2OT5A

Crystal structure of the hiv gp41 core with the enfuvirtide resistance mutation n43d
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
67
structure length
67
Chain Sequence
SGIVQQQNDLLRAIEAQQHLLQLTVWGIKQLQARSGGRGGWMEWDREINNYTSLIHSLIEESQNQQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Impact of the enfuvirtide resistance mutation N43D and the associated baseline polymorphism E137K on peptide sensitivity and six-helix bundle structure.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Viral protein
molecule keywords HIV-1 gp41 glycoprotein
total genus 29
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 2007-02-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2ot5A00
1MOFA 4FIPC 3CP1A 1JPXA 5HFLA 5CMUA 4N21A 1DF4A 5H9CA 1I5YA 2EZOA 3MHSC 1K34A 1QCEA 1MG1A 1SZTA 2OT5A 3MHHC 3H01A 2P6JA 4JGSA 2M7WA 3M99B 4N23A 3P30A 4E2LA 1ENVA 1Y66A 1JQ0A 5HFMA 3GWOA 5KA5A 5CN0A 3B8MA 3K9AA 4JPRA 1DLBA 2LP7A 1QBZA 1Y4MA 2EBOA 4JF3A 2MK3A 2EZPA 5KA6A 1QR8A 1I5XA 1F23A 4G2KA 3B8NA 3WFVA 3B77A 4FK5C 1QR9A 2X7RB 1DF5A 3CYOA 1EBOA 1K33A 4FJCC
chains in the Genus database with same CATH superfamily
1XILA 4UUJC 3CP1A 3JSNA 4QE7A 5CMUA 1OCOC 3OAAG 2ILMA 3HKCB 5B3SB 3M99B 5JJNB 1BHBA 2VQFB 5KX5B 5JVDA 4LFCB 3ZX6A 1FXKB 3K03A 2XHBA 3ABTA 4X20B 1Q8IA 2HHHO 2EILB 1GRJA 4B08A 2W6IG 4RWUA 3H9VA 1Q43A 3C3TA 4IIJB 1M1KW 2E3CA 1Q82W 4WFGA 1D5NA 4CS2A 1JFFB 4I7ZB 4J9YB 5IDJA 1HP8A 1UFIA 4QIWF 5B1BB 5B1BC 4FPPA 3N2GA 4PA7A 2Q0OC 3JAKA 4UCVA 1XNRO 4NB5A 5IYZA 3JAMN 1S5HC 4LF4O 2WA3A 5IT9N 3H1KH 4O4JA 2DYRC 3WU2Z 4JPRA 2QA4V 1SQGA 2A79B 4QPJA 1HNWO 4FLUA 1VARA 1Y74B 2WAMA 1YITV 3WB0A 4DV2O 4B3RB 2O57A 1F51A 4KL1A 4ZBMA 4DXWA 3D8CA 1AI4A 4G28B 3LSQA 3CD6V 4DUZB 4LC1A 2PUSA 2GBOA 1V54C 1ZSPA 3JARB 4L87A 1NVPD 4OX9B 4GT1A 2QWNB 3UO3A 1OZ0A 2Q0AA 4PA9A 1CEZA 3CCUV 1THZA 3WFVA 1YDXA 3ZHSA 1VMGA 2PYJA 5HFLA 5ITZA 3BCCH 1A32A 3QG5A 3S3XA 3K58A 1R3KC 2WLJA 2PY5A 4NTWA 3G71V 3JARA 2B9ZA 3FAVA 3L9DA 3E2EA 2G38A 2Q5ZA 1GTOA 4UCOA 1K97A 1Z2GA 5LL6Y 1SETA 3U10A 4LF5B 3CRMA 1B06A 4LH7A 2IJJA 3OFNG 4HZ3A 3K5LA 5EYPA 1YJ9V 1Z5VA 3Q4HB 1F7YA 4ZHQB 4Q6GA 1V55C 4MS2A 1L0LH 3KCYA 1GN4A 3APQA 5KHHA 3OE7G 2QDOA 4DV2B 4EFEA 3BVOA 4YJ3B 4IT5A 3L74H 4X89A 2YC0A 3AG4C 5JCOA 1SRYA 1SESA 1COWG 3HKDA 2LGWA 5JQGB 5C8YA 5FNVB 4TWKA 4NYKA 1OCZB 4K8ZA 2HVJC 3P3NA 5K1PA 3SPGA 2ZE7A 2WA4A 5KHJA 4FZ0A 3VQWA 1WAZA 2YICA 2AXTZ 4X66B 2XASA 3STLC 4PA6A 5EC2C 3CCLV 4G27B 4GZRB 2E76B 2WLIA 3OW2U 2JGDA 1W0KG 5BMVB 1Q81W 2M7WA 1VQNV 3L75H 5E79Z 2WWWA 3P32A 5B1OA 3GWKC 4PD4F 1IZ3A 2E5LO 2LFRA 2ZINA 4CS4A 1S5LZ 2UXCB 3NXSA 4DUYO 5CA1A 3Q4HA 1Q3EA 3SYOA 2HFEC 4WCEV 2RNBA 1I7FA 1ZL8A 1S76D 5CN0A 3BY6A 4HYOA 3T1HB 4WFEA 4UXNA 4DR3O 2VQEO 4X62O 4PA4A 5K1XA 2Z3YA 4NXMB 4FLXA 4LF9B 4K8XA 3JD3A 3RVZA 2IH1C 3OMNB 1Y74A 1NH2B 3LDDA 5B1AB 3DSQA 2UUCO 1HNZO 4JI8O 1XHXA 3LSSA 4MVZA 4O4HA 4TV9B 1Q7YW 2WLMA 2A9HA 1SQQH 4JZGA 2R72A 3JD0A 4RO2A 5LGUA 5D5PA 3B40A 3K79A 4DW0A 2BSKB 3HB3B 2GSMB 2CTRA 3BAAA 2UUBB 3E22B 1KC8W 1VQ4V 1N4CA 2Y0IA 3OEHG 5LA6A 3B8NA 4LF4B 1SQVH 3U0ZA 4F6RB 3RW0A 2DYRB 3OD4A 1Q6UA 4MVMA 3K0DA 5BR8B 3AG3C 4B3TB 4X64B 1VQ5V 4MW8A 4BIZA 2Y69B 4X9QA 4DV6O 4QNHB 1YJWV 3K5OA 4DV4B 1QLEC 2QSAA 2VS0A 4DR4B 4J7KA 4X1KA 3FYIB 2OYQA 2DOSA 1FXVA 4P30A 3G6EV 4HNAB 2GUZA 1EZJA 2YDEA 2ZKOA 1IXMA 2PZSA 1OCZC 2CDYA 3T2MA 4PI2A 2DWDC 4JI7O 3BA9A 3ABLB 2EINC 2BTOA 5JQGA 4K3AA 1YF2A 2Y4UA 1D2DA 1AP5A 3LNNA 3DTUB 3ICXA 3AG3B 1MNGA 2BTQA 3GB7C 4TUYB 4EB6A 4Z2WA 1XMOO 4I9WA 4TV8A 3JD4A 3SGIA 1RPOA 1KKCA 1B04A 4B3MB 2VRZA 4AILC 2YEVA 4FM0A 1H2KA 2LJ2A 5JH7B 2CUGA 3CCSV 3ZN1A 4X1YB 1P7BA 4GX1A 4DV7O 2IJKA 5FLXN 3CCEV 1AR1B 2WPDG 4X88A 2EIJC 4O4HB 4BWAA 1NH2D 2DW4A 4PJ0Z 4R8CA 3IC7A 2EIKB 1F4MA 4PDLA 3BRCA 1PP9H 1BS3A 1FXKA 5CBHA 1AJPA 2DMXA 4IYHA 4JI4O 4O2AA 1O9HA 3JATA 1XOUA 1PNMA 5B3SC 3P3PA 4CH3A 2XOKG 2WLLB 4X1KB 5F2VO 4DR2B 2P5OA 2YIDA 3KKYA 1HWYA 4KUMA 1WB7A 1N0NA 1JFFA 2K1EA 2MW2B 4P2ZA 3ZN0A 1ZLZA 4LWSA 3JATB 2NNUA 4WFAV 3W7SA 4B3TO 4J42A 4JV5O 1H2NA 1MOFA 4JAAA 4DR2O 2OCCC 3OGCC 2W6JG 3AG7A 3H1JH 3K06A 1VQ6V 4X1IB 3E86A 2XAJA 3T4ZA 3CHXA 1QR8A 3LUTB 4XBFA 5C8YB 4WFBV 3UCSC 3RYIB 4U7OA 2VQFO 4O2BA 1NS1A 5KHIA 4H0LB 3N2KA 2E5LB 2JS3A 3ETDA 1GO3F 3P30A 5KHKA 2PI5A 1Y66A 4JTCB 2NN4A 3J7AU 1X4TA 2BOBC 1K5SA 4GKJO 3ZHRA 4CC6A 2PI4A 1K33A 1PNLA 1OCCC 1EM1A 2YIAA 3BA8A 4GKKB 2HR3A 3BPZA 4DK1A 2DQ3A 4MVOA 3UM7A 4BR6A 3H1HH 5H6RA 4D7TA 3DC6A 1IVSA 2ETNA 3OMIB 2NLJC 5H2FZ 2HEPA 3JD1A 4RUFA 3LSUA 1H2LA 4IL6Z 5EYPB 2BE3A 5GTIZ 4UV9A 4DYLA 1YHQV 4DV5O 3SPHA 2UXCO 1US6A 1QLEB 3KG2A 5IYCO 3CSXA 5GONB 1KBHA 4MVQA 1YTFB 1J5EB 4YHHB 1LR1A 3EXAA 3IGAC 4XDKA 4PDVA 3PJSK 4I9QA 4JYAB 4FM1A 4KHPO 2H8PC 2FL4A 2Q67A 5L3FA 2EZPA 1EN5A 1NR7A 3ZRWB 2JJ1G 3A0BZ 2Y69C 5LHHA 4FLTA 5J9PC 4J9ZB 3G80A 4LF7O 3JSLA 2A06H 4GYCB 3R66A 1FKAO 2ZNJA 1JJOA 2JEXA 4TOIA 1K5QA 3GVMA 4GUNA 1NT2B 3E35A 5EBLC 2EILC 1IURA 5J2TA 1KKDA 3QF7A 4I50B 4UCTA 1HDJA 1S3JA 5LHIA 3SYCA 1U97A 2CH7B 2V1DA 4LFAO 4A5UB 4GCZA 4WFHA 3CRQA 1YI2V 1JR9A 2ITDC 2WLIB 5KLVH 2B5UA 1QVFU 5IJ0A 1SQPH 4ZHQA 3E8BA 3O65A 4L8JA 5EC1C 2EIJB 1XMQB 2Z5UA 3TK1A 2Q6AA 3CEIA 3CS5A 1IX9A 2VWJA 4BW9A 3OGIB 5GW7A 5IE9A 3JAWA 3HKEA 2HP8A 3WB2A 2JRIA 4CZZA 4LFBO 3B77A 2QWPB 1KU9A 1NQTA 2CE4A 3CE2A 3FYEB 4DV7B 1IDSA 1IBMB 5BR8O 5B66Z 5JWPA 2EZOA 3DXRA 4MTXA 2JK5C 1I0HA 4X1YA 5CA0B 1RM1C 4JGSA 4UVBA 5B5EZ 4B3MO 2YI8A 1WA8B 3FKSG 2N05A 4IHJB 1SQBH 2EBOA 3G6BA 2QTSA 2ZM6B 1NTZH 3D3IA 2OCHA 1SKVA 1NVPB 1R6KA 1FXKC 1PV0A 2D2CB 4TSFG 1AVMA 1I5YA 4JI7B 2FMLA 4JI2O 1I94O 4B7KA 2OTJV 5LXTA 1FXHA 3CX5F 3D36A 4Z1MG 3RYCB 3UQ8A 1R6TA 4O4LA 1G1XB 1BHAA 1E79G 2ZE6A 2HJFC 2YXLA 3AG1C 5B1AC 1U96A 1KECA 3K9SA 4FZ1A 4QPKA 1KB9F 4DV0B 4DR3B 3FB8C 2QWRB 2XAQA 1BT8A 2ZDIC 5BY1A 2RJZA 4DR1B 4I0XA 3ETEA 1G6UA 5GTHZ 5A9GA 4YY3B 1V9PA 1N32O 4KP4A 3RYFA 2DWEC 2IU0A 3JCZA 1Q6HA 4JYBA 5IY5B 5H9CA 3D3QA 1GN6A 3C3SA 3LDEA 1GKFA 4CC5A 1AI7A 1MZEA 4H13B 1K9MW 4R50A 4CBCA 2PGGA 2QM4A 2HHHB 3CCQV 1NKDA 3FX7A 3HKCA 1Q6IA 4J7JA 4UB8Z 5BZBA 4O4IB 1EN4A 4PDMA 1MSWD 5KAIZ 2MK3A 4G2KA 1AJNA 4KFMA 5LXTB 3ZHQA 3ABLC 1N33O 4RAIA 4LF6O 3UT5A 2ZQMA 1DTOA 2QR4A 1ORQC 1K8AW 2OT5A 1IBKB 2UXBB 2PTMA 3H1IH 3AG2C 3CRAA 1IXBA 1VF6C 2B1IA 2Y48A 2AGAA 2IJHA 2ZT9B 5EBWC 3CCMV 3K9AA 1XUQA 4ASUG 4JI5O 4QE9A 4DR1O 1HNXB 3ABKB 5FL7G 1BL8A 4O2AB 1PD3A 2CTPA 5JJJB 1KQSU 4EEQA 1S77D 2VWKA 3SJBC 2WLLA 1H2MA 1FAFA 3OTOB 4BAYA 5HFMA 1WPXA 4AQYO 4HBNA 4CS3A 4DK0A 5LP6A 4KHPB 1UPGA 5JVDB 2H94A 4ICGA 1CXZB 3VOUA 3W7TA 1GM9A 4Q20A 1EZVH 1XNRB 2JEUA 4MVUA 3QO7A 1VQMV 4DRXA 4FFBA 1AILA 1M56B 1K92A 3OM3B 4F6EA 2WLKA 2QEXV 4MTOA 4DV1B 5D5QA 4DR7O 5KUMA 2YUAA 4B3RO 5IJ9B 3ML0A 3OTFA 2P22C 5DM6V 1GK9A 3G67A 1JA8A 5IY5C 4BW5A 1RSOA 1R3IC 1RFYA 2W0FC 4TV9A 1EN6A 2AZ0A 1H38A 5LOVA 4R7CA 1H8EG 4O4IA 5IWAO 3CMAV 2OCCB 3TGUH 3K0GA 2Q7GA 1I94B 5TISZ 4UCUA 3STZC 1Y76A 4I0XB 4K0KB 2X6CA 3ABUA 5FPRA 4TQDA 3SPIA 1AJQA 2KG7B 1AI6A 1PNKA 1GMGA 4E2LA 1BCCH 3HKBA 4UVAA 4RUEA 1RP3B 2QKSA 2Q8VA 3ZMZA 4U3JA 1Y4MA 3RGBA 2N04A 4GKKO 5CA1B 2P7TC 4DUZO 1Y76B 1IBMO 5BXZA 5KUKA 4J80A 1X59A 3RN4A 3B8MA 1GH6A 3SR2C 2XAGA 4U3JB 3FFQA 4JF3A 2UUAO 3SYPA 4JI2B 2PF4E 2V4DA 5LGTA 1OV9A 1S5JA 2UXBO 3ABKC 3A2FA 3M8AA 1J5EO 3W7WA 3OUFA 3CRRA 1VQKV 4P9OA 4JAUA 1VEWA 5IYDO 1RM1B 2ZE8A 2EJ7A 1XQ8A 1NJIW 3FD9A 5AG2A 1DLBA 2XUMA 4EKWA 2HG5C 3TJTA 2CGNA 1AI5A 1K3EA 4J41A 3D36C 4DO2A 1NI8A 1GN3A 2LO1A 5KHGA 1ZAUA 1SS3A 5DEDA 4DR6B 2ZE5A 4JZ2A 2QJ1A 4X20A 1MZFA 4IIJA 3IAYA 3HKBB 4F4LA 5LYJA 3AG2B 4X65O 4GLXA 2X7RB 2Q4PA 1XI1A 2E74B 4JI1B 1Q90D 2GDSA 3CCRV 1M57C 3RWRD 4DUYB 2IH3C 5KMGB 1FD9A 1M56C 4DV5B 4MTFA 2IBZH 5CA0A 1G8MA 2BTQB 4EB6B 1R3LC 4XDLA 3EHBB 2ZIOA 3RYFB 4EFBA 3NR7A 5IYZB 3BHPA 3ZRVA 1YJNV 3A8TA 1Y6XA 2ADQB 1MABG 2ADPA 2X0LA 4CH6A 2EJRA 2F23A 1B6QA 4N23A 1L1FA 1NTKH 3ZMSA 1S72V 4JTDB 3ASOC 4I5SA 3THOA 2Y4TA 4JI5B 5L3BA 2GV9A 3KZIZ 3A0RA 4I55B 3ZRSA 2F4VB 1Q5OA 1E1RG 1TVKB 1TUBA 1XEQA 5CB4A 2ZR3A 3H01A 1N36O 1Y67A 5EK0A 1YCIA 3JCUZ 2ZM6O 2HVKC 1AP6A 1NU1H 4ZIBA 2K9PA 2QGNA 1AB3A 3UO2A 3OUSA 4I55A 4JTAB 2CTWA 2C2AA 2KQXA 2UXDO 5LP6C 1TUBB 2OIGA 1KYOF 1L8DA 3RBZA 3AK1A 1PL0A 5LBQA 4MVRA 4YXWG 5KMGA 1W0JG 1WB8A 2AW9A 1WA8A 1P7GA 5FNVA 4HAMA 1BZKA 2Q7HA 1ZWIC 4B7EA 3LNMB 5LYJB 2JIZG 4DR5B 4FJCC 3ZHVA 5EIBD 3A0HZ 1YTFD 5B1NA 1R73A 3SYAA 2XAHA 2KKWA 4JYYA 3HKDB 4KXRA 2OTLV 5L3CA 5KA5A 1YXBA 1DK1A 2DJVA 5L3DA 3TETA 3IFXA 2YIBD 1L0NH 3OTOO 3I5DA 2H3OA 2ZDIA 3FB5C 4OPHA 1LUVA 2DQ0A 2P90A 3I56V 2FYUH 3SDLA 1M57B 4H33A 1R6NA 3FAVB 1H2SB 2X6BA 3ZRWA 3J80N 4LH6A 1XMQO 1I5XA 1GAXA 1J95A 1VQLV 4J7ZA 2A7WA 3MD0A 3L73H 1JPXA 3E22A 1AR4A 3MHSC 2LW7A 3S3WA 2KB1A 3AG4B 5EIBC 4X8AA 4YJ3A 5LMUO 1NZ6A 2EIKC 2JDIG 3EFFK 1NTMH 3ASNB 1SF9A 5H6QA 3SJAC 2D3OW 3BABA 4NKGB 2HJDA 2ZR2A 2YSUB 3K57A 5LMUB 4ZI7B 5C93A 1DGSA 3U11A 4JAVA 1MG1A 1LUWA 1VF6A 2WLNA 4JI3O 2Q68A 2BCCH 1XNQO 3JYCA 5FPOA 1JOYA 2EX3A 4FFBB 1GM8A 4IYIA 2AHZA 4DR4O 3O9OA 4YHHO 2QTOA 2JGUA 4O4JB 4JI8B 3DGEA 3ZS8C 2R9AA 2UXXA 3HR0A 1Q86W 3N2GB 1BSMA 2A3QA 1W59A 2IU3A 3JASA 3WG7C 3WG7B 3M7MX 2YIBA 4OXSA 4DW1A 2UXNA 4U3FH 2AZ2A 4LF5O 1N33B 1RSOB 1M4UA 2Q7EA 3T1CA 3RFRA 2B1GA 3ZMVA 4BIUA 4PV1B 5LOVB 1K73W 1VQ8V 3ZRXA 2KSDA 3CXCU 2QM8A 2CH7A 2FB5A 3QTCA 3SYQA 4JI6B 1SC5B 1XHZA 1JJ2U 3CPWU 5IYBO 4X65B 1YVWA 4UVCA 4MTGA 1BGYH 2QWOB 3ZCCA 2IW5A 1VQPV 2R9IA 5EZYA 4CH5A 3CMEV 2F93B 1SQXH 3F5TA 4JYAO 4PDRA 5A2QN 3OT7A 3K59A 1XNQB 1CPYA 1HR0O 2LFSA 3MDSA 3FB6C 5JCOC 1FYJA 2DYSB 2UUBO 4NXNB 3RT3C 4X66O 2EIMB 3T1HO 4ABMA 2R70A 3X2QC 3T1YB 2V7QG 3CYOA 4ZI7A 1AR5A 2CGOA 4DV3O 4DV0O 2UU9B 4TUYA 2YS8A 1FFTB 2P4VA 4YJ2A 3CRCA 2QKAA 2QM7A 2IJIA 1HNZB 2F1MA 1FJGB 1JVMA 4AHCA 1ZTEA 3G4SV 1F23A 2P67A 4B3SB 1KP2A 4FK5C 1S0VA 5JH7A 3B2EE 4JI3B 1EBOA 4JI6O 2YXYA 4H37A 4PELA 3JASB 2IM9A 4E4EA 2M6YA 3SJQC 4JI4B 3EVKA 2XT9A 4YY3O 3ASNC 1P4RA 3E8HA 3OR7C 1M5IA 2QKCA 3JAWB 5EZYB 4ZOLB 5DECA 4GX0A 3E8GA 3PN1A 3ETGA 2XNDG 5CB4B 3ZIAG 3K08A 2L35A 4RQFA 1HR0B 3VQXA 3K3WA 1FFXB 3CCJV 1VQ7V 4JV5B 1WLEA 1JQ0A 5EBMC 3N2KB 1KD1W 1WN7A 3CCVV 2ZIMA 4GKJB 1GN2A 1JMKC 4LNUB 4LFBB 1TA8A 5J2TB 3E8FA 4YIOA 1BMFG 2CAZC 1N8RW 4F6RA 4LP8A 4JASA 3VBBA 1K4DC 2JVDA 4I4TB 1TAEA 1MMMA 1YSCA 1XDCA 2QE7G 5LP6B 1OCRB 3OMAB 4DV3B 4GX2A 2FKXA 2F95B 3B4SA 2ARHA 4MW3A 4NXMO 3GWOA 3HPLC 2VQEB 1HNWB 5KA6A 3CXHF 1QNMA 3VQYA 4WBNB 2CK3G 1VQ9V 4LBEC 4PHZA 3OR6C 1WP8A 4N21A 1N36B 1PL4A 1XL4A 1K34A 5L3EA 1W2BU 5CBFA 5JJEB 3IJ4A 2Y0PA 3MHHC 3ZEDA 2AHYA 4WF9V 3I55V 4YJ2B 3KCXA 2JGDB 4O2BB 4DV6B 2ZCEA 5CA3A 1SZXA 4R6ZA 4OX9O 1ZUQA 4NTXA 4WBNA 5E1AC 5J2UA 4CH4A 5LGNA 1N34B 5LA6B 4UB6Z 4UCRA 2HKOA 3QO5A 4LF9O 3QO8A 4NVPA 3K5MA 2BSKA 3L70H 2LGQA 4OGQB 5IJ0B 4BIOA 1VF5B 4MSWC 1F4NA 1QBZA 5H5NA 3X2QB 2XTAA 1VIBA 2ZD9A 1I08A 2LQTA 3SPJA 1K4CC 1DF5A 4ZOLA 4FMTA 3CJHB 4DR5O 1SERA 2QWQB 3JAKB 1M93A 2F4VO 1N32B 2RMKB 2E75B 2P6JA 4X1IA 3ZMTA 5IWAB 3BEHA 3DC5A 3OEEG 2CTQA 1ZX3A 4FLVA 1QQCA 1SA0B 2Z0AA 1B3QA 2ZNIA 4K35A 4DV4O 2HLDG 5KAFZ 4DRXB 4ZKIA 1XREA 3CC2V 3J81N 1FS0G 1JX9A 1TGOA 2YXHA 2OWOA 1T5EA 3AK2A 3SJCC 4LF8O 3C90A 1XL6A 4J11A 4MT8A 4W4KA 5KX5A 2ODMA 5IJ9A 3E89A 1BE3H 2DE0X 3R65A 4GX5A 4NXNO 1KP3A 2EINB 2ATKC 4Z1VA 3RYCA 1R3JC 1IBKO 1SZTA 4FLWA 2OIEA 1Z5WA 1TUEB 2RQ6A 1MSDA 3BFRA 1H8HG 1ENVA 2X6AA 2WLHA 2A0LA 4AQYB 4LR3A 4FVMA 1URFA 1AROP 1O9GA 1WP7A 1FJGO 1PKXA 4O4LB 2ITCC 4FIPC 1VF7A 3F7VC 1QHTA 1DF4A 4LNUA 3HKEB 3UT5B 2UU9O 1KMIZ 4HNAA 3H1LH 1JCHA 3ZBHA 2GTAA 1YZBA 4LFCO 2RN9A 4JI0B 3SPCA 3JD2A 2Q73A 4TT3G 3T4DA 3QVNA 4JI1O 4P9PA 1H2GA 1SQFA 2XAFA 2ZXWB 4D6TH 2NR5A 1BQ0A 2JJ2G 1WNSA 2Q9LA 2EIMC 3L72H 3RVYA 3AEIA 4X64O 1SA0A 4IGGA 4LF7B 1YEWA 5GONA 3JALB 4QGPA 3K5NA 3LDCA 3ABMB 5J2UB 2KG7A 5LMNB 3ASOB 3CB2A 1TVKA 1OCRC 1XMOB 4I4TA 1QVGU 2WSSG 3TXQA 3RYIA 3CC4V 1WPBA 1ROPA 3JALA 3ETQA 1OCOB 2F66C 1GM7A 1NBMG 2LW1A 4OPAA 3B09A 1QLNA 1VQOV 4YIPA 3ZHUA 4JI0O 2EULA 2GTSA 2FTKA 1D5AA 4FFKA 3CC7V 4C7UA 3RYHA 4NR1A 3ZMUA 1IBLB 4FM2A 1RPRA 3QNEA 2PYLA 4U7NA 1EFRG 3UKMA 3MAQA 1YIJV 4D7SA 1IBLO 3WB1A 4DV1O 1HNXO 2P06A 1NR1A 1CP9A 3CWBH 1K7DA 1QR9A 4K0KO 3TCUA 5L3GA 1KUQA 1UJWB 1XBLA 2RCVA 1R1BA 1VP7A 4UCSA 1LNQA 4LF6B 1FPOA 1M9NA 1WJZA 3N27A 5BMVA 4TV8B 4B3SO 1PM9A 2L6LA 1P84F 3CJHA 2UUCB 4RQEA 2R9RB 2RDCA 4W4LA 1OCCB 4QJFB 5CBGA 4I50A 4MVSA 1P49A 3TXSA 3W7UA 4FLZA 1HW7A 1QCEA 2W0XA 1OJHA 1N34O 2GHYA 4DR6O 1PPJH 3F5WC 4DR7B 3K04A 2UXDB 4TQFA 1V54B 2ZXWC 3T1YO 2DYSC 1FFXA 1MA1A 4FLYA 1QU7A 4X62B 4UFZA 2JS5A 5ITZB 1ZL8B 2DN9A 2BOCC 2F43G 1OHHG 1E1QG 3RYHB 1M90W 3W7XA 3IC9A 3VQVA 1G4YB 2P4KA 3AK3A 4XDJA 3ZJZA 4WFFA 4PA3A 4LCUC 5LHGA 4LFAB 3AG1B 3ABMC 5LMNO 2UUAB 4JYCA 5DN6G 3ZHTA 2GUZB 2N74A 4LF8B 3DXRB 2YEVB 2YI9A 3E83A 3APOA 4H44B 3FB7C 4UV8A 3L71H 2Q69A 4LWSB 2LP7A 4IHJA 4J10A 1N0JA 4NTYA 1BQZA 4AI8A 3F7YC 4PI0A 1V55B
chains in the Genus database with same CATH topology
2XNDG 1MOFA 4UUJC 3CP1A 4QE7A 2P7TC 5CMUA 3K08A 3ZIAG 1OCOC 4RQFA 3OAAG 2OCCC 3OGCC 2W6JG 3K3WA 5KUKA 3CCJV 3K06A 5B3SB 1VQ6V 3M99B 1VQ7V 1BHBA 1WLEA 1JQ0A 5EBMC 1KD1W 3CCVV 3B8MA 3E86A 2XAJA 2XAGA 3T4ZA 1FXKB 3K03A 4JF3A 3E8FA 1QR8A 3LUTB 3SYPA 1BMFG 4XBFA 1N8RW 3ABTA 4LP8A 4WFBV 5LGTA 4U7OA 4JASA 2EILB 3VBBA 1K4DC 2W6IG 3ABKC 3W7WA 1YSCA 3OUFA 1M1KW 2QE7G 1OCRB 3OMAB 1Q82W 4GX2A 4WFGA 1VQKV 3ETDA 1GO3F 4JAUA 4P9OA 3P30A 4MW3A 5IYDO 1Y66A 4JTCB 4J9YB 3GWOA 5IDJA 1RM1B 2PI5A 3HPLC 1NJIW 1DLBA 4EKWA 2HG5C 2BOBC 4QIWF 5B1BC 1K5SA 5B1BB 1AI5A 5KA6A 1K3EA 4DO2A 4FPPA 2CK3G 2PI4A 1VQ9V 4LBEC 4PA7A 1K33A 3OR6C 1PNLA 1OCCC 4N21A 1XL4A 1K34A 5L3EA 1W2BU 5CBFA 3MHHC 2HR3A 2AHYA 2DQ3A 1S5HC 4MVOA 4WF9V 3UM7A 3I55V 5H6RA 2DYRC 3OMIB 2NLJC 4JPRA 2QA4V 3JD1A 4RUFA 2A79B 4QPJA 5CA3A 4R6ZA 4F4LA 3AG2B 5E1AC 2WAMA 2X7RB 4UV9A 5LGNA 1YHQV 3SPHA 1YITV 1QLEB 3CCRV 3KG2A 1M57C 2HKOA 1F51A 2IH3C 5IYCO 4ZBMA 4DXWA 1AI4A 4G28B 4MVQA 1YTFB 3LSQA 3CD6V 3QO5A 4LC1A 3QO8A 1V54C 1M56C 4L87A 4MTFA 3IGAC 4XDKA 4PDVA 1G8MA 3PJSK 1NVPD 4GT1A 2H8PC 2Q67A 1OZ0A 1R3LC 1F4NA 1QBZA 3EHBB 4MSWC 4XDLA 4PA9A 5L3FA 2EZPA 1CEZA 3CCUV 3X2QB 2ZD9A 1THZA 1NR7A 3ZRWB 3WFVA 2JJ1G 3SPJA 1K4CC 2Y69C 3ZRVA 1DF5A 4FMTA 5LHHA 1YJNV 5HFLA 5J9PC 1SERA 1MABG 4J9ZB 1R3KC 2X0LA 2WLJA 2P6JA 2EJRA 3G71V 1B6QA 4N23A 2JEXA 3ZMTA 1K5QA 1L1FA 3ZMSA 1S72V 3BEHA 3OEEG 4JTDB 3E2EA 3E35A 3ASOC 1GTOA 2EILC 4I5SA 5EBLC 1KKDA 1K97A 1SETA 1S3JA 5LHIA 3SYCA 5L3BA 2IJJA 3OFNG 4HZ3A 3A0RA 3ZRSA 2V1DA 1YJ9V 4GCZA 2HLDG 4WFHA 4ZKIA 1E1RG 1YI2V 1V55C 2ITDC 2WLIB 4MS2A 2B5UA 1QVFU 3CC2V 3E8BA 3OE7G 2ZR3A 1FS0G 3H01A 1JX9A 5EK0A 5EC1C 2EIJB 2Z5UA 3TK1A 2Q6AA 4X89A 5GW7A 1XL6A 2HVKC 3AG4C 4MT8A 4CZZA 1SRYA 1SESA 3E89A 1COWG 3B77A 1NQTA 3OUSA 3R65A 3FYEB 4GX5A 1KP3A 4JTAB 2EINB 2C2AA 4TWKA 2ATKC 1OCZB 2EZOA 1R3JC 4MTXA 2HVJC 1SZTA 3RBZA 2JK5C 1TUEB 1RM1C 4JGSA 3SPGA 4UVBA 1PL0A 1H8HG 1ENVA 2X6AA 5LBQA 3FKSG 2WLHA 4MVRA 4YXWG 1W0JG 2EBOA 2A0LA 3D3IA 2XASA 4HAMA 3STLC 1AROP 4PA6A 5EC2C 1ZWIC 3CCLV 1NVPB 4G27B 1R6KA 3LNMB 1PKXA 2JIZG 2ITCC 4FJCC 4FIPC 3F7VC 1FXKC 1DF4A 4TSFG 1I5YA 1YTFD 5B1NA 2WLIA 3OW2U 1R73A 1W0KG 3SYAA 2XAHA 1Q81W 2M7WA 1JCHA 2OTLV 2OTJV 5L3CA 1FXHA 3D36A 1VQNV 5KA5A 2WWWA 4Z1MG 5L3DA 3SPCA 3TETA 3IFXA 3JD2A 3P32A 5B1OA 4TT3G 1BHAA 1E79G 2ZDIA 3FB5C 2HJFC 3T4DA 3AG1C 2DQ0A 2LFRA 2P90A 3I56V 5B1AC 1KECA 3NXSA 4P9PA 1M57B 1H2GA 4H33A 4QPKA 2XAFA 1R6NA 2ZXWB 3FB8C 3SYOA 2JJ2G 2HFEC 2X6BA 3ZRWA 4WCEV 1S76D 2XAQA 5CN0A 2ZDIC 3BY6A 4HYOA 4WFEA 4UXNA 3ETEA 1I5XA 1J95A 2EIMC 1VQLV 4PA4A 3MD0A 3RVYA 3AEIA 2Z3YA 4KP4A 2DWEC 2IU0A 3JCZA 1JPXA 4JYBA 5IY5B 5H9CA 3MHSC 3JD3A 2KB1A 3RVZA 3LDCA 3AG4B 2IH1C 4X8AA 3OMNB 3ABMB 3LDEA 1GKFA 1NH2B 2EIKC 2JDIG 3EFFK 3LDDA 3ASNB 1AI7A 5B1AB 5H6QA 2D3OW 3ASOB 1OCRC 2ZR2A 2YSUB 1K9MW 3LSSA 4MVZA 1Q7YW 2WSSG 4R50A 1QVGU 4CBCA 2WLMA 3CC4V 5C93A 2A9HA 3JD0A 4RO2A 5LGUA 1ROPA 1OCOB 4JAVA 1MG1A 3K79A 1GM7A 1NBMG 2WLNA 3CCQV 2Q68A 3JYCA 1QLNA 1VQOV 1JOYA 1NKDA 3HB3B 2GSMB 1GM8A 5BZBA 2AHZA 2FTKA 3CC7V 4PDMA 1MSWD 1KC8W 1VQ4V 2MK3A 2QTOA 3OEHG 3DGEA 4G2KA 1AJNA 3B8NA 4KFMA 3ZMUA 2UXXA 3ABLC 1Q86W 1RPRA 3QNEA 3RW0A 4RAIA 2DYRB 2IU3A 4MVMA 3K0DA 3WG7B 4U7NA 2ZQMA 3AG3C 3WG7C 1EFRG 1DTOA 3UKMA 1ORQC 1YIJV 4OXSA 2OT5A 1K8AW 1VQ5V 4MW8A 4BIZA 2UXNA 3AG2C 2Y69B 4QNHB 1YJWV 2B1IA 2Y48A 1QLEC 2IJHA 3CCMV 5EBWC 3T1CA 3K9AA 4ASUG 2B1GA 3ZMVA 4BIUA 1NR1A 1CP9A 3FYIB 1K73W 1K7DA 4QE9A 1VQ8V 3ZRXA 3CXCU 1FXVA 2QM8A 4P30A 1QR9A 3G6EV 3ABKB 1EZJA 1BL8A 5FL7G 3TCUA 5L3GA 1PD3A 1IXMA 3SYQA 1UJWB 1OCZC 1KQSU 1S77D 3T2MA 1JJ2U 3CPWU 2WLLA 5IYBO 2DWDC 4UVCA 1LNQA 4MTGA 3ABLB 2EINC 3ZCCA 2IW5A 4BAYA 1VQPV 1M9NA 2R9IA 5HFMA 1WPXA 3DTUB 3AG3B 3GB7C 2H94A 4I9WA 3CMEV 4RQEA 2R9RB 3JD4A 3VOUA 4QJFB 1OCCB 4PDRA 5CBGA 1GM9A 3W7TA 1RPOA 4MVSA 4Q20A 2YEVA 3W7UA 1QCEA 2JEUA 4MVUA 1CPYA 3QO7A 2GHYA 1VQMV 3F5WC 3K04A 2LFSA 3CCSV 1V54B 1M56B 2ZXWC 3FB6C 3ZN1A 2DYSC 2DYSB 1P7BA 4GX1A 2IJKA 1K92A 3OM3B 2WLKA 2QEXV 4MTOA 3CCEV 1AR1B 2EIMB 3X2QC 2WPDG 2BOCC 4X88A 2F43G 2EIJC 2V7QG 3CYOA 5KUMA 1OHHG 1E1QG 1NH2D 2DW4A 3ML0A 1M90W 4R8CA 3W7XA 5DM6V 3IC7A 1GK9A 1G4YB 4XDJA 3ZJZA 4WFFA 1FFTB 4PA3A 4LCUC 5IY5C 5LHGA 3AG1B 4BW5A 2EIKB 1F4MA 4PDLA 1R3IC 2QM7A 2IJIA 3ABMC 2W0FC 1JVMA 4JYCA 1H38A 4R7CA 1FXKA 5CBHA 1AJPA 5DN6G 1H8EG 3G4SV 3CMAV 2OCCB 1F23A 2P67A 1KP2A 3K0GA 4FK5C 5B3SC 1S0VA 1PNMA 1EBOA 4H37A 2XOKG 2WLLB 4PELA 3STZC 2YEVB 2X6CA 3ABUA 3E83A 3SPIA 4KUMA 3SJQC 1HWYA 1AJQA 1AI6A 1PNKA 3FB7C 1GMGA 4UV8A 4E2LA 2Q69A 2K1EA 2QKSA 3ASNC 4RUEA 1P4RA 4P2ZA 4UVAA 3ZN0A 3E8HA 3OR7C 3ZMZA 2LP7A 1Y4MA 2NNUA 3F7YC 4WFAV 4GX0A 3E8GA 1V55B 3W7SA 3ETGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MOF A;  4FIP C;  3CP1 A;  1JPX A;  5HFL A;  5CMU A;  4N21 A;  1DF4 A;  5H9C A;  1I5Y A;  2EZO A;  3MHS C;  1K34 A;  1QCE A;  1MG1 A;  1SZT A;  2OT5 A;  3MHH C;  3H01 A;  2P6J A;  4JGS A;  2M7W A;  3M99 B;  4N23 A;  3P30 A;  4E2L A;  1ENV A;  1Y66 A;  1JQ0 A;  5HFM A;  3GWO A;  5KA5 A;  5CN0 A;  3B8M A;  3K9A A;  4JPR A;  1DLB A;  2LP7 A;  1QBZ A;  1Y4M A;  2EBO A;  4JF3 A;  2MK3 A;  2EZP A;  5KA6 A;  1QR8 A;  1I5X A;  1F23 A;  4G2K A;  3B8N A;  3WFV A;  3B77 A;  4FK5 C;  1QR9 A;  2X7R B;  1DF5 A;  3CYO A;  1EBO A;  1K33 A;  4FJC C; 
#chains in the Genus database with same CATH topology
 1XIL A;  4UUJ C;  3CP1 A;  3JSN A;  4QE7 A;  5CMU A;  1OCO C;  3OAA G;  2ILM A;  3HKC B;  5B3S B;  3M99 B;  5JJN B;  1BHB A;  2VQF B;  5KX5 B;  5JVD A;  4LFC B;  3ZX6 A;  1FXK B;  3K03 A;  2XHB A;  3ABT A;  4X20 B;  1Q8I A;  2HHH O;  2EIL B;  1GRJ A;  4B08 A;  2W6I G;  4RWU A;  3H9V A;  1Q43 A;  3C3T A;  4IIJ B;  1M1K W;  2E3C A;  1Q82 W;  4WFG A;  1D5N A;  4CS2 A;  1JFF B;  4I7Z B;  4J9Y B;  5IDJ A;  1HP8 A;  1UFI A;  4QIW F;  5B1B B;  5B1B C;  4FPP A;  3N2G A;  4PA7 A;  2Q0O C;  3JAK A;  4UCV A;  1XNR O;  4NB5 A;  5IYZ A;  3JAM N;  1S5H C;  4LF4 O;  2WA3 A;  5IT9 N;  3H1K H;  4O4J A;  2DYR C;  3WU2 Z;  4JPR A;  2QA4 V;  1SQG A;  2A79 B;  4QPJ A;  1HNW O;  4FLU A;  1VAR A;  1Y74 B;  2WAM A;  1YIT V;  3WB0 A;  4DV2 O;  4B3R B;  2O57 A;  1F51 A;  4KL1 A;  4ZBM A;  4DXW A;  3D8C A;  1AI4 A;  4G28 B;  3LSQ A;  3CD6 V;  4DUZ B;  4LC1 A;  2PUS A;  2GBO A;  1V54 C;  1ZSP A;  3JAR B;  4L87 A;  1NVP D;  4OX9 B;  4GT1 A;  2QWN B;  3UO3 A;  1OZ0 A;  2Q0A A;  4PA9 A;  1CEZ A;  3CCU V;  1THZ A;  3WFV A;  1YDX A;  3ZHS A;  1VMG A;  2PYJ A;  5HFL A;  5ITZ A;  3BCC H;  1A32 A;  3QG5 A;  3S3X A;  3K58 A;  1R3K C;  2WLJ A;  2PY5 A;  4NTW A;  3G71 V;  3JAR A;  2B9Z A;  3FAV A;  3L9D A;  3E2E A;  2G38 A;  2Q5Z A;  1GTO A;  4UCO A;  1K97 A;  1Z2G A;  5LL6 Y;  1SET A;  3U10 A;  4LF5 B;  3CRM A;  1B06 A;  4LH7 A;  2IJJ A;  3OFN G;  4HZ3 A;  3K5L A;  5EYP A;  1YJ9 V;  1Z5V A;  3Q4H B;  1F7Y A;  4ZHQ B;  4Q6G A;  1V55 C;  4MS2 A;  1L0L H;  3KCY A;  1GN4 A;  3APQ A;  5KHH A;  3OE7 G;  2QDO A;  4DV2 B;  4EFE A;  3BVO A;  4YJ3 B;  4IT5 A;  3L74 H;  4X89 A;  2YC0 A;  3AG4 C;  5JCO A;  1SRY A;  1SES A;  1COW G;  3HKD A;  2LGW A;  5JQG B;  5C8Y A;  5FNV B;  4TWK A;  4NYK A;  1OCZ B;  4K8Z A;  2HVJ C;  3P3N A;  5K1P A;  3SPG A;  2ZE7 A;  2WA4 A;  5KHJ A;  4FZ0 A;  3VQW A;  1WAZ A;  2YIC A;  2AXT Z;  4X66 B;  2XAS A;  3STL C;  4PA6 A;  5EC2 C;  3CCL V;  4G27 B;  4GZR B;  2E76 B;  2WLI A;  3OW2 U;  2JGD A;  1W0K G;  5BMV B;  1Q81 W;  2M7W A;  1VQN V;  3L75 H;  5E79 Z;  2WWW A;  3P32 A;  5B1O A;  3GWK C;  4PD4 F;  1IZ3 A;  2E5L O;  2LFR A;  2ZIN A;  4CS4 A;  1S5L Z;  2UXC B;  3NXS A;  4DUY O;  5CA1 A;  3Q4H A;  1Q3E A;  3SYO A;  2HFE C;  4WCE V;  2RNB A;  1I7F A;  1ZL8 A;  1S76 D;  5CN0 A;  3BY6 A;  4HYO A;  3T1H B;  4WFE A;  4UXN A;  4DR3 O;  2VQE O;  4X62 O;  4PA4 A;  5K1X A;  2Z3Y A;  4NXM B;  4FLX A;  4LF9 B;  4K8X A;  3JD3 A;  3RVZ A;  2IH1 C;  3OMN B;  1Y74 A;  1NH2 B;  3LDD A;  5B1A B;  3DSQ A;  2UUC O;  1HNZ O;  4JI8 O;  1XHX A;  3LSS A;  4MVZ A;  4O4H A;  4TV9 B;  1Q7Y W;  2WLM A;  2A9H A;  1SQQ H;  4JZG A;  2R72 A;  3JD0 A;  4RO2 A;  5LGU A;  5D5P A;  3B40 A;  3K79 A;  4DW0 A;  2BSK B;  3HB3 B;  2GSM B;  2CTR A;  3BAA A;  2UUB B;  3E22 B;  1KC8 W;  1VQ4 V;  1N4C A;  2Y0I A;  3OEH G;  5LA6 A;  3B8N A;  4LF4 B;  1SQV H;  3U0Z A;  4F6R B;  3RW0 A;  2DYR B;  3OD4 A;  1Q6U A;  4MVM A;  3K0D A;  5BR8 B;  3AG3 C;  4B3T B;  4X64 B;  1VQ5 V;  4MW8 A;  4BIZ A;  2Y69 B;  4X9Q A;  4DV6 O;  4QNH B;  1YJW V;  3K5O A;  4DV4 B;  1QLE C;  2QSA A;  2VS0 A;  4DR4 B;  4J7K A;  4X1K A;  3FYI B;  2OYQ A;  2DOS A;  1FXV A;  4P30 A;  3G6E V;  4HNA B;  2GUZ A;  1EZJ A;  2YDE A;  2ZKO A;  1IXM A;  2PZS A;  1OCZ C;  2CDY A;  3T2M A;  4PI2 A;  2DWD C;  4JI7 O;  3BA9 A;  3ABL B;  2EIN C;  2BTO A;  5JQG A;  4K3A A;  1YF2 A;  2Y4U A;  1D2D A;  1AP5 A;  3LNN A;  3DTU B;  3ICX A;  3AG3 B;  1MNG A;  2BTQ A;  3GB7 C;  4TUY B;  4EB6 A;  4Z2W A;  1XMO O;  4I9W A;  4TV8 A;  3JD4 A;  3SGI A;  1RPO A;  1KKC A;  1B04 A;  4B3M B;  2VRZ A;  4AIL C;  2YEV A;  4FM0 A;  1H2K A;  2LJ2 A;  5JH7 B;  2CUG A;  3CCS V;  3ZN1 A;  4X1Y B;  1P7B A;  4GX1 A;  4DV7 O;  2IJK A;  5FLX N;  3CCE V;  1AR1 B;  2WPD G;  4X88 A;  2EIJ C;  4O4H B;  4BWA A;  1NH2 D;  2DW4 A;  4PJ0 Z;  4R8C A;  3IC7 A;  2EIK B;  1F4M A;  4PDL A;  3BRC A;  1PP9 H;  1BS3 A;  1FXK A;  5CBH A;  1AJP A;  2DMX A;  4IYH A;  4JI4 O;  4O2A A;  1O9H A;  3JAT A;  1XOU A;  1PNM A;  5B3S C;  3P3P A;  4CH3 A;  2XOK G;  2WLL B;  4X1K B;  5F2V O;  4DR2 B;  2P5O A;  2YID A;  3KKY A;  1HWY A;  4KUM A;  1WB7 A;  1N0N A;  1JFF A;  2K1E A;  2MW2 B;  4P2Z A;  3ZN0 A;  1ZLZ A;  4LWS A;  3JAT B;  2NNU A;  4WFA V;  3W7S A;  4B3T O;  4J42 A;  4JV5 O;  1H2N A;  1MOF A;  4JAA A;  4DR2 O;  2OCC C;  3OGC C;  2W6J G;  3AG7 A;  3H1J H;  3K06 A;  1VQ6 V;  4X1I B;  3E86 A;  2XAJ A;  3T4Z A;  3CHX A;  1QR8 A;  3LUT B;  4XBF A;  5C8Y B;  4WFB V;  3UCS C;  3RYI B;  4U7O A;  2VQF O;  4O2B A;  1NS1 A;  5KHI A;  4H0L B;  3N2K A;  2E5L B;  2JS3 A;  3ETD A;  1GO3 F;  3P30 A;  5KHK A;  2PI5 A;  1Y66 A;  4JTC B;  2NN4 A;  3J7A U;  1X4T A;  2BOB C;  1K5S A;  4GKJ O;  3ZHR A;  4CC6 A;  2PI4 A;  1K33 A;  1PNL A;  1OCC C;  1EM1 A;  2YIA A;  3BA8 A;  4GKK B;  2HR3 A;  3BPZ A;  4DK1 A;  2DQ3 A;  4MVO A;  3UM7 A;  4BR6 A;  3H1H H;  5H6R A;  4D7T A;  3DC6 A;  1IVS A;  2ETN A;  3OMI B;  2NLJ C;  5H2F Z;  2HEP A;  3JD1 A;  4RUF A;  3LSU A;  1H2L A;  4IL6 Z;  5EYP B;  2BE3 A;  5GTI Z;  4UV9 A;  4DYL A;  1YHQ V;  4DV5 O;  3SPH A;  2UXC O;  1US6 A;  1QLE B;  3KG2 A;  5IYC O;  3CSX A;  5GON B;  1KBH A;  4MVQ A;  1YTF B;  1J5E B;  4YHH B;  1LR1 A;  3EXA A;  3IGA C;  4XDK A;  4PDV A;  3PJS K;  4I9Q A;  4JYA B;  4FM1 A;  4KHP O;  2H8P C;  2FL4 A;  2Q67 A;  5L3F A;  2EZP A;  1EN5 A;  1NR7 A;  3ZRW B;  2JJ1 G;  3A0B Z;  2Y69 C;  5LHH A;  4FLT A;  5J9P C;  4J9Z B;  3G80 A;  4LF7 O;  3JSL A;  2A06 H;  4GYC B;  3R66 A;  1FKA O;  2ZNJ A;  1JJO A;  2JEX A;  4TOI A;  1K5Q A;  3GVM A;  4GUN A;  1NT2 B;  3E35 A;  5EBL C;  2EIL C;  1IUR A;  5J2T A;  1KKD A;  3QF7 A;  4I50 B;  4UCT A;  1HDJ A;  1S3J A;  5LHI A;  3SYC A;  1U97 A;  2CH7 B;  2V1D A;  4LFA O;  4A5U B;  4GCZ A;  4WFH A;  3CRQ A;  1YI2 V;  1JR9 A;  2ITD C;  2WLI B;  5KLV H;  2B5U A;  1QVF U;  5IJ0 A;  1SQP H;  4ZHQ A;  3E8B A;  3O65 A;  4L8J A;  5EC1 C;  2EIJ B;  1XMQ B;  2Z5U A;  3TK1 A;  2Q6A A;  3CEI A;  3CS5 A;  1IX9 A;  2VWJ A;  4BW9 A;  3OGI B;  5GW7 A;  5IE9 A;  3JAW A;  3HKE A;  2HP8 A;  3WB2 A;  2JRI A;  4CZZ A;  4LFB O;  3B77 A;  2QWP B;  1KU9 A;  1NQT A;  2CE4 A;  3CE2 A;  3FYE B;  4DV7 B;  1IDS A;  1IBM B;  5BR8 O;  5B66 Z;  5JWP A;  2EZO A;  3DXR A;  4MTX A;  2JK5 C;  1I0H A;  4X1Y A;  5CA0 B;  1RM1 C;  4JGS A;  4UVB A;  5B5E Z;  4B3M O;  2YI8 A;  1WA8 B;  3FKS G;  2N05 A;  4IHJ B;  1SQB H;  2EBO A;  3G6B A;  2QTS A;  2ZM6 B;  1NTZ H;  3D3I A;  2OCH A;  1SKV A;  1NVP B;  1R6K A;  1FXK C;  1PV0 A;  2D2C B;  4TSF G;  1AVM A;  1I5Y A;  4JI7 B;  2FML A;  4JI2 O;  1I94 O;  4B7K A;  2OTJ V;  5LXT A;  1FXH A;  3CX5 F;  3D36 A;  4Z1M G;  3RYC B;  3UQ8 A;  1R6T A;  4O4L A;  1G1X B;  1BHA A;  1E79 G;  2ZE6 A;  2HJF C;  2YXL A;  3AG1 C;  5B1A C;  1U96 A;  1KEC A;  3K9S A;  4FZ1 A;  4QPK A;  1KB9 F;  4DV0 B;  4DR3 B;  3FB8 C;  2QWR B;  2XAQ A;  1BT8 A;  2ZDI C;  5BY1 A;  2RJZ A;  4DR1 B;  4I0X A;  3ETE A;  1G6U A;  5GTH Z;  5A9G A;  4YY3 B;  1V9P A;  1N32 O;  4KP4 A;  3RYF A;  2DWE C;  2IU0 A;  3JCZ A;  1Q6H A;  4JYB A;  5IY5 B;  5H9C A;  3D3Q A;  1GN6 A;  3C3S A;  3LDE A;  1GKF A;  4CC5 A;  1AI7 A;  1MZE A;  4H13 B;  1K9M W;  4R50 A;  4CBC A;  2PGG A;  2QM4 A;  2HHH B;  3CCQ V;  1NKD A;  3FX7 A;  3HKC A;  1Q6I A;  4J7J A;  4UB8 Z;  5BZB A;  4O4I B;  1EN4 A;  4PDM A;  1MSW D;  5KAI Z;  2MK3 A;  4G2K A;  1AJN A;  4KFM A;  5LXT B;  3ZHQ A;  3ABL C;  1N33 O;  4RAI A;  4LF6 O;  3UT5 A;  2ZQM A;  1DTO A;  2QR4 A;  1ORQ C;  1K8A W;  2OT5 A;  1IBK B;  2UXB B;  2PTM A;  3H1I H;  3AG2 C;  3CRA A;  1IXB A;  1VF6 C;  2B1I A;  2Y48 A;  2AGA A;  2IJH A;  2ZT9 B;  5EBW C;  3CCM V;  3K9A A;  1XUQ A;  4ASU G;  4JI5 O;  4QE9 A;  4DR1 O;  1HNX B;  3ABK B;  5FL7 G;  1BL8 A;  4O2A B;  1PD3 A;  2CTP A;  5JJJ B;  1KQS U;  4EEQ A;  1S77 D;  2VWK A;  3SJB C;  2WLL A;  1H2M A;  1FAF A;  3OTO B;  4BAY A;  5HFM A;  1WPX A;  4AQY O;  4HBN A;  4CS3 A;  4DK0 A;  5LP6 A;  4KHP B;  1UPG A;  5JVD B;  2H94 A;  4ICG A;  1CXZ B;  3VOU A;  3W7T A;  1GM9 A;  4Q20 A;  1EZV H;  1XNR B;  2JEU A;  4MVU A;  3QO7 A;  1VQM V;  4DRX A;  4FFB A;  1AIL A;  1M56 B;  1K92 A;  3OM3 B;  4F6E A;  2WLK A;  2QEX V;  4MTO A;  4DV1 B;  5D5Q A;  4DR7 O;  5KUM A;  2YUA A;  4B3R O;  5IJ9 B;  3ML0 A;  3OTF A;  2P22 C;  5DM6 V;  1GK9 A;  3G67 A;  1JA8 A;  5IY5 C;  4BW5 A;  1RSO A;  1R3I C;  1RFY A;  2W0F C;  4TV9 A;  1EN6 A;  2AZ0 A;  1H38 A;  5LOV A;  4R7C A;  1H8E G;  4O4I A;  5IWA O;  3CMA V;  2OCC B;  3TGU H;  3K0G A;  2Q7G A;  1I94 B;  5TIS Z;  4UCU A;  3STZ C;  1Y76 A;  4I0X B;  4K0K B;  2X6C A;  3ABU A;  5FPR A;  4TQD A;  3SPI A;  1AJQ A;  2KG7 B;  1AI6 A;  1PNK A;  1GMG A;  4E2L A;  1BCC H;  3HKB A;  4UVA A;  4RUE A;  1RP3 B;  2QKS A;  2Q8V A;  3ZMZ A;  4U3J A;  1Y4M A;  3RGB A;  2N04 A;  4GKK O;  5CA1 B;  2P7T C;  4DUZ O;  1Y76 B;  1IBM O;  5BXZ A;  5KUK A;  4J80 A;  1X59 A;  3RN4 A;  3B8M A;  1GH6 A;  3SR2 C;  2XAG A;  4U3J B;  3FFQ A;  4JF3 A;  2UUA O;  3SYP A;  4JI2 B;  2PF4 E;  2V4D A;  5LGT A;  1OV9 A;  1S5J A;  2UXB O;  3ABK C;  3A2F A;  3M8A A;  1J5E O;  3W7W A;  3OUF A;  3CRR A;  1VQK V;  4P9O A;  4JAU A;  1VEW A;  5IYD O;  1RM1 B;  2ZE8 A;  2EJ7 A;  1XQ8 A;  1NJI W;  3FD9 A;  5AG2 A;  1DLB A;  2XUM A;  4EKW A;  2HG5 C;  3TJT A;  2CGN A;  1AI5 A;  1K3E A;  4J41 A;  3D36 C;  4DO2 A;  1NI8 A;  1GN3 A;  2LO1 A;  5KHG A;  1ZAU A;  1SS3 A;  5DED A;  4DR6 B;  2ZE5 A;  4JZ2 A;  2QJ1 A;  4X20 A;  1MZF A;  4IIJ A;  3IAY A;  3HKB B;  4F4L A;  5LYJ A;  3AG2 B;  4X65 O;  4GLX A;  2X7R B;  2Q4P A;  1XI1 A;  2E74 B;  4JI1 B;  1Q90 D;  2GDS A;  3CCR V;  1M57 C;  3RWR D;  4DUY B;  2IH3 C;  5KMG B;  1FD9 A;  1M56 C;  4DV5 B;  4MTF A;  2IBZ H;  5CA0 A;  1G8M A;  2BTQ B;  4EB6 B;  1R3L C;  4XDL A;  3EHB B;  2ZIO A;  3RYF B;  4EFB A;  3NR7 A;  5IYZ B;  3BHP A;  3ZRV A;  1YJN V;  3A8T A;  1Y6X A;  2ADQ B;  1MAB G;  2ADP A;  2X0L A;  4CH6 A;  2EJR A;  2F23 A;  1B6Q A;  4N23 A;  1L1F A;  1NTK H;  3ZMS A;  1S72 V;  4JTD B;  3ASO C;  4I5S A;  3THO A;  2Y4T A;  4JI5 B;  5L3B A;  2GV9 A;  3KZI Z;  3A0R A;  4I55 B;  3ZRS A;  2F4V B;  1Q5O A;  1E1R G;  1TVK B;  1TUB A;  1XEQ A;  5CB4 A;  2ZR3 A;  3H01 A;  1N36 O;  1Y67 A;  5EK0 A;  1YCI A;  3JCU Z;  2ZM6 O;  2HVK C;  1AP6 A;  1NU1 H;  4ZIB A;  2K9P A;  2QGN A;  1AB3 A;  3UO2 A;  3OUS A;  4I55 A;  4JTA B;  2CTW A;  2C2A A;  2KQX A;  2UXD O;  5LP6 C;  1TUB B;  2OIG A;  1KYO F;  1L8D A;  3RBZ A;  3AK1 A;  1PL0 A;  5LBQ A;  4MVR A;  4YXW G;  5KMG A;  1W0J G;  1WB8 A;  2AW9 A;  1WA8 A;  1P7G A;  5FNV A;  4HAM A;  1BZK A;  2Q7H A;  1ZWI C;  4B7E A;  3LNM B;  5LYJ B;  2JIZ G;  4DR5 B;  4FJC C;  3ZHV A;  5EIB D;  3A0H Z;  1YTF D;  5B1N A;  1R73 A;  3SYA A;  2XAH A;  2KKW A;  4JYY A;  3HKD B;  4KXR A;  2OTL V;  5L3C A;  5KA5 A;  1YXB A;  1DK1 A;  2DJV A;  5L3D A;  3TET A;  3IFX A;  2YIB D;  1L0N H;  3OTO O;  3I5D A;  2H3O A;  2ZDI A;  3FB5 C;  4OPH A;  1LUV A;  2DQ0 A;  2P90 A;  3I56 V;  2FYU H;  3SDL A;  1M57 B;  4H33 A;  1R6N A;  3FAV B;  1H2S B;  2X6B A;  3ZRW A;  3J80 N;  4LH6 A;  1XMQ O;  1I5X A;  1GAX A;  1J95 A;  1VQL V;  4J7Z A;  2A7W A;  3MD0 A;  3L73 H;  1JPX A;  3E22 A;  1AR4 A;  3MHS C;  2LW7 A;  3S3W A;  2KB1 A;  3AG4 B;  5EIB C;  4X8A A;  4YJ3 A;  5LMU O;  1NZ6 A;  2EIK C;  2JDI G;  3EFF K;  1NTM H;  3ASN B;  1SF9 A;  5H6Q A;  3SJA C;  2D3O W;  3BAB A;  4NKG B;  2HJD A;  2ZR2 A;  2YSU B;  3K57 A;  5LMU B;  4ZI7 B;  5C93 A;  1DGS A;  3U11 A;  4JAV A;  1MG1 A;  1LUW A;  1VF6 A;  2WLN A;  4JI3 O;  2Q68 A;  2BCC H;  1XNQ O;  3JYC A;  5FPO A;  1JOY A;  2EX3 A;  4FFB B;  1GM8 A;  4IYI A;  2AHZ A;  4DR4 O;  3O9O A;  4YHH O;  2QTO A;  2JGU A;  4O4J B;  4JI8 B;  3DGE A;  3ZS8 C;  2R9A A;  2UXX A;  3HR0 A;  1Q86 W;  3N2G B;  1BSM A;  2A3Q A;  1W59 A;  2IU3 A;  3JAS A;  3WG7 C;  3WG7 B;  3M7M X;  2YIB A;  4OXS A;  4DW1 A;  2UXN A;  4U3F H;  2AZ2 A;  4LF5 O;  1N33 B;  1RSO B;  1M4U A;  2Q7E A;  3T1C A;  3RFR A;  2B1G A;  3ZMV A;  4BIU A;  4PV1 B;  5LOV B;  1K73 W;  1VQ8 V;  3ZRX A;  2KSD A;  3CXC U;  2QM8 A;  2CH7 A;  2FB5 A;  3QTC A;  3SYQ A;  4JI6 B;  1SC5 B;  1XHZ A;  1JJ2 U;  3CPW U;  5IYB O;  4X65 B;  1YVW A;  4UVC A;  4MTG A;  1BGY H;  2QWO B;  3ZCC A;  2IW5 A;  1VQP V;  2R9I A;  5EZY A;  4CH5 A;  3CME V;  2F93 B;  1SQX H;  3F5T A;  4JYA O;  4PDR A;  5A2Q N;  3OT7 A;  3K59 A;  1XNQ B;  1CPY A;  1HR0 O;  2LFS A;  3MDS A;  3FB6 C;  5JCO C;  1FYJ A;  2DYS B;  2UUB O;  4NXN B;  3RT3 C;  4X66 O;  2EIM B;  3T1H O;  4ABM A;  2R70 A;  3X2Q C;  3T1Y B;  2V7Q G;  3CYO A;  4ZI7 A;  1AR5 A;  2CGO A;  4DV3 O;  4DV0 O;  2UU9 B;  4TUY A;  2YS8 A;  1FFT B;  2P4V A;  4YJ2 A;  3CRC A;  2QKA A;  2QM7 A;  2IJI A;  1HNZ B;  2F1M A;  1FJG B;  1JVM A;  4AHC A;  1ZTE A;  3G4S V;  1F23 A;  2P67 A;  4B3S B;  1KP2 A;  4FK5 C;  1S0V A;  5JH7 A;  3B2E E;  4JI3 B;  1EBO A;  4JI6 O;  2YXY A;  4H37 A;  4PEL A;  3JAS B;  2IM9 A;  4E4E A;  2M6Y A;  3SJQ C;  4JI4 B;  3EVK A;  2XT9 A;  4YY3 O;  3ASN C;  1P4R A;  3E8H A;  3OR7 C;  1M5I A;  2QKC A;  3JAW B;  5EZY B;  4ZOL B;  5DEC A;  4GX0 A;  3E8G A;  3PN1 A;  3ETG A;  2XND G;  5CB4 B;  3ZIA G;  3K08 A;  2L35 A;  4RQF A;  1HR0 B;  3VQX A;  3K3W A;  1FFX B;  3CCJ V;  1VQ7 V;  4JV5 B;  1WLE A;  1JQ0 A;  5EBM C;  3N2K B;  1KD1 W;  1WN7 A;  3CCV V;  2ZIM A;  4GKJ B;  1GN2 A;  1JMK C;  4LNU B;  4LFB B;  1TA8 A;  5J2T B;  3E8F A;  4YIO A;  1BMF G;  2CAZ C;  1N8R W;  4F6R A;  4LP8 A;  4JAS A;  3VBB A;  1K4D C;  2JVD A;  4I4T B;  1TAE A;  1MMM A;  1YSC A;  1XDC A;  2QE7 G;  5LP6 B;  1OCR B;  3OMA B;  4DV3 B;  4GX2 A;  2FKX A;  2F95 B;  3B4S A;  2ARH A;  4MW3 A;  4NXM O;  3GWO A;  3HPL C;  2VQE B;  1HNW B;  5KA6 A;  3CXH F;  1QNM A;  3VQY A;  4WBN B;  2CK3 G;  1VQ9 V;  4LBE C;  4PHZ A;  3OR6 C;  1WP8 A;  4N21 A;  1N36 B;  1PL4 A;  1XL4 A;  1K34 A;  5L3E A;  1W2B U;  5CBF A;  5JJE B;  3IJ4 A;  2Y0P A;  3MHH C;  3ZED A;  2AHY A;  4WF9 V;  3I55 V;  4YJ2 B;  3KCX A;  2JGD B;  4O2B B;  4DV6 B;  2ZCE A;  5CA3 A;  1SZX A;  4R6Z A;  4OX9 O;  1ZUQ A;  4NTX A;  4WBN A;  5E1A C;  5J2U A;  4CH4 A;  5LGN A;  1N34 B;  5LA6 B;  4UB6 Z;  4UCR A;  2HKO A;  3QO5 A;  4LF9 O;  3QO8 A;  4NVP A;  3K5M A;  2BSK A;  3L70 H;  2LGQ A;  4OGQ B;  5IJ0 B;  4BIO A;  1VF5 B;  4MSW C;  1F4N A;  1QBZ A;  5H5N A;  3X2Q B;  2XTA A;  1VIB A;  2ZD9 A;  1I08 A;  2LQT A;  3SPJ A;  1K4C C;  1DF5 A;  4ZOL A;  4FMT A;  3CJH B;  4DR5 O;  1SER A;  2QWQ B;  3JAK B;  1M93 A;  2F4V O;  1N32 B;  2RMK B;  2E75 B;  2P6J A;  4X1I A;  3ZMT A;  5IWA B;  3BEH A;  3DC5 A;  3OEE G;  2CTQ A;  1ZX3 A;  4FLV A;  1QQC A;  1SA0 B;  2Z0A A;  1B3Q A;  2ZNI A;  4K35 A;  4DV4 O;  2HLD G;  5KAF Z;  4DRX B;  4ZKI A;  1XRE A;  3CC2 V;  3J81 N;  1FS0 G;  1JX9 A;  1TGO A;  2YXH A;  2OWO A;  1T5E A;  3AK2 A;  3SJC C;  4LF8 O;  3C90 A;  1XL6 A;  4J11 A;  4MT8 A;  4W4K A;  5KX5 A;  2ODM A;  5IJ9 A;  3E89 A;  1BE3 H;  2DE0 X;  3R65 A;  4GX5 A;  4NXN O;  1KP3 A;  2EIN B;  2ATK C;  4Z1V A;  3RYC A;  1R3J C;  1IBK O;  1SZT A;  4FLW A;  2OIE A;  1Z5W A;  1TUE B;  2RQ6 A;  1MSD A;  3BFR A;  1H8H G;  1ENV A;  2X6A A;  2WLH A;  2A0L A;  4AQY B;  4LR3 A;  4FVM A;  1URF A;  1ARO P;  1O9G A;  1WP7 A;  1FJG O;  1PKX A;  4O4L B;  2ITC C;  4FIP C;  1VF7 A;  3F7V C;  1QHT A;  1DF4 A;  4LNU A;  3HKE B;  3UT5 B;  2UU9 O;  1KMI Z;  4HNA A;  3H1L H;  1JCH A;  3ZBH A;  2GTA A;  1YZB A;  4LFC O;  2RN9 A;  4JI0 B;  3SPC A;  3JD2 A;  2Q73 A;  4TT3 G;  3T4D A;  3QVN A;  4JI1 O;  4P9P A;  1H2G A;  1SQF A;  2XAF A;  2ZXW B;  4D6T H;  2NR5 A;  1BQ0 A;  2JJ2 G;  1WNS A;  2Q9L A;  2EIM C;  3L72 H;  3RVY A;  3AEI A;  4X64 O;  1SA0 A;  4IGG A;  4LF7 B;  1YEW A;  5GON A;  3JAL B;  4QGP A;  3K5N A;  3LDC A;  3ABM B;  5J2U B;  2KG7 A;  5LMN B;  3ASO B;  3CB2 A;  1TVK A;  1OCR C;  1XMO B;  4I4T A;  1QVG U;  2WSS G;  3TXQ A;  3RYI A;  3CC4 V;  1WPB A;  1ROP A;  3JAL A;  3ETQ A;  1OCO B;  2F66 C;  1GM7 A;  1NBM G;  2LW1 A;  4OPA A;  3B09 A;  1QLN A;  1VQO V;  4YIP A;  3ZHU A;  4JI0 O;  2EUL A;  2GTS A;  2FTK A;  1D5A A;  4FFK A;  3CC7 V;  4C7U A;  3RYH A;  4NR1 A;  3ZMU A;  1IBL B;  4FM2 A;  1RPR A;  3QNE A;  2PYL A;  4U7N A;  1EFR G;  3UKM A;  3MAQ A;  1YIJ V;  4D7S A;  1IBL O;  3WB1 A;  4DV1 O;  1HNX O;  2P06 A;  1NR1 A;  1CP9 A;  3CWB H;  1K7D A;  1QR9 A;  4K0K O;  3TCU A;  5L3G A;  1KUQ A;  1UJW B;  1XBL A;  2RCV A;  1R1B A;  1VP7 A;  4UCS A;  1LNQ A;  4LF6 B;  1FPO A;  1M9N A;  1WJZ A;  3N27 A;  5BMV A;  4TV8 B;  4B3S O;  1PM9 A;  2L6L A;  1P84 F;  3CJH A;  2UUC B;  4RQE A;  2R9R B;  2RDC A;  4W4L A;  1OCC B;  4QJF B;  5CBG A;  4I50 A;  4MVS A;  1P49 A;  3TXS A;  3W7U A;  4FLZ A;  1HW7 A;  1QCE A;  2W0X A;  1OJH A;  1N34 O;  2GHY A;  4DR6 O;  1PPJ H;  3F5W C;  4DR7 B;  3K04 A;  2UXD B;  4TQF A;  1V54 B;  2ZXW C;  3T1Y O;  2DYS C;  1FFX A;  1MA1 A;  4FLY A;  1QU7 A;  4X62 B;  4UFZ A;  2JS5 A;  5ITZ B;  1ZL8 B;  2DN9 A;  2BOC C;  2F43 G;  1OHH G;  1E1Q G;  3RYH B;  1M90 W;  3W7X A;  3IC9 A;  3VQV A;  1G4Y B;  2P4K A;  3AK3 A;  4XDJ A;  3ZJZ A;  4WFF A;  4PA3 A;  4LCU C;  5LHG A;  4LFA B;  3AG1 B;  3ABM C;  5LMN O;  2UUA B;  4JYC A;  5DN6 G;  3ZHT A;  2GUZ B;  2N74 A;  4LF8 B;  3DXR B;  2YEV B;  2YI9 A;  3E83 A;  3APO A;  4H44 B;  3FB7 C;  4UV8 A;  3L71 H;  2Q69 A;  4LWS B;  2LP7 A;  4IHJ A;  4J10 A;  1N0J A;  4NTY A;  1BQZ A;  4AI8 A;  3F7Y C;  4PI0 A;  1V55 B; 
#chains in the Genus database with same CATH homology
 2XND G;  1MOF A;  4UUJ C;  3CP1 A;  4QE7 A;  2P7T C;  5CMU A;  3K08 A;  3ZIA G;  1OCO C;  4RQF A;  3OAA G;  2OCC C;  3OGC C;  2W6J G;  3K3W A;  5KUK A;  3CCJ V;  3K06 A;  5B3S B;  1VQ6 V;  3M99 B;  1VQ7 V;  1BHB A;  1WLE A;  1JQ0 A;  5EBM C;  1KD1 W;  3CCV V;  3B8M A;  3E86 A;  2XAJ A;  2XAG A;  3T4Z A;  1FXK B;  3K03 A;  4JF3 A;  3E8F A;  1QR8 A;  3LUT B;  3SYP A;  1BMF G;  4XBF A;  1N8R W;  3ABT A;  4LP8 A;  4WFB V;  5LGT A;  4U7O A;  4JAS A;  2EIL B;  3VBB A;  1K4D C;  2W6I G;  3ABK C;  3W7W A;  1YSC A;  3OUF A;  1M1K W;  2QE7 G;  1OCR B;  3OMA B;  1Q82 W;  4GX2 A;  4WFG A;  1VQK V;  3ETD A;  1GO3 F;  4JAU A;  4P9O A;  3P30 A;  4MW3 A;  5IYD O;  1Y66 A;  4JTC B;  4J9Y B;  3GWO A;  5IDJ A;  1RM1 B;  2PI5 A;  3HPL C;  1NJI W;  1DLB A;  4EKW A;  2HG5 C;  2BOB C;  4QIW F;  5B1B C;  1K5S A;  5B1B B;  1AI5 A;  5KA6 A;  1K3E A;  4DO2 A;  4FPP A;  2CK3 G;  2PI4 A;  1VQ9 V;  4LBE C;  4PA7 A;  1K33 A;  3OR6 C;  1PNL A;  1OCC C;  4N21 A;  1XL4 A;  1K34 A;  5L3E A;  1W2B U;  5CBF A;  3MHH C;  2HR3 A;  2AHY A;  2DQ3 A;  1S5H C;  4MVO A;  4WF9 V;  3UM7 A;  3I55 V;  5H6R A;  2DYR C;  3OMI B;  2NLJ C;  4JPR A;  2QA4 V;  3JD1 A;  4RUF A;  2A79 B;  4QPJ A;  5CA3 A;  4R6Z A;  4F4L A;  3AG2 B;  5E1A C;  2WAM A;  2X7R B;  4UV9 A;  5LGN A;  1YHQ V;  3SPH A;  1YIT V;  1QLE B;  3CCR V;  3KG2 A;  1M57 C;  2HKO A;  1F51 A;  2IH3 C;  5IYC O;  4ZBM A;  4DXW A;  1AI4 A;  4G28 B;  4MVQ A;  1YTF B;  3LSQ A;  3CD6 V;  3QO5 A;  4LC1 A;  3QO8 A;  1V54 C;  1M56 C;  4L87 A;  4MTF A;  3IGA C;  4XDK A;  4PDV A;  1G8M A;  3PJS K;  1NVP D;  4GT1 A;  2H8P C;  2Q67 A;  1OZ0 A;  1R3L C;  1F4N A;  1QBZ A;  3EHB B;  4MSW C;  4XDL A;  4PA9 A;  5L3F A;  2EZP A;  1CEZ A;  3CCU V;  3X2Q B;  2ZD9 A;  1THZ A;  1NR7 A;  3ZRW B;  3WFV A;  2JJ1 G;  3SPJ A;  1K4C C;  2Y69 C;  3ZRV A;  1DF5 A;  4FMT A;  5LHH A;  1YJN V;  5HFL A;  5J9P C;  1SER A;  1MAB G;  4J9Z B;  1R3K C;  2X0L A;  2WLJ A;  2P6J A;  2EJR A;  3G71 V;  1B6Q A;  4N23 A;  2JEX A;  3ZMT A;  1K5Q A;  1L1F A;  3ZMS A;  1S72 V;  3BEH A;  3OEE G;  4JTD B;  3E2E A;  3E35 A;  3ASO C;  1GTO A;  2EIL C;  4I5S A;  5EBL C;  1KKD A;  1K97 A;  1SET A;  1S3J A;  5LHI A;  3SYC A;  5L3B A;  2IJJ A;  3OFN G;  4HZ3 A;  3A0R A;  3ZRS A;  2V1D A;  1YJ9 V;  4GCZ A;  2HLD G;  4WFH A;  4ZKI A;  1E1R G;  1YI2 V;  1V55 C;  2ITD C;  2WLI B;  4MS2 A;  2B5U A;  1QVF U;  3CC2 V;  3E8B A;  3OE7 G;  2ZR3 A;  1FS0 G;  3H01 A;  1JX9 A;  5EK0 A;  5EC1 C;  2EIJ B;  2Z5U A;  3TK1 A;  2Q6A A;  4X89 A;  5GW7 A;  1XL6 A;  2HVK C;  3AG4 C;  4MT8 A;  4CZZ A;  1SRY A;  1SES A;  3E89 A;  1COW G;  3B77 A;  1NQT A;  3OUS A;  3R65 A;  3FYE B;  4GX5 A;  1KP3 A;  4JTA B;  2EIN B;  2C2A A;  4TWK A;  2ATK C;  1OCZ B;  2EZO A;  1R3J C;  4MTX A;  2HVJ C;  1SZT A;  3RBZ A;  2JK5 C;  1TUE B;  1RM1 C;  4JGS A;  3SPG A;  4UVB A;  1PL0 A;  1H8H G;  1ENV A;  2X6A A;  5LBQ A;  3FKS G;  2WLH A;  4MVR A;  4YXW G;  1W0J G;  2EBO A;  2A0L A;  3D3I A;  2XAS A;  4HAM A;  3STL C;  1ARO P;  4PA6 A;  5EC2 C;  1ZWI C;  3CCL V;  1NVP B;  4G27 B;  1R6K A;  3LNM B;  1PKX A;  2JIZ G;  2ITC C;  4FJC C;  4FIP C;  3F7V C;  1FXK C;  1DF4 A;  4TSF G;  1I5Y A;  1YTF D;  5B1N A;  2WLI A;  3OW2 U;  1R73 A;  1W0K G;  3SYA A;  2XAH A;  1Q81 W;  2M7W A;  1JCH A;  2OTL V;  2OTJ V;  5L3C A;  1FXH A;  3D36 A;  1VQN V;  5KA5 A;  2WWW A;  4Z1M G;  5L3D A;  3SPC A;  3TET A;  3IFX A;  3JD2 A;  3P32 A;  5B1O A;  4TT3 G;  1BHA A;  1E79 G;  2ZDI A;  3FB5 C;  2HJF C;  3T4D A;  3AG1 C;  2DQ0 A;  2LFR A;  2P90 A;  3I56 V;  5B1A C;  1KEC A;  3NXS A;  4P9P A;  1M57 B;  1H2G A;  4H33 A;  4QPK A;  2XAF A;  1R6N A;  2ZXW B;  3FB8 C;  3SYO A;  2JJ2 G;  2HFE C;  2X6B A;  3ZRW A;  4WCE V;  1S76 D;  2XAQ A;  5CN0 A;  2ZDI C;  3BY6 A;  4HYO A;  4WFE A;  4UXN A;  3ETE A;  1I5X A;  1J95 A;  2EIM C;  1VQL V;  4PA4 A;  3MD0 A;  3RVY A;  3AEI A;  2Z3Y A;  4KP4 A;  2DWE C;  2IU0 A;  3JCZ A;  1JPX A;  4JYB A;  5IY5 B;  5H9C A;  3MHS C;  3JD3 A;  2KB1 A;  3RVZ A;  3LDC A;  3AG4 B;  2IH1 C;  4X8A A;  3OMN B;  3ABM B;  3LDE A;  1GKF A;  1NH2 B;  2EIK C;  2JDI G;  3EFF K;  3LDD A;  3ASN B;  1AI7 A;  5B1A B;  5H6Q A;  2D3O W;  3ASO B;  1OCR C;  2ZR2 A;  2YSU B;  1K9M W;  3LSS A;  4MVZ A;  1Q7Y W;  2WSS G;  4R50 A;  1QVG U;  4CBC A;  2WLM A;  3CC4 V;  5C93 A;  2A9H A;  3JD0 A;  4RO2 A;  5LGU A;  1ROP A;  1OCO B;  4JAV A;  1MG1 A;  3K79 A;  1GM7 A;  1NBM G;  2WLN A;  3CCQ V;  2Q68 A;  3JYC A;  1QLN A;  1VQO V;  1JOY A;  1NKD A;  3HB3 B;  2GSM B;  1GM8 A;  5BZB A;  2AHZ A;  2FTK A;  3CC7 V;  4PDM A;  1MSW D;  1KC8 W;  1VQ4 V;  2MK3 A;  2QTO A;  3OEH G;  3DGE A;  4G2K A;  1AJN A;  3B8N A;  4KFM A;  3ZMU A;  2UXX A;  3ABL C;  1Q86 W;  1RPR A;  3QNE A;  3RW0 A;  4RAI A;  2DYR B;  2IU3 A;  4MVM A;  3K0D A;  3WG7 B;  4U7N A;  2ZQM A;  3AG3 C;  3WG7 C;  1EFR G;  1DTO A;  3UKM A;  1ORQ C;  1YIJ V;  4OXS A;  2OT5 A;  1K8A W;  1VQ5 V;  4MW8 A;  4BIZ A;  2UXN A;  3AG2 C;  2Y69 B;  4QNH B;  1YJW V;  2B1I A;  2Y48 A;  1QLE C;  2IJH A;  3CCM V;  5EBW C;  3T1C A;  3K9A A;  4ASU G;  2B1G A;  3ZMV A;  4BIU A;  1NR1 A;  1CP9 A;  3FYI B;  1K73 W;  1K7D A;  4QE9 A;  1VQ8 V;  3ZRX A;  3CXC U;  1FXV A;  2QM8 A;  4P30 A;  1QR9 A;  3G6E V;  3ABK B;  1EZJ A;  1BL8 A;  5FL7 G;  3TCU A;  5L3G A;  1PD3 A;  1IXM A;  3SYQ A;  1UJW B;  1OCZ C;  1KQS U;  1S77 D;  3T2M A;  1JJ2 U;  3CPW U;  2WLL A;  5IYB O;  2DWD C;  4UVC A;  1LNQ A;  4MTG A;  3ABL B;  2EIN C;  3ZCC A;  2IW5 A;  4BAY A;  1VQP V;  1M9N A;  2R9I A;  5HFM A;  1WPX A;  3DTU B;  3AG3 B;  3GB7 C;  2H94 A;  4I9W A;  3CME V;  4RQE A;  2R9R B;  3JD4 A;  3VOU A;  4QJF B;  1OCC B;  4PDR A;  5CBG A;  1GM9 A;  3W7T A;  1RPO A;  4MVS A;  4Q20 A;  2YEV A;  3W7U A;  1QCE A;  2JEU A;  4MVU A;  1CPY A;  3QO7 A;  2GHY A;  1VQM V;  3F5W C;  3K04 A;  2LFS A;  3CCS V;  1V54 B;  1M56 B;  2ZXW C;  3FB6 C;  3ZN1 A;  2DYS C;  2DYS B;  1P7B A;  4GX1 A;  2IJK A;  1K92 A;  3OM3 B;  2WLK A;  2QEX V;  4MTO A;  3CCE V;  1AR1 B;  2EIM B;  3X2Q C;  2WPD G;  2BOC C;  4X88 A;  2F43 G;  2EIJ C;  2V7Q G;  3CYO A;  5KUM A;  1OHH G;  1E1Q G;  1NH2 D;  2DW4 A;  3ML0 A;  1M90 W;  4R8C A;  3W7X A;  5DM6 V;  3IC7 A;  1GK9 A;  1G4Y B;  4XDJ A;  3ZJZ A;  4WFF A;  1FFT B;  4PA3 A;  4LCU C;  5IY5 C;  5LHG A;  3AG1 B;  4BW5 A;  2EIK B;  1F4M A;  4PDL A;  1R3I C;  2QM7 A;  2IJI A;  3ABM C;  2W0F C;  1JVM A;  4JYC A;  1H38 A;  4R7C A;  1FXK A;  5CBH A;  1AJP A;  5DN6 G;  1H8E G;  3G4S V;  3CMA V;  2OCC B;  1F23 A;  2P67 A;  1KP2 A;  3K0G A;  4FK5 C;  5B3S C;  1S0V A;  1PNM A;  1EBO A;  4H37 A;  2XOK G;  2WLL B;  4PEL A;  3STZ C;  2YEV B;  2X6C A;  3ABU A;  3E83 A;  3SPI A;  4KUM A;  3SJQ C;  1HWY A;  1AJQ A;  1AI6 A;  1PNK A;  3FB7 C;  1GMG A;  4UV8 A;  4E2L A;  2Q69 A;  2K1E A;  2QKS A;  3ASN C;  4RUE A;  1P4R A;  4P2Z A;  4UVA A;  3ZN0 A;  3E8H A;  3OR7 C;  3ZMZ A;  2LP7 A;  1Y4M A;  2NNU A;  3F7Y C;  4WFA V;  4GX0 A;  3E8G A;  1V55 B;  3W7S A;  3ETG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...