2OT3B

Crystal structure of rabex-5 vps9 domain in complex with nucleotide free rab21
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
166
structure length
157
Chain Sequence
AYSFKVVLLGEGCVGKTSLVLRYCTTLQASFLTKKLNIGGKRVNLAIWDTAGQERFHALGPIYYRDSNGAILVYDITDEDSFQKVKNWVKELRKMLGNEICLCIVGNKIDLEKERHVSIQEAESYAESVGAKHYHTSAKQNKGIEELFLDLCKRMIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rab5 GDP/GTP exchange factor
publication title Structural basis for Rab GTPase activation by VPS9 domain exchange factors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 58
structure length 157
sequence length 166
ec nomenclature
pdb deposition date 2007-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2ot3B00
2DFNA 1KI6A 4QG7A 2XITA 1DE0A 4JYBA 1NN0A 4X8OA 5LDDC 2ZI4A 1KDPA 5EUQB 1W4AA 3THOA 2QMHA 4DRZA 1WA5A 1Z07A 2DWQA 2QPAA 8OHMA 4F91B 4E07A 1OPXA 4CT5A 1KJYA 2OSBA 1J8MF 1I4DD 4WZ6A 3VX3A 1ZCAA 4TMVA 2GJ9A 2AXNA 3OHMA 3H86A 3FOZA 3VQTA 2O8DB 2GA8A 1WB9A 1YHNA 3B1XA 4LCBA 1JPNA 3CZPA 1ZNZA 4ASUA 3QQ5A 4ITRC 3LX8A 1G5TA 2UKDA 4CEJA 4KBGA 4EPWA 1HUQA 1NKTA 3RS5A 1U98A 1GITA 1ZUHA 1KSFX 2C99A 1XCGB 2WPDD 5HCNA 4B35A 1U0LA 1J2JA 2H92A 3QI2A 2FPKA 2ZJ5A 2J41A 1NVXQ 4GP7A 1I4TD 2HJVA 4M2LA 5FPKA 4DLVA 1XZPA 4EPXA 2IYSA 4TLAA 1PLJA 1GDDA 3QXXA 1PVOA 5IT5A 4H1VA 3UANA 2VA8A 4JVMA 4UNPA 1NSTA 1GNPA 1GKYA 1C9KA 3OE7A 2J7KA 3GMTA 4GFDA 5CIQA 1TF5A 3U60B 2QP4A 2P2LA 2D74A 2WM9B 4Q00A 4CIDA 1U0JA 5F3WB 2PCJA 2VQSA 4M1MA 2BBWA 1QF9A 3LBIA 3OAAD 4NH0A 4QBIA 3AQ4A 4D0GA 1OT3A 5JECA 1A5TA 3ICQB 5D3MB 2ONKA 1IOZA 4RJLA 3IILA 1TEVA 2AFIE 4XSGA 1W4BA 2ZANA 3ZIAD 1R5OA 1NG1A 1AKEA 1E79A 1NVUQ 3U6BA 4S35A 5AWFC 3SDZA 4WA7A 4WOPA 2F9MA 2G1JA 1DO2A 1T8UA 2VIIA 2VSOA 4BFXA 3A37A 2REXB 4AIIA 3LH5A 1GILA 1RFLA 3U4QA 1HQCA 5KSZA 1YKSA 1FP7A 4QGHA 1G17A 1E0AA 3E70C 3TK1A 1F48A 1KAOA 4X8LA 2JJ8A 2GDJA 4G5SA 4IVPA 4LYHA 4DSTA 3TLXA 1Z0AA 4KV9A 1RE0A 2IHBA 2X2FA 1QHGA 4LDJA 1D9XA 4QHSA 4NDZA 2OCAA 2FZ4A 2ZRLA 1J7KA 4LHZA 4Q02A 4AK9A 1SHKA 4F92B 4WAUA 1HYQA 5JS7A 3A1VA 2YINC 5KSYA 4OI0A 2B8TA 4XTRA 3VHXA 1G7TA 3EX7C 4RD4A 4OK6A 1ZD1A 2ZQ5A 2V4ZA 4GOXA 3FKQA 3RAPR 3RRMA 2QAJA 3NBYC 2ZRAA 2NOAA 5BYKA 1J8YF 3GFPA 4OHWA 4DCSA 5FR1A 1YVDA 2ZS7A 3X1DA 2REBA 2JJ1A 3D8BA 2GJKA 5TV2A 1E94E 1AQYA 1EK0A 2F7SA 4B2LA 3EZ9A 1C1YA 3QPUA 4B6EA 2VTKA 1LW7A 2YWFA 1LFDB 1ZM2A 1EFCA 4IKEA 4B48A 1M74A 4MGYR 3DO6A 4BUJA 1E0JA 5DE3A 1GM5A 1P73A 2LWIA 2FFHA 3SJCA 4Q9HA 3V4FA 1TU4A 4GSYA 4BECA 4DSOA 3FGNA 2C03A 4CVNA 4EFLA 1E4YA 4RD3A 3FTQA 3ZGXA 1TUEA 1EFTA 3IKJA 5CK4A 1Z22A 4BWYA 1NLYA 5JFGA 1T3SA 3CRQA 4KXFB 2XX3A 4W5WA 2CLCX 4E5UA 1UKYA 4KBFA 3GQBA 3QF7A 1G6HA 2ZR0A 5DNYB 4US0R 4Q1DA 3X1YA 2A30A 1ETUA 3L0SA 4IDOA 1E99A 5A4JA 5JCPA 5C18A 1Z6XA 1W46A 3QG1A 3OFNA 3OIWA 4P4SB 4TYQA 5LD2B 3LAWA 3THYB 3TH5A 4I1OA 4X8MA 4TMKA 3BFXA 1CF4A 2AHOA 2Z6VA 4JLMA 3CNOA 3TSZA 1TQ4A 1ZM4A 3K0FA 1Y63A 5UKDA 5JEEA 5JBQA 4OJKA 4MUAA 2CMKA 3GLHB 4XWOA 2Q3HA 4IFBA 4M4SA 2GHIA 1G19A 3K0SA 3ICEA 4FWTA 1KMHA 1OJLA 1G3UA 3QIAA 3S1AB 2NO0A 4NONA 4XJXA 4M0LA 4LBVA 4D81A 1R6BX 3OEEA 1AS0A 2GEDA 2HV8A 2ZJ2A 2OLJA 4JL5A 1SVKA 2XGJA 4M9QA 1QHHA 2PMKA 1GTVA 3KKOA 2QN6A 2RGNC 1X6VA 4Z1MD 4L4UA 3G5UA 4CF7A 2DFTA 3DHWC 4B3FX 4FWIB 2ZI3A 4IJMA 2ZRBA 5H70A 5FUXA 1OH5A 4ZKDA 1UBCA 3UATA 2GXQA 1PLKA 2C8VA 2C98A 3NBFA 3T5GA 3TR0A 2OV2A 1VIYA 4PX9A 3THXA 1XNJA 2DWOA 2OE2A 3WHLA 3KXKA 4C0JA 4HB0A 5HZKA 4OYHA 1Q1QA 2GCOB 1U81A 2PLRA 3I61A 1S9HA 5LB4A 2H8KA 4ZIRB 1KI8A 3KXIA 3QXHA 1V5WA 4AD8A 3DL0A 4Y0VA 4LYFA 3A1UA 2OCPA 2R9VA 2ZE8A 4TL6A 1COWA 1X1SA 1NVVQ 4E22A 4UNNA 1P5ZB 3Q3JB 4NL4H 3BB1A 3NC0C 1OYYA 1AZSC 2IS2A 2JCSA 4C0SA 3AVQA 2IS1A 1XTIA 2SHKA 2J9RA 3IQWA 4ZCLA 4ZDIA 3UMFA 5HZHA 1DTSA 1CRQA 5A0FA 1D2MA 2J1LA 1T3LA 3MRSA 4PHHA 5FPTA 3WNBA 3KKPA 2MSEB 4BASA 5L3SB 2WIBA 1RZ3A 2P5TB 1TQ2A 3GJ6A 4C30A 4OQNA 3MWJA 3SJZA 4B34A 1NLZA 3VKGA 2Q21A 5E95A 4PFSA 5GJBA 3B13B 1YU9A 3LQRA 1R0WA 4PAQA 1XD9A 3GFOA 4NCIA 4C0KA 4DCTA 2ZRHA 5EE1A 1AKYA 4I1UA 5FUVA 4TT3D 4DCUA 3T5DA 1H8HA 1G8HA 2IYXA 1SXJC 3RWOA 4KVAA 2VLIA 2WJHA 3K0CA 4Z8XA 1AM4D 2JA1A 3EG5A 2QP3A 3LNCA 4DHEA 4Z54A 1DAIA 2JDID 3CF0A 3QXJA 3MWKA 4KSCA 4URUR 1IBRA 5K8IA 2H5EA 2A78A 4HUQB 4QJ3A 3THWA 1YJ5A 3IQXA 2EWWA 4OI2A 1KNQA 3U7EB 1TPZA 4M1SA 3QPWA 4PC3A 4CT4B 4A8JB 4F93B 1WF3A 3BWDD 2ZRKA 1VHLA 1FPMA 5EZ5A 4LC0A 1I2MA 5K8TA 1E2HA 4IOJA 4DSNA 4EUNA 2CHVA 4MQBA 3ZZUA 4JBWA 2B7CA 2FJUA 2BIFA 4JLAA 5KUTA 3BB3A 5DHFA 1KZGB 3LBNA 2GAAA 2NPFA 1ZUNB 4EFMA 4DCVA 4MYUA 4M1KA 1KMQA 3BH6A 1A7JA 1OFTA 4LHXA 1DG1G 3BIFA 3X1WA 3Q8XB 4M9ZA 1XXHB 5EP3A 2P0EA 2CNWA 3VR5A 4WZAE 5C46F 5C1BA 4GT1A 1XTRA 5H1YA 4Q1FA 1XEFA 3FPAA 4M1YA 4GZLA 5C4GB 2OM2A 1UM8A 2YWEA 4KLZA 1OXSC 1SVLA 3DMDA 4PC1A 4LPSA 3C5HA 3JZAA 2ZTSA 4PANA 2YKGA 4GOKA 1TEXA 3CPHA 1L4YA 3A6PC 1J70A 4JS0A 2BMDA 3KQUA 1RRPA 1ZRHA 4Q4AB 1P61B 1P2UA 3LBHA 2GILA 3EC2A 5L3RA 1IY0A 1Q44A 2YYZA 3O47A 1TTTA 4IRUB 4R9UC 4RFSA 2NO9A 5J4YA 5B30A 3O8DA 4O2LA 1Z63A 3U61B 5G41A 4CEIA 1F2UB 4BLTA 4LV8B 3DMNA 3LA6A 3CUEF 3CX7A 1IN8A 3FHCB 3C8UA 1R8QA 4XD7A 2P6NA 2WWWA 2ZREA 3U44B 3A4NA 2NQ2C 3N70A 1BYIA 3CH4B 3U3JA 2P65A 3FHOA 2KI5A 4MH0R 3B1ZA 3AV0B 4EPYA 1Q22A 5FBRB 4BFSA 1DADA 4G1UC 5EXPA 1U8ZA 3LX5A 1E1QA 4ILEA 4P4UA 3QEJA 4EJSA 5KPDA 3BBPA 3KTAA 1KDTA 4O0MA 3EARA 1XMVA 2ATVA 2GJSA 3OEHA 1T5LA 4EQ6A 1DPFA 4PQFA 1MRNA 3E1SA 5FOSA 2O8FA 4RVCA 3IEVA 3IIMA 4A1FA 4KFUA 3J81k 1VG1A 1XD8A 2AL7A 2OXCA 1E6CA 4K8OA 1RJ9B 1RRGA 4JJKA 3C41J 2QPOA 3NHBA 2CK3D 4BLSA 3PUZA 1XZQA 2IBMA 2PT5A 3ADKA 2F3TA 4KFSA 2OFOA 4S2EA 2VF7A 3IHWA 2E87A 3TJZA 3QKSB 1IXSB 2X1VA 4IOMA 5JZVA 2IC5A 1QZXA 4Q01A 2R6FA 4Q1EA 3RYTC 4CYMA 4RD1A 4XVQA 5G40A 5SZJA 3PEUA 5P21A 3NEJA 2B92A 1QBKC 4W7SA 1UADA 4DLYA 5FTKA 1JR3E 2P6RA 4F4IA 5BWMA 1XPUA 1PUIA 1BIFA 2O5VA 4PZZA 1LB1B 3AF1A 2C2HA 3OIVA 4JSTA 1RYHA 4PO8A 2VF8A 1UDWA 5FTMA 1Z5ZA 4Q18A 1KI7A 3I92A 3P4YA 4CEIB 2KWIA 2C04A 2H16A 1XFAA 4KVGA 4OQMA 1X8KA 2BMEA 3AF2A 1TF2A 4F7WA 2EW1A 3WYAA 1ZM9A 2ECKA 4ZV4A 3W8RA 5IK2D 4GPTA 4TL8A 3D31A 4LRWA 1U94A 1Q1BA 2WJJA 5FUWA 3W90A 4DBLC 3TVDA 3ECCA 1QRAA 4UNRA 4HAUA 5SZKB 1R2QA 4C0AC 1Q0UA 1OXUA 2ZRCA 3CKLA 3L43A 4MRVA 1E9SA 1WP9A 1KK3A 1LF5A 1Y3AA 3K9LA 3LV8A 4D80A 4D25A 1H8EA 2CHGA 2ORIA 2JLVA 1II8A 1E2KA 2CCJA 3N2EA 1UF9A 2GF9A 3ZZ0A 4QOSA 2CE7A 1DOAA 1R7RA 2BWJA 1OLOA 4HLDA 3ASYA 3DM9B 3NBXX 4RZ3A 5E7IA 1LS6A 5LBIA 2Q6TA 4TL7A 3LLUA 2PZEA 4JMPA 3K0AB 1ZD9A 3LW7A 3P20A 5DN6A 3PITA 1ZW6A 4BFUA 4URXR 1W2GA 3Q5DA 4YMVA 3GLGB 3T1OA 3AKCA 1AGRA 3PCRB 3EPJA 2GEVA 2F1IA 1WMSA 3AM1A 3TKLA 1P2VA 2FNAA 3QF4A 1QHYA 1C4OA 1U8AA 3H2YA 5KO2A 3GEHA 1Z0JA 2N46A 2QTHA 4A4DA 1QHXA 2O8CA 1N25A 2J0SA 3A1TA 2ODNA 2FSHA 1E2JA 3RS7A 3TQFA 4BQSA 1O87A 4K46A 5FPYA 3U7FB 1OIVA 4NCHA 1Z0DA 1P7CA 1R0ZA 1OSNA 5DHAA 3GPLA 2O0JA 1IY2A 2GJ8A 3CRMA 5L3QA 1E9BA 1DG3A 4V0OA 3TQCA 2XZPA 3CF6R 1W7AA 4BEBA 1E3MA 3B5JA 5JRJA 5DI9A 4Q47A 2XXAB 721PA 2CBZA 2ZJBA 4C9BA 2HXSA 3AKYA 3D3QA 3PUWA 1JJVA 1G8PA 2QTFA 1P6XA 2GZHA 2WWIA 3CX6A 4JT2A 3W6OA 4DDWA 2O8BA 3D7MA 1W44A 2X8AA 2ONJA 1ZUIA 3T1TA 3QVVA 1ZAKA 1FQJA 4BLRA 3B8HA 1FMJA 5FOTA 1XU4A 2H1LA 4MDFA 1K5DA 1KI2A 1XEWX 3A36A 1CR4A 3AB3A 4V0NA 2AD1A 1W2HA 1ZD8A 1HV8A 3K1JA 2HCBA 1KO5A 2ZJAA 3IO3A 2WJIA 2F43B 3SS8A 2XOKA 1L8QA 4OHZA 2IYTA 3UIEA 4BRWA 1FX0B 1GNQA 5AJVB 3FMFA 4MKHA 1AJEA 3IPXA 2NO1A 5G3YA 3H1TA 1MABB 1OKKD 2V54A 2V6IA 2ZETA 2ZI9A 3KUCA 2ZUDA 4PTLA 1LTQA 3T12A 4UJ5A 1EFRA 1S9DA 1KY2A 5EXXA 5B64A 1Z6TA 1CJVC 2XTZA 4Q21A 1ZYUA 2AKAB 3U7HB 3GD7A 4ZI3A 4QBHA 4AC9A 1UEIA 1JQLB 3MMPA 1XCPA 3RANA 4MRRA 1EFUA 2RH5A 3B82A 1PJRA 3AEZA 4RCZA 2V7QA 3K0EA 3RABA 4D0LB 1B23P 4POAA 5DSZA 3CIOA 4A0RA 1R5BA 3VR2A 2HLDD 2QAGB 1D5CA 3W5JA 5DO9A 5FBVB 3GLHE 2MMGA 2QI9C 4U7DA 1JR3A 4M1OA 4BFWA 1GRRA 1OHHD 2ZRJA 4OK5A 5JCZA 1Q12A 1Z29A 1XEXB 4ARZB 4UQOA 2O8DA 2FFAA 1IXZA 4PZLA 4LZZA 1RKBA 5EUMA 4IDHA 2H7VA 2J7PD 1QDEA 1KI4A 2IYUA 2V1XA 3ASZA 3PEWA 3KDSE 2ZVQX 4PSKA 5GVRA 2G9NA 4LYAA 2ZPTX 4URVR 3AVXA 3TMKA 4TMTA 1S2MA 2QSZA 3HYTA 4LJ6A 4ZO4A 5KNBA 2AX4A 2DWPA 2QTVB 5JS8A 1T4GA 4U00A 4JL6A 4Q9IA 2IYQA 1WDTA 2A5FA 4IHQA 1GL6A 1P9NA 3FMIA 5J4VA 2NG1A 5HE9A 3M0EA 3LW8A 5KDOA 1EWQA 4IOLA 2W2TA 3ZS8A 5HPYB 1YZLA 5JJIA 1DAGA 5BQ5A 2J0UB 3VKWA 2QRNA 3K0CC 5D3MA 2WSSD 1SVWA 2IUSA 4JT4A 4RSGA 3HPRA 4Q9JA 4PPGA 1R0YA 3VTKA 1CRPA 2NPIA 4FCVA 2D7DA 1J90A 1G3QA 3BJIC 1TAGA 4B74A 4JIMA 1KI1A 1FL9A 1XF9A 3L0OA 4DEYA 3U3KA 1E2MA 5CK5A 1DS6A 1BOFA 2KSQA 1U90A 2OG2A 3L0IB 5AUQA 2HXYA 3RS0A 1MV5A 3K70C 2FN4A 1HT1E 1ONBA 2JATA 2OZEA 3QKRB 2GXAA 3LDAA 5CJPA 4G5QA 4DB2A 1E2EA 5TMPA 2BEJA 3B1YA 3LVQE 1ZU4A 3SJAA 2PMDA 4ZDJA 3BGWA 4UNQA 2G83A 4WVFA 4OQXA 4D2IA 4A9AA 1SKQA 4YXWD 1N6NA 3SBEA 1Z2AA 4LOAA 1IAQA 2JLUA 5EE9A 3PEVA 2RGEA 1W4RA 3KJIA 4HDOB 4OJQA 5GJVC 4DLWA 5FTJA 3M4YA 1NBMD 1GAJA 3FWYA 2WAYA 4TL9A 2JLQA 4HB3A 2D3WA 4Q19A 4PC6A 2F6RA 4Q7JB 4N0DA 3LFUA 2QE7A 3JVVA 2EU8A 2OESA 3TAHA 4FN5A 3TE6A 2GKSA 2GK7A 2QNRA 3AH8A 3BH0A 2XSZD 3QPVA 4LPKA 2PBRA 1CKEA 1S8FA 3PENA 2ZE5A 1PV4A 1KNXA 1W48A 1FP6A 1G1MA 2IWRA 1SULA 1FQKA 2ZYUX 4WBSA 2E1RA 4FMDB 1HURA 4FMCB 1NMYA 3ETLA 1A2KC 1N6IA 2NZJA 3DOFA 1N0WA 1NVVR 1ESNA 4TLCA 4WW0A 2YC2C 2W58A 3DEFA 3TUIC 4A0GA 3FKSD 2OILA 4B76A 3GLFB 1XXHE 2ANCA 2FWRA 3N2IA 3SFZA 3VR3A 2GZAA 1NRJB 2ZM5A 1OIXA 4PC2A 2ZJYA 2OCBA 4IDNA 2RHMA 1A4RA 5LB2A 1N0UA 5DI3B 221PA 4TSFA 4A82A 4X8HA 1OH7A 3MJRA 4O2RA 4URWR 2I1VB 1GL9B 3K09A 4EJSC 4TTRA 1W49A 3CNLA 3CM0A 3CW2A 4YLGA 4P4SA 5E4FA 5FOWA 1W36C 1E96A 2JIZD 1A82A 4M22A 2YOFA 3ZQJA 3THYA 3PXGA 4JLBA 3MFYA 3PQCA 1SKYB 2P5SA 2FFBA 1NN1A 4JLPA 3GLHA 3L8YA 1UBFA 1L7VC 2ZI6A 4Q4LA 1N0VC 3AVUA 4PPFA 2P6UA 3S1AA 4LSGA 2NO7A 3K9NA 5J4HA 1IN5A 2IEYA 2W6JA 1M7GA 1S0UA 2XAUA 1ANKA 3T35A 3UXMA 2IYYA 1KKMA 4ABYA 4DIDA 1Z6AA 3W5IA 4LBZA 4PAMA 3RC8A 3R7WB 2HT1A 4B47A 1GWNA 1XRJA 2PL3A 2GAOA 4Q9LA 3I32A 3VR4A 4EAQA 1W0JA 3F3YA 5FL7A 3HU2A 1LV7A 4PPQA 4A6PA 4DVGA 1KO1A 2AXPA 2HJGA 2O0KA 1E69A 3U7GA 4LY6A 2MSDB 4AYTA 1NF3A 1OB5A 4JLJA 2IWHA 1JXOA 3AVWA 2DBYA 2ATXA 1JI0A 4OI1A 1XWIA 2ZSBA 3OF5A 3TAUA 4DWJA 4GP6A 4HLUA 2D2FA 3HDTA 4P4TA 1ZJ6A 4NE2A 4XVRA 4V0KA 2GCOA 5J4KA 3BERA 3B85A 1KK0A 1BKDR 4Q1BA 3BE4A 1W47A 2VYFA 3EPKA 4IW3B 4ZIRA 2IYVA 1GIAA 3KQLA 1Z0KA 3WMFA 3SOPA 1GKUB 1ODFA 4LC1A 3AF0A 1G41A 2A7QA 3X1XA 3R9IA 1G291 2C9CA 1HTWA 2FOLA 2RB4A 1XJCA 1G18A 3W8NA 2ODEA 4DLXA 4DDVA 2DFLA 3RDPA 1N2CE 5TXGA 4MKIA 2FV8A 4B3GA 2ZSEA 4Q48A 3VKHA 1P2SA 2WPDA 5DGXA 1IHUA 5L3SA 1UKVY 4PR0A 3U3MA 2IS4A 4A36A 2CEAA 2ZRDA 5AJWA 2BCGY 5FPHA 4ZDKA 1YZQA 1S4QA 1ZP6A 2NGRA 3EPLA 1BMFD 1E2PA 2ZUCA 3R9WA 2IYLD 2ZVPX 2QMOA 1E9AA 2VEDA 2VSXA 4MDEA 1N6PA 2FFQA 4PSAA 4YDSA 4DKXA 4XTCS 4F38A 3T15A 4HUQA 4A0FA 2H17A 2GJAA 2PX0A 3OAAA 4P33A 3UWOA 1NMZA 3LXXA 4UXIA 2OCYC 1SHZA 4A8JA 1WBBA 1ZU5A 3MLEA 2AK2A 4KU4A 4EFNA 1KYIA 3L0PA 4O25A 3CB4A 1NN3A 3ZIAA 2B8WA 4UXHA 3C16C 3TSWA 4ESVA 3JVUA 3RVBA 5FH9A 3A4MA 4GBMA 4QNRA 1G16A 3IIJA 3FB4A 2R2AA 1YR8A 3NC1C 1KZ7B 3GLGE 1IY1A 3AVPA 1EX7A 4D0NA 1PLLA 3U6KA 2CDNA 2ZR7A 1X1RA 3QOFA 3B9QA 3FYHA 1GSIA 5TY0A 3PVSA 5EJEA 4BFZA 2W0MA 3NH9A 1XXHA 2CXXA 5JWOA 1E1RD 3FDIA 3NDBB 4GL2A 2UVQA 1XMSA 3BK7A 1KK1A 4XWAA 1KGDA 4R98A 3CPEA 4ERNA 1M8PA 1Z83A 1KSHA 2C5LA 5JHGB 1AQUA 1G9XA 1VG9B 2BKUA 1RYFA 2QT1A 3Q85A 1WXQA 1Q1EA 4HZUB 3AVVA 3R20A 4Q4AA 3ZH9B 4AKIA 2B6HA 2YVUA 4LHWA 4UXJA 4R7ZA 5FOUA 4DLZA 1E32A 4A2WA 5KHOC 2OXRA 1F5NA 3OZXA 4QNMA 4US1R 1GZSA 3SNHA 2IF2A 4URZR 1F2UA 4M8NE 1Z6GA 4JLDA 4MKFA 3Q7PA 2VL7A 3MWLA 4M53A 5EP1A 5AUOB 2WMNB 3BXZA 1E2NA 2NMVA 3ZZTA 1CJUC 1K8RA 3U44A 1XMIA 2GBLA 2G1KA 2OAQ1 3EA5A 1BH2A 2CL7X 1OV4A 1R8SA 1D9ZA 1RVDA 3NHAA 1FOEB 1T8TA 3WNDA 1IM2A 3NXSA 1HEIA 1Z3IX 2G88A 4DLRA 1G8FA 3SYLA 2W6ID 1AS2A 4II7A 4B3BA 3U3RA 1GNRA 5CDFA 1US8B 3AGPA 3I62A 3CH5A 1ZNYA 3IUYA 4UKDA 3F0TA 1DAKA 1YE8A 1VYTA 2FSFA 3RWMB 4FI3C 1TU3A 3SJBA 1RJ9A 1PUJA 4LJ8A 1ZMXA 2OFWA 2Q3FA 1NL3A 3NDPA 3QBTA 4GI7A 4AG6A 2OBNA 2VP6A 3EWSA 2REOA 3A58B 1S96A 4DEXA 2J46A 4XH9B 3C4JA 3IGFA 5KSPA 5JSZB 1I4LD 3QKSA 4MGIR 5AUPB 4A92A 4TQUS 4KFRA 2V55B 1NJGA 4Z51A 4TLEA 1XD2B 3W9YA 4B3DA 4PQRA 5DISB 2EYUA 2AN9A 1E2DA 2KB0A 1RC8A 4LV6A 1W5SA 4JLKA 3EW9A 1J99A 5JWHA 2O8EB 4Z1MA 5GJCA 1M34E 3IBYA 5F9HA 3KQKA 2VO1A 4M1WA 1FTNA 4P3YA 2OO7A 5EXTA 3VMFA 4PXAA 1G8GA 2IA5A 3H4MA 2FMXA 1W0KD 5F98A 2WAXA 1TX4B 4HLQB 3BRWD 5FOVA 3SHWA 4LJ7A 1A2BA 4C3ZA 1P3JA 2LCFA 5JJKA 3DDCA 3CF2A 2GZDA 4AI6A 3N5CA 4QHYA 4MRSA 4OQFA 4FINA 1L4UA 1I2DA 5FBLB 3KX2A 4G5RA 2GTPA 3BB4A 3Q7QA 3SEAA 1T3HA 1X86B 1XJ0A 4LX0A 3WBJA 1LF0A 1VPLA 2LKDA 4HB2A 4LI0A 2F55A 1VCIA 2XZOA 5EE3A 3I5YA 5FUYA 1KDOA 2YNMA 4LJ4A 3CNNA 4OI4A 5CB6A 1JJ7A 2BM1A 1MO4A 3B78A 3NBZC 2VP9A 2BVNA 2YOGA 2BV3A 3PIRA 4A2QA 3K0AA 3Q5EA 2OFXA 4I81A 1BO6A 3I4LA 3W3ZB 3SQWA 3F5FA 3GLGA 2WJGA 5BXQC 3GJ4A 2ZSFA 3TBKA 4BLOA 3AUYA 2D06A 3ZS9A 1XTJA 4V03A 1DAFA 1P2TA 2XNDD 3EWAA 3GEEA 4HUTA 4Q4HB 4XVUA 3KJHA 1OB2A 5KU1A 4DDUA 2XB2A 4LGMA 4TT3A 4A0HA 2MMCA 4A6XA 4HB4A 4QJ4A 3H0KA 4L9WA 1G4AE 2RGDA 3WP0A 2JDIA 4C7OB 2QPTA 2JLXA 1P75A 3BC1A 2NTYC 4GRAA 4JKIA 4XSHA 5EQTA 4HDCA 2V1UA 2H57A 5AJZA 5G3ZA 3GP8A 2JLYA 1MT0A 2ZJOA 2QENA 1G4UR 2WWXA 4NMMA 4PHFA 4Q4JB 3L82B 5HKKD 1OH8A 4TYPA 4QM6A 2ZI7A 1VKJA 3CR8A 3QBVA 1MR3F 2PH1A 1FNMA 1MO5A 2C78A 2YWHA 3K8YA 3EZ6A 1SXJD 2XXAA 1S3GA 2OBLA 2DB3A 5AK0A 1CR2A 5F9FA 1OF1A 3X2SA 2EVWX 2J5XA 5A5GA 2YJTD 5KNCA 3CLVA 2RGCA 3TIFA 2VSFA 3K09C 1P4SA 3CPJB 4Q7KA 1YR7A 4RFVA 1N6LA 2K5UA 2PT7A 2QRZA 2JJ2D 4MKGA 5LD2C 1L2TA 1YR6A 4IFEA 3ZVLA 3KB2A 3ADBA 5DLQC 1KAGA 1KO7A 2L0XA 2W2VA 3X1ZA 2VHUA 3TNFA 2F43A 2ERXA 2CL6X 2WZQA 5JRZA 5CB8A 2C9OA 4NYMQ 1FX0A 4ZPXA 4TYWA 3P26A 2IS6A 4QXAA 4TTQA 1Z6YA 1H65A 1JEEA 1DAEA 4R2HA 3SI7A 1IN4A 1MABA 3GCGA 1U99A 3P27A 4G0NA 1Z08A 4OKSA 3NWJA 4NYIQ 4DB4A 4KHZA 1KK2A 1XJQA 4DUGD 4NPHA 3NVAA 3HU1A 3GLIB 3I73A 2DY1A 1CU1A 2D62A 1BYUA 3B7GA 1BS1A 1NVWQ 2VHQA 3DKVA 2PCLA 1OXXK 3TR5A 1SVSA 2QY9A 4IXMA 4NZYA 3PG5A 1FTSA 5FFMA 1ZVQA 1SKYE 2WICA 2QAGA 3DPUA 1GG2A 1T0HB 2NIPA 2R65A 2PX3A 4K81B 4BE7B 1UFQA 3T06B 3ZVRA 3AVYA 4HLUC 4ARZA 1XEXA 1RW4A 2FSIA 5IF9A 3V4RA 1NKSA 2XJ4A 4TMXA 1GOTA 3WMGA 4G5OA 5BN4A 2VHTA 3RRZA 3IDQA 3QXSA 4KAXA 3B6EA 5ELXA 2EWVA 1QHSA 1QVRA 1TMKA 1YQTA 1XB2A 3GJXC 3W6NA 2JLSA 1VMAA 2W2XA 3CO5A 4KSBA 1X8LA 2W00A 521PA 1YRAA 2QGZA 4DIEA 1M7BA 2YZ2A 2ZEJA 1S3SA 1T6NA 4BZQA 4EDHA 4WXRA 1CJKC 2CHQA 2P3SA 2WVJA 4E09A 5FR2A 2ZRGA 5G53C 1D8TA 2CK3A 4C0BA 4IOKA 5C2JB 5F2EA 1P72A 2HF9A 4DT1B 4IEEA 3TUZC 5JLJA 1M6NA 4R71A 4HYYA 3LLMA 3TSOA 1U8YA 2TMKA 3VU9B 4ASUD 1QHIA 3A1WA 4W5HA 3KKMA 4BLPA 2OLKA 2J0UA 3TGPA 3SHFA 1MRSA 4LV5B 4PC7A 4LUCA 3CR7A 3KXLA 2GK6A 4RD2A 4QM7A 2QM8A 1CIPA 3SBDA 3AF4A 2WV9A 3A4LA 1HQYE 1DEKA 1QG4A 4HZIA 4LBWA 3VNUA 4MYCA 1X3SA 3L2OB 1SVMA 3CBQA 3LRPA 2JLWA 2VHJA 5TARA 3HYRA 3P1JA 2R62A 4A8JC 4D4MA 4QBGB 1DAHA 2YOHA 4PPNA 1N3BA 5FTNA 3IIKA 2IYWA 2JAQA 1G20E 3OE7D 2ZE7A 3NKVA 3BFVA 1KIMA 3LXRA 4OHXA 2CJWB 4JZKA 4KCGA 2CVFA 2GVDC 4NBSA 1ZBDA 3QKRA 1DO0A 5IK2A 2VBCA 3KUDA 2IL1A 3I5XA 2QT0A 3LY5A 4ZKEA 1VECA 2ZRMA 1VIAA 4C2UA 4A2PA 4CW7A 4A15A 2Q9CA 3BD9A 4CGZA 1K6MA 2GWHA 2ZJ8A 4RKFA 2I3BA 1E79D 1WCV1 1VCNA 3WBKA 5J4LA 2GCPA 2AWNA 5CYOA 5SZHB 3MWYW 4ACBA 5FI1B 2A2ZA 1SGWA 2AFHE 5KOYA 3CWQA 4IEIA 2JEOA 4U02A 2XTNA 4O3MA 1AA9A 3EA0A 1D2EA 5J40A 1B0UA 2ZI5A 2PZGA 2W0SA 2C95A 1FUUA 1G7SA 1HE1C 1VG0B 4KI0A 2RGGA 1ELOA 4JKYA 1TQDA 1JBKA 1E2QA 1OIWA 3EIEA 3K53A 2HDNB 3P32A 4EIWA 2VPPA 2AWOA 5ANRB 2OHFA 3IPYA 1UPTA 1G7CA 1NSFA 4IVQA 4M21A 2FGKA 3VHLB 2DHRA 1VYUA 1E9FA 3FMOB 1E0SA 3GLFA 3IEUA 1UJ2A 3E5HA 1Z47A 4KITB 2IW3A 4CDGA 2RGAA 3GJ8A 4D4JA 3UG6A 1CR0A 1JXMA 1ZNWA 2GBLC 2ZS8A 2JJ1D 3VR6A 3I1FA 5DI3A 3KL4A 1DARA 1F2TB 1SXJB 3B2EA 1NBME 1KTVA 4V02A 1XEWY 2B21A 4FMDF 1TQ6A 1IN6A 4Y0AA 3T34A 2BEKA 1GKIA 4FMCF 2KE5A 2CLSA 2BJWA 4JBXA 2W83A 1GL7A 4AKGA 2NZ8A 2BM0A 2FDCA 5CJ2A 3AUXA 1N5IA 3R9XA 4CRWB 3F8TA 4QFMA 1E9DA 1XDBA 4HEJA 2RHDA 4AYWA 2GVZC 2QBYB 1XTKA 1EX6A 2X19A 4Z8YA 3ZVNA 1HH4A 2VH5R 4YMSA 4B3CA 3QY0A 4QBFA 4CEHB 1T0JB 4MGZR 4JYCA 3W3AA 3MUFA 2YV5A 4OK3A 1MH1A 3JZMA 2O0HA 3R7WA 3CRVA 5J47A 4BEJA 1X8JA 4B71A 2BDTA 3AKDA 1OKKA 3OFND 4QGGA 1NY6A 3DVLA 1VDZA 4JVLA 2OT3B 1CULC 3CRRA 4QHTA 3GJ5A 2G0TA 5E3HA 1CLUA 3PUVA 3WYGA 1HE8B 2FE4A 2JGNA 3PFIA 2A5GA 4NTZA 4DJTA 4HAWA 621PA 3RS4A 1DVRA 3OEED 1S1MA 5IDVA 1KSGA 4OHVA 2HLDA 1CJTC 3P4XA 3IHLA 1NY5A 1Q3TA 1M1YE 3KKQA 2MSCB 3UK6A 1OHHA 3HR8A 1W1WA 5DH9A 2OAP1 2QORA 4JLNA 1G7RA 1R5NA 1EESA 2KJQA 4PZYA 2ZR9A 2WWFA 4TWZA 4DC9A 3SN6A 1R10A 2J7PA 1MKYA 3LD9A 4V0ME 4DDTA 121PA 3HJNA 5BW8A 1Z0FA 3KZ1E 1UDXA 3E2IA 4YMUA 2WWGA 3EXAA 1E98A 3L8ZA 1KI6B 1VG8A 3Q9LA 1E9RA 4D26A 2V6JA 3B1VA 2GXSA 2GETA 2DCUA 4Q7LA 2QM7A 1Z28A 3PUYA 1NJFA 2IF0A 4GNKA 4LHVA 2ZROA 4BFTA 2HEIA 2CCGA 2ERYA 1XBTA 4TLDA 4ZI2A 3HWSA 5TVKA 3U2QA 1RRFA 1QG2A 4D4KA 2VHCA 4KO8A 4MRNA 4LJAA 1G64A 2O52A 4Q03A 1II0A 1M2OB 2ZYTX 4JVSB 4B6FA 2WTUA 3QG5A 1COWD 1TADA 3I8SA 2FH5B 2D7CA 1CEEA 1SVOA 4AKHA 1YZGA 4I1SA 3CX8A 2FPLA 4CEJB 3NH6A 4ACAA 2VRWA 4L9SA 2ZSDA 4Q1AA 2QQEA 2WSSA 5CDFE 2RGXA 2ZYVX 2D2EA 3QUSA 2ORVA 3AVOA 4G01B 3PEYA 2IXEA 4P0TA 1OXVA 821PA 1NG9A 4LHYA 4PHGA 2FEMA 3R8CA 2BCJQ 4NP6A 3RRYA 2HYIC 3ZD6A 1H8HD 2CL0X 5SZIA 1KJZA 2QZ4A 5JI3E 1F60A 4ESHA 4MUBA 1CR1A 3ZLJA 3I3SR 3QE0A 4NKRA 1CS4C 3QVUA 1N6RA 4DLSA 3O8RA 1VHTA 2XJ9A 4V0LA 3RSOA 4N3NA 4NCJA 3OIYA 1XX6A 1UKZA 2ODWA 3EASA 4QL3A 5L3VA 1OFUX 3I8XA 2DPXA 4YXWA 4OBEA 2EFHB 3LVRE 3R8FA 1DELA 3PJRA 2RGBA 3K70D 2FU5C 4YQFA 1TF7A 2GNOA 4R2IA 3AKEA 4HZUA 1NBMA 2GF0A 2QP9X 2R6GA 3T61A 3U4QB 3WMEA 1SVIA 3ND8A 2JLRA 4AYXA 4C4PA 4OHYA 4M1TA 2ZRNA 2WMOB 2IEZA 1U9IA 4F4JA 3RSLA 1ZCBA 3W6PA 2HT6A 4KYIB 1OW3B 2XSZA 2C77A 5FL3A 4NU0A 4BZPA 2PJRA 2CNWD 2QGNA 4B33A 1KDRA 1OXTA 3VNVA 1JPJA 4B75A 2CLDX 4RZXA 1E2IA 1U0HC 5GADl 3AP3A 4JVNA 4B32A 3NG1A 3H84A 3ZDQA 2IT1A 4TYNA 2UZIR 5CITA 3FKSA 1G6OA 1E9CA 2QAGC 2WJYA 1RRCA 3GJ3A 3SFVA 2ZJZA 1EGAA 2QEQA 1R0XA 1O3YA 3REGA 3O8BA 4BGDA 1YZKA 2BBSA 1US8A 5KTYA 3SZRA 4L8GA 2BHRA 2J45A 5KPJA 1F6BA 3KQHA 5FI0B 1XPOA 2R8RA 2UZ3A 1AK2A 5FBQB 2F1HA 2A5JA 4HAXA 3GLIE 2JIZA 3KJGA 2GXUA 4NYJR 3DOEA 4XD7D 1LY1A 3EZ7A 4B43A 1IONA 2VP0A 1ZINA 2V8OA 1NLFA 1EXMA 2QU8A 4ZCMA 4Q1CA 5FOXA 4EPVA 4P31A 5JSZA 4WZBE 2YHSA 3U3OA 3UMSA 4C2TA 3EPHA 3REFA 1LNZA 1XD2A 2IX3A 2ASEA 1E1QD 1F3OA 2XB4A 4AG5A 3ADDA 2Z83A 1AN0A 4LYJA 3RS2A 1W36D 2ZAMA 3OEHD 4N0EA 1WRBA 3KFXA 4V0MA 3TW4A 1ZIPA 2HCJB 2EFEB 3C14C 3WHKA 2O8EA 1FUKA 1G5PA 2BMFA 1LVGA 1W5TA 2FGJA 3DZDA 2RKOA 1YZTA 3HP1A 2FEOA 3FFAA 3BFKA 1JB1A 3K0FB 4D82A 3ZD7A 1G21E 4RKEA 1GP2A 1QVAA 2QSYA 4URYR 1N6HA 5FPSA 4LWZA 1YRBA 4OQLA 5HCIA 1KMHB 3KJEA 5AUNB 5DIFA 4W9MC 4HI0E 4NYMR 2EFGA 3CWZA 4XOIA 1A1VA 1IJEA 4RZ2A 4YMTA 1KJWA 2WSMA 5AR1A 1JR6A 2G77B 1QHHB 1E9EA 1RIFA 2IHYA 3FE2A 2R6AA 4XWKA 4QJ5A 2XEXA 3ZYCA 5C4MA 3QSYA 4NYIR 1P62B 2ZU6A 1Z0IA 2HUPA 2H18A 1K5GA 3EIHA 3TW8B 4EKDA 2AD5A 4PAOA 1NN5A 3VX4A 421PA 2EYQA 2QQ0A 2ZE6A 2F1JA 2BJVA 2YC4C 1G5RA 4I99A 5HE8A 4KJZA 5JWRA 1P9WA 3KFVA 2KBEA 2KBFA 1N6OA 3MD0A 3THXB 5AJXA 5L8VA 3BS4A 1EFHA 3RC3A 3FMPB 4UJ3A 5JI2E 3QEOA 4YMWA 3MCAA 2E9SA 4Q4HA 1E2FA 1FNNA 3DM5A 1EG7A 3Q72A 1G8YA 1BMFA 1ZC4A 1H8ED 1NP6A 2C9YA 4HAZA 4BZXA 2JLZA 4RD0A 2J87A 3EC1A 1XTSA 3K9GA 4BLQA 4XIGS 1UEJA 3BAFA 4C7OA 2ZAOA 1XP8A 4TMZA 5CM8B 3TUJC 3BORA 3QXCA 4Q9KA 4KYUA 1XMJA 4FD2A 5DN6D 1UKEA 3AP2A 4Q4JA 2Y8EA 2IUUA 5JHHB 3T1VA 2XTMA 2Z0MA 5CLQA 5H68A 1FFHA 3CRW1 5AJYA 1MOZA 1Q57A 2EFDB 1CP2A 3G82C 3WNCA 5KDDA 2VP5A 3DZ8A 1HY3A 3DKPA 3VR1A 1GRQA 1AZTA 4BPBA 4OL0A 1QHNA 3KB1A 3GFTA 3SYKA 3ND9A 2OEPA 4P32A 1P9RA 3TRFA 4B2IA 4PQYA 3FFBA 2IYZA 2XZLA 2RMKA 1KO8A 2PEYA 3THWB 3HU3A 4HAVA 4DLTA 1E1RA 1CBUA 2F1RA 2ZS9A 2J0VA 4B44A 2GRJA 4YDHB 1CXZA 3CONA 5E7MA 1KY3A 3I72A 2V3CC 2A3RA 2AR7A 4JLOA 4ZDWA 3MJHA 1FZQA 2GESA 1MO6A 3K70B 1JNYA 2X2EA 4AKEA 2EQBA 3WYFA 5CLLA 5EP4A 1Q20A 2QMUA 2B7BA 4US2R 5GJWC 1AGPA 3NIBA 5TDHA 3RS3A 3GLIA 5HTKA 1NIPA 1XPRA 5LPNA 1SXJE 3C7KA 2C96A 2QMEA 3UMRA 2GEUA 2N1BA 4JBYA 4NYJQ 4WIAA 2FA9A 1IXRC 1N6KA 1MO3A 3RNLA 6Q21A 4WXPA 2F3RA 2XOKD 1Z06A 4E03A 2AK3A 1JALA 4DZZA 3HR7A 4GOJA 4I4LA 1OYWA 2QA5A 2CCKA 4B3XA 4GMDA 2ZITA 4MGKR 4Q66C 4IDQA 4IVRA 2NO6A 1Q1ZA 3B9PA 4MA4A 1HA3A 3AF3A 2IK8A 3AGQA 3WXMA 5EE0A 1EFRD 1GRNA 1KI3A 2IYRA 4RD6A 3GJ7A 2HYDA 4I1VA 2W6IA 1T91A 5FTLA 2Z43A 2QROA 5DYGA 5FBWB 1ZM3A 4RFSB 4NCKA 2FZLA 2D4HA 2PLFA 5CYPA 3QENA 1CTQA 2CE2X 3SU8A 4TYYA 2ORWA 2R44A 2V7QD 4PHTA 2N42A 1VTKA 4MRPA 1UBEA 5IRCD 4TQAA 5JMTA 4BRUA 4D4LA 2YWGA 4HLCA 4UNSA 4EPTA 1JR3D 1OFIA 3KKNA 4M9SA 1AS3A 2CVHA 1TNDA 3QKUA 2WHXA 1OE0A 1TL7C 1RPZA 3GLFE 4DT1A 1II9A 4HSEA 5CIWA 5E7JA 3NEYA 1E2GA 1CJMA 2ZYWX 3VU9A 2A5YB 2AKYA 4PSVA 4RCYA 4GZMA 5KDLA 4EJSB 2F9LA 3BH7A 2I1QA 3KTAB 4FIDA 1XCMA 4HDQB 1W36B 3VAAA 4EQ6B 2ZXUA 1W4CA 3UPUA 1PZNA 2A9KA 2O8FB 3LQQA 2BOVA 2WKPA 5KSOA 1FW6A 4KFTA 3B60A 4TZ6A 2PJZA 3SE0A 3VFDA 2RAPA 1E2LA 3SQXA 3FVQA 3V00A 2ANBA 1KHTA 1XTQA 3M1IA 1W0KA 3PUXA 2Q0HA 2XNSA 3IO5A 2LKCA 4RZUA 3ZQ6A 5EP2A 3B1WA 2VP2A 3LO5A 4DLUA 3FHTA 1GVNB 2CJWA 3D6TB 3RHFA 5JJLA 4LJYA 2P67A 2PEZA 2QUZA 3M6AA 4DSUA 2FG5A 4LK2A 3T1QA 4L15A 2Q3MA 4C0LA 2RGNA 3SR0A 5KYKA 1D2NA 2X77A 2Z5FA 4TLBA 1FMLA 4L5BA 1ESMA 1KI9A 2J59A 2G0NA 2WKRA 2BBOA 5GVSA 1NI3A 1NIJA 4ZCIA 5BN5A 3ONWA 3K9HA 4TN1A 1YZNA 4PO1A 1WQ1R 1KSJA 2I4IA 4JJZA 2HF8A 4AWXA 3WP1B 2DFKB 4QC2A 5M04A 1AIPA 4YONB 4B2PA 3WY9A 1VCOA 1UAAA 1YR9A 2RCNA 1KKLA 3OESA 2ZRFA 3C15C 2R6DA 1ZNXA 2IXFA 2BC9A 2WOOA 5IHPA 1S1CA 5DYIA 4FCWA 4QGAA 5H8WA 2FF7A 1T9HA 3WRXC 1HT2E 1OH6A 3SC3A 1WBDA 5J5CA 2J0QA 3RLFA 1LS1A 1VCMA 3ADCA 1WE2A 2PZFA 3MAAC 4NHOA 4TZ0A 2WWHA 3HPQA 4LJ9A 1JECA 1JQJC 2ZUBA 3QJYA 2XNDA 4Q7MB 1JAHA 4EPRA 2V9PA 4DXAA 5D3QA 4H1UA 4LBYA 1U9IC 5CM9C 2IXGA 2WKQA 4FW9A 3OIUA 1Z8FA 2EFCB 2QG6A 2WIAA 1II8B 4W5JA 1ZC3A 1E0KA 1Z2CA 2WJVA 4MYHA 5B58C 2QL6A 5B57C 3UG7A 3EZ2A 5EE5B 4N1AA 1IN7A 5BYJA 1D6JA 1U2RA 2BMJA 2Z4RA 1KO4A 4FCTA 2ZRIA 4CZ2A 4C0QC 1E4VA 3MG9A 4JL8A 1JAIA 2R6CA 3W34A 2QE7D 4QRHA 4RY2A 5HKKA 3AP1A 4GDFA 1Q3HA 4LJ5A 1M7HA 2FPMA 2DYKA 4KODA 1F2TA 5EZ6B 3EZFA 1G3MA 4QKQA 1SXJA 3A1SA 1NNEA 1NMXA 1T5IA 3IBGA 4Q5IA 3ZJYA 3UKDA 1P60A 3CZQA 3QF4B 3G0HA 3PR1A 4KLNA 4BFVA 1IQPA 4J0QA 1N5JA 3RRNA 4ON9A 2O8CB 2G3YA 3A8TA 5B2ZA 4GMXA 5BN3A 5K8UA 4C0HA 3O8CA 1SZPA 1G3IA 3MGCA 4G5GA 3EAQA 2JJ2A 2FX3A 1IJFA 3MSXA 4AY2A 4TMWA 1VYVA 3QNUA 2QBYA 2Q9BA 4MITA 3TVTA 3BOSA 4HAYA 2A5DA 3GJ0A 1R4AA 3PV0A 5L3QB 3U5ZB 5HR5A 4CEHA 1N5KA 1G3RA 4TSFD 2WBLC 2BBTA 5TB5A 5K8LA 1V43A 4YC7A 4DCNA 1DAMA 4D6PA 4NCNA 1EWRA 2Z4SA 4G3XA 5KNDA 1ZIOA 4FXPA 1SQ5A 1TUIA 2FSGA 2O8BB 3NTUA 3WRYC 4F4CA 3SYNA 4JSYA 4DUGA 2BKEA 1JEDA 2ZRPA 5JEDA 2WWYA 2IUTA 2ZSAA 3QKTA 2WOJA 4M9XA 2ZU0C 4TQ9A 4L16A 4IXNA 1YZUA 4U5XA 1OFHA 5EXSA 2VP4A 4HATA 2G6BA 2OBMA 3UWKA 1KOFA 2GCNA 2DR3A 4B73A 1GUAA 2W6JD 2Q9AA 1N5LA 4H9GA 1Q21A 2JASA 3EIQA 3KQNA 1UBGA 2ZIAA 4TTPA 4MYTA 4FMBB 1GFIA 4IDPA 4PO9A 1DBSA 3C5CA 2J3EA 4QGFA 2ODBA 3LWNA 1ZM7A 1W0JD 4BFYA 3GEIA 3AVTA 4JLVA 5FL7D 4AURA 3ZVMA 2OUKA 3V9PA
chains in the Genus database with same CATH superfamily
1KI6A 4QDKA 1HDYA 3KAKA 3R6GA 1DE0A 1H69A 4JYBA 5JD5A 4UNIA 5AQEA 4E5VA 1QV7A 1XP5A 2XR1A 3EQ6A 1KDPA 3ND5A 4JBGA 5G1OA 1FDSA 4DRZA 2Z09A 1A9SA 1KKUA 2QPAA 3R7FA 8OHMA 1KFBB 1XLUA 1Z12A 2Q3JA 4F91B 5AHKA 2IOHA 4CT5A 3T3OA 1KJYA 2CJFA 1J8MF 3ZWAA 1I4DD 2COUA 3NNSA 3KR1A 1SQGA 3ND6A 3UHJA 4BKPA 4ZQBA 3GFQA 1YRHA 2YDXA 3FOZA 3UUWA 1V95A 2BHTA 3EGOA 2DH5A 2GA8A 2JARA 2Q7XA 1YHNA 2Y1DA 3MS4A 4I4TF 4YAGA 3T3MB 4FKZA 1NFQA 5DTIA 2BUAA 3TNLA 4WNIA 5C8DA 3EFOB 4RVSA 4F1WA 2XRFA 2LD4A 3F6EX 4YWJA 4ZK6A 3MPOA 1U98A 4WQMA 1E1KA 5HCNA 3ZZ1A 5I51A 1U0LA 5LIPA 2FPKA 5DOVA 2J41A 4HNHA 4V0SA 2HJVA 4I5EA 5FPKA 2FFJA 4DLVA 4O4LA 1HWYA 3PL1A 4IIJB 5AHWA 4EY7A 4JDPA 3B12A 1D4AA 4JENA 5A4MS 3GRYA 2OHIA 4JVMA 1V8PA 3IVRA 4UNPA 4YRDA 4OIMA 2C4KA 2QM0A 2J7KA 4JJ4A 5FHRA 3GMTA 4TUYB 3VI4B 3VKVA 1ENYA 2JJYA 4BJ3A 4PPYA 4ZO8A 3COWA 4KE6A 3VDXA 1X1DA 4BNJA 4QBIA 3AQ4A 3PGJA 4KNYA 4IV0A 3ICQB 3F4LA 1Z4OA 4R40A 2ONKA 1XLWA 3VBEA 1BRTA 1TEVA 3AEYA 2AFIE 3OTIA 4N3BA 3SLGA 1B93A 1TYCA 2ONYA 1RAAA 4XSGA 1P33A 2HXGA 2ZANA 4YAEA 2GFHA 3C6YA 1L7PA 1NVUQ 1FS4A 1W52X 2QR5A 2GUGA 1EK6A 1Y4ZA 2Z95A 1K5PA 4PHCA 4S35A 4HBZA 2F9MA 2G1JA 2VSOA 3ILSA 4WA7A 4BFXA 3ZXIA 3LH5A 4W5OA 2XMSA 4UTZA 3DEHA 3TOVA 2AX3A 3NANA 4AUNA 5TQ2B 4QGHA 1H1LB 4JP8A 1KOJA 4ZI7B 4QREA 2FUG6 3RROA 3PQ7A 2C7QA 3ZWXA 4QUIA 1Q14A 4DA4A 1BN7A 3P2MA 4LYHA 1Z0AA 3KXDA 1RE0A 4ZQEA 3TOCA 1QHGA 2O59A 4QGBA 4YBRA 2OCAA 4NCBA 3UMJA 2VDWA 3AYZB 1P4HA 1HYQA 5JS7A 5IKXA 3TLAA 4X85A 1MB2A 1TYZA 2B8TA 2ZVDA 4TV9A 4R9SA 5T4EA 1MG5A 1G7TA 5COAA 5EZQA 1OT5A 2WD7B 1ZD1A 1WTCA 4WY5A 9LDBA 2K6GA 5A6VA 4EL5A 1HF3A 4NPCA 1ZOIA 1XZLA 3M3HA 2X3UA 2HSWA 2RCYA 1Q2XA 1VL1A 4GKAA 4I6JA 3I42A 4OHWA 4JU8A 5FR1A 1A77A 1ZXBA 4N0PA 1E5LA 3H1EA 2FW6A 4V2UA 1KYTA 1HZZA 1C9JA 1Y4UA 3D8BA 3LK7A 2GJKA 2R97A 1E94E 2UYOA 3HV2A 3H2SA 3ORSA 2GPTA 2C3YA 1C1YA 1I4WA 3E18A 1PGQA 3KWFA 1G4HA 4G9GA 5FBHA 3JAKA 5EHQA 5B7PA 4DV0B 1ZM2A 2VWHA 1EFCA 4IKEA 1ULZA 4B48A 3BPSA 4J4BA 2A0YA 2OHOA 3GFFA 3SQOA 2M9MA 1E0JA 5DE3A 3RYCB 3EBPA 1GM5A 1P73A 2LWIA 3TR6A 4YX9A 3SJCA 1DOHA 4ZTBA 1YZ3A 4RV5A 4DSOA 5KNLA 5CJJA 3UNXA 1D2GA 1PNQA 3EWNA 5BYBA 3CEHA 3W4IA 3T7KA 4MR9B 4RD3A 2XUOA 3FTQA 3GHYA 1MTOA 1MMFB 2HIGA 4YQYA 5E9AA 5I9MA 2ZXFA 2A92A 2KYRA 5CK4A 3TXXA 4E70A 2O3RA 3V8NA 4F0JA 5ALJA 3LKZA 3W5CA 1VIVA 1IQUA 2F90A 4W5WA 4XW2A 1JHPA 3PXDA 2PD6A 3QF7A 1KP2A 4QYSA 1HDXA 1M8FA 4JI7B 4US0R 1FDOA 2AUTA 1ECBA 2FMTA 3BTOA 2MOKA 5FB3A 3H05A 5LBTA 2IU0A 1YE3A 1E99A 1PNOA 1NA5A 5J58A 1J0BA 4L5YA 5C18A 2KS6A 1W46A 5CDGA 3KZOA 1GFWA 4P4SB 1DXOA 1KEKA 1M9NA 2WWTA 3LAWA 4X3PA 2NWQA 5EJ2A 2WILA 4ZVUA 4CE6A 5KYNA 3THYB 1PJZA 3IQGX 4KUEA 5JH7B 4X7BA 1CF4A 5DBIA 3CNOA 2CZCA 4MR7B 5UKDA 3GCDA 2H2WA 2NNLD 1FP2A 2IPXA 2EIHA 3FRJA 2CMKA 4NFYA 1PJBA 2CUNA 2Q3HA 3ZTTA 3IURA 4OB8A 1G19A 4WBXC 4ATNA 4CKZA 1HFJA 3F8SA 2DFDA 2X6QA 4M6WB 1NLMA 2W6CX 2Q2VA 2XA2A 1R6BX 3NHZA 3OEEA 2GEDA 3R3YA 4BLWA 1UZNA 2ZJ2A 5AM0A 3K73O 1DX4A 1GPAA 1XZGA 1IU9A 1HLGA 2OLJA 2ZB8A 3I58A 3S3TA 5J1SB 2PMKA 2Q9UA 4HN9A 4Y1RA 2PAFA 4YRFA 2ZBDA 3O8LA 4Z1MD 2VG8A 3G5UA 4G97A 4L4UA 1B8PA 2JIBA 1L5QA 5HMLA 3TW8A 1UC9A 4GNRA 1WXGA 2JPDA 3WGTA 3ELDA 4FWIB 1ZITA 2H5IA 1PFVA 4JJ7A 2VDQB 1V4NA 1E1LA 4R1TA 2GXQA 3V3KA 4FB4A 3RUFA 1A2QA 5LNK6 3RCBA 1TEHA 1E61A 3NBFA 3TR0A 4PX9A 3IDZA 3CN9A 1QMGA 2VT3A 3LOUA 1G8SA 1M67A 5DSTA 4C0JA 5I9SA 6YASA 2OO5A 1N1MA 1E92A 1T2CA 2G67A 4XASA 2PLRA 2QV7A 3AL2A 1S9HA 4HS4A 5TMBA 3RLIA 2NSLA 4YP5A 5JC8A 2VEOA 4K6MA 1V5WA 4N0MA 4OHPA 4N76A 2XE7A 1OR8A 1ZLXA 2Q1UA 3OVMA 4WUVA 2P6PA 2R9VA 4TL6A 1COWA 1X1SA 3SC6A 4CG3A 3EXIB 3H5WA 4NL4H 4N65A 3NC0C 2Y6UA 1VKRA 2IS2A 3HY3A 3ET4A 3S70A 2FQXA 3AVQA 4C0SA 2SHKA 3U4IA 1O4VA 2J9RA 1K2VN 1M2JA 2JEZA 1DTSA 1EUDA 3UGTA 1D2MA 1T3LA 3MRSA 3WNBA 1ZH8A 5D6OA 3F78A 4MV4A 4MUNA 3VXKA 4A0SA 3ILYA 3HUTA 1FSSA 3DNMA 3A6DA 1ULSA 1TQ2A 2WG0A 4C30A 3DLTA 3SJZA 4DQXA 1T8PA 2ZKLA 4MVJF 2PPVA 5E95A 4DLLA 5GJBA 4UEWA 3B13B 1C3OB 1R0WA 1QPBA 4TZTA 4AZ3A 2LV8A 4DTCA 5EHZA 1BJTA 1CFZA 1E64A 1JG6A 2FDXA 2HFKA 3K35A 4M86A 4KMMA 4NCIA 3DF7A 4EYKA 1WLYA 3A27A 5FUVA 4TT3D 4IS3A 1JPUA 4DCUA 4EDFA 4CL0A 1H8HA 2Q1YA 5EUBA 3B6MA 4EM6A 1SXJC 1UWCA 2JVKA 2VDMB 4KVAA 3AVVA 1KAEA 2QP3A 3MJVA 5IBRA 1GGFA 4DHEA 3QXJA 1AUOA 1RQLA 1LJLA 3KJZA 2NV6A 4KSCA 5AI8A 3BL5A 5K8IA 5KYXA 2GPAA 2AQIA 5JAZA 3L7NA 4EW2A 1ISPA 4ND8A 4E0BA 4AJ2A 4MDHA 5CUQA 1BCSA 2VDJA 2HPVA 3MJFA 4EOGA 5LQKA 4F93B 2ZRKA 3RU9A 1I5RA 4TS3A 5EZ5A 2XMRA 3DBHB 1BVUA 3WLAA 1O0BA 1MFZA 3K2IA 5LXTA 1J2YA 3E8XA 4IOJA 5EWMA 4DSNA 4EUNA 2Y1WA 2CHVA 4U39A 2IDZA 3IR7A 2V9CA 1W88B 2YMLA 3ITDA 4GKVA 2WVHA 4JIGA 1K7XB 1T25A 1UBTS 3OQIB 3GBVA 4PTYA 3KYIB 3Q7EA 2B7CA 1NFFA 2YJ3A 3K2EA 5KUTA 2VJNA 3HWWA 1UOPA 1N8KA 2V03A 5ARCA 3BB3A 3QI7A 1EJ0A 3HVIA 3CLRC 2FPGA 1RCFA 1HDZA 1L9XA 3DQZA 3LBNA 4OJTA 2NPFA 2F48A 4G1FA 3SEZA 1RLTA 4K3VA 4MYUA 4DCVA 1D2AA 1TM7E 1OFTA 2R7MA 1T5TA 2RK6A 2WFLA 2DZDA 1PJ3A 2ZAIA 4UBKA 2B1JA 4Y6PA 3TRHA 5AK6A 4DNXA 4M9ZA 1UPFA 3QX9A 3CJTA 4LZAA 1VJ1A 2NTEA 3ABIA 3P2YA 3G9UA 2PFSA 4H7FA 3V8BA 1QU2A 2JIRA 3VV2A 2W90A 4FEEA 3LGAA 4Q1FA 2FZWA 3EXEB 2VZ0A 1O5IA 4H7IA 1M6VB 3KK0A 4X61A 1SVLA 1TD9A 1X7DA 3DG9A 3DMDA 3C5HA 3JZFA 3A6PC 1TEXA 2H4XA 1QVVA 5FD8A 4CKWA 4R1LA 1PU2A 2BMDA 1CUVA 3HXOA 3L40A 3KQUA 1KZYC 2QTNA 1T9BA 3L5KA 1Q17A 2GILA 1FRVA 1N4DA 1DG9A 4Y67A 2YYZA 1ILEA 1Y5LA 3PRKE 1ADYA 3F1KA 4OFWA 2C8LA 3W9SA 1H2RS 2AG6A 1XYGA 3QJ5A 4XLZA 1A0OA 1FA9A 1Z63A 3INRA 5G41A 1F2UB 1IMJA 3OHPA 3VU8A 4BO3A 5K0TA 2OY0A 3P2IA 2QJFA 3CX7A 3DUWA 4ND2A 2NSHA 3NQ41 4EX6A 3PICA 4C88A 3RO7A 4F3YA 4EHHA 1R8QA 2FQ1A 2BH9A 1DJMA 4X95A 3UJ3X 3U44B 3M5PA 4GX2A 2NQ2C 2PGJA 3WWPA 5CFRA 3CH4B 4Z0PA 3FHOA 1K27A 3MB8A 4OU5A 1U3CA 2IV7A 2X0EA 3K05A 4EPYA 1ZH4A 4KEAA 4RHXA 5FBRB 3E15A 4DRXB 1ZLYA 1ZVKA 2M2IA 4G1BA 2WTAA 4X20A 4EAAA 1ZD2P 2I65A 3L6UA 4ILEA 2WU4A 1KA9H 3QEJA 4P4UA 1GGJA 2IXAA 3BBPA 4PX5A 1HGXA 3EARA 2GJSA 4GGOA 5J2UF 1HDRA 3F67A 3OEHA 1R9JA 1EB9A 2TYSB 3E1SA 3OZTA 1DKPA 5FOSA 1OTXA 4AN0A 2BR4A 3NM4A 4A1FA 1VG1A 1YZHA 3KOWA 4ZQFA 1SPBS 1S2GA 2BKXA 2JKZA 1LSSA 5EJGA 5J5AA 1ZOOA 2C5SA 3K1AA 1RJ9B 3LPAA 4K8OA 3OP4A 3PR3A 4CF3A 5KYUA 2PX5A 3REQA 3NHBA 2CK3D 4OM7A 3X1KA 4BLSA 3KR9A 4U7TB 1TIPA 3CEPB 1XZQA 3TLGA 3D6NB 3LC0A 3QOWA 4AMUA 2X40A 4S2EA 1T9CA 2CDRA 3VI3B 7GPBA 1OZFA 1RLJA 1PDOA 2E87A 2R66A 3NO4A 1PT6A 3QKSB 4U2EA 3VJMA 3C3BA 5JZVA 1DBPA 2N75A 4YYEA 2CLHB 2R6FA 4IDBA 3RBVA 2A1IA 3RSCA 4E31A 5G40A 2KLHA 3IDFA 2B92A 3KQTA 4FZVA 2ZBVA 4OYYA 4TWRA 3S5UA 5HWSA 4KL8S 2TMYA 2C9MA 1Z74A 4IXWA 4K05A 5HFAA 1QQBA 4JQCA 5AFSA 5BWMA 2PO5A 1BIFA 4UHDA 1G8AA 3PF9A 4O2BB 4E6PA 1SB8A 3DAYA 3QKWA 4RM3A 3AF1A 2C2HA 3CISA 1RYHA 4OBBA 1BCRA 2SKCA 3WK5A 2BFEB 4YI5A 1DV2A 1OLXB 3NP7A 4Q18A 4AKSA 4CMBA 4CEIB 3GEMA 4JUCA 2AN1A 2C04A 2OMKA 3P0HA 1ZH0A 3IJEB 4KVGA 4KQ9A 4PM4A 3WYBA 1ZL0A 4FHDA 4F7WA 4ENPA 3BE8A 1QCCA 4AP6A 4B31A 3WDSA 4EMSA 2B99A 2ECKA 1ZD5A 5CB4A 1K3FA 4TL8A 4YT8A 2WJJA 4ZTZB 2BGUA 2I0FA 2BM9A 3W90A 4DBLC 4J0GA 3ECCA 1QRAA 3BX1A 3BMQB 2GUWA 4YO8A 4C0AC 4QEDA 1OXUA 3ZU3A 4C14A 3L43A 1WUKS 2WTMA 3K9LA 5IAOA 3N8KA 4PAWA 5AO9A 3AUUA 4D56A 1II8A 1E2KA 2CCJA 2O5RA 2YZMA 3E35A 3S6JA 1GTRA 3D3WB 4QUJA 4YRKA 4QOSA 2YMPA 2FK7A 2BWJA 3AEKB 2DU8A 3GG2A 4K9LA 1C41A 2A4KA 1FLDA 2VH2A 3BG5A 3DM9B 4H3SA 1ZA2A 4RZ3A 5A4AA 3GUCA 3IVCA 3OQ6A 2O3UA 4JMPA 3DULA 2A88A 5HXAA 1YIOA 3M89A 3PITA 2BFCB 4B3SB 1VI2A 2IY8A 3O1JC 3T1OA 4JXZA 1KH3A 2ZIWB 3AKCA 2ADMA 5IKMA 5EHGA 3IUMA 4BNGA 5F73A 1BX1A 3VV3A 1LJUA 3ZHXA 1MNQA 4NY1A 2FNAA 4Z5XA 1PR4A 2GYYA 2WZCA 3ASVA 3KOZA 2J3DA 2AC2A 3TPCA 2WU3A 5KO2A 3VC7A 3P2OA 1WPXA 4FYWA 4JYAB 2O8CA 5LOVA 4LXQA 5BQXA 2DFVA 2UZ0A 2YXNA 3ZWQA 3A1TA 2ODNA 3TQFA 4AX8A 4ZMSA 3CW9A 3DL2A 3ZGOA 5IJAA 5BRAA 3IRVA 4H4DA 3LL4A 1Z0DA 4NLLA 1DX9A 1O5OA 1R0ZA 5DHAA 3ZXYA 5M29A 3FZYA 3GPLA 3DD1A 4YUZA 1ENPA 3D43A 3PWZA 3TCKA 1IY2A 1ICEA 2LVBA 4QBTA 5L3QA 1YF3A 2IBTA 2H1VA 1DG3A 3EOAI 3TQCA 3K2BA 3VR6D 2OVBA 1W7AA 1C3JA 3CCFA 4BEBA 3CV3A 1E3MA 3E0XA 3IDAA 3SXJA 5DI9A 2DY0A 1V7ZA 1F4PA 3H04A 4IH4A 3SS7X 2CBZA 3JQGA 1L1RA 3LHSA 3NCHA 4ABTA 4Z53A 3NBUA 3D1VA 3PUWA 2Y1EA 2YJ4A 2JCYA 1G8PA 2ZTMA 5DK4A 2QTFA 3W6OA 2WWIA 2BGKA 3CX6A 4JT2A 3ABSB 4TTAA 4AVYA 1ZOSA 4C1BA 3I83A 4PYNA 1M2FA 2EV9A 4WY8A 4KN6A 2K7FA 3H8VA 4QUBA 4QQFA 3RU2A 4EUKA 4BLRA 2W8BB 3B8HA 3LIPA 3SBOA 4F6RB 1XU4A 4XEHA 3VBCA 4EB6A 1K5DA 3HJHA 3G2KA 3NKLA 1GJRA 4CLOA 3T1NA 4UOEA 3NR2A 1KO5A 2PTGA 3ZNQA 4EZEA 3IO3A 2WJIA 1EFVA 1UKCA 2F43B 4KOEC 3ZEIA 1NUSA 2P3LA 5BYAA 1C8BA 1OYOA 4YJ3F 3FMFA 4MKHA 2IIBA 2O07A 3IPXA 3M81A 3H1TA 1HRKA 3G0IA 3QVOA 2V54A 1MQ8B 1WW3A 3HNOA 4DA6A 3EF3A 5KYYA 2JGJA 2Z3ZA 1WXIA 3KOUA 1LTQA 3T12A 4D8WA 2PRSA 5SICE 5L6MB 3KCQA 1WU7A 2COKA 5C34B 4H31A 1Z6TA 5B64A 1CJVC 3BWMA 4RHFA 5HKOA 2AH5A 2JHFA 2B4AA 1U9CA 2AKAB 3U7HB 1FFGA 1FNDA 1V1MB 1VL8A 2VJLA 1L4MA 3FI0A 3MMPA 2O2IA 2FPPB 2X9NA 3N05A 1KDVA 1PJRA 1Y3CE 3GJSA 3K0EA 1EBBA 2FN7A 3NONA 1FJHA 1X19A 1T2DA 2JGKA 1YVRA 4KRYA 5DNAA 1NURA 3KQVA 1A97A 1T2EA 2QAGB 1KEUA 1GFZA 2QJWA 2M98A 3S29A 1JR3A 2C1EA 2ZRJA 3ZDRA 4BUCA 4OK5A 1RJEA 5JCZA 1JS1X 1Z29A 2OO5C 2VP3A 2XECA 2XQFA 4E13A 1TA0A 4PZLA 4LZZA 1RKBA 3HCEA 4S1VA 2FOXA 4TLLB 2FWPA 4N3GA 3E5MA 2R1VA 1AHPA 2XUQA 5K6TA 3HCBA 1T0BA 3DKKA 3T5TA 3C4VA 4BN0A 3M83A 1L5FA 4RDHA 2JD2A 2ZPTX 1YR2A 3TSCA 2QSZA 3TIIA 4ZO4A 4MIYA 3FUTA 1QE3A 5DVZA 4U00A 3GFGA 1TZCA 2EFYA 4XCVA 4Q9IA 2IOYA 2XUZA 2A5FA 4XVHA 3OQPA 1KVTA 2XZDA 2YV2A 3BKWA 3ON5A 3OPVA 1EQUA 1XZMA 4TVOA 4IHQA 5DM60 4M46A 1P9NA 2SNIE 4BMNA 4E5PA 2R1TB 1J5PA 4ODIA 2CGEA 2R8BA 4K9PA 2ADOA 3OG9A 5CT5A 4IOLA 4JT9A 1CD5A 3LJKA 1EWQA 4YJKA 2FW9A 1TJ3A 1WL8A 2A1UA 1V16B 2BFBB 2DUUA 3EBLA 2XUKA 1YE5A 4LX8A 2FP3A 3D5TA 4H6WA 1HE2A 1DAGA 5BQ5A 2J0UB 2VJPA 4PQGA 3VKWA 3VSEA 1ZX1A 4FT4A 3QELA 2R2GA 2WPNA 5HBRA 5M34A 4XM2A 4ICIA 1TJ5A 2EJCA 3DGFC 3WWZA 4Q9JA 4I4TA 5CA1B 1R0YA 3GXOA 1N9GB 5EMNA 3WLKX 2BEVA 2NPIA 4FHCA 2ZWOA 2D7DA 1O5TA 2V7WA 3GUHA 1PO7A 3BJIC 1SA0B 4HGQA 3TTTA 4QZVA 5F1KA 4WT7A 1GGMA 1TAGA 2OAGA 2YVAA 4LRQA 4OLHA 3Q87B 5KKNB 2CSXA 2CHEA 4UM7A 4E14A 5KAMA 3JATB 1DS6A 2W2NA 2KSQA 1BN6A 5FLYA 1VMIA 4WK4B 2HD4A 1RM0A 3KT3A 1NBEA 5AMXA 3L0IB 1K9VF 1TMGE 3BM5A 5JANA 2GBGA 1MV5A 3FNBA 4JK3A 1QWSA 2OFFA 1LDYA 3A6GA 3CURA 2Q7OE 1ONBA 1Q83A 2CXSA 3D2CA 5BQFA 4DB2A 2B78A 2P77A 2WJAA 4L0MA 2K4MA 2O2JA 4QU5A 3ZNNA 2BEJA 3HJCA 3P2EA 4ZWNA 3OFJA 4KN8A 1XCBA 3MRVA 4YREA 3UXEA 3G02A 3LQ1A 3IQFA 4OQXA 1TUBB 2LBPA 1SKQA 4PZUA 5TMEA 3ETNA 1X7WB 5E2BA 1V8ZA 4CF5A 4EL0A 1PFUA 1QMPA 3CJRA 4LOAA 3GNQA 5EE9A 2WU8A 4HH3C 2Q5HA 3A32A 1Z75A 4J75A 3KJIA 3CEMA 4HDOB 3U13A 2BGTA 4RWEA 1RMTA 5FTJA 4K5QA 1NBMD 1NV9A 1NZFA 3WS7A 2ISQA 5LZ4A 1WSDA 2CMDA 2ATIA 4MJLA 2JIQA 4NECA 1HK7A 2F6RA 4Q19A 5ERXA 4DYDA 3QLTA 2VWQA 5B2FA 3E4CA 1RZRA 2E4WA 4HS9A 4K2HA 2A0UA 2EC5A 2OESA 2W2MA 4E4RA 1O96B 2GK7A 2QNRA 3BH0A 3PA8A 2XSZD 3QPVA 3VU0A 4KXVA 2QAIA 4QEZA 3L6RA 3MN1A 4UDYX 4B1FA 3ER9A 3WAJA 3DONA 3T7RA 1FP6A 1OMOA 1OD6A 3OM8A 4IWXA 1UBLS 1SULA 2ZYUX 4ZCQA 5EXEA 1A8IA 1VI5A 1J0DA 4LJKA 4BNVA 1A2KC 1JZSA 2BI4A 1AKMA 1RBQA 1ZSNA 3OETA 4L4RA 3USZA 9ABPA 2W58A 4B76A 1ZK4A 2Z9CA 2QJOA 3BUSA 4R8SA 2FI1A 1QS0B 3U9SA 2ANCA 1BS9A 3M1AA 4OV6B 3SFZA 3U56A 1EJBA 3CCCA 3P0EA 4QXRA 1HR0B 1ECLA 1OIXA 2IITA 4HADA 5K3SA 1CS0B 3L7BA 3BREA 4Z4CA 2C3MA 4NMXB 3E48A 1B0AA 3JZDA 3R7NA 2C42A 4RESA 1E3WB 1N0UA 1Q7EA 1A8QA 2OWEA 5LB2A 4PSUA 4QUAA 4D4GA 4X8HA 4EG0A 1PS0A 1PSDA 3K2QA 4JKOA 4O2RA 1GL9B 3K09A 4MGEA 5IKEA 4GKJB 1UXIA 3CM0A 3DDWA 3FDZB 3ZWMA 1S2LA 2HQBA 2JIZD 1Y8QA 2YQZA 3KSMA 4LAFA 4M22A 3SX0A 3MFYA 3IBCA 4QYIB 4KAJA 2QVCA 2ZJFA 3FSRA 4FYMA 4PWYA 4ARSA 1G42A 1NAHA 2OAEA 1HSZA 3H4TA 2ECFA 4H1HA 1GR1A 1NN1A 4JLPA 3PU6A 3QXGA 3GLHA 4J7XA 5GMOA 5C8ZA 4RENA 5K0BA 2WAAA 3SIXA 1KERA 1LQ2A 1N1DA 2C7BA 4Q4LA 3AVUA 1MQAA 4KRGA 4RJJA 2FP4B 2P6UA 1I6KA 2P0AA 4LSGA 3TIGA 5F51A 3K9NA 1QPZA 2W6JA 2YASA 3RRFA 4ER0A 1ANKA 4ARAA 1GSOA 4CM9A 4ECEA 1N4AA 3OJCA 2IGBA 1U3TA 1Z6AA 5ELMA 4IBOA 3CN7A 3V4LA 4M1EA 2B37A 2I3AA 1LPMA 4GI3A 4MIKA 1CHNA 4FW8A 3V1UA 2HPZA 4B47A 5IJ0B 4RMJA 2HT1A 1LPNA 3E9CA 3VO2A 4E21A 3FCOA 3M3PA 3I32A 4Q9LA 3R23A 1U7PA 5FL7A 4DVGA 1LV7A 4A6PA 2O9JA 1S02A 3DZKA 2AXPA 2GBPA 3QUBA 4MPDA 1SZDA 2JIPA 5K1ZA 5JSHA 1ODKA 2MSDB 3PD1A 4AYTA 4LF8B 4MI6A 5PNTA 1JXOA 1BHSA 1WHSB 2P4HX 5E6UA 3IE0A 3OC6A 5EQDA 1JI0A 5U4XA 2C9DA 2ZSBA 5EIWA 4GP6A 5FBKA 2EF1A 3JWHA 1NXSA 1XCOA 4P4TA 3VVMA 2L2QA 4V0KA 1K9SA 2GCOA 2DKNA 5GM1A 4R31A 4U2DA 1Y81A 2HQ1A 3IAM6 3HB9A 3OT1B 1HDEA 3WWYA 4EHJA 1W47A 4ZIRA 3ENZA 4RPJA 3NHPA 2CD7A 2R60A 2ZR8A 4B4VA 1LLQA 2O6HA 4RVOA 3HZRA 1NQOA 4WN9B 1G41A 1J1ZA 1LV8A 1QH1B 2G1UA 4I8DA 4CCAA 3W8NA 2BN4A 1G18A 2AJTA 2ODEA 3GPCA 3RVNA 5HS6A 3I04M 3R6DA 5HF6A 5ALIA 3C8MA 1HKHA 1SOAA 1UMBB 3LHIA 4RAQA 5DHUA 4CKBB 1ZVVA 5L51A 3P0FA 4DCPA 3O8NA 3F3MA 5DGXA 5E2IA 1ZN9A 1UKVY 3IE1A 1FFBA 3PFWO 2CEAA 2ZRDA 1VJRA 1BMDA 3INTA 4JEHA 1VE1A 3RH0A 1SM4A 3T5BA 1CG6A 5FPHA 4ZDKA 4B84A 2W2LA 4F45A 1ZP6A 2NGRA 5DWDA 2IDJA 4Y2GA 4EYEA 1BMFD 5LQJA 3R9WA 5TS3A 2IYLD 1V1RA 2QMOA 1E9AA 4KGZA 3VR0A 4KN5A 2V58A 5AVZA 4MDEA 4L85A 5B1YA 2ZWIA 1N6PA 4R01A 1E5DA 1N75A 1QGDA 5CP8A 5IPFA 3SAJA 4CETA 3BE6A 3VR5H 1LI7A 3DEYX 4A0FA 4X7RA 3TTWA 1P7VA 1F3LA 2H17A 3AFHA 3DBVO 4P33A 3OZBA 3HRIA 3G85A 4YUXA 1JJAA 3AR4A 3LXXA 1W87A 5FUBA 5HQ3B 4EZBA 1WBBA 1PS8A 2IEDA 2Q5QA 1R4NB 3HSKA 1D07A 3PHIA 3ZKWB 5ECGC 2JRLA 5M5BA 3TSYA 2FZKA 3KHTA 4BGVA 1ONNA 1NN3A 1E89A 1PHPA 1WD5A 1KYQA 4UXHA 4LJSA 3AEXA 3C16C 4YCNA 1A27A 1E6MA 2XADA 3ET5A 3LCVB 1UOQA 2WJWA 3AINA 1AQJA 4ZYTA 1G16A 1PZHA 2R2AA 1ONOA 4YJ2F 2CJYA 1OAAA 2A9VA 2VRCD 3QIVA 4MVJA 1IY1A 1QTNA 3AVPA 1RXIA 4KG7A 1JG7A 3RIMA 3DYBA 4W5QA 1GNTA 1ZUNA 3QOFA 2G9UA 4P98A 2BLLA 2W98A 1NQXA 3TJMA 3U26A 2W0MA 3NH9A 1EDDA 1XXHA 1LSOA 1GUBA 1TO6A 4R83A 4WOBA 4MUIA 5JWOA 3FCEA 2OHXA 3BK7A 2EDCA 1EGVB 2J0EA 3OM1A 2Q7DA 3TLJA 4GM0A 4YP9A 1L5ZA 4LE0A 1PZMA 3RAFC 5JHGB 1M8PA 1Z83A 2BFFB 2QQFA 4GD3Q 4KO1S 3LCJA 5J23A 2ZB2A 4Q39A 4MWDA 3AR7A 3MVEA 4MMYB 4P92A 3OE1A 2R6HA 4RC9A 4EW3A 5LYJF 4MPPA 4LHWA 3L8GA 1QGOA 1GYPA 1N2ZA 1ZK0A 1E32A 4A2WA 4DLZA 5KHOC 2OXRA 2I1LA 5EIBC 2E85A 2FPUA 3HB4X 4QNMA 3ZK7A 2OO3A 4RABA 4GMGA 1LX7A 1Z6GA 2CHFA 4MKFA 3UHPA 2OL4A 2J8ZA 3Q7PA 1H4VB 5HOEA 2ONZA 3RAJA 1SCIA 4ZOEA 5EP1A 4LJLA 4XDHA 5JXHA 3QNMA 1Y6JA 5EC8A 1MB0A 2PUBA 1CJUC 2F3QA 4OYLA 2VUUA 4IIFA 2GBLA 3H1AA 4GBJA 4K6HA 4LKRA 3WB9A 3WV5A 4DM7A 1JI3A 1QZ3A 1R18A 2IUEA 2VPIA 2BD0A 2SKEA 4QDJA 4K9KA 1R8SA 1YL5A 1F06A 2P1RA 3AETA 3REOA 3WNDA 3HKDA 1RRKA 4BZWA 1IM2A 2P0YA 4HDKA 1A5ZA 2G88A 3DWEX 4C7JA 4GS5A 4WK2B 1PBNA 1P2DA 4D99A 2YIVX 2RD2A 2QG4A 3AFOA 4P3XA 4P4NA 4RE6A 5KVVA 3F4BA 4A26A 4ARVA 3HN7A 3R3SA 4J07A 5DF1A 1DEOA 4IGKA 3W2IA 3CH5A 4B45A 2QVLA 4F4HA 1J0CA 1DAKA 1EDEA 3SX2A 1VLQA 1E1CB 1ECGA 2FSFA 4P1ZA 4QOFA 4TT8A 1SOWA 4FI3C 3SJBA 4GPEA 3UM9A 1PUJA 3HWX1 2Q3FA 3NDPA 3QBTA 4PLFA 5CCEA 1KEPA 3KTOA 3CX3A 2AVDA 2G28A 3EWSA 5H4GA 2FPIB 1VSTA 4XH9B 1F1BA 3GP3A 4GICA 3FYDA 5DULA 5EGNA 4C87A 2Q0QA 4LIPD 4CFSA 1I4LD 4XLTA 5AUPB 5EINA 1MT3A 1POWA 5JLAA 5KNCH 3M34A 2IIQA 1JE0A 3A1NA 3LE8A 1LX6A 3RFTA 1E2DA 3R1IA 5A3JA 3RIXA 3OWHA 1ECPA 1N2CA 1XUOA 4QELA 2PZAA 3T7JA 2H7XA 5D5PA 4UPEA 1LZKA 4JLKA 2UYHA 5JWHA 4JJIA 1XRMA 3ZNOA 3IBYA 5F35A 3ZLVA 5C1DA 2F62A 4AB1A 3K4HA 2VO1A 3QBDA 1DBRA 1FTNA 5JU6A 4JCCA 5DM70 4YTEA 3AM3A 1LRKA 3W79A 1O95D 5JS6A 2YMQA 3H4MA 1JIXA 2FMXA 1ODJA 1DI0A 1W0KD 3Q0EA 5F98A 4AO6A 1Z7WA 3BRWD 3RAGA 1JSZA 4LJ7A 4MTLA 3RSFA 4OHMA 4DMUB 1CUWA 1QM5A 4TS9A 4ZHQB 5IFLA 3TTVA 3GT7A 5CHEA 3QU7A 3EEBA 3CF2A 1WDWB 3KPWA 4AI6A 2R00A 3RUIA 4QHYA 1I8TA 1EP2B 3WYEA 4P4LA 4KBYA 4M1ZA 4L95C 5B3AA 2PKYX 2VVTA 4HD8A 5FBLB 2J9FB 1F0KA 3TI9A 1BGWA 3BB4A 1X86B 3GEGA 4LX0A 1VPLA 1Z6PA 4ZRMA 3Q3VA 1NJ5A 1P74A 3S40A 4F9TA 2CBGA 3ANXA 3I5YA 4IUBS 4OI4A 2YNMA 2DSTA 4RA6B 5D84A 5KJEA 3IP1A 4AZ0A 2WA1A 4DG5A 4RSMA 2BM1A 5BY2A 4M89A 3NU1A 1JH9A 2B2NA 3B78A 2VP9A 3H75A 2BVNA 1CUYA 2BFDB 1G9TA 3Q5EA 2OFXA 5TEVA 2E3JA 3STUA 3MB5A 3GLGA 1UBMS 3HB0A 2QX9A 3EGDA 3PFFA 2D06A 2NXNA 4B6OA 1DAFA 4QUGA 2C2ZA 3EWAA 5IZ4A 5KTMA 3IT2A 2BKLA 3L46A 5FP0A 3MCZA 1DQYA 2NXWA 4DDUA 2XB2A 2ET6A 2JI8A 4QXPA 2PIDA 2XCRB 3SCZA 2A9FA 2MMCA 3I5UA 2B30A 4QJ4A 4NU8X 3ZTYA 3H0KA 3NPMA 3V33A 2V7UA 1JJIA 1G4AE 1LDMA 1BHJA 3HQ4O 4EFLA 1NUQA 2I67A 2RGDA 1YOVB 3NFYA 2JDIA 1F51E 3PNBA 5LZ7A 1R0RE 5IZCA 1NMSA 1M76A 4GRAA 4Q3EA 4XSHA 2V1UA 4P36A 2J3HA 3K20A 3GP8A 4XPIB 1A5AB 1Z0UA 2Q4OA 4PLHA 2JLYA 1LA2A 3UMCA 2QENA 1AHIA 1PL7A 3WX0A 2FUCA 3R3JA 4HPXB 4RZIA 3DVQX 2WWXA 3AIKA 1E7YA 1VKJA 3QBVA 2PH1A 3TZLA 2YWHA 1SXJD 3N8GA 4BWGA 2OBLA 3MOSA 1XRQA 3M4JA 2DB3A 5AK0A 5IJ9A 4UVGA 5F9FA 2A59A 4YJGA 1OF1A 4C4RA 4FXOA 4P3OA 3KAPA 4QUEA 1TAQA 4H0CA 3V2UA 2FG6C 2YJTD 1AQ6A 3PXBA 3LSYA 3ZXUB 1WW2A 3AM4A 3CZ9A 3K09C 3CPJB 4Q7KA 2CXRA 1YACA 3AY3A 4LGYA 2K5UA 2O4CA 2QRZA 1Y82A 4YMIA 5LD2C 2IHTA 3AG5A 5GIPE 4YS6A 4F84A 1FYVA 1DUIA 1AK1A 3M82A 1KO7A 3X1ZA 3TNFA 1X2EA 4AW9A 2G5CA 4P4GA 5E4TA 2V7BA 4NOMA 2R86A 2XLCA 4OB7A 4UREA 1QQ7A 3ZE6A 4QXAA 4BNIA 4ZYYA 3AY7A 4MJ7A 1H65A 5AM2A 5JATA 5BR1A 3CLRD 4UZFA 1ZBQA 1V11A 1IN4A 1MABA 1K66A 3GCGA 2ZUTA 4UTNA 1YFLA 5KNDD 3KT8A 1XAGA 1Y5MA 1PGPA 1EFPB 3NWJA 3CE9A 4MB0A 3TLYA 1R4ZA 3LOPA 1K06A 5G1PA 2GM9A 4DB4A 4OSEA 1OY1A 1F17A 5JNLA 4I4IA 3I73A 1KE1A 3F5SA 5EERA 5JTTA 3PPXA 2M6LA 1SCUA 2RB5A 4QQRA 1BS1A 4AQDA 4YROA 2VHQA 1QH0A 5KJFA 1S8OA 4RK0A 1OXXK 2QY9A 4MWOA 5A04A 1VGQA 3PG5A 2XRYA 4YAUA 2WLTA 3NVKI 2HMTA 2ZYSA 3I76A 1EBUA 4WJZA 1VIMA 3DT8A 3GZNB 2YYAA 2XCOA 1LK7A 3DPUA 3KQQA 2GO7A 3O7MA 3SWWA 1KC1A 2BW0A 2FPRA 3S7TA 4B09A 3OY2A 2PX3A 3WDMA 5HOQA 3ZI0A 1FU4A 5DNCA 1K4YA 3ZVRA 1RQNA 1EAYA 3RB8A 3AWIA 4ARZA 1XEXA 2FSIA 3NGXA 2KM1A 3V4RA 3CH6A 4KI7A 3RF7A 2XJ4A 1SK8A 3UFXA 1GOTA 1IOLA 1M34A 2R48A 3RYHA 2OHJA