 2R2BA 2JELH 1A1OA 3HI6H 2OXHA 2BVUA 4MDJB 4XZUB 3VXTB 2IAMC 4PJIF 4JFYA 4N0FB 5K59F 1CXIA 3MRCA 1ZLSH 3RPKA 4FQXC 1I7TA 4XNMB 2A1WL 3PJSA 2ADGA 2I07A 4LNRB 2XKUA 4U49A 3QCVL 1F6AB 4O02H 1U93A 5HHQA 3C2AH 1EO7A 4FXKB 2UYLA 4KJYA 1MHCB 2VC2H 3OF6D 4WY7L 3C60A 3SOBH 2R0ZH 5DWUH 1J9CT 1TETH 3IDIB 5I17A 5JOPE 3BIAX 1I1CA 4NRZB 3INUL 2JK5A 4JFZH 3SY0A 4Q6IA 3TO2B 3ABZA 3WIHA 1X7QA 4DN4H 2DMBA 1X5LA 3FO1A 3PQYA 3T0EE 2DJ4A 2Q8AL 1FC2D 3SJVB 5FOBA 2NY6C 4NWTH 4PJ9D 4I48B 1H3PL 2G9HB 4M5ZH 4K71C 4KQ4L 5HHMD 5KAQF 2QHRH 3WEXB 5LAXB 4U05A 3VWJA 1RULH 5HHNB 1MAJA 4H25A 2HRLA 2FJFA 4XVSH 4FQQB 4YXLH 3H9HA 1NC2B 4KUZH 4NP4L 1NCWH 1UJ3B 3R4DA 4Z7QF 3GSNB 4KC3B 1S7WB 1BPVA 3MR9A 4JDTH 2YKLL 3Q3GB 4MZ3A 5IMKA 1Q9LA 2A1WH 4ZAKC 4XWGH 3IU3B 3V4VL 1AGEB 5TDOA 5DDHB 5F9AC 3QCVH 3WIFA 4AENB 1CL7L 1IGYB 5I0ZA 3DNKA 4YBHA 2LTQC 1Q94B 4MQSB 1BJ8A 4WI9A 5LBSH 5SWSA 2NX5D 5T3ZH 3BYTA 4ETQB 1DQLH 2Q7YB 4B7IA 3U4EA 1P84K 1VGKA 3ZT5A 4XCFH 4X80L 3PHOA 4QHNB 1MFEL 3QRGL 3S36L 1MF2L 2W1NA 5FA4A 4V2BA 3OB0H 2V2XB 4PRAA 3V6ZB 5J57B 1AO7E 2Q3AA 1JVKA 3JWOL 3RWIA 5BW7A 4MYWB 3THMH 1JRHL 4P9HH 4YE4L 1GCFA 3BGFB 1YEHH 1KYOK 2GJ6D 4L4VB 4X6DB 5DD5L 1MCNA 3CXDH 4HWNA 4KQ4H 5B4MD 2F54A 3G5VB 1QP1A 5EO9A 3HG1D 5KSUB 2XQBL 4UMGA 1NLDH 5IGXL 4X7DC 4XBGB 4LSPH 4JJ5A 1S7VA 2B1AL 2IANE 4NQVB 3H42L 3C5ZD 4L3AA 5HYQB 1BLNA 3I02B 1I1AB 3NIFE 5EOCL 1QFWL 2DOCA 2GSGA 4G7VH 4N8VG 4RMTA 3V4VH 4EUPH 2YC1B 1S9KC 1W8NA 3QNZB 1HHIA 4JJHA 3V5KB 1IRAY 3WJLC 1HCFX 2H1PH 2QL1A 5C0GB 3OF6A 5D7SL 3EDJA 3NZHL 2W07A 4KU1A 5MI0B 4TN9A 5KSAD 1MF2H 1YQVL 2MKLC 5GS0L 5FA3A 2XKNA 4BQ8A 3A6BH 3MREA 3ZDYF 4GMTH 5T1MB 3L3HA 1MOEA 1ZHLA 1CICD 1DBJH 4NHUA 1JRHH 4HK0A 2HFTA 2NMSA 2W0KA 4PJ9A 3CX5K 4W4OC 2X1PA 5C0IB 2DLEA 5DS8A 1WJ3A 1O5DT 2C1OB 5IMMB 5T33H 2WWKT 2C4FU 4ODWA 3WFEL 3ILQC 2FX9L 3BH9A 5CKAA 3GSWB 4FFWD 1WC7A 3UPRB 4PJHF 4ZUSA 2FIKB 1K5NA 1NEZA 1R5VA 4JCLA 4JO4L 3H42H 4MQXD 5DD6B 3LEYL 3QUYC 1OM3L 5FUZL 5EOCH 2ED7A 2VDOL 3TBSB 3QO1B 3AGVA 5DD0L 4G7YH 3IDYB 3REWB 1ERNA 4JDZB 3MRNB 5FGCE 2QR0A 3OWEA 5H8DA 4B41A 1MRCL 3DYMA 3D9AL 3ZYIA 3HZMA 4OZGB 2NX5A 3PL6B 5D7SH 3UTPD 3GUTA 2J12B 4HUKB 5CINH 3NZHH 2BSTA 3BWUC 4NQED 3WNOA 3QEUA 4L9DA 3QQ3B 1YQVH 3DUSB 3GMRA 5IBTH 5GS0H 5BZWB 1ZE3C 4LEOB 3RVTC 1VCAA 2WIIA 1DE4B 4U31A 4YHLL 4KRMB 3GJFK 5EU3A 2D7PA 1N5YH 4FTVA 2GJ6A 4C83B 3U30B 1HK6A 4EN3C 1RZFL 1QLEL 3WFEH 1BJ1H 1A3QA 2C3VA 2JKXA 1HQ4B 2IBZX 3HG1A 2DQCH 1H5BB 4NNPL 5GSVA 1ZANH 2AQ1A 2XOTA 3IS1X 1UB6A 5IW6B 3RWFB 5HHVH 1RUPL 3C5ZA 5FUZH 3QNXA 3L3IB 2BOCA 3OKEA 3S35L 2VDOH 3STZA 1VEPA 5T5NF 4JEGB 4PR5B 3T77A 2YK1L 5DD0H 3EOTH 3K4AA 3UTQA 4MA7L 3RBSA 4R2GD 2Y23A 3MYJB 5I2IB 1TZIA 5AD0B 1VFOA 3RY6A 5FECA 2Q6WA 3HNTH 5T5FL 3ZDZF 3UPCA 2ITDA 4MXQD 3B5TA 5FUOL 4V2CB 3OKDA 4YDJB 1CE6A 1AHWC 3NVQA 4XGZB 5KSAA 3TJHC 3KXFB 3LKQB 3ISWA 4LSRL 1JHLL 2FATL 4JZJC 5ICZB 1MRDH 1CICA 4Q9BA 3L5XH 4LBEA 4UU9B 4J4PD 3T0EB 3GB7B 3FFDA 5C09D 4MJ2A 1QLEH 4OQTA 2XWBA 2AXGA 4XCEA 4YHKH 3V0VB 2GTWA 4Y16D 3O9WD 5HVHC 5I1DB 4ORGB 1RUPH 3WV0A 4HPYL 5D1QC 2NY1B 2ITCA 2OBGA 3DV4A 1X44A 1KPUA 4P2OB 1IAIM 1S9YB 1H8SA 2YK1H 1SJHB 4HULB 4WTZG 1KSRA 4OI9A 1NC4B 4TSBL 1OW0C 3RHWF 3IF1A 1N2RA 3BP4B 3WN5A 4PRHB 3CVHH 2EDQA 4F33A 1OGAD 4I77H 5DEGA 2WV3A 1WISA 5I16A 5FUOH 4UIKL 4F2MA 4OZHE 1U8QA 5F8RC 1NJ9A 1QTYT 4NQEA 4W81A 2D03L 3VRJB 4PRDB 1VESA 4OIBA 2QQNL 1Q38A 4E0RB 4P59L 4LSRH 1F45A 2Y6SD 1JHLH 2FATH 3QXAA 5I6XB 5JOEA 1AO7B 2UVFA 4FQ2H 3TCLA 4XTRD 2X9XA 1CVRA 3Q5YA 5DHVB 1U8NA 2V9QA 1I3VA 1RD6A 3QUMB 5EWIL 1NPUA 4KUCD 3EYVA 4KDTA 1E6OL 5CEZL 1NFIB 2IJ0C 3PP3K 4R0LB 1RZKC 5JTWA 5E8OA 3TVMB 5J56B 3KYMA 1GIGL 1SVZA 3ARUA 1DSFH 5FM4A 1MFDH 4QOKE 2IANB 5LG1A 2OLDA 1D5XA 4N1HB 5BJTA 1X5XA 1OAQH 4J3SA 5SX4H 5ENWB 4K7FA 5DJXB 2JJVA 3VXMD 3N1GC 1EVTC 4NO0D 5J6GA 1FGVL 2X4RA 4PP1C 4D0BB 4ZTOL 2AXFB 1QBMH 1DLFL 2H9GB 3EO1B 5IQ7L 2IG2H 1J1PH 1O7SA 3MRRB 5DLML 5IG7B 5C6TH 2DM4A 4PS4L 5L7XL 4L8BB 1TENA 4WW1A 1UACH 4LCYB 4LP5A 4QHUA 1SMOA 1I8LA 4ZOBA 5AYQA 5A43C 4H8WH 4M7KH 2YPKB 3P4NA 1HHKA 4TRPH 3O0RL 2EH7H 2YBRB 1ZMYA 3OJ2C 1XF3B 3I75B 4J4PA 3BH8B 1NANI 1DN2A 4K3DH 5C09A 4OFVA 3D18B 2PTUA 1KTKE 1OQXA 43CAA 1E6OH 2IFFL 2LFGA 2YWZA 3SDDD 3O9WA 5T3ZD 1KLUA 1GIGH 3BZFB 5CZXD 1HH9B 3LEXA 5DMIH 2JTDA 1KJ3H 3VXQA 3RY5A 2A6DA 2BCKB 2ATKA 2EIBA 1MCOL 3VD7A 3R1GL 2YD5A 5FGCB 2E9IA 4PB9L 1TJGH 4NOFA 2VWEE 3O8XD 3BKJL 3LQZA 4Y19E 1OGAA 4TQEH 1EHLL 2YRPA 5EFIA 3GMLB 4PPTA 1R5IB 3RWCB 5KSBE 5L7XH 2XZQH 4JY5L 1FAIH 4ZD3L 1R6VA 5IP4A 3V5HA 4Z7UA 3NTCL 1BQLH 1ULVA 1HHJA 1G9NH 1Y6MR 2GFBA 3E3QC 4R7DB 5EU6A 3O0RH 2FD6L 1LE5B 1CGVA 1F8TH 1A14L 3CFCL 3V4UH 2OL3L 4C56E 4DK3A 5ESVA 2YRZA 3PWVA 3WNNA 4Z7NE 5IB5A 2IFFH 5J12C 3H7LA 3EJZD 3HAEG 4LOUC 4YXKH 3O3UN 4X8XA 4ZFFA 1KJMB 3FO9B 1KT2A 4NKDA 1P9MA 3L3JB 4QTHB 4YHNA 5I30L 1OAUL 1R24B 3GI8L 1EBAA 4YUEL 5EO0A 2KL6A 1FZJA 4X98A 1KEGL 4WVRA 1FRGH 1GPOH 5E6ID 1ND0A 3LN5B 5T1DL 3ARBC 1LDPL 2I26N 3R1GH 1KN4H 3VXMA 2YD8A 4PB9H 3OR6A 4NO0A 3RIAK 3BKJH 1ZGLA 2FJGB 2R9HD 5I1JH 2NY2D 4TULL 1EHLH 5F1IA 2DQDH 4HJGB 5CZKA 1ZOXA 3QR2A 4OLZH 4MGXA 3MA9L 4KY1H 1L9NA 3AC0A 1LP9B 1Q0YH 1U3ZA 1W0YT 4ZD3H 4WJ5A 2VB5A 3NTCH 4NO3B 1T21A 3CFDB 4NKMA 3MJGX 1WBZA 5E1AA 5D7LB 3MGTB 3WNMA 1A1MB 5TQ2L 2HJFB 4LCWE 1HH6A 1HKLH 1CZ8H 2NY3B 5EPMB 1S7XB 4OCLC 1N0LA