2OT3B

Crystal structure of rabex-5 vps9 domain in complex with nucleotide free rab21
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
166
structure length
157
Chain Sequence
AYSFKVVLLGEGCVGKTSLVLRYCTTLQASFLTKKLNIGGKRVNLAIWDTAGQERFHALGPIYYRDSNGAILVYDITDEDSFQKVKNWVKELRKMLGNEICLCIVGNKIDLEKERHVSIQEAESYAESVGAKHYHTSAKQNKGIEELFLDLCKRMIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rab5 GDP/GTP exchange factor
publication title Structural basis for Rab GTPase activation by VPS9 domain exchange factors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 58
structure length 157
sequence length 166
ec nomenclature
pdb deposition date 2007-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2ot3B00
4OK6A 2ZAMA 1EWRA 4NKRA 4RKEA 2VH5R 3IQWA 1R0YA 3B1WA 4RCYA 4TSFD 1E9BA 3BGWA 4BZXA 1FX0B 2NGRA 4B73A 4DBLC 5FI0B 2F43A 1SXJB 4DKXA 2H5EA 2ZR7A 1P5ZB 1X8KA 1O87A 4TL7A 4ARZA 1HH4A 4HLDA 4TMWA 1S3SA 2CCGA 2WPDA 4DT1B 3KXLA 5DHFA 1I4TD 1US8A 2QM8A 1MABB 3V4RA 1ZC3A 2PEYA 4YMSA 2JDID 2GXAA 1B23P 4A0RA 2MMGA 3BJIC 3I92A 4C0AC 2OFOA 4M8NE 2FEOA 2LCFA 5AUOB 1N25A 4EAQA 1YKSA 3TE6A 2ZUDA 4UNQA 2GETA 2A5GA 2ZS8A 2GBLC 1DO2A 1FTNA 3RC3A 5FFMA 2ZJZA 2PJRA 3FKSD 4OI4A 1Z63A 4V03A 1EFHA 2QMUA 2W6ID 2XJ4A 3AF3A 1R0ZA 2XTMA 4TSFA 5JCZA 3BORA 1MO6A 2IYTA 2JAQA 1Q20A 4LV6A 1U81A 3ICEA 3DL0A 2BKUA 4HSEA 4BLPA 3SJZA 3I5YA 2GZHA 3GLGA 4CIDA 2XOKD 4LBYA 1NSTA 2KBEA 4PC6A 2PCLA 2VHCA 3L8ZA 2JDIA 3U44A 1QHIA 4ZCIA 3KTAA 2G1KA 3AKCA 3QF4A 4WA7A 1DAIA 1W2HA 3C5CA 2PZGA 3CPJB 5CDFA 4NE2A 1CXZA 1N5JA 4I99A 3ND9A 4Q03A 4B74A 4TZ0A 4ACAA 4MH0R 2YINC 4TWZA 2ZRLA 3DKPA 2AR7A 2LKCA 5HKKD 1M2OB 3EXAA 3FKSA 4GP7A 1M74A 2W6IA 4NYIR 4MQBA 1IHUA 4JBYA 4DLSA 1OXXK 5J4YA 3BERA 1F5NA 1Q57A 2JJ8A 4NTZA 1P62B 2ZVQX 5FBRB 5JZVA 1W4CA 4AKIA 1R8SA 5AUPB 2PZFA 3H84A 3ZYCA 5FUVA 2O8CB 2XOKA 4ZCMA 5CYOA 1OFIA 3I61A 4KCGA 2ECKA 1WA5A 1XXHB 4B71A 4LZZA 1UKYA 1NBMD 5KNDA 4KLNA 2YV5A 1N0UA 4BRWA 2J1LA 4DLUA 1Z83A 2QP3A 3IPXA 2VEDA 1P9NA 1PLJA 2AD1A 3DZDA 4JLKA 4QBGB 5HKKA 4Q4AB 4O25A 2E9SA 3K09A 2VF8A 4GL2A 4IFEA 3TUZC 1XZPA 4YDSA 1MT0A 1U8AA 3CX7A 5EP3A 1E6CA 2C96A 2HXSA 3HU3A 4PSAA 2YJTD 3KKMA 1AZSC 4AG5A 1XPOA 3FMIA 2BCJQ 2WWHA 1AS0A 3PQCA 3BH7A 4MGYR 4QBFA 1II8B 3QSYA 2ERXA 3FKQA 1TAGA 2K5UA 4HB2A 4JVLA 4D0GA 1PV4A 2IYLD 2CNWD 3THXB 2IHYA 1G7RA 4L9WA 1OLOA 2IYXA 1D2EA 1KI4A 2ZI5A 5E7IA 1R4AA 2ZVPX 4KODA 5EXSA 2OE2A 5TY0A 1OV4A 4JLPA 1NBMA 4M1SA 4E22A 1KYIA 1G41A 3QVVA 5J40A 1CKEA 5DLQC 2BCGY 3OEHD 1KDRA 4JKYA 2WIAA 3T5DA 1XD2B 4ESVA 4W9MC 2OBLA 3THYA 2QSYA 3ZDQA 4W5JA 4JL8A 4MDFA 5DO9A 2ZRNA 4DLZA 4DLYA 3AVWA 2P6NA 1W5TA 3HP1A 2W83A 3NEJA 3AP2A 1LS6A 3I5XA 5LB4A 4U7DA 4JSYA 3OESA 2F3RA 1OXSC 4NYIQ 2J46A 3RS7A 1R7RA 1TQDA 2HUPA 4TTPA 2AK2A 2VP6A 2ZS9A 2FJUA 5JFGA 2CNWA 4AKGA 1AQUA 3K8YA 2QGNA 1QVRA 2GAAA 4QM7A 4QFMA 2AWOA 2WWXA 1YZLA 3SC3A 5BN4A 3OEHA 3AQ4A 1Y3AA 1NKTA 1RW4A 3GQBA 3W3AA 5AJXA 3G5UA 5K8IA 2C04A 2ZUBA 1BH2A 1W47A 4QRHA 4K8OA 5D3MA 5IDVA 4QJ3A 5C1BA 2D62A 3KFXA 1KK1A 4XVQA 5JHHB 3B2EA 5EZ5A 3WYGA 2WWYA 1XRJA 1CJMA 1SZPA 4G5OA 3PUZA 5A0FA 4C0BA 4BRUA 4PHHA 1ZYUA 5FUYA 5B2ZA 1NY5A 3TNFA 1BYIA 221PA 3SR0A 2F43B 2IS6A 2KWIA 4ARZB 2RCNA 4JYBA 1G1MA 3EC1A 2RGXA 1HE8B 5L3RA 1OFUX 2PEZA 3KB1A 2CVFA 1OIVA 1I4LD 2GCOA 4JBWA 1UADA 3SFZA 3WP0A 3BB4A 2ZI9A 3C5HA 1VCMA 3EPJA 1Z47A 1Z29A 5CLLA 1TADA 4DCVA 4GDFA 1VCOA 1AQYA 1W44A 2F3TA 1G17A 5FOUA 1KKLA 1KO7A 4A2QA 3TBKA 1II0A 3KXKA 1WBBA 2ZANA 2FZLA 2J7KA 3IIMA 4ZCLA 1OB2A 2V9PA 3VKHA 1ZAKA 1ZD9A 4W7SA 3K09C 4ZIRA 1JR6A 4JLOA 1SKYB 3Q5DA 3UPUA 1R5BA 2HF9A 1Z3IX 5J4KA 4CRWB 2RHMA 1W2GA 1T8TA 4E5UA 5FR2A 3DOFA 4QGAA 2PMKA 3GLGB 4PAOA 1XPRA 1P2UA 1W4AA 2Y8EA 1XD9A 3HR8A 1XFAA 4JMPA 4A92A 1TNDA 2QY9A 3IHWA 1NVWQ 5J4HA 3U44B 2I1VB 1NIJA 3KTAB 2AK3A 3QF4B 2BJWA 2IXFA 2P65A 1UBGA 4OK5A 1M7HA 4JZKA 1XNJA 3IDQA 5J47A 1NNEA 2DFKB 2ZYWX 3D7MA 4M1YA 1DARA 2OCBA 3MSXA 3IEVA 1LTQA 4MUAA 5TMPA 1GFIA 5DIFA 4IEIA 1E32A 1KY2A 3UKDA 4C3ZA 3GLFE 1KO8A 5IF9A 4TMVA 2DCUA 3PG5A 1G5TA 2QORA 2WJIA 2IYSA 1OW3B 1ESNA 3T1VA 4D2IA 3R20A 1TEXA 2O0KA 3I3SR 2GZAA 2ZI4A 3PIRA 4TLCA 2XX3A 1OH5A 1TUEA 1SVSA 1NY6A 2C95A 1OSNA 2FF7A 2RH5A 1FP6A 3KB2A 4N0EA 4F91B 3K0SA 2HDNB 4OI2A 2FFHA 4D25A 4Q47A 1JXMA 3H2YA 1EX6A 4BFSA 1M7GA 2P67A 4D0NA 4AWXA 4ZI2A 1KK0A 1XTQA 3RVBA 4JYCA 3ETLA 3KJHA 3KKOA 1TEVA 1FUUA 3TK1A 4KFUA 3DO6A 4C0QC 1IN6A 4DZZA 1Q12A 2IS2A 4Q00A 2WKPA 2A5JA 3QKTA 4LV5B 1H8HD 2ORWA 2QE7D 1WE2A 1WF3A 3OFND 4FMCF 3RHFA 3DMNA 1FMJA 4G5GA 5TB5A 4A0GA 1KSJA 2NOAA 2WIBA 2Q9CA 4LJ9A 2QAGC 4IOMA 4Z51A 3GLIE 2J0UA 3Q8XB 3BOSA 4UKDA 1M7BA 1FOEB 5BQ5A 1RRCA 3WHKA 4AYXA 4AI6A 3MWKA 3K0FA 4JLNA 2C77A 1XTKA 4AG6A 3THYB 3OEED 4KVGA 5FTKA 4E03A 3CRQA 4XIGS 4WXPA 2KB0A 1LFDB 4HUQA 2XNSA 1MOZA 5DNYB 2FFQA 3EASA 3UMFA 1T5IA 3K0CA 4OL0A 3M4YA 1H8HA 4O0MA 4OHVA 2QE7A 2ONJA 2AN9A 3OFNA 5KDLA 3VMFA 5K8UA 4MKIA 4JVNA 3IKJA 2YKGA 3HU1A 5HCIA 1G6HA 1EFRD 4HUTA 3CB4A 2PX3A 3QKRA 4TL9A 3IUYA 1UEJA 1TQ4A 2ZETA 4HAXA 4DDVA 5JLJA 2BBSA 2GTPA 3VKWA 1U9IA 4LHXA 2O8DA 1CR1A 3K1JA 4RVCA 4CEHB 4IVPA 1ZRHA 4HB4A 2X1VA 2GJSA 3PV0A 1Z22A 1HA3A 3TLXA 3OEEA 4LYJA 1ZD1A 5D3MB 4CEJB 2ZIAA 1G5PA 3P4YA 3LO5A 1D2NA 2BOVA 2VTKA 2FMXA 4HDQB 2VLIA 1G6OA 1E2EA 3KX2A 3BAFA 4JVSB 3U60B 1YZQA 4FMCB 1HQCA 3P32A 2IEYA 2XTZA 2GXSA 4S35A 4FXPA 1SVWA 2N1BA 4Q7JB 4BQSA 1KO1A 2HV8A 1A82A 4IEEA 3AVPA 2PH1A 5BN3A 4C0HA 3RWOA 4D80A 2WMNB 1EFRA 3RC8A 4FN5A 2W58A 1UEIA 3MWLA 1QG2A 3AGQA 3GJ0A 4I1OA 4PFSA 4MRNA 4OBEA 2J7PD 1E79D 1U98A 2GCOB 2PT7A 2ZYUX 1PZNA 1NJGA 1Q1EA 1U99A 4G0NA 4RCZA 3FFBA 3TVDA 2EWWA 1I2MA 4LK2A 1KSGA 1HUQA 2WJYA 2WJHA 3NBYC 1XMSA 2CE7A 3NBXX 4ERNA 4ZIRB 5KUTA 1SXJE 5C2JB 2W6JD 2C9YA 4DCUA 3K9LA 2WWGA 4KYIB 4M53A 2CMKA 521PA 5FTLA 3VR2A 5JS8A 1XPUA 1CR4A 4Z8YA 1XEFA 1OH7A 2AHOA 1W36D 2WOOA 3FHCB 1G7SA 1NG1A 4O2LA 4Q7KA 3VR4A 2J7PA 1E79A 2H8KA 1LVGA 3U3JA 2IYRA 2J41A 1FW6A 4Y0AA 2PLRA 1KIMA 3R7WA 4G5SA 4WAUA 1N5LA 2ZTSA 1JAIA 2RGBA 1DAGA 4QGFA 5KO2A 4Q1CA 1IXRC 5L3SA 4D4JA 3R9IA 4BEJA 1QHGA 1VMAA 4TYWA 2W6JA 2JEOA 4HATA 2H1LA 1XCGB 2NZJA 3TJZA 3HWSA 4EJSC 1YU9A 4PHGA 4TQUS 2AKAB 1WB9A 1SVOA 1G3UA 1EXMA 1CJTC 1T3HA 1T9HA 2BBTA 4OYHA 1U8ZA 2V6JA 2GDJA 3RS3A 3KUDA 2PCJA 4B44A 2LWIA 4GFDA 2XXAA 3PEUA 3FGNA 3B1XA 3PUWA 3RLFA 1R10A 1KNQA 4A6XA 2QPTA 4OHXA 4D81A 1UFQA 1JPJA 2RGEA 2ZRKA 1U9IC 4Q1AA 3CKLA 2PL3A 4LBZA 3O8RA 2R8RA 4JLVA 3K0AA 5DISB 3WRYC 3TW8B 4A2PA 721PA 2CLSA 2N46A 1RJ9B 5FTNA 3VTKA 4KI0A 5AWFC 3GCGA 4TYNA 3AVQA 3GD7A 3BIFA 4IRUB 5CM8B 4L9SA 3MRSA 2WTUA 1QHHB 2ODWA 3PUXA 4PAQA 1SVKA 1XXHE 5FPYA 1TU4A 4RD6A 2OZEA 3MGCA 3M0EA 1OXVA 1D2MA 4TLDA 3I62A 3OIWA 4JIMA 3SQXA 1ZP6A 2J0UB 2RMKA 1IBRA 1F2TA 2HCJB 2V6IA 2A3RA 4M9XA 1E2IA 1G21E 3RRYA 4EPRA 1N5IA 1RFLA 4QBHA 1YRAA 3K0FB 4LYAA 5AJYA 1U8YA 1J8YF 2CE2X 3RSLA 2X2FA 1AIPA 1CBUA 1ZUIA 2H17A 1KI8A 4CT5A 2FX3A 1QHNA 3GJ5A 4IJMA 4OHYA 1GNRA 5GVRA 2GBLA 4GI7A 3A36A 1FMLA 4HUQB 4FCWA 2WM9B 4JJZA 2NO9A 2QRZA 2NQ2C 1S1CA 4LJ7A 4P31A 4V0ME 1BMFD 2CJWA 3EZ6A 1JR3D 4CW7A 1CIPA 2GEVA 3TQCA 2I1QA 3QKRB 5FBWB 3LQRA 2WOJA 3QENA 4HAVA 4RY2A 1UJ2A 2B6HA 4PO8A 4URYR 2O8DB 4L15A 1N6IA 1C1YA 5HCNA 4XTCS 2YYZA 3RDPA 3U7HB 4MRVA 2XZLA 4JLDA 4I81A 3SN6A 1JB1A 3SBEA 2DYKA 1E1QD 1RVDA 3EPKA 5FPSA 1GKUB 1KO4A 4US0R 5JWRA 1NMYA 4ZDWA 4C9BA 2IF2A 2YVUA 1G3MA 3CRRA 3QQ5A 4P4SA 2ZUCA 3VHXA 4DCSA 3E5HA 1TTTA 1IXZA 1J8MF 2EYQA 2PT5A 4YLGA 3FMOB 4PO1A 2CL0X 1BMFA 421PA 3CW2A 3AF2A 3KJEA 3AKEA 1JR3A 3WYAA 3O8CA 3KKQA 3LV8A 5H68A 2UVQA 1RRFA 1W36C 1FZQA 2C9OA 2EW1A 3DOEA 4LYHA 3U7GA 1QHSA 1KDTA 1VG8A 1XX6A 1IOZA 4EPYA 1X8JA 2YC2C 4HAWA 4PAMA 3BFVA 1E0SA 2WKQA 1GIAA 3KQKA 4WZ6A 3U4QA 3K0EA 4DLVA 3BFXA 4K81B 4DIEA 1E1QA 2GJKA 3ASZA 5FBLB 1E2GA 1JALA 3DMDA 5KSOA 4XSHA 2QMOA 3CPEA 2OFXA 4B75A 1MRSA 4WZAE 2ZI7A 3U2QA 2O8EA 4XWOA 3WYFA 3IBGA 3IBYA 4PC1A 3R9XA 4ZO4A 2QN6A 3TSOA 1MH1A 3LWNA 2J3EA 3GLHA 1N6NA 2DFNA 4C2TA 2JJ2D 5TDHA 1TQ6A 4A15A 2MSEB 2IWHA 2GKSA 4KXFB 4Q4JA 3EX7C 4XOIA 2QTFA 2BMJA 2D4HA 2QQEA 3B9QA 3H0KA 3THOA 1AK2A 2EFGA 3QXJA 4IKEA 5J5CA 1E9SA 4MRRA 2BEJA 2F9LA 5JBQA 3VR6A 3WP1B 4BLTA 1GSIA 1KKMA 2GA8A 3GEIA 1DVRA 1NF3A 3EPLA 4XD7D 5AUNB 5EXXA 5JI3E 4M0LA 3KJGA 4HDOB 1SKYE 5TVKA 5L3QA 1FNNA 2WJVA 3LW8A 3BK7A 5AUQA 5L3SB 4PC7A 3X1DA 1VIYA 5L8VA 4G3XA 4B3BA 2NPIA 1CJKC 1II9A 3L0IB 2NO1A 2ZYTX 4I1SA 2KJQA 2WWFA 2ZRMA 4A0FA 1E2LA 1JQLB 3QXSA 1KK3A 2CL7X 3GLGE 2IXEA 3WMEA 2C8VA 4KU4A 2JJ2A 4M1OA 3BFKA 3AUXA 3HYRA 1Z0FA 1XEWX 1ZNWA 3ZQ6A 5C18A 1Z0AA 5KNBA 1Z6YA 4B3FX 4AURA 1DG3A 1FUKA 2HJGA 5CDFE 3LA6A 1KMHA 3K70C 1D9XA 4ILEA 4LHWA 1TF7A 2LKDA 2JLXA 2XXAB 1D5CA 3DM9B 4QGGA 5E95A 2A5DA 2WSSD 2DPXA 1IN7A 3CIOA 4XD7A 4WBSA 3VX4A 4D6PA 4XWAA 3QIAA 1PUIA 1ZU5A 1KAGA 4AIIA 1W5SA 3EWAA 2A9KA 4R9UC 1GILA 1Q3TA 4RKFA 3RRNA 5EUQB 3V00A 5KNCA 3SJCA 1JBKA 1T3LA 3ZIAD 3NC0C 2J87A 3JVUA 3OE7D 2UKDA 4BFUA 1C4OA 5KTYA 2O0JA 3A1UA 3QPWA 1QG4A 3REFA 2F1IA 1E9EA 4LDJA 3B5JA 1NIPA 1KI3A 2DWQA 2ODNA 2QP9X 3NXSA 5EP2A 3R9WA 3Q72A 1JAHA 3RABA 1KAOA 4EPXA 1UBFA 3PXGA 5DI3A 3TIFA 1DOAA 1U0HC 4NCHA 2RKOA 3KQNA 3NVAA 2GXUA 2WSSA 5CIQA 3DPUA 5JWHA 3F8TA 4ZDKA 4LSGA 4W5WA 1OFHA 2HF8A 3K53A 3ZLJA 3EW9A 4DB4A 3TSWA 1G8HA 1X86B 4LUCA 121PA 3X1WA 3T35A 3ZIAA 4P4TA 2NMVA 1E0KA 1XMJA 3OE7A 4URXR 4GP6A 4X8LA 1Z06A 3B82A 2ZM5A 1A2BA 1G3IA 2OCYC 3UK6A 3AUYA 5SZJA 3QBVA 4PSKA 1U90A 4A9AA 4LJ4A 2DB3A 4YC7A 1I2DA 3D8BA 1S1MA 2QZ4A 1AJEA 5C4GB 1GAJA 1FTSA 1NN1A 3FHTA 4B33A 3ONWA 1MRNA 3EA0A 3T34A 3O8BA 1NBME 1SULA 1N3BA 3AB3A 4JS0A 2CHGA 4NHOA 4G5RA 4JLAA 2ATXA 1E2NA 1ZNZA 2QTHA 4Q4HA 4NYMR 4PSVA 1XB2A 1ZJ6A 3TW4A 4PTLA 1SVIA 1V5WA 2BJVA 2OXCA 3QEJA 5AJZA 4DIDA 4DDUA 5KSZA 1A1VA 3IGFA 2IBMA 3OZXA 4YMWA 1LF5A 3MWYW 2GJAA 2R65A 4XH9B 3OHMA 2BDTA 1W0JD 4GZLA 2GEUA 1QVAA 4OQXA 2IW3A 4KHZA 4IDHA 4IXMA 1MR3F 1T5LA 4KV9A 4QHYA 1E2MA 1DBSA 3NEYA 1VG0B 2WJGA 1EK0A 1KZGB 2JGNA 5TXGA 2PBRA 3B78A 4P4SB 5DSZA 3EG5A 1KI1A 1OHHD 4MA4A 1KDPA 4V02A 3MD0A 3GFOA 1DEKA 2FGKA 2OUKA 4LJAA 1B0UA 2RHDA 3MUFA 3C15C 5SZKB 2FE4A 1ZM3A 2OHFA 3G0HA 4QHSA 3TQFA 4DSOA 3EIEA 4RD2A 4AD8A 5GVSA 4Q66C 2F1RA 2IYWA 4IVRA 3WMFA 1Q22A 2IYZA 4YMTA 3U4QB 1XZQA 3CF0A 1O3YA 2CLCX 3KUCA 1UM8A 1W0JA 1F3OA 3ECCA 2IYQA 3FDIA 3M6AA 3NHBA 4KSBA 2HT6A 3SJBA 3CZPA 5FBVB 2D2FA 1GDDA 2ZE6A 2RGNC 1VKJA 1FFHA 2CHVA 2R6CA 2FWRA 3E1SA 2VHQA 3LH5A 4CEIB 2GNOA 1OIXA 4RZ3A 1YZUA 2O8EB 2I4IA 2FPKA 4FMBB 1OHHA 4L4UA 1ZM7A 4UNNA 3TRFA 1P4SA 2IHBA 1E3MA 5F9FA 2D7DA 4GBMA 1GKYA 1G4UR 2RGCA 4FWTA 1IONA 4X8OA 5TV2A 3QKSA 4Q4JB 1EFTA 3FYHA 5BN5A 2Q21A 3UXMA 4X8MA 2GK7A 2C78A 1JEEA 1OT3A 3RS4A 4GZMA 3F0TA 1DADA 4Z1MD 4PPNA 5FUWA 1UPTA 2QAGA 4BLQA 4M9QA 4NYMQ 2FSIA 2A2ZA 1OYYA 3W3ZB 1P2SA 1Z28A 2IC5A 2MMCA 3LXXA 1OJLA 1US8B 4MKHA 1SVMA 3IIKA 5L3QB 4URUR 2ZSDA 1T0HB 1KJWA 1RE0A 3SOPA 1G8GA 3EC2A 5G3YA 1YZKA 2G1JA 5JMTA 3ICQB 3L43A 4DUGD 4Q9LA 2GJ9A 2GVZC 4ZV4A 1DELA 2KE5A 2MSCB 3D3QA 4BZPA 2G88A 2QENA 4TYPA 3ZD7A 3GFPA 1DAKA 4PZZA 2OBMA 2NPFA 5E3HA 1N6RA 2VO1A 5CK4A 5EE3A 3I8SA 2WKRA 4BFTA 4PO9A 1KMHB 2V1UA 8OHMA 2QA5A 4Z1MA 4JL6A 5L3VA 4QJ5A 2PMDA 1F6BA 1NRJB 2JATA 4CZ2A 1UAAA 2ZSAA 4Z54A 5KSYA 1Q44A 4NDZA 5KDDA 1E96A 1HQYE 4LY6A 3R8FA 2OLKA 5SZHB 2ASEA 2QQ0A 4QG7A 3VR1A 2UZ3A 4PQRA 4AC9A 3B60A 2X8AA 3CRVA 3AGPA 4DUGA 4PC2A 2ZS7A 1OE0A 1E0AA 4BFXA 3VQTA 3LLUA 3P26A 2FEMA 4XVUA 1G64A 5IK2D 3B1VA 4EPVA 5DYIA 3K9NA 1VPLA 1S9HA 2C98A 3GJXC 3P1JA 4MKFA 3PVSA 3IEUA 3WNCA 4TLBA 1SHZA 3LBIA 4DEYA 4LJ8A 4NH0A 5DYGA 1P60A 3TVTA 3AEZA 5EZ6B 5BYJA 4GOJA 5HPYB 1E9FA 1N6KA 2BEKA 2WWIA 2ZJOA 3QOFA 2A5FA 4E07A 1EESA 2DR3A 2ZI3A 1R8QA 5B58C 4M1WA 1WMSA 3I73A 1ZCAA 1N6LA 4ZPXA 2UZIR 2ONKA 1Z0DA 4P0TA 3TMKA 1X1SA 3WBJA 1RKBA 2G6BA 2G3YA 3HDTA 3L0SA 3QUSA 5DH9A 3SYLA 1CU1A 1ETUA 2QT0A 2CCKA 4YONB 5IK2A 2VRWA 5JECA 2DWOA 4QXAA 3W90A 3FPAA 4XTRA 1KOFA 1OKKD 1S3GA 2AXPA 3FE2A 4KAXA 3NHAA 3KDSE 3BRWD 1JQJC 2F9MA 3FOZA 2JLUA 3QNUA 1EFUA 3SHWA 2OILA 1KY3A 4BEBA 4OHZA 1CS4C 1H65A 1ONBA 1Q0UA 4Q4HB 2OCPA 3KKNA 4HLUC 1YR8A 5CB8A 2OO7A 2IXGA 1T3SA 3UG7A 4DJTA 3TR0A 4GPTA 2Q3FA 3F3YA 3MMPA 3QBTA 4HAUA 2Z83A 1G7CA 4JLBA 1HYQA 4LX0A 4TLAA 3W9YA 621PA 2REOA 3THWA 3AVUA 1JEDA 3QG5A 1HT1E 2BMDA 4HZUA 3ZGXA 1W46A 2QMEA 2BBWA 1M1YE 1S8FA 1OKKA 4Q9JA 2VSFA 5EP1A 2ZRHA 2GZDA 3B6EA 2C5LA 3B85A 3F5FA 5DI9A 4EJSA 1A4RA 4LPKA 2RB4A 2J5XA 3B1ZA 1AS3A 2QI9C 4ON9A 4PZLA 1J90A 2R6DA 3WNBA 2D7CA 1IY2A 3U3RA 2PLFA 4QNMA 2IEZA 3P20A 2J0VA 2AL7A 1P6XA 4DSUA 5ANRB 1LV7A 4FMDF 2WICA 4MDEA 3MJHA 4URVR 3RRZA 2HJVA 4HAYA 2G0TA 2ZROA 3NDBB 1Q21A 3VNUA 2DHRA 4B48A 4F93B 3TAUA 4HAZA 4N1AA 4AYTA 4P33A 3BXZA 5FTMA 3HYTA 3L0OA 2X77A 1TF2A 4Q7LA 3GLIA 5EE0A 1S4QA 2IYUA 4BECA 1GTVA 2EQBA 2P0EA 1G4AE 1G8YA 1NVUQ 3KKPA 3FWYA 2AKYA 3BC1A 1WQ1R 2XITA 4G01B 2PZEA 5FL7D 2IX3A 5CLQA 4II7A 3W5IA 1P2TA 2Q3HA 4LV8B 3TSZA 2Q9BA 2JLWA 1N5KA 3LBHA 5CITA 3QKSB 4D26A 1QRAA 2CHQA 2ZRGA 2ZU6A 4KBFA 4LJ6A 5JHGB 4R71A 4C4PA 1E9CA 4PXAA 4URWR 2HLDD 3BH6A 1CJVC 2QAGB 4PQFA 2ZITA 3IPYA 5JRJA 1ZU4A 5LPNA 2HEIA 4XWKA 4JBXA 4AY2A 2NO7A 1W4RA 2GAOA 4U00A 3REGA 1XMVA 3JZAA 1DAEA 4NCIA 2XB2A 4KITB 2V55B 3GJ6A 1Q3HA 3U7EB 2JLRA 1RZ3A 1VG1A 3HJNA 1YZNA 3AVTA 1E94E 4V0LA 4HI0E 2BBOA 2H18A 4KFSA 5IRCD 5FL7A 4LWZA 4OK3A 2J45A 4RZXA 4DWJA 1WBDA 4A36A 4NCJA 4FMDB 1E2KA 4QGHA 4B6EA 4RFSA 4BLSA 1EGAA 2GVDC 2FDCA 5H8WA 3RSOA 3B7GA 4TYYA 4LGMA 5LD2C 2QP4A 1IQPA 4AKHA 3FMFA 4DB2A 2HLDA 1KSHA 4PZYA 4HYYA 4S2EA 2JLSA 3QE0A 3A1WA 2YC4C 3GJ3A 5A5GA 1WDTA 4KO8A 3S1AA 1SKQA 3K9HA 2VA8A 3IILA 2O0HA 4KJZA 4UJ3A 4ESHA 5JEEA 4BPBA 1AZTA 3TKLA 1G5RA 2GILA 2GWHA 2QT1A 1VCIA 2XZPA 3N2IA 5J4LA 3JZMA 4IDOA 5HR5A 4MGIR 1IXSB 3AP3A 3W6NA 4I4LA 1L2TA 3LDAA 5TARA 3B1YA 1KGDA 1U0LA 3IIJA 1IAQA 4US1R 3CNNA 5DHAA 4FI3C 1F2UA 4R98A 1G16A 1KI6A 1XEXA 1YE8A 4TMZA 4HLQB 1BIFA 1P9WA 4JKIA 1ZIOA 1EG7A 2IF0A 5H70A 4KSCA 3LAWA 3HU2A 5GADl 1VYTA 3A37A 1N2CE 1KZ7B 3A8TA 1TU3A 2V4ZA 2W0MA 5K8TA 1CULC 1Q1ZA 5JJIA 2ZE5A 4EKDA 4ZKEA 3CR7A 1OH6A 1DG1G 3CH5A 4DCTA 3Q3JB 1MABA 5EE9A 3T61A 5HE8A 2QEQA 2AX4A 3AKYA 1Z08A 3E2IA 4LRWA 3SYNA 4OQMA 4IDQA 4A8JA 4CGZA 2IYVA 2WMOB 3OF5A 3VAAA 1HT2E 1HEIA 2BWJA 4LBVA 3ZQJA 1BS1A 2VIIA 3V4FA 2R6FA 3QJYA 3DHWC 1S96A 1LY1A 4TMKA 3U3OA 2FPLA 3T15A 4IOKA 3UMSA 3FTQA 4MGKR 2AFIE 3MJRA 4UNRA 5G53C 4TN1A 3MWJA 2ZR9A 4A4DA 2BVNA 1HV8A 5FOTA 3EZ2A 5F2EA 2FFBA 2J9RA 2QTVB 5BYKA 5E7JA 5IHPA 1ZCBA 3AV0B 2ZE8A 2EYUA 1DS6A 2YWGA 1SHKA 4XVRA 1D6JA 3K70D 1MO3A 2XB4A 2QBYA 4TMTA 1E4YA 2AD5A 1OF1A 3IO3A 4Z8XA 1RRGA 5IT5A 3WNDA 2QGZA 1NMZA 3THWB 4Q9KA 3J81k 1NVVR 4HZUB 2NZ8A 2WVJA 4ITRC 2WJJA 3VR5A 4IXNA 3GJ4A 1N0VC 3ASYA 4TMXA 3SHFA 4MYCA 2C03A 2ZAOA 2YOFA 4RD0A 1T6NA 4B76A 2W00A 4F4JA 1E1RD 4EJSB 2QU8A 4BFZA 2OBNA 2QL6A 3ADKA 4N3NA 3ZJYA 1I4DD 1YJ5A 3AKDA 3CR8A 4PHFA 4TQAA 3EPHA 2YZ2A 4Q1FA 4RJLA 3LQQA 1VYUA 1L8QA 5LDDC 1UKZA 1KI2A 3EZ9A 2CL6X 3BD9A 4IFBA 3SZRA 4DCNA 3CF2A 2REBA 1ZM2A 2CCJA 2ZYVX 3PR1A 2FFAA 4JL5A 1ZUNB 4NBSA 5AJWA 1PVOA 2BC9A 2D06A 3QI2A 1CP2A 2AFHE 5UKDA 2ORVA 4POAA 4NZYA 3QPVA 4C7OA 3T1QA 2WSMA 5CJPA 4A82A 4ZDIA 1GRNA 5FPHA 3T5GA 2NTYC 4X8HA 4EFMA 2X2EA 1JR3E 4BFWA 2YWHA 4CYMA 2DWPA 1G8FA 2C99A 1VCNA 2A5YB 2VHJA 2A7QA 1Y63A 1E1RA 3H4MA 2ZRFA 5G41A 4DC9A 5KDOA 4EIWA 1NMXA 1YZGA 4KBGA 5EUMA 1ODFA 2DY1A 1MO5A 2VF7A 2YOGA 5FOSA 2Z6VA 2ZJBA 3CLVA 3VX3A 1W1WA 4NYJR 4H1UA 1II8A 1XEWY 1E2PA 5GJWC 3THXA 1SXJC 3PEVA 2R44A 3EIQA 4GMXA 4NONA 4BLRA 1E2FA 1E9AA 1FL9A 2OCAA 4Y0VA 5LBIA 4Q02A 2IWRA 2HXYA 3EWSA 1XJQA 1VG9B 4TTQA 3T1OA 1GM5A 3MFYA 3NWJA 3LX8A 5AR1A 4ABYA 2Z4RA 4TL8A 4A8JC 2QPOA 2ZJ8A 5E4FA 1E69A 2VSOA 2ZR0A 3H1TA 3GP8A 2XSZD 1NVVQ 3NTUA 2BM1A 3D31A 1A2KC 3Q5EA 5CYPA 1Z2AA 3B13B 2CEAA 3L8YA 3SYKA 2HT1A 1P61B 3LRPA 4RFSB 3FB4A 3RS5A 1G7TA 5KHOC 1DE0A 1HY3A 2DBYA 1DPFA 4I1UA 1S0UA 4L16A 4WIAA 3SS8A 1W4BA 3KFVA 3M1IA 1YRBA 2OSBA 3H86A 4G1UC 3AH8A 2ZI6A 1W7AA 3S1AB 2QUZA 1R0XA 1UDWA 4AK9A 1W0KD 2V7QD 1P72A 3CX6A 1NLFA 1FPMA 3QF7A 3FHOA 3OIUA 3R7WB 3B8HA 2VL7A 3UG6A 1N6OA 1QHYA 2V54A 2P2LA 4DSTA 2WAYA 2XSZA 5EE5B 1UDXA 2JJ1D 4LHYA 2CDNA 3CM0A 3NBZC 4V0OA 1F2UB 1XEXB 1KI6B 1V43A 5FTJA 1M6NA 2ZRBA 4D4KA 4FCTA 4LHVA 4GRAA 2VQSA 4B43A 1U0JA 5EP4A 2WBLC 2DFTA 3PFIA 1TL7C 1XTIA 1Z0JA 2GXQA 3RS0A 3U7FB 3W6OA 2OAQ1 3L0PA 3SFVA 1W36B 4NYJQ 3X1XA 1AGPA 3QKUA 2FSHA 2FA9A 3QXCA 3UATA 2PJZA 4R2IA 3E70C 1W0KA 2V7QA 4Q1EA 4M21A 3X1YA 1NI3A 2FZ4A 2GRJA 4GNKA 4QC2A 2R2AA 4BFYA 3VHLB 2JLVA 2C9CA 4A8JB 1P7CA 5CIWA 4BE7B 3TR5A 1SVLA 2SHKA 3CF6R 3SDZA 2BMEA 2JJ1A 1G18A 2RGNA 3K0AB 3OIYA 4PC3A 3CRW1 4P3YA 5JSZA 4M9ZA 4I1VA 4XJXA 4MYUA 2ERYA 4TQ9A 2WV9A 4MRPA 1Z2CA 1NSFA 3TUJC 1AKYA 3QPUA 4PR0A 2J0SA 2E1RA 2OFWA 3AVVA 2DFLA 1Z6GA 2IUSA 1P3JA 2PX0A 2H16A 2WAXA 5FR1A 2FSFA 5F3WB 2F6RA 2Q0HA 1QDEA 2VP9A 4QOSA 3AVXA 3EZ7A 2B8WA 4MRSA 2FN4A 5FOVA 3ND8A 2QBYB 1S2MA 4C0JA 2W2VA 3AVYA 4KFRA 3SEAA 2O52A 1GKIA 1C9KA 1F2TB 1X1RA 4IVQA 4MITA 1DAFA 3U3MA 3QXXA 2ZQ5A 5HE9A 2IL1A 5JS7A 4LC1A 1OYWA 4P32A 4EPTA 2IS1A 4HLCA 3N5CA 3ADDA 2YWFA 5KYKA 3LVQE 2ORIA 5G3ZA 3QG1A 1P75A 1J7KA 1ZD8A 3C41J 2XZOA 2IS4A 2FGJA 1F60A 3MLEA 4KLZA 3LY5A 4DLTA 1Z6TA 4Q48A 4WXRA 1LNZA 2V3CC 3BS4A 3CUEF 1VHTA 1M34E 1VYVA 1RYFA 1JXOA 1YR7A 4LC0A 3A4LA 2CJWB 5B30A 4E09A 4WVFA 3K70B 3L2OB 3NKVA 1U2RA 2H57A 2CK3D 2QM7A 1FQJA 1NLZA 5H1YA 4M1KA 4DLRA 1J2JA 1XCPA 1GUAA 3GMTA 4LPSA 4C7OB 1R6BX 2O8BA 3P4XA 2ZE7A 3A58B 4O2RA 4OQFA 5K8LA 3KQUA 1VECA 1IN5A 1PJRA 2GCPA 3RS2A 2NIPA 2JLYA 1KJYA 3K9GA 2OAP1 2WZQA 4CVNA 4F7WA 2J0QA 2P5TB 3WY9A 5GJBA 3A1TA 3I32A 3C4JA 3I72A 2VHUA 4JT4A 2TMKA 2P3SA 3A1SA 4EFNA 4B3XA 1R5NA 2RGDA 3ZS8A 3D6TB 4PHTA 3T12A 1VHLA 5KPDA 4PQYA 3UIEA 4BUJA 2F1JA 4DSNA 3GEEA 2CK3A 3PITA 2WWWA 4HZIA 1YZTA 3ZS9A 2X19A 5LB2A 1BYUA 1OH8A 1Z0KA 3PUYA 3VFDA 2ZJ5A 1TMKA 2G0NA 1QF9A 3LD9A 4URZR 2GK6A 2ZRCA 5KU1A 4H1VA 3KL4A 4YXWD 4JLJA 4UNSA 3PEWA 4NCNA 1WCV1 3U5ZB 1HURA 5AJVB 1G8PA 5M04A 3B9PA 1T4GA 2E87A 4FINA 3T1TA 2ANBA 3QXHA 4PPQA 3FMPB 4UQOA 1CRPA 5SZIA 5HTKA 5A4JA 3GLHB 4KYUA 4Q9HA 5C46F 4B3CA 2EVWX 4CF7A 1LS1A 3TUIC 2YOHA 3W6PA 4CT4B 5BXQC 4R2HA 5FPTA 3U61B 4LOAA 4HLUA 4GT1A 2P6RA 4TL6A 3DVLA 3O8DA 2Z0MA 3C8UA 2QRNA 1ZVQA 4CEHA 3T06B 2WHXA 4MKGA 1HE1C 3WMGA 1XWIA 1G3QA 3CNOA 4C0SA 2IA5A 4YXWA 4CEJA 4H9GA 1T0JB 1GG2A 1YR6A 1NVXQ 3GFTA 4PPGA 5KOYA 3Q85A 2ZJ2A 3ZD6A 1COWD 4HB3A 3EA5A 3P27A 4OJKA 5EXTA 4C2UA 3KJIA 1OPXA 4LBWA 3I1FA 2G77B 2C2HA 3KXIA 2N42A 1JI0A 5DGXA 1OXUA 2D3WA 3VNVA 4Q19A 2FV8A 3VU9A 1LW7A 3FFAA 4GOKA 2W2XA 3EARA 2QMHA 2XNDD 5JJLA 1CR0A 3CH4B 1NN0A 2JASA 4YMVA 3SU8A 2F55A 4UJ5A 4OQNA 3KZ1E 2GF9A 1PLLA 2ZEJA 1CJUC 4HDCA 2QNRA 5F9HA 2IYYA 1COWA 2IUTA 5JSZB 1W48A 3DDCA 3AVOA 4ASUD 1M8PA 1L4YA 1UKEA 2YWEA 2AWNA 1RC8A 2VSXA 1VDZA 3A6PC 3AM1A 2EFEB 2OV2A 1IJEA 2VYFA 3CPHA 3NH9A 4FWIB 4LYFA 3N2EA 5CM9C 3LFUA 4P4UA 4YDHB 2ZSFA 3ZVRA 3ZVNA 1RPZA 4BZQA 1DO0A 2XNDA 5DI3B 4IDNA 4DDWA 2ATVA 1GP2A 4D0LB 2R9VA 2RGAA 2XTNA 4A0HA 1GL7A 3KQHA 2EFDB 3AF4A 1AA9A 2RAPA 1E0JA 4EQ6A 2JLQA 2QPAA 3AF1A 4LCBA 1GNPA 1Z07A 3OIVA 3GJ8A 1N6PA 2FPMA 1G9XA 1IJFA 4U5XA 1P2VA 3C14C 4ASUA 1YR9A 4B6FA 2FOLA 2L0XA 4EFLA 1XF9A 3RANA 1ZUHA 4MYHA 1AS2A 1UKVY 2NO0A 1TUIA 2GESA 1XU4A 3W5JA 3UWOA 1CF4A 4Q1DA 3PEYA 1GVNB 1KHTA 5EXPA 3ADCA 3UWKA 1CEEA 4V0NA 1XBTA 3A1VA 2OXRA 2CLDX 4IHQA 3JVVA 4BASA 4HEJA 4DLXA 1KI9A 1X8LA 4QJ4A 3ZH9B 4MUBA 1Z0IA 4NP6A 1U94A 4QM6A 3OAAD 4LI0A 4LHZA 4EUNA 3GLFA 4NMMA 3RRMA 1QZXA 2O8BB 2VBCA 1GITA 1TPZA 2ANCA 1KTVA 1ZC4A 4PANA 4B32A 1ZW6A 1KDOA 4M4SA 1IM2A 1OXTA 4FCVA 2H92A 5FUXA 1RJ9A 4JT2A 1X3SA 821PA 2GHIA 3I8XA 4D82A 3WRXC 4NL4H 4Q1BA 1E9RA 3GJ7A 2B92A 4M22A 4NPHA 3I4LA 2A30A 1FP7A 1JPNA 3W8RA 4IOLA 4FIDA 1ZINA 4A2WA 1QHHA 1WP9A 2GEDA 4RD1A 4XSGA 3LW7A 3RAPR 1GZSA 2Z43A 1VTKA 3BB3A 3CRMA 1G3RA 3ADBA 1E2DA 4OQLA 3GPLA 3EZFA 1ESMA 2FSGA 2FG5A 5HZHA 1SQ5A 4A6PA 1GRQA 1VIAA 1ZBDA 3OAAA 1D8TA 1J70A 2CBZA 4QKQA 3QVUA 2OT3B 3FVQA 4RD4A 1JECA 2W2TA 4J0QA 4NU0A 1NP6A 2I3BA 5CK5A 2XGJA 4M9SA 5GJVC 2NG1A 3DEFA 1EFCA 4DLWA 2Z5FA 4ZDJA 2EFHB 5DE3A 1UBCA 5FBQB 2B7BA 4L8GA 1L4UA 4LJ5A 5FOXA 4US2R 5FPKA 3VKGA 1KO5A 5EJEA 4DRZA 3UMRA 1JJVA 1XCMA 4DEXA 2ZRJA 3NIBA 1GRRA 3VR3A 2CVHA 1FNMA 2RGGA 3IHLA 4JLMA 1K5DA 4OI1A 2ZJYA 2REXB 1E9DA 1LB1B 3WXMA 4Q5IA 2NO6A 3BB1A 4IW3B 2ZSBA 4TYQA 4BLOA 2ZRPA 1JJ7A 1Z8FA 2H7VA 3DZ8A 4IDPA 4B2IA 1W49A 3Q9LA 5G40A 1PUJA 1WXQA 2GF0A 3ZZTA 2OEPA 1PLKA 3CNLA 1ZIPA 4DVGA 4UXJA 4F4IA 5DN6D 2XJ9A 3U6KA 4JJKA 3LLMA 1GNQA 3AP1A 1H8ED 1A5TA 4QNRA 4RZUA 3BH0A 2VP0A 1K8RA 1R0WA 2ZRAA 3BWDD 4JSTA 3SBDA 3CWQA 4PPFA 4BGDA 1CLUA 2QSZA 2BKEA 1XDBA 3LNCA 1YQTA 1YHNA 4D4LA 4B35A 1QHXA 4ZI3A 2ZRDA 3HPRA 1XMIA 3O47A 1ZMXA 4CDGA 2ZJAA 1XP8A 4ZKDA 5ELXA 3C16C 3LBNA 4ACBA 3IQXA 4RD3A 2F7SA 3VU9B 1KJZA 1NKSA 1RRPA 3QEOA 4OJQA 1ELOA 4UXIA 4DDTA 2Z4SA 1OB5A 1SXJD 1K5GA 1G20E 5DN6A 1ZNXA 4G5QA 2VP2A 1H8EA 2A78A 2BHRA 1D9ZA 3C7KA 3PUVA 1E2JA 1BOFA 5JJKA 1KSFX 2MSDB 3R8CA 3X1ZA 3RYTC 4TT3D 1NJFA 1ZM4A 2VPPA 2KBFA 2HCBA 1GWNA 1KI7A 5FOWA 4B47A 4RSGA 2AXNA 3ZZ0A 1E4VA 5B57C 1JNYA 4B3GA 2IUUA 4F38A 1P73A 2ZRIA 4YQFA 4MYTA 1NLYA 1Z5ZA 2O8FA 4FW9A 2P5SA 2JA1A 4HB0A 1Q1BA 2VP5A 3G82C 1MO4A 3NDPA 1NG9A 1FX0A 4FD2A 4Q4LA 3CBQA 3CO5A 3MCAA 1SXJA 4WZBE 1Q1QA 4QHTA 1HTWA 4Q7MB 2IK8A 2YNMA 4EQ6B 1LF0A 3SNHA 4DT1A 1SGWA 5CJ2A 6Q21A 2EFCB 4PX9A 2V1XA 5J4VA 4TT3A 2IT1A 4M2LA 2YHSA 4R7ZA 1T91A 4B34A 2XEXA 2JIZD 1KNXA 2R62A 4OKSA 3TH5A 3PJRA 3ZZUA 3N70A 1P9RA 1XTJA 2J59A 5FL3A 3UANA 2EU8A 3W8NA 1E2QA 4QL3A 2KI5A 3K0CC 2W0SA 4EPWA 1KMQA 5KPJA 5E7MA 3W34A 1R5OA 2QG6A 4C0LA 3SI7A 1NL3A 3HPQA 5LD2B 2ZSEA 2B7CA 1BO6A 4GOXA 2ZU0C 3GLFB 1Z6XA 2QROA 5JWOA 1AM4D 5EQTA 1XTSA 1DAMA 4B3DA 3NBFA 1IY1A 3A4NA 1RIFA 2VHTA 1IN4A 3HR7A 4TLEA 3SE0A 2HYIC 4OI0A 5JRZA 1N6HA 3BBPA 4A1FA 2JIZA 1IY0A 4L5BA 3TAHA 1OFTA 2JLZA 3AF0A 3RNLA 3GEHA 1CRQA 1GOTA 2B21A 3NG1A 5BWMA 1OIWA 2OG2A 4W5HA 1BKDR 4V0KA 4M1MA 3WBKA 2V8OA 5FI1B 1MV5A 2CXXA 3CWZA 2GJ8A 5P21A 2BM0A 3EIHA 3Q7PA 4WOPA 2O8CA 5KSPA 3U6BA 3LVRE 4MGZR 5B64A 3KQLA 1UBEA 2BMFA 2ZREA 2Q6TA 1XXHA 2P6UA 3TGPA 4O3MA 1J99A 2JCSA 3QY0A 4YMUA 2BIFA 1TX4B 1ANKA 2GCNA 4AKEA 1RYHA 3GLIB 4KFTA 5HZKA 2HYDA 2QAJA 4DHEA 4RFVA 1S9DA 3LXRA 4C0KA 2VP4A 4Q4AA 1EWQA 2OM2A 1AGRA 2BV3A 3DM5A 1NN3A 5GJCA 1G19A 3PENA 2ZPTX 1IN8A 4BWYA 4B2LA 5JCPA 2R6AA 1FQKA 1DTSA 3L82B 4UNPA 1GL9B 1N0WA 1QBKC 2D2EA 2FNAA 4RZ2A 3DKVA 5CB6A 1TQ2A 5EE1A 2OESA 1DAHA 4OHWA 3MAAC 1XJ0A 1EX7A 4V0MA 4Q21A 4C30A 4EDHA 4IOJA 3CX8A 2G9NA 4F4CA 2D74A 4M1TA 1XD2A 4DXAA 5BW8A 1NN5A 3V9PA 2ODBA 3GLHE 1KK2A 4F92B 2ZXUA 1XD8A 4NCKA 5JI2E 4TTRA 2F1HA 1TF5A 2FH5B 1XTRA 2G83A 3EAQA 4KVAA 4D4MA 2FU5C 2EWVA 1WRBA 1L7VC 1T8UA 1GL6A 3NH6A 4TZ6A 3U3KA 1XJCA 2Q9AA 4Q9IA 5JEDA 4GSYA 3IO5A 4AYWA 5C4MA 3CZQA 3A4MA 1G291 4WW0A 4LJYA 1X6VA 2B8TA 2OLJA 1E98A 1R2QA 2Q3MA 4K46A 4U02A 4GMDA 3X2SA 3SQWA 1CR2A 2WPDD 1ZNYA 2ODEA 1CTQA 1Z6AA 1UF9A 3ZVMA 1AN0A 1MKYA 1YVDA 4JVMA 4N0DA 1E2HA 1F48A 2KSQA 3LX5A 4UXHA 3Q7QA 3MG9A 5AK0A 4B2PA 4CEIA 5F98A 1A7JA 3CONA 4Q01A 3ZVLA 1E99A 1AKEA 3NC1C 4QBIA 1ZM9A 2XAUA 4Q18A 2O5VA 3SJAA 3BE4A 5FH9A 1K6MA 5D3QA 3WHLA 4BFVA 2O8FB 3PCRB 2R6GA 3RWMB
chains in the Genus database with same CATH superfamily
1ZN9A 4LDPA 3IV9A 3IQWA 4RCYA 3KCNA 4YWHA 2PV0A 4TSFD 1X94A 3D7LA 3H8VA 1FX0B 2MYTA 2NGRA 2XYGA 5TS3A 4DBLC 3BSSA 5BV1A 1NVDA 1U0SY 3V2HA 2G07A 1MDBA 4N8DA 4ARZA 1GN8A 2ZJ4A 4NZNA 1XZIA 1QFYA 4YPFA 2PUBA 2B98A 2JC3A 2CCGA 2WPDA 3GNTA 3QU9A 4GKBA 4TMWA 4FIZA 3KXLA 5IP5A 3UCXA 1MABB 3V1YA 4UE6A 4EGAA 1ZC3A 3KT6A 3LY8A 4NBWA 1NQUA 5L7YA 4M8NE 3ZD8A 2UU9B 1A1SA 2LCFA 1RKXA 1PL0A 1RHKA 3U1TA 1L6RA 1SVUA 2JCBA 5CNMA 1U80A 5AVRA 5A9SB 4N8SA 5JVDB 2A5GA 2Y9PB 4ZJPA 3NAGA 4GEKA 3ZWNA 1PSDA 4PRYA 4WY5A 5BQ3A 2D8MA 5FFMA 4S05A 3HGMA 1JVNA 2NZVG 4H6XA 1AQ6A 3RF7A 1CY4A 4ALNA 4BNTA 1G98A 3D2BA 4Z53A 3PU6A 3K2IA 2XTMA 1O57A 4WFQA 3CINA 1I4OA 2GT1A 3CC8A 5JCZA 3LJKA 1V6SA 4LV6A 3ICEA 4U2BA 3RUCA 4ISCA 1L3BA 2BKUA 2G9UA 4OLJA 1UC5B 3LWZA 4IQ8A 3IP5A 2QN8A 3SJZA 2W2KA 4R9NA 1I5RA 1E3EA 3BGIA 2KBEA 3M7IA 4PC6A 4LDRA 2R66A 1E7QA 4JUDX 2VHCA 1V11A 1CR6A 1CZNA 4ZCIA 4F5DA 1YCHA 4UOQA 5AVSA 2G1KA 3OJOA 2Y1FA 1DJMA 1BWQA 5HJ5A 3UFBA 1BHSA 4TZ0A 2YINC 5DM4A 2XUJA 1V95A 3LK6A 4G4GA 4OSPA 3MJSA 4PG6A 5FAKA 3IVAA 3N87A 1M2OB 3GYBA 3D7KA 1Z7BA 3ZDZB 1M74A 2W6IA 3M6MD 4XX1A 3OM1A 5CDUA 1ZL0A 1IHUA 4JKOA 4DLSA 4BO3A 3ME5A 1F5NA 1PEDA 4FB4A 5FWAA 5JZVA 3QEMA 1C9DB 2PMFA 4FKZA 2AZMA 1Y82A 3OWHA 4G85A 4R3NA 1JVBA 2MDTA 4C43A 2VDKB 4R1MA 1BDMA 5HFAA 1RFGE 2P6PA 2F3PA 4FS3A 4G97A 5BWNA 3RFVA 3D43A 5AW2A 4QU5A 4ZAYA 2LDXA 3UB4A 4ZI7A 1XXHB 3N2GB 1NBMD 1ZGGA 4ZXPA 4F0JA 5KNDA 3CGWA 2X5OA 3AEUA 2WU0A 1SFRA 3L8DA 2YV5A 5HGXA 3JALA 4C0XA 2FZKA 3JAWB 2J1LA 2Q46A 1MOPA 3L1IA 1B2LA 3Q10A 4KMSA 4WFIA 1LKZA 2ZVJA 3DZDA 1PLJA 5JSYA 5HKKA 1G21B 4F46A 4K2AA 1MC1A 5BUSA 1H69A 2AA3A 4MQ6A 5EZYB 2RHGB 5JAOA 2XF8A 3N8HA 2XODA 3MCZA 4YASA 3FLBA 3RKRA 1CZUA 3DQZA 3G88A 2QTCA 3UK1A 4C04A 2YJTD 3KKMA 3CZMA 4AG5A 1B8UA 1XPOA 3OC6A 1Z4PX 3D1VA 4COOA 4XVHA 2WWHA 3DDSA 3PQCA 1AO0A 4IV8A 3DBLB 3ZGYA 4BV2A 3QSYA 3G7UA 4HB2A 2K5UA 4JVLA 3BF8A 3V8EA 4JT9A 2IHYA 1CUZA 1OLOA 2IYXA 5E7IA 1CEXA 4KODA 5EXSA 3EXEA 1UBOS 2OE2A 3DXYA 4M1SA 4MDYA 4NJEA 4OQEA 4BL5A 5BXQC 3PGKA 4PGGA 1T4CA 3EQZA 3ONVA 1B42A 1G41A 4JMLA 3QVVA 3IUNA 4MSUA 1CKEA 4CM1A 2PSSA 1WZCA 4Y6RA 3T5DA 3M82A 1DKRA 4W9MC 2GHTA 3QMPA 2P2YA 1YNOA 4LZNA 4W5JA 2R79A 4WGGA 3ZJVA 5HIAA 1CQJA 3D5EA 4TUYF 2OWDA 4BMCA 4DLZA 1LJUA 2GN8A 4DLYA 3SIRA 4N48A 2P6NA 3FCAA 3HP1A 5JR3A 1JWAB 4O4IB 1E1MA 1LS6A 1X77A 2NU7B 4EHIA 1QS0A 2XYPA 4N3BA 1H22A 4JSYA 4AMZA 4DW8A 3ESDA 4YMGA 2QM0A 2VT3A 2PKCA 4EITA 5ERYA 2KMLA 3MD9A 3OJFA 1R7RA 4BPRA 4AZSA 2AK2A 2IUEA 2VP6A 4UHEA 5JFGA 1VJ1A 1YC5A 1R8YA 1CHDA 1JIJA 1OC4A 1KXZA 3K8YA 3NT4A 4XYMA 5FOQA 4YJKA 2A57A 5K0TA 1XMXA 4LY0A 2WWXA 4QFMA 1C8VB 3TR0A 2HM7A 4UZEA 4PZAA 1VFNA 2PJRA 3SC3A 3WLNA 1IPEA 3ZY5A 4AL4A 4DJ5X 5BN4A 3GWZA 3OPYI 4DJDC 4UTRA 1ZY2A 3GQBA 1KJNA 2NYRA 4KOAA 1LBHA 4JROA 4UNIA 2XKAA 3G5UA 5K8IA 2JZOA 5AW9A 2C04A 1Z2NX 4EVIA 5BVGB 3LT5A 4QJ3A 1TO1E 5D3MA 4LNAA 1UWLA 5HKLA 1ZG3A 1ND6A 3OX3A 3ZCUA 1PQPA 5KINB 2O4CA 4GIBA 5CR9A 2RGUA 3HZRA 5JHHB 4RJTA 3UHAA 3NVKI 1SCDA 1CJMA 4FS8A 4G5OA 2FYTA 4PWZA 2WB2A 4BRUA 4RK0A 3ZUPA 3CW8X 1PUXA 1NY5A 2HY7A 4PTYA 1J1UA 3T7JA 3SR0A 4J0FA 4WK6A 2H4HA 3WBFA 1UMKA 1Z33A 4KX5A 4HNSA 1MPTA 4G9BA 1W0CA 2CLHB 3V4ZA 5IDQA 1OIVA 1JHMA 2OD7A 3WP0A 1EFVB 1OILA 1VCMA 3JVIA 2ZUTA 5CLLA 3WFIA 4DCVA 3WQSB 4E51A 4I9GA 4GDFA 1VCOA 3JPYA 5BUQA 4HJRA 1AQYA 3E8SA 1O9GA 3O38A 3KZCA 1TYEB 4FP9A 1Q14A 4FT2A 2ZPUA 3KXKA 4J0JA 4U9HS 3GHYA 1L5FA 4ZCLA 2Z2XA 3P9CA 2Q6KA 1DT3A 3VAYA 4RTJA 2JIDA 1ZD9A 1JR6A 3UWDA 1YQQA 1TYCA 4MO2A 5B1SA 3HJGA 2VJNA 3PICA 4HH3C 2HSEA 2X15A 5FLEX 4MP3A 5A3QA 1AJEA 3V4PB 3W9BA 1U4NA 4I8IA 4ZMRA 2BHLA 2DOKA 3KO8A 2AG8A 3EYAA 2XV1A 5BV8A 2H5LA 4HL6A 2RHMA 2X14A 3O3CA 3RFFA 4R41A 5FNVA 3CLRD 4B5LA 4EG6A 4E5UA 3GCDA 2A0KA 3DOFA 4YP1A 1S2OA 4EY5A 3E84A 4BMVA 1JYSA 2Y1GA 1GUBA 2Y8EA 4IVNA 1HWYA 4XWWA 1L7EA 1YTLA 2IUYA 1L7XA 4RL6A 1RHQA 2QY9A 3IHWA 3RI3A 3U44B 2I1VB 3KTAB 1SKAA 4XYLA 3D2AA 1YU6A 2IXFA 4JB3A 4MUKA 3GUZA 3OA2A 1T8RA 1GADO 2P65A 2WAMA 3P52A 4WKOA 2JK1A 4OK5A 3FFWA 3IDQA 1LNSA 3GXOA 2DFKB 3A04A 3RSSA 4B40A 1DARA 2BKLA 2GJ4A 2ZBGA 1L5LA 1EIWA 3WZ2A 4V1CA 1O96A 4CUKA 3UBTA 1E32A 4E46A 2OBBA 2FPOA 3GLFE 1KO8A 2I4MA 4OJNA 1BAPA 4UAVA 4LOHA 4W7IA 5E6UB 2DCUA 2WHRA 1G5TA 4BAUA 3ON5A 1ZVVA 2HW8A 1QP4A 3GRUA 3T3MB 2G9ZA 3T7AA 2FWBA 3R20A 4N0PA 5EIEA 5CMLA 3I3SR 4TVOA 3TM5A 4CR6A 3PFGA 1NU6A 1D04A 3VA7A 1CB0A 5HSGA 1ZVJA 5CX1B 1XUOA 1NY6A 1MC4A 2VSQA 3ZDDA 2FF7A 3IULA 1IBMB 1LBIA 3IXMA 2CKMA 3MOGA 5GIPE 3OU2A 4N0EA 1O9HA 2FFHA 2XMGA 4AQDA 1V35A 4Q47A 1CVLA 1EX6A 2ZWMA 1CUIA 4XWTA 4LTDA 2PGXA 2FW6A 2FVYA 1SAYA 3JWIA 2EJCA 4V3BA 1R27A 4IL5A 4JYCA 4BFLA 5FORA 4EK9A 4JJ8A 4H0FA 4H7HA 1QIIA 3TK1A 4EW3A 2C8LA 2O7VA 4UD6A 4HDSB 4OYYA 4BNDB 1QCCA 1KARA 3KPVA 1XZJA 4OFWA 4PX5A 2CXNA 2OV8A 2XB8A 4ZAGA 4Q00A 2IS2A 2IYFA 2WKPA 4R1UA 4RQBA 2OQ2A 1REQB 2XRFA 4ZYUA 4YJGB 4CMEC 4E2WA 5JXIA 1E62A 2MYNA 1DRKA 1BE0A 4F3KA 5C5EA 4DMFA 3TI7A 4DR2B 2NOAA 3PP8A 3IPLA 2QAGC 1DAOA 2QX7A 1GPAA 4UKDA 4GI2A 5CA1A 5H83A 4EG3A 1SO8A 1YQWA 1FOEB 3T5TA 2NP7A 3UF0A 1PVDA 1T5HX 1HM5A 3R3SA 5SICE 1PDOA 3AIOA 2J3MA 3RC9A 4C7KA 1MN6A 3K0FA 3CV3A 3EGIA 4JLNA 3D3NA 2EG5A 4AG6A 3FOAA 1GZUA 4R81A 2YASA 4M6WB 4R01A 3GZNA 1O6BA 1ZITA 4XIGS 3GRKA 5C8VA 3H9JA 4RVFA 1YR2A 2KB0A 4EATA 1UDRA 1KKUA 2XNSA 2XD9A 4FHCA 1KZHA 5A4DA 3G8BA 5DNYB 4UTNA 4U2DA 3R44A 5ALFA 1LX6A 3REQA 5CB4F 4O0MA 1H8HA 1FBTA 1O89A 5AVVA 2BYTA 2AN9A 3ZHQA 4UM5A 4AJ1A 3PHIA 4LXYA 4G07A 4MKIA 2HQ1A 3FJ1A 4WLNA 3IKJA 2HCFA 2MSWA 1N9ZA 5ALSA 4X62B 1G6HA 1D2RA 4Y2QA 1P1CA 1EFRD 4EGCB 3F4LA 4AXXA 4EY4A 4HUTA 3WYCA 4YCMA 1XNQB 1Y6QA 5CLFA 1C4WA 4L9AA 1AQJA 2B37A 1PEYA 3VKWA 2B30A 1U9IA 1XYVA 4GH5A 4RS4A 2O8DA 5JW6A 3FYSA 1Q83A 1QGDA 4P6VF 2X1VA 3U9TA 4D9JA 3ZY4A 4F56A 1YAJA 3H2KA 3OEEA 2QM3A 1AMUA 4NENB 3PQ7A 4OAPA 5KMGA 2ZAYA 2ZIAA 1BJTA 1U7UA 1QLHA 3A6ZA 3P4YA 1C3OA 3LO5A 5EAIA 3UJ6A 1VRWA 3HKCB 1XT6A 5TT0A 3KX2A 1UQUA 3TQIA 3G5MA 4BNNA 1T1JA 4IJQA 2B0CA 4AJNA 4FMCB 2C2KA 4S35A 5CEJA 4ZV9A 1SVWA 1LLDA 4Q7JB 1TVKB 4FUQA 5ER6A 5JASA 1X7XB 2HV8A 1W9MA 2VHXA 4C0HA 1VJCA 4YFYA 4AZ3B 2MINB 3NO4A 5F5XA 4BP3A 4YP9A 8AT1A 1W581 4FLEA 5JLAA 1B43A 4MQFB 4CLDA 5CCEA 1QIDA 5JYBA 1IJBA 1ZD3A 2YYYA 2ZYUX 3ZKAA 2PVPA 1PZNA 2CW5A 5AVOA 1NJGA 2IEIA 4NFSA 4ARVA 4BVFA 3KWMA 5JU6A 1J0DA 1P5JA 3WIDA 2YFQA 3IBTA 3ZU4A 2WIJA 4IIDA 3AFOA 3JD3A 1ZUD1 1KSGA 2AG6A 5SY6A 2GO7A 2AZXA 5TPWA 2B0JA 1Z15A 1GUFA 1XKTA 3GL9A 2WEKA 3S3TA 1ZGAA 3N76A 3DNFA 3F1KA 2E55A 2HMTA 2K4MA 1JAYA 1I7PA 1XMSA 3W79A 1AKTA 1QFZA 3WGNA 3HL0A 5C2JB 2WUVA 5MN5A 1GQ2A 3DYBA 4HWOA 1WQ4A 3FXAA 2XMBA 3K9LA 4M53A 4BTVA 4EUHA 5B37A 4XIFA 3VR2A 3L7LA 5JS8A 4M83A 4PZUA 4BBZA 4GICA 5E1DA 1FFEA 4ZZ2A 3RNOA 3CN7A 4G2TA 1QGOA 5HCUA 2A8YA 1PYDA 4M8LA 4YP7A 3B6MA 5FRDA 2ADOA 1YFLA 2WUGA 3U4GA 1G7SA 1LQ2A 1NG1A 2H0AA 4KMOA 1JLKA 2DBRA 2J7PA 2Y67A 1LVGA 3LC1O 4MINA 2XVZA 4BN5A 1ZH2A 5BNZA 1TI7A 2J41A 1AX9A 4JLSA 5KYUB 2BEVA 5M29A 2EATA 2QTBA 3OLCX 4MA0A 1KIMA 4C6HA 3QEBZ 1GPYA 3EGDA 4G5SA 3GT7A 5G4LA 3OICA 5IJXA 2BUBA 1JTFA 4GPEA 4NE7A 2Z8ZA 5GWXA 3SBOA 4CHGA 5KO2A 1ZK4A 2QX9A 2WABA 2WZCA 1CJCA 1ABFA 1Y1LA 2QPLA 1QRTA 1U11A 5TE9A 2F8SA 3TMYA 4D9EA 3R9IA 4BEJA 1QHGA 1VMAA 3LCRA 2W6JA 3LKBA 4GHWA 4HMQA 1V8FA 3DDNA 3UMVA 3Q2KA 4QDJA 1S4MA 4R1TA 3BZWA 1ICEA 2MWMA 3PDHA 1X87A 1FUEA 1WB9A 1DDGA 1SVOA 1G3UA 4GKJB 1ZWLA 4B6GA 1TQHA 1TAQA 3DBRA 3M6UA 2G4VA 1UPAA 3DFFA 2UUPA 4Z4GA 5EKDA 4LFCB 3CVYA 2DVMA 2EF0A 1QYCA 2HUNA 3UHJA 3F3MA 5AKLA 3ORYA 3WWEA 1MVLA 1ZBQA 1A77A 1B1AA 1PJAA 2DPHA 2WU8A 1PE0A 4B9EA 3FGNA 3PUWA 3RLFA 2XXAA 2Q1WA 1KNQA 2PWYA 1JZSA 3DMPA 4TVBA 4OHXA 3QK7A 4F9GA 2HFKA 2H29A 2AJBA 2RGEA 2VJOA 4YALA 1U3WA 3E58A 3FLAA 1HFWA 4QIHA 1E1KA 5EIWA 3CKLA 1RXEA 3FNEA 2E5WA 1N2CA 3GZ4A 4JENA 1QWOA 2XCIA 3FX2A 1K4KA 1UKAA 2BP7B 2RG1A 4ZYZA 1C4XA 2BFOA 1K86A 2QW0X 2WP8J 1L4FA 4ZXFA 5FTNA 4GXTA 2EKPA 1V4VA 2CNBA 3L0DA 3T5AA 3GD7A 1J07A 1JAXA 3QPBA 3FVTA 1P45A 1LBEA 2P6MA 4BO9A 4ZOLA 2X0DA 3MRSA 4LF7B 3MK31 4EHFA 1XO1A 3PUXA 3T41A 4EDFA 4G8CA 1TT7A 1XXHE 3TPCA 2AZTA 2CFRA 1C0PA 4RD6A 4CMCA 4WNAA 1TFUA 1DIAA 3MGCA 5LBTA 2GARA 1ZH0A 4IHJA 1A7AA 1KAQA 4HDNB 4TLDA 3BF7A 3K16A 4R8MA 1WMBA 1ZISA 2EJBA 5FHQA 4KC0A 2V59A 5LNK1 1PT7A 2J8ZA 3NFYA 4RYLA 5EQFA 1EG2A 1IBRA 1QMGA 3OEYA 3FUWA 1G21E 1YB6A 4ZOCA 1CDZA 4J76A 3TNYA 5C7OO 1ADFA 3CTPA 1G59A 2QX8A 2OTCA 4ZHQA 1NHGA 1YRAA 5AJYA 4LYAA 1U8YA 1CS0A 1CHNA 3RSLA 2JRCA 5JPIA 5JZBA 1AIPA 1CBUA 4E30A 2H17A 4XSVA 1JQEA 1KI8A 1T25A 3A1DA 4H18A 6REQB 5LQNA 2NVWA 3OPYA 4KPUB 4GVPA 3SZUA 4CG2A 4DDMA 1VL1A 2OV1A 3W9UA 3LKZA 1AQIA 1JV2B 4CL3A 1OVGA 1RWPA 3ZDFA 4KBYA 4K1LA 1JJIA 1M2FA 4MWOA 4PE5B 4LJ7A 2NQ2C 1ZJ4A 2FZEA 2MR6A 3WL6A 1BMFD 1L4LA 1X7YA 3R9XA 4IIFA 1M1YB 3EEFA 2Y6VA 4OLAA 3ELDA 3ZU6A 1RKVA 1AGYA 2VDLB 1Y1PA 5ENDA 4MVWA 4QUHA 3AJDA 2BZ0A 3QMWA 3I64A 1PJBA 2YIVX 5B6PA 3B8EA 3H1EA 3HKEA 4H60A 2WZBA 1WR8A 4RH0A 1DX6A 3GEDA 4WCFC 4HS9A 2R1UA 4BE4A 3U7HB 2HRRA 4G24A 4DV7B 1JB1A 1E1QD 2IZ1A 5K0BA 1KO4A 4RC9A 1L5VA 2YWCA 1RD4A 1UQTA 4G5YA 3WLTA 3ZLBA 2C5HA 1OZHA 2QXTA 5JWRA 5A05A 3W5CA 1JP7A 3B2QA 1VGRA 1JT9A 3CRRA 3OOWA 4DCSA 5EHXA 3K71B 4W5RA 2A0YA 1EVLA 1YB5A 2G7ZA 3W06A 3T0IA 3PUIA 3LS2A 2PT5A 4YLGA 1EGMB 4PO1A 4KR6A 1Y8CA 3CW2A 1WMDA 3AF2A 3WYAA 5DM70 3O8CA 3L7IA 3F71A 3KKQA 4RYDA 3BXHA 3RSQA 3JQ9C 2EW1A 2QRVB 4LYHA 4RHYA 5JCXA 1SA0A 3I01A 3ZHXA 4CKWB 3UMYA 3U62A 1AD2A 1EEXB 1TB4A 3VZPA 1G66A 4IDGA 4PAMA 3EFHA 1E0SA 3AETA 2WKQA 1OQAA 3KHSA 3U4QA 1PR2A 3B70A 2JS7A 3THSA 3Q8WA 4NOMA 5DOZA 1L3IA 4CFSA 1JG6A 4HF7A 3BCRA 3KKKA 1E2GA 3HJUA 3G2OA 2RG7A 5FJJA 1AH2A 2W6CX 2YHBA 1QTRA 4BJ5A 5LL6P 2RIPA 3GRYA 4UEKA 3HUUA 4B75A 3CU5A 2VQDA 3TJMA 2ZI7A 2O8EA 1OLXA 4MNTA 4U8HA 3WFZA 3O9ZA 5EMHA 2PN1A 1Y1SA 2EEZA 2P9HA 3RD5A 4UAUA 4QDKA 3LWNA 1I01A 2XADA 3VXKA 2J3EA 3GLHA 5BO5A 4CQJA 2B5VA 2DFNA 2ID8A 5ADUS 1VHWA 3OX2A 5TDHA 1GAXA 1UOPA 5FQNA 1PF7E 1NUSA 5KNBD 1SB8A 4NZZA 3DYVA 3VU3A 1Z37A 4QUAA 2QN1A 3MRVA 3DV0A 1U02A 1E9SA 1RSZA 3FUTA 3ZV4A 2QTTA 4BLTA 3KLOA 4DILA 1P2GA 5KKNB 3T7SA 1NF3A 3GARA 2PSHA 3EZXA 4CM9A 1Q77A 5AUNB 1W34A 2PMCA 3V1UA 1YA4A 1YOVB 4X1IA 1ADBA 4MKZA 3SIWA 1ENPA 3BE8A 1PR4A 4X7PA 3B53X 5L3SB 5F98A 5G2OA 2I2FA 5TEWA 1OAOA 3HJTA 5EWLB 4EGFA 1E60A 3L0IB 3ZTYA 2HK8A 1Q3KA 2ZRMA 2ZYTX 3DKIA 4KWTA 4DMCA 3EEBA 4RM2A 5A5EA 1QH8B 3EDMA 2IYOA 3FPBA 3NJ8A 4TWAA 2CL7X 4KH0A 1KQNA 4E31A 1G0NA 4FE3A 3KTDA 1MORA 4M1OA 4U6NA 4BCBA 4XKJA 4F2HA 3H3FA 5P8WA 1Z0FA 1RKQA 4HGNA 4N5IX 5F35A 5TJ9A 3RVMA 3UENA 5MN4A 2JGKA 3H6GA 3UCEA 4ZC1A 2HJGA 3C3JA 4MVJF 4R31A 5EJMA 4A91A 4CUZA 2JKZA 1D9XA 3DT9A 4LHWA 1TF7A 2LKDA 4O0LA 1D5CA 2SCUA 1R1DA 2ZIGA 2QTLA 3QVGA 5LUBA 2A5DA 4MTLA 5HUHA 2YL2A 1P81A 3LL4A 3CT6A 4RKYA 1IN7A 4YPVA 2HH9A 3L6EA 3FA2A 3F6RA 3VX4A 4D6PA 2Y1LA 3G5TA 3PC2A 1E3QA 1PUIA 1K68A 1ZU5A 3DF7A 1P0IA 1W5SA 4IUCS 3EWAA 4LN1A 5EGNA 5KNCA 4QYSA 5EUQB 3V00A 2AR9A 1T3LA 4JC0A 1KH3A 1ULHA 2P0AA 3DP7A 3UAWA 2J87A 3I9MA 3OQPA 3VISA 3VZCA 2NU6A 2HJSA 4BFUA 3QWIA 4AWAA 5KTYA 1Y8RB 2ZJFA 3QPWA 1WW8A 3S55A 3USES 3AOGA 1QG4A 2FUCA 4J2OA 3OM8A 5CG2A 1XIVA 2ACKA 3NCTA 1YI8A 4OU4A 1D4ZA 1K06A 1YVUA 1DHRA 1NIPA 4HGYA 3RFXA 2PZAA 2YXEA 3QYAA 2DWQA 3UW1A 3KR0A 1CC1S 2QP9X 3JARB 1RXCA 1E3IA 3DZBA 3PWSA 4WCVA 4H7JA 4FHFA 3PXGA 5DI3A 3UOAB 1TAUA 1RT9A 1SBIA 1DOAA 1U0HC 1I1NA 1J56A 3PKJA 3TIFA 3KQNA 1VC2A 1LSUA 3C7TA 4LVNA 3G7SA 3W8DA 4F71A 5CFLA 1BW9A 3W5AA 2VPTA 5JWHA 5EINA 1VSVA 3O95A 1DP4A 1EQUA 2RDMA 2X13A 4IUDS 2HZ7A 1N92A 1F2DA 1QH1B 3K53A 5ERGB 3EW9A 3KYIB 4DB4A 3MB8A 3HTXA 3O1JC 3NJRA 3X1WA 3ZIAA 4YHHB 4RF4A 4FFVA 3D6FA 1TEZA 1XMJA 2NMVA 1I2AA 2ZCJA 3G6WA 4X8LA 3DE5X 4H0CA 4YRKA 2OCYC 3UK6A 3IH5A 1JEAA 3SF0A 1F06A 2AI3A 1U90A 3GLTA 4YC7A 2ADMA 4JWTA 4OUDA 4U6SA 1S1MA 3FBTA 1SCAA 3QFHA 1BX3A 1BN6A 1MJFA 5C4GB 3CLTC 4QPNA 3KEFA 4EG5A 4G1FA 5I7FA 4CFYA 2W42A 1A3CA 4LJLA 4B33A 3ONWA 1MRNA 5H0IA 1T5SA 1FVXA 1S2IA 1H2FA 1NBME 1MOSA 2WAOA 3AG5A 3LVFO 3PDIB 3BUSA 5FBHA 2C4TA 4ZVTA 3BREA 4DGSA 1SC9A 1ZK3A 5AKIA 2HHJA 3UOWA 3ZDYB 5JY1A 1DXHA 4W5QA 4LJRA 2PFKA 3FPFA 2VJAA 1ZJ6A 4MUIA 2PZLA 1A96A 2FOXA 1UFVA 2Z58A 1SVIA 2BJVA 4NAHA 5AJZA 3W0LB 4DIDA 5ARBA 4WBXC 1B00A 2IBMA 3IGFA 4GZ5A 1GQYA 1LF5A 2MSKA 1U2SA 1N7GA 2GJAA 3LQYA 3PFCA 5H3HA 3TO5A 3PNQA 4UQPA 3AG6A 3OZRA 2GEUA 5CG1A 2DHQA 3U4DA 4G37A 2VDWB 2G1UA 4QBKA 3JASB 1P0MA 4IDHA 1HDOA 4YJ3B 1DBSA 2L42A 3R7NA 5DNCA 3GROA 3NEYA 4N03A 4TM8A 5CD1A 1R3UA 1EK0A 5F52A 2JGNA 3L1HA 2XT9A 2TMDA 4FFNA 5DSZA 1PYGA 2AVDA 3EAFA 3L4BA 3W8FA 4Z7NB 3HJFA 1LZLA 4LJKA 5HDQA 3ES9A 3BA1A 4MOWA 4Z9YA 4FB5A 1D03A 1UK8A 2VC2B 1HRKA 1DEKA 1SXIA 4LZJA 5JAZA 1B0UA 2W6PA 4F3CA 5IT9A 3ZHBA 1P9LA 2FE4A 2I8LA 1RQGA 3EDYA 3FLEA 5IJAA 4Q4DA 3FN4A 1R18A 3VOTA 2X8WA 1QZ3A 3HB7A 5GVSA 1HYGA 4Q66C 3F6YA 4Y6GB 2F1RA 4DC1A 3H7AA 1Q22A 4YMTA 3ETNA 1XA4A 1Z45A 1JFRA 1O3YA 3KUCA 3UMGA 1UM8A 1W0JA 4Y8VA 4KRXA 1QGUB 3M6AA 5B1YA 2PIDA 4ZOEA 2A9FA 5FBVB 1GDDA 4GPZA 2I65A 4IIJF 1CF9A 2O3TA 2RGNC 3HBLA 4PU0A 4NZ9A 1VKZA 1EJ2A 3Q40A 2R6CA 4XI9A 4H2DA 1PV2A 3GRAA 5C0OE 5CUQA 4G0ZA 3G17A 1H2WA 4RZ3A 4E5NA 3AR8A 4ZZ1A 3CBGA 3WYNA 3WK4A 1O03A 4IHAA 1ZM7A 3FAKA 3UJCA 1E4OA 4WLUA 3TRFA 5L4NA 4LISA 2VHVA 4LYEA 2CMFA 1X7HA 1P4SA 1UR5A 2WVHA 4K9LA 5JO9A 1QBGA 3WVNA 1U9ZA 4GBMA 1E3MA 1GKYA 2IU0A 2RGCA 1H1LA 1U65A 5IG2A 4ZQHA 1IONA 2RK6A 3Q8KA 2NXNA 1NXVA 3OPMA 1U7PA 4ANFA 2JL1A 2Q21A 3UXMA 1ZHHA 2H54A 4X8MA 2C78A 4ZVUA 1X80B 3IXLA 1DADA 3GG2A 5AESA 1TVMA 1JE1A 1RYEA 1WHTB 4HEQA 4NYMQ 4X1YA 3TFQA 1NTOA 1P2SA 4GC9A 3WWZA 4DY6A 1OJLA 5AW6A 2X0NA 2F48A 2EGGA 3I76A 1RYBA 4TTSA 5T3UA 2GPYA 3SHTA 1EDDA 1RTTA 1U3FA 4ZEOA 3ICQB 1DKNA 3EXG2 3JD0A 2HN9A 4DMUB 1DTWB 2B61A 2WF7A 3VPFA 1M1NA 3C5EA 3V1MA 3WE7A 1YR1A 2VRCA 3K9BA 4HNQA 4RMHA 4RJJA 4BZPA 3NUQA 1RQXA 1WXIA 2K2WA 3ZD7A 3EVCA 1MQAA 4B2YA 3MB5A 4PZZA 2WTNA 5C3MA 3KG2A 3U7RA 4AZTA 1N6RA 3R09A 2X4IA 1NQOA 2HSGA 3COYA 3I8SA 3KQVA 3VDNB 2WKRA 6PFKA 2AR0A 1CF2O 4C7BA 2GUWA 1ZWKA 4U63A 5IJWA 8OHMA 2C94A 1Q11A 2H2AA 4Z1MA 4JL6A 5L3VA 2PMDA 1F6BA 3LXUX 3PQ5A 1BCRA 2ZSAA 4E70A 1HNXB 1Q44A 1ZSNA 4NDZA 4BMPB 2W2KB 1OZFA 3HSKA 3PNYA 3L77A 1HQYE 3U0VA 5C51B 2OLKA 4GF5A 4OP1A 5SZHB 3KOXA 1QWSA 3B3JA 2HK6A 1JDJA 2Q4BA 2UZ3A 3INRA 4QG7A 3VR1A 3GUYA 1RWXA 2VJYA 3B60A 3DVRX 4KIFA 4OO3A 3MTAA 3CRVA 4Y67A 5ADVA 2BR4A 5I7EA 3LPMA 4OBWA 1HKHA 3EXFA 4NNJA 4GGPA 3KQTA 3PGMA 4PC2A 1X7GA 2JD0A 1OE0A 2ZS7A 4PLTA 2ZTLA 4ZANA 5TT1A 4BFXA 2VFAA 1V3TA 1Z18A 2FEMA 4DWOA 3EULA 3DOCA 1TYDE 5IK2D 3U40A 1FP1D 1ZEMA 3TCNA 5DYIA 4EPVA 4B7ZA 1VPLA 2XUHA 5DN9A 2FCRA 3GJXC 4I4TA 1VA5A 1P7WA 3C70A 4MKFA 4RVHA 3LBIA 3WL3A 4NH0A 4X6YA 2VTBB 1P60A 4NDNE 3TVTA 1EZZA 2X7JA 3DBHA 3ZU2A 3FVVA 3OURA 1U8FO 5HPYB 4R68A 3AESA 2XWSA 4KKXB 2BEKA 2AW3A 3NTXA 3NOXA 1QYDA 1RHUA 2CD7A 4I19A 1KC1A 1YHZA 2P5UA 5BWCA 3QOFA 2BT4A 4LY9A 4N39A 3AZPA 4WINA 3VHQA 4E07A 3MIZA 1MLDA 1WKVA 2WHYA 5FLXA 1V71A 4JLWA 4ZWNA 4YT4A 3UVEA 4RK1A 1EYZA 1Y9EA 2HJHA 5J2UA 1VQ1A 4L7VA 4XQ0A 4BIIA 2J30A 4P0TA 4DR1B 4HDMA 4FFPA 1X1SA 2RGRA 2G6BA 2EARA 1YV9A 2G3YA 2XDAA 2Z56A 3HDTA 1NMSA 1U3TA 3JALB 3QUSA 4GG1A 2GDZA 4KR3A 2D4AA 3LFHA 3ZN2A 3FPEA 5JECA 4POOA 4QXRA 1P2FA 1LC3A 3ONFA 4GX5A 4BKPA 2AXPA 3R6LA 1RZVA 3C39A 2E48A 3WDMA 1Q0TA 3JWHA 4TM7A 2G67A 2F9MA 2IYNA 1EFUA 2QE6A 1I1QB 1YD7A 3PNLA 2XB9A 4UUBA 3TLMA 2NQTA 4ZT4A 3IEPA 4BEBA 3GT0A 1KVSA 1VE3A 3AI7A 3OZFA 1H65A 3QHQA 1Q0UA 1O8BA 4Q4HB 4R69A 2PUAA 1YR8A 2OO7A 4FGUA 4R3UC 2AOUA 3MWDA 5CNJA 4DJTA 4U7JA 3E22B 1NRIA 1A8HA 3GJSA 4NV0A 1UIMA 2OHVA 1PN3A 3DFIA 3UJBA 3UB2A 3C7DB 4G1BA 4UMDA 3H5WA 3TL3A 1KVQA 1MB3A 2G25A 1YNSA 4JLBA 2NYAA 4LX0A 4NJEB 4OOEA 1PG0A 3LU1A 5B4UA 1YI1A 1E6MA 2R68A 3NZEA 3KAQA 2XA9A 3B51X 4XR4A 3THWA 1BX1A 2BMDA 4MV4A 3UB3A 1W46A 2ZJ0A 2VDVE 4OX9Y 5JJCA 1ISMA 1YQGA 2JCXA 5T41A 4Z4FA 2P30A 4BVJA 2ZBRA 2PS3A 1LFAA 1M1YE 5HFJA 4AO6A 5DGCA 3ICVA 1TYAE 3KZVA 2ZRHA 1NV8A 3QVOA 3B85A 2VJLA 4IMRA 1FPQA 4P35A 4PCUA 1A4RA 2RB4A 3AYZB 4KACA 4N47A 4ON9A 1FU7A 1RHRA 1Z4MA 4LCJA 2IKSA 3HRIA 2D8AA 4MCHA 3VYWA 3U3RA 2CYAA 2IEZA 4BO7A 1RR6A 3GDGA 1PR0A 3T4UA 4DSUA 4QASA 2IP1A 2QVGA 2VNHA 4MI6A 4FMDF 4GS5A 3WC4A 3VI3B 4BATA 3BTUA 2ZROA 1RQLA 4GYWA 1S8NA 3EPRA 5KTMA 3GEMA 1DJNA 4TV9F 2O1XA 5JQWA 1THGA 2CDAA 4TRMA 2D00A 4JA2A 1GQSA 2B1IA 4Q7LA 1Y33E 2WR8A 3AY7A 3T5PA 3PXUA 1UJNA 1KGSA 2IYUA 5K09A 3O3OB 1VM6A 1LXCA 2EQBA 5LMNB 1DOHA 5K8VA 5FWNA 3NS7A 4WE3A 4WNYA 1M9NA 1CV2A 1XL0A 2O9JA 1BQ4A 3LUHA 5FADA 3VSBA 1E6LA 4DR3B 1FLAA 3CH7A 4MIEA 3KSBC 5AI0A 2IX3A 3K96A 1U7OA 1N8NA 1T24A 3HKBB 4LV8B 1HYHA 3L6RA 4ZYYA 1N5KA 4JI8B 4JCCA 4MXDA 3NNNA 2JLWA 3QKSB 4F4FA 2GM4A 1QRAA 2JGAA 4MRMB 1NX9A 3ANNA 4KBFA 3SR4A 4DA8A 5JHGB 3VVLA 3HXTA 2O0MA 4PXAA 3WFJA 1KEPA 1CNEA 1IVYA 3FCOA 1G9SA 2Y1WA 1CJVC 3DLTA 3USZA 5JRJA 4G4SO 2NXCA 3O03A 3UGQA 3LP6A 4XWKA 5M34A 1DXOA 1U6IA 4HDKB 5IEBA 1IBCA 4Y3UA 1NBEA 1W4RA 1NYQA 4U00A 1XMVA 3EW7A 5IAAA 4NCIA 3R7SA 1PG2A 3JRXA 3E3OA 3G2QA 2Q4EA 2V55B 4KITB 3GJ6A 2GTHA 5C8XA 3WKCA 2J9GA 3AVTA 4KNWA 3A4TA 3KE9A 5BWBA 2P0YA 4HI0E 3QIVA 3NAMA 1ZCFA 2BCEA 3NPAA 1R0SA 1Z5OA 4KFSA 4Y1EA 3LYAA 3TQSA 4LWZA 3GNSA 2J45A 4RZXA 4DWJA 4A36A 3DMTC 4I5FA 3W2IA 2ZLBA 4CDRA 4QGHA 1JDNA 5I7UA 3EUAA 1N2OA 1FVHA 1DIBA 5H8WA 4FC7A 1CETA 3F7TA 1PT9A 1R5JA 4TYYA 5BOVA 4R40A 1IQPA 3I0NA 3EUFA 3NCHA 4A5OA 5KTKA 4RANA 2C7VA 2VOJA 1SRRA 2DQZA 2HLDA 4TXLA 5F77A 4S2EA 5ETJA 1RI1A 3OZ7A 1VLVA 2Q2OA 3A1WA 3GJ3A 4G1MB 4M0MA 4DOMA 1VDMA 4WBNF 1N8TA 5A5GA 1ZRSA 3E4DA 4NECA 3K9HA 1FJGB 4BPBA 1AZTA 1G5RA 3AF5A 1HPLA 1VCIA 5AVQA 4UHCA 5AW8A 3QNMA 5HR5A 2JGMA 5TQ0A 1TC1A 1Y9JA 4PYOA 5JC8A 3UAOA 5DGIA 4BLWA 3B1YA 1U0LA 3IIJA 4DABA 1IAQA 3OT1B 5AHOA 1IHYA 1J6UA 4LZPA 2EOAA 5CVCA 2E82A 5DHAA 3RBZA 1ZX1A 1COZA 3JCZA 4I9NA 1G16A 1KI6A 1XEXA 1RCTE 4ZEVA 3PRJA 1CZRA 1BIFA 1UMCA 1Q0PA 1Y7LA 3SSAA 1QO0A 4V1CB 3H2BA 3KSRA 1ZIOA 2AX3A 2Z8YM