2OT5A

Crystal structure of the hiv gp41 core with the enfuvirtide resistance mutation n43d
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
67
structure length
67
Chain Sequence
SGIVQQQNDLLRAIEAQQHLLQLTVWGIKQLQARSGGRGGWMEWDREINNYTSLIHSLIEESQNQQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 gp41 glycoprotein
publication title Impact of the enfuvirtide resistance mutation N43D and the associated baseline polymorphism E137K on peptide sensitivity and six-helix bundle structure.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Viral protein
total genus 29
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 2007-02-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2ot5A00
4E2LA 1ENVA 1K34A 2X7RB 3CYOA 2P6JA 1DF5A 3K9AA 1F23A 2EBOA 3CP1A 1K33A 1Y4MA 2MK3A 3MHHC 1I5XA 4N23A 4JF3A 1JPXA 1JQ0A 2LP7A 2OT5A 5HFMA 2M7WA 2EZPA 1MOFA 2EZOA 1QCEA 5H9CA 4G2KA 3B8MA 3MHSC 1Y66A 4FJCC 3GWOA 4JPRA 5CN0A 1SZTA 1QBZA 5KA5A 1DF4A 1QR8A 3P30A 1DLBA 3H01A 4FK5C 1EBOA 4JGSA 3B77A 1QR9A 3M99B 4FIPC 5KA6A 1MG1A 5HFLA 5CMUA 1I5YA 3WFVA 3B8NA 4N21A
chains in the Genus database with same CATH superfamily
4FLVA 5B3SC 2CK3G 1UJWB 3CCMV 1MMMA 2PYJA 2BSKA 2E76B 2A7WA 4HAMA 4EFBA 2UXCB 1TVKB 2VRZA 2QSAA 2YDEA 4CC6A 2PY5A 1I08A 4DUYO 2HG5C 4ZHQA 5EBWC 4Z1VA 3B77A 4B3SO 1FJGO 1AI6A 4PA6A 3Q4HB 3OTFA 1H38A 4WFFA 1S3JA 2RN9A 1VQ8V 4LF4O 2AW9A 4J11A 1AB3A 4IHJB 4U7OA 4LF7O 2E3CA 4MW8A 3STZC 3CMEV 1EBOA 1CEZA 3OD4A 3J80N 5F2VO 3L70H 4B3SB 2P06A 2IH1C 3FB7C 4DRXB 2ZR2A 2ZXWB 2LO1A 1FXKA 1NBMG 5LXTB 3UM7A 3LSUA 4JYYA 4DV7B 3VQXA 4QE9A 2PZSA 1AI4A 4LF7B 3JD2A 5EK0A 1I5YA 3O65A 1Y74A 1IX9A 2AZ0A 2ADPA 3OAAG 2PUSA 4JPRA 3ZRWA 1PPJH 1PP9H 3RT3C 2R9AA 4I9WA 3ASOB 3D36A 4DV5O 1MOFA 3B8MA 4WFHA 4DO2A 1XNQB 2QKCA 2KQXA 4UCSA 1FAFA 2XT9A 3L71H 4PDVA 3LNNA 1YSCA 1NI8A 1IBKO 4DV4O 2X0LA 1FXKC 1M56C 3T1HB 3A8TA 3BA8A 1Q86W 1QU7A 1W0KG 2F66C 2QM4A 3HB3B 3HKCA 4DV5B 1DGSA 2CH7A 1NTKH 2NLJC 2P4VA 3RYFB 2QWNB 4NTXA 2QTOA 4JI1B 3WFVA 4JI3O 4NKGB 2JJ2G 1WP7A 3D36C 4DV4B 3RW0A 1R3KC 3LDDA 5CBGA 2EIMB 1T5EA 1RFYA 2AXTZ 2E74B 5B1OA 4JI7B 1YJ9V 1AJNA 4DK1A 4LF5O 1IZ3A 1E79G 2OIEA 2HEPA 1H2LA 3OT7A 3TXQA 3H1KH 4FZ1A 2Y69B 4J7KA 3EFFK 2EZPA 3CCEV 1N33O 1VF5B 2E5LO 4PI0A 1OCZB 4I7ZB 4LBEC 1BQZA 1SQXH 2LFSA 4DR3O 1U97A 1CP9A 1F4NA 3AG3C 2WLLA 4QJFB 5IYZB 4DR1B 2MW2B 3AG2C 3JYCA 2QA4V 4LF9O 1E1QG 1HR0B 5JH7A 4BIZA 3CXHF 2OTJV 4GCZA 5IE9A 3SYQA 1BSMA 5EZYA 5KHHA 1PL0A 4DV0O 5L3FA 4LF8O 4F6RA 2DYSC 5GONA 4JTDB 3SPCA 1M90W 1GN6A 2RQ6A 4X88A 5CA1A 3L72H 1LR1A 3ZHUA 3C3SA 1NTMH 1LUWA 4X66B 3OGCC 1CXZB 4WBNA 4EB6B 5IYDO 4GKJO 2HJFC 3FFQA 1D5NA 3WG7B 4LF8B 3U10A 1KBHA 5LYJA 3T1CA 5LGUA 4GZRB 2ZDIA 3FAVB 2GUZB 2CAZC 3QNEA 1FYJA 3AK2A 2VQFO 2EINC 4J10A 2HFEC 1Y76B 1VF6C 5KUKA 1GO3F 4JTAB 5IJ9B 1SKVA 4TUYB 3RBZA 5GTIZ 2H94A 5JQGA 4FFBB 2Q7GA 3ZN0A 4MVQA 3CRQA 2BTQA 2DQ3A 1ZL8B 4N23A 1EZVH 1JMKC 4OX9B 2Q7HA 1UFIA 4X64B 2PI5A 3SJQC 4BR6A 2Q73A 2ZDIC 3FKSG 5CBFA 2QWOB 1GRJA 2DJVA 2MK3A 4UUJC 2L35A 4LFAB 3OEHG 4PELA 3G6EV 1GAXA 5BMVA 3FYEB 2Z0AA 2DWEC 2W0FC 2P4KA 4KL1A 4NXNB 1JJOA 4H0LB 1PNLA 2RDCA 3TJTA 3KCXA 5LL6Y 2EIJC 4B3TB 2JEUA 1KC8W 2Q5ZA 1KP3A 4X65O 4J7ZA 2P6JA 1M9NA 2N74A 2XAGA 4JI2B 5D5QA 1NKDA 3A0BZ 4J9ZB 3STLC 3OR7C 3RYIA 1OCCB 4CC5A 1SA0A 2JGDB 1WJZA 3K5MA 2JGUA 1OCRC 3SYOA 3OGIB 3RYCA 2HJDA 4PA9A 5DEDA 3D8CA 3HR0A 3CB2A 3DTUB 1GKFA 2EULA 4X20B 5HFMA 5KHKA 1P49A 2WA4A 3JAKA 3S3XA 3DXRA 5B1BC 2YI9A 3ZHTA 4W4LA 3U11A 4CS2A 3IJ4A 4JYAO 2Q0AA 2Z5UA 2WWWA 3SR2C 2Z3YA 5KX5A 3UKMA 5IJ0A 4TV8A 3OR6C 2GTSA 4L87A 4FLWA 2M7WA 5LGTA 1I0HA 1GM7A 1K9MW 5LGNA 4NR1A 3LNMB 4O4HA 2ODMA 2CTWA 5JCOA 4ZKIA 4K0KB 2HHHO 2HP8A 4DR2O 1OCOB 1ORQC 1M57C 3JARB 4UB8Z 4JYBA 3FB8C 2JS3A 2YIBD 1VQ7V 2HVKC 5EC1C 3K04A 3ZRVA 2VWKA 2EIKB 2P90A 1HNZO 4CZZA 4DR4B 1QLEB 4YY3O 4U3FH 2HKOA 1OZ0A 4LP8A 4QPJA 5KHGA 2HHHB 1ZWIC 3OTOO 5AG2A 4DR2B 1AJQA 4NVPA 4JI4O 1NQTA 5IT9N 4MW3A 1OV9A 3RVYA 3F5WC 4MS2A 3L74H 5LMNB 1WB7A 3HKEA 3M8AA 4B08A 4JV5B 4LNUA 4CBCA 2EILB 1H8EG 1VQLV 5H9CA 1XNRB 1Y66A 3JATA 1XEQA 1TGOA 3SJBC 3VBBA 2OIGA 3JALA 4FFKA 2ZXWC 3RVZA 4DK0A 4YY3B 4FIPC 4B3RO 3N27A 5HFLA 3G4SV 5LP6A 4D6TH 4J42A 3ABUA 4R6ZA 3CCJV 2F4VB 1HWYA 2OT5A 1YDXA 3QO8A 1FKAO 3CRAA 3E22A 1V54B 4TV9B 4X1YA 4AILC 4HZ3A 4AHCA 1EN4A 1K92A 2VWJA 3QO5A 2CGNA 3ETDA 1KD1W 3C3TA 2DYRC 4UFZA 1HNXB 3ICXA 1NR7A 2YXYA 4DV1B 4HBNA 2AZ2A 2KSDA 4IIJA 3BVOA 3G6BA 3CJHA 2ZT9B 3ZX6A 4JAVA 4BAYA 2QWPB 5LP6C 1H2KA 1AR1B 3HKDB 3L9DA 4O4IA 1QR9A 2ZCEA 4KHPB 3SJCC 5LMUO 2OYQA 2R9IA 2N04A 3QO7A 2XHBA 2Q9LA 1H2MA 2QTSA 5C8YA 4X62O 3E86A 2ZIOA 2EJ7A 4RO2A 1AI7A 1P7GA 2CTQA 4JTCB 2AHZA 3A0HZ 3CXCU 3P30A 1EFRG 4UCVA 1KU9A 2D2CB 2EIMC 3T2MA 4Q6GA 4D7TA 5KMGA 4MTGA 5FLXN 5DM6V 2B5UA 1BHAA 1N34O 3MHHC 4O4LB 2WSSG 5TISZ 5J2UA 2DMXA 3CMAV 2NR5A 2IU3A 3ABKB 1X4TA 4XDKA 2EJRA 1VARA 4EEQA 3JCUZ 2FTKA 4GKKO 4O2AA 3ETGA 4IGGA 4X9QA 4DV3B 4G28B 4PI2A 1K4DC 1YVWA 2WLKA 2F95B 5KUMA 4DXWA 2QWQB 1V55B 1URFA 1HNWB 3BABA 1Y67A 3R65A 5FNVB 1K4CC 5J2TA 4YJ2B 2UXDB 2JVDA 3E89A 1L0NH 1K8AW 3EXAA 5IY5B 2JK5C 1M5IA 4KFMA 1RSOA 4PA4A 2WLMA 1MABG 1MSDA 2CGOA 1B6QA 3JASB 1Q90D 1BGYH 1WA8B 2UUAO 1NZ6A 1R3JC 2KG7B 3ZMSA 2ZQMA 4LR3A 5J9PC 3P3PA 4DW0A 1PNMA 3ETEA 3K0GA 5B66Z 1AVMA 4Z2WA 2ZNIA 1SETA 4G2KA 4OPHA 1VQ5V 3T4DA 1TUBA 4EFEA 4YHHO 3AG4B 2NNUA 4FPPA 1Z2GA 3DGEA 3BRCA 1WN7A 4DUYB 3TK1A 1N4CA 1FJGB 1KKDA 3FYIB 3I5DA 2QKSA 1JFFB 4ICGA 4GT1A 1Q6IA 3DC5A 3ABMC 3VQVA 3CCQV 2QKAA 4LF6O 1QCEA 4YJ3B 2XAHA 4LF4B 3E8BA 1TAEA 1QVFU 2XASA 1B04A 3SJAC 1GK9A 1QLNA 3BA9A 3JAMN 1NS1A 4A5UB 1YEWA 3IFXA 5DN6G 5H5NA 2OWOA 2W0XA 2R9RB 3K03A 1Q81W 1J5EO 5CA3A 1Q82W 3CCUV 4MT8A 1S76D 1M1KW 2L6LA 3ZS8C 2P5OA 1K5SA 2F43G 1GN3A 2F93B 1EN6A 5LHIA 5JVDA 4LCUC 2OCCB 3E8HA 4JI8O 1U96A 1FFXB 3MHSC 1KUQA 4K35A 1EN5A 3K59A 4ZOLA 4I5SA 1AILA 3QVNA 2FL4A 5CMUA 3ZMZA 5CN0A 4I0XB 1IBKB 1W2BU 4UV8A 3AK1A 5CA0A 1JPXA 3SDLA 2DW4A 1G1XB 4LWSB 4HNAA 3CCVV 3ZEDA 1ZSPA 4YXWG 2ZD9A 3W7UA 3ABLC 3MD0A 3A2FA 1P4RA 1RM1B 3R66A 3MDSA 3SYAA 3CHXA 1XBLA 1BE3H 3HKBB 2IU0A 3THOA 4CH6A 4JI3B 1H2NA 4UXNA 4JAAA 3F7YC 3WB0A 1JOYA 3ETQA 1NJIW 3NXSA 4JI5O 4I4TB 3ASNC 4GYCB 5LBQA 1IURA 4X1KA 3PN1A 1THZA 3N2GA 1XREA 4LF5B 1SS3A 3HPLC 1PKXA 3ZMVA 1HW7A 2X7RB 1NVPB 3FX7A 2ZNJA 4TQDA 1HP8A 1R6NA 5ITZA 4NTWA 1BL8A 3JAWA 1GH6A 1VQPV 5B3SB 1WLEA 3I55V 1IBMO 1N33B 1KYOF 2E5LB 4O2BB 2P67A 5K1XA 1PNKA 5LA6A 3T1YO 1RP3B 1VF6A 4TWKA 1YITV 4J80A 4DR3B 5LOVA 1BZKA 2V1DA 1R6TA 4PA7A 3AG1C 1K97A 2YUAA 1I7FA 2LP7A 4O4JB 4X1IB 2CDYA 4LF9B 4IL6Z 2WAMA 1G8MA 3JCZA 4L8JA 4NTYA 2JRIA 3G67A 3SYPA 5CB4A 4AI8A 3KCYA 1JX9A 3UT5A 4DV0B 5L3GA 2GDSA 1ZUQA 3WU2Z 5B1AB 2R72A 2ETNA 4DR5O 3T1YB 4I55B 1QLEC 2W6JG 2Q4PA 1WPBA 4TSFG 4KP4A 1JQ0A 1MNGA 2BSKB 4CS4A 2JEXA 4U7NA 1GMGA 2A79B 3CRMA 4FM2A 2ZR3A 4B3MO 3OMNB 5B1NA 2UU9O 3VQYA 1GN4A 4ZHQB 4GKJB 3ZIAG 3CD6V 2ATKC 3TETA 1Q8IA 2XOKG 3RYHA 4ZI7A 2EZOA 4PDLA 2IJJA 5IWAO 1I94O 3X2QC 2D3OW 3N2KA 2VQFB 2Y4TA 2ZKOA 1NVPD 1IBLO 4PD4F 2UU9B 4MVMA 5EYPA 3M7MX 4H13B 4LH7A 1V54C 4B7KA 1F4MA 2EX3A 2LGWA 3VQWA 1ZX3A 4DV6O 1H2GA 1PV0A 4R8CA 4WFEA 3SYCA 4CS3A 1FXKB 4BIUA 1M56B 4I9QA 4GLXA 2ZE5A 2C2AA 2HR3A 3LDCA 2IBZH 3U0ZA 1BS3A 3T4ZA 1UPGA 3ZBHA 1N0JA 1XMOO 1DF5A 1Y74B 2IJIA 4U3JA 3ZRWB 3CCLV 1K73W 2CE4A 2JIZG 1TA8A 5A2QN 3GWOA 1F7YA 1QBZA 5EC2C 1R3LC 2IJHA 3B40A 1SQPH 1VEWA 1TVKA 1XMQO 4ZBMA 4W4KA 4X65B 4P2ZA 4QE7A 4RQEA 1G4YB 4DR6O 1VQ4V 3CSXA 1GTOA 1N32O 3HKCB 1VIBA 4P9OA 1GN2A 2CH7B 3BFRA 1L8DA 2QR4A 3OUSA 3RFRA 2P22C 3UO2A 4P30A 3RN4A 2Q68A 3K5NA 2YXLA 4IHJA 4BWAA 3AEIA 3AG3B 4DR7O 4WFGA 3S3WA 4NXMO 4DR6B 1IXMA 4LH6A 1DK1A 2DN9A 4JYAB 5KA6A 4DRXA 1S5LZ 3IAYA 1KKCA 2YEVA 5LXTA 2DYSB 2YXHA 2YICA 3CPWU 4FLXA 1YHQV 2UXBO 1SESA 4RUFA 1WB8A 3JD4A 4NXMB 4JI0O 2ADQB 1PL4A 4WCEV 2Y4UA 3M99B 4XDJA 1XL4A 4X1KB 1YZBA 4LFCO 2BE3A 4UCRA 1DTOA 4EKWA 5GTHZ 2XNDG 3ZRXA 2WLLB 3F5TA 3LDEA 3QF7A 1COWG 5LHHA 3RGBA 3K9SA 4ZIBA 1VQMV 3CC2V 5JH7B 4RUEA 3JAWB 2X6CA 1XDCA 2YS8A 3CEIA 5EZYB 1HNZB 4PA3A 1NT2B 1IXBA 5EBMC 4MTFA 1ZLZA 2EINB 4F6RB 4CH4A 2UUCO 5LA6B 3EHBB 4N21A 2BTOA 5GONB 3SPGA 3OTOB 1YF2A 3JD0A 2ZE6A 4JI4B 5L3DA 2YIDA 4UVAA 3CCRV 4MVSA 3W7SA 3GB7C 3ZRSA 1YIJV 3ZMUA 3RWRD 5CA1B 2G38A 2BOBC 3ZHQA 4GX1A 3RYFA 1SF9A 4BW9A 4WBNB 3ASOC 1WNSA 1Q3EA 2QDOA 3P32A 4B3RB 1XL6A 1BHBA 1Y4MA 5LYJB 3QTCA 1VQKV 2QGNA 4OGQB 3B2EE 1ZTEA 5E79Z 4QIWF 1Y6XA 4P9PA 1M4UA 2B9ZA 4FVMA 4F4LA 3H1HH 4J7JA 2F23A 2IH3C 2PI4A 2QM7A 4H33A 3G71V 1N36O 4RWUA 5JQGB 1LUVA 3BY6A 1K34A 1VQOV 2WLJA 4RAIA 2V4DA 2BTQB 2EIJB 4UCOA 5JJEB 1YJNV 1L1FA 5KAFZ 3UQ8A 5BXZA 5LHGA 1Z5WA 4UCUA 5IYZA 2UXXA 4ASUG 3ZN1A 2WA3A 5EIBD 1V9PA 4JYCA 2P7TC 1O9GA 4K8ZA 3FB6C 5LMUB 3CRCA 4BIOA 1MA1A 3FB5C 4DV2O 1OCRB 4X62B 2YC0A 4FLYA 3K5OA 1NTZH 3BAAA 1B3QA 5BMVB 3H01A 2Y69C 1XUQA 5B1BB 1IDSA 4WF9V 2UXCO 1OCZC 4R50A 1ENVA 1Z5VA 2ITDC 3OM3B 3J7AU 1RPRA 1N34B 2XAQA 3E8FA 1JVMA 2LW1A 5JWPA 4KXRA 1L0LH 4EB6A 1OJHA 3BPZA 3KG2A 3EVKA 4TT3G 5KLVH 1VP7A 4XBFA 1SZXA 3RYIB 2X6AA 1SA0B 1ROPA 5JJNB 5KHIA 5IDJA 3FAVA 4FZ0A 2R70A 1XI1A 2GUZA 4UCTA 4GKKB 2FMLA 1KMIZ 4PHZA 1KB9F 1M57B 1W59A 3GVMA 3RYCB 4FLUA 2JJ1G 1Y76A 2CTPA 5H6RA 1EM1A 2A3QA 2RMKB 2PYLA 3JAKB 5IJ9A 2QEXV 3DXRB 4TUYA 1S0VA 4FFBA 2LJ2A 1S77D 1OHHG 5L3BA 1A32A 4WFBV 1SQFA 4F6EA 1QNMA 4YIOA 1X59A 4D7SA 1ZL8A 5KX5B 1AR5A 4E4EA 5IJ0B 4GUNA 2UUAB 4TV8B 4DV7O 1QHTA 5H2FZ 2YSUB 2WLIA 3E35A 5B1AC 3WG7C 4X89A 3ZCCA 1K7DA 2KKWA 2LGQA 2XUMA 4O4HB 1H2SB 1MZEA 3E83A 1SERA 1Q7YW 4YHHB 3K79A 2GBOA 3ZJZA 2XTAA 4MTXA 3K08A 2YEVB 1XNQO 2YIBA 1TUEB 1D5AA 3OW2U 3DSQA 3TGUH 2Y0IA 1O9HA 4LF6B 3BCCH 3JSNA 1SQQH 3T1HO 1YXBA 4WFAV 4UB6Z 1JR9A 3E8GA 1G6UA 4JF3A 5BY1A 2XAJA 3HKEB 4DW1A 2GSMB 4LNUB 3SGIA 3SPJA 2JGDA 2DYRB 1J5EB 1Q6HA 4FLZA 3JATB 3ZMTA 4JI1O 2PTMA 2JDIG 2UXNA 3WB2A 4B7EA 3JALB 5L3CA 2IM9A 2YIAA 4E2LA 4PDRA 4X20A 5LP6B 2DQ0A 1SQGA 2QWRB 1I5XA 3L73H 3APQA 4JI7O 4MVRA 2DWDC 1FPOA 3KZIZ 4K8XA 4JI8B 1HDJA 3E22B 4X1YB 1AROP 4GX5A 3B4SA 3DC6A 1E1RG 1OCCC 3O9OA 3JSLA 1BMFG 2E75B 5C93A 4IIJB 3CJHB 3JARA 1QR8A 1NR1A 3D3QA 1FD9A 4J9YB 4PJ0Z 4Q20A 3F7VC 4BW5A 2QM8A 5L3EA 4DR1O 2QJ1A 1MZFA 4O4IB 3GWKC 4I50A 1HR0O 2Q7EA 2AHYA 4JASA 4GX2A 5C8YB 2XAFA 1JCHA 2K1EA 2ARHA 3OUFA 3FD9A 4FM0A 4JI5B 1AI5A 1KECA 5KMGB 3MAQA 5FPRA 4NYKA 1H8HG 3CC7V 4OXSA 3CP1A 1S5HC 1OCOC 1AP5A 5E1AC 3K3WA 5J2UB 4X66O 1M93A 1S5JA 1NU1H 1IVSA 2Y0PA 1VQNV 1VMGA 3TCUA 3IC7A 1BT8A 3AG7A 3OEEG 1YJWV 2ZINA 1IBMB 5IYCO 4OPAA 4X8AA 2EIKC 3A0RA 4O2AB 1JJ2U 1Q5OA 3PJSK 2FKXA 1D2DA 3CE2A 3W7XA 3NR7A 1XILA 2YI8A 4TV9A 2IW5A 2Q67A 5J2TB 3CX5F 2JS5A 1LNQA 4XDLA 2LQTA 3ABMB 1R73A 2EILC 5EIBC 1RSOB 4OX9O 4H37A 4DR5B 4X64O 1XQ8A 5KAIZ 4MVOA 3KKYA 2ZIMA 3HKDA 4K3AA 1MSWD 1R3IC 4FMTA 4PV1B 3ZHRA 1TUBB 3L75H 4DYLA 2ZE7A 4JGSA 1WP8A 4NB5A 1R1BA 1MG1A 5BZBA 4B3MB 2B1GA 1JA8A 4TQFA 3CC4V 4LFAO 3VOUA 4G27B 4Z1MG 2EBOA 3TXSA 4JAUA 4RQFA 2HVJC 3W7WA 2CTRA 4NXNO 2WLIB 2ZE8A 1J95A 4B3TO 5IWAB 1I94B 2UUBO 4FK5C 4DUZO 4AQYO 2VS0A 2B1IA 3LUTB 2OCHA 4QNHB 1RPOA 4O4LA 3B8NA 4LFBO 1IBLB 4JI2O 2Q69A 3OE7G 4UV9A 3OMAB 3JD1A 1SQBH 4JI6O 4DV6B 4MVZA 3H9VA 1WAZA 4KUMA 1S72V 3OMIB 3C90A 1NH2B 1FXHA 2UUBB 4DUZB 1W0JG 2CUGA 4AQYB 2NN4A 5FNVA 4LFBB 1F23A 3ABTA 4JZGA 4YJ2A 3ABLB 3P3NA 1BCCH 5JVDB 4UVCA 1N8RW 5KHJA 2AGAA 1CPYA 1XMOB 3K5LA 1PM9A 4JI6B 1XHXA 4FM1A 1ZAUA 3SPHA 3JASA 4GX0A 2PF4E 1WA8A 1QQCA 3Q4HA 2KG7A 4ZOLB 5FL7G 3ZHSA 1QVGU 4H44B 3CYOA 2ILMA 3K0DA 3ASNB 3ABKC 3UO3A 2WLNA 3CWBH 2O57A 1XMQB 4K0KO 5CA0B 5CBHA 1R6KA 2A0LA 5B5EZ 1SRYA 1AJPA 3AG2B 4HNAB 1DF4A 1V55C 3E2EA 1N32B 1JFFA 1FXVA 1WPXA 5IY5C 3UCSC 2GHYA 4YJ3A 4DR4O 5K1PA 1B06A 4FJCC 2ZM6O 4J41A 4MVUA 1PD3A 3AG1B 4DR7B 5LMNO 5EBLC 4JV5O 3N2GB 2VQEO 2F1MA 2PGGA 3K9AA 4I50B 2X6BA 3AG4C 1XNRO 4QGPA 3K57A 1FFTB 4MTOA 2ITCC 5IYBO 1NH2D 3OFNG 2WPDG 5ITZB 1K3EA 3J81N 3H1IH 2K9PA 2RJZA 2ZM6B 1DLBA 2UXBB 2DE0X 1YTFB 3H1JH 4JI0B 4YIPA 2F4VO 3K58A 5LOVB 1P7BA 4LFCB 5JCOC 2HLDG 1FFXA 2H8PC 2VQEB 2M6YA 2DOSA 2BCCH 4PDMA 1GM8A 2Q6AA 1VF7A 2QE7G 2WLHA 3LSQA 2GTAA 3ZHVA 1VQ6V 3LSSA 5CB4B 4I0XA 1HNXO 4DV1O 3X2QB 3UT5B 3ML0A 3CS5A 2RCVA 2UUCB 2GV9A 1K33A 4LWSA 1EZJA 4CH5A 4QPKA 1Q6UA 1KQSU 3BHPA 4MSWC 5FPOA 4FLTA 4IYHA 3D3IA 1P84F 4KHPO 1BQ0A 4HYOA 3HKBA 1Q43A 2OCCC 1AP6A 1YCIA 2FB5A 1SC5B 2H3OA 1XOUA 2W6IG 1N0NA 2LW7A 2Y48A 3I56V 1K5QA 2IJKA 1F51A 3AK3A 3RYHB 3QG5A 4ZI7B 4I4TA 4ABMA 2RNBA 3IC9A 5KA5A 5BR8O 3N2KB 5D5PA 4IT5A 3CCSV 4CH3A 1AR4A 2OTLV 2A9HA 3CRRA 5JJJB 5H6QA 3WB1A 5EYPB 1FS0G 1N36B 1RM1C 3BEHA 2KB1A 1YTFD 4O2BA 1SZTA 4UVBA 5A9GA 2A06H 1GM9A 2BOCC 2N05A 3H1LH 4DV3O 3APOA 1KP2A 2V7QG 5BR8B 4IYIA 1US6A 2Q8VA 3G80A 1HNWO 4LC1A 3SPIA 1VQ9V 1SQVH 2UXDO 4O4JA 2FYUH 4X1IA 4C7UA 5GW7A 2LFRA 3IGAC 1YI2V 3JD3A 1XHZA 4U3JB 2Q0OC 4DV2B 4TOIA 3K06A 4R7CA 3W7TA 4I55A 4JZ2A 3B09A 5DECA
chains in the Genus database with same CATH topology
5B3SC 1F4MA 2CK3G 1UJWB 3CCMV 1E1RG 1OCCC 4HAMA 1H2GA 4R8CA 1BMFG 4WFEA 3SYCA 4CBCA 2EILB 1H8EG 5C93A 1VQLV 5H9CA 1FXKB 1Y66A 4BIUA 1M56B 2C2AA 2HR3A 3LDCA 1QR8A 3VBBA 2HG5C 1NR1A 2ZXWC 3RVZA 5EBWC 3B77A 4J9YB 4Q20A 3F7VC 4BW5A 2QM8A 4FIPC 5L3EA 3T4ZA 1AI6A 5HFLA 3G4SV 4PA6A 1DF5A 3ABUA 2IJIA 4R6ZA 2AHYA 1H38A 4WFFA 3CCJV 1S3JA 1VQ8V 1HWYA 2OT5A 3QO8A 4JASA 3ZRWB 4GX2A 3CCLV 1K73W 2JIZG 3GWOA 4U7OA 2XAFA 1QBZA 1V54B 4HZ3A 5EC2C 1K92A 4MW8A 1R3LC 3STZC 2IJHA 3CMEV 1EBOA 1JCHA 1CEZA 2K1EA 3QO5A 3OUFA 1AI5A 3ETDA 1KD1W 1KECA 2IH1C 3FB7C 2DYRC 1H8HG 2ZR2A 4ZBMA 4OXSA 1NR7A 3CP1A 3CC7V 1S5HC 1OCOC 2ZXWB 4P2ZA 1FXKA 5E1AC 1NBMG 4QE7A 4RQEA 1G4YB 3K3WA 3UM7A 1VQ4V 1VQNV 4JAVA 4BAYA 4QE9A 3TCUA 1GTOA 3IC7A 1AR1B 3OEEG 1YJWV 4P9OA 1QR9A 1AI4A 5IYCO 3JD2A 5EK0A 1I5YA 4X8AA 2EIKC 3OUSA 3A0RA 3OAAG 2R9IA 1JJ2U 3QO7A 4JPRA 4P30A 2Q68A 3PJSK 3ZRWA 3E86A 3W7XA 4I9WA 3ASOB 3D36A 3AEIA 3AG3B 1MOFA 4RO2A 1AI7A 2IW5A 2Q67A 3B8MA 4WFGA 4WFHA 4DO2A 1LNQA 1IXMA 4JTCB 2AHZA 4XDLA 3CXCU 3P30A 1EFRG 4PDVA 1YSCA 2EIMC 3T2MA 3ABMB 4MTGA 5KA6A 1R73A 2EILC 5DM6V 2X0LA 1FXKC 2YEVA 2B5UA 1BHAA 1M56C 4H37A 3MHHC 2WSSG 1Q86W 1W0KG 2DYSB 3HB3B 3CMAV 3CPWU 4MVOA 1YHQV 1SESA 4RUFA 3JD4A 1MSWD 1R3IC 4FMTA 2IU3A 3ABKB 4XDKA 2EJRA 4JGSA 4WCEV 3M99B 2FTKA 1MG1A 2NLJC 3ETGA 1XL4A 4XDJA 5BZBA 2QTOA 3WFVA 4G28B 2B1GA 1K4DC 4EKWA 1DTOA 2JJ2G 2WLKA 5KUMA 2XNDG 3ZRXA 4DXWA 3CC4V 3VOUA 4G27B 2WLLB 3RW0A 4Z1MG 1V55B 2EBOA 3LDEA 1R3KC 1COWG 3LDDA 5CBGA 3R65A 4JAUA 2EIMB 4RQFA 5LHHA 2HVJC 1K4CC 3W7WA 1VQMV 3CC2V 3E89A 1K8AW 4RUEA 5B1OA 2WLIB 5IY5B 2JK5C 2X6CA 1J95A 1YJ9V 1AJNA 4KFMA 4PA3A 1E79G 4FK5C 4PA4A 2WLMA 4MTFA 5EBMC 1MABG 2B1IA 2EINB 3LUTB 1B6QA 4QNHB 1RPOA 3B8NA 3EHBB 4N21A 1R3JC 3ZMSA 3SPGA 3JD0A 2ZQMA 5J9PC 2Q69A 3OE7G 4UV9A 5L3DA 3OMAB 4UVAA 3CCRV 2Y69B 4MVSA 1PNMA 3ETEA 3K0GA 3EFFK 3GB7C 3JD1A 3ZRSA 3W7SA 2EZPA 3ZMUA 1YIJV 3CCEV 1SETA 4G2KA 4MVZA 1VQ5V 1OCZB 2BOBC 3T4DA 4LBEC 4GX1A 4KUMA 3AG4B 2NNUA 2LFSA 1S72V 3OMIB 4FPPA 3DGEA 1NH2B 1FXHA 3ASOC 1CP9A 1F4NA 1W0JG 2WLLA 3AG3C 4QJFB 3P32A 3TK1A 1KKDA 3FYIB 1XL6A 2QKSA 3AG2C 3JYCA 1BHBA 2QA4V 1F23A 1Y4MA 3ABTA 1E1QG 4GT1A 3ABLB 4UVCA 4BIZA 1VQKV 1N8RW 1CPYA 3ABMC 2OTJV 4GCZA 4QIWF 3CCQV 1QCEA 3SYQA 4P9PA 2XAHA 3E8BA 4F4LA 1QVFU 1PL0A 2XASA 3SPHA 5L3FA 1GK9A 4GX0A 2DYSC 1QLNA 2IH3C 4JTDB 5FL7G 1QVGU 2PI4A 2QM7A 3IFXA 5DN6G 4H33A 3G71V 3SPCA 1M90W 3BY6A 1K34A 3CYOA 2R9RB 3K03A 1VQOV 2WLJA 4RAIA 3K0DA 3ASNB 3ABKC 4X88A 2WLNA 1Q81W 2EIJB 5CBHA 1R6KA 2A0LA 5CA3A 1YJNV 1Q82W 3CCUV 4MT8A 1L1FA 1S76D 1M1KW 1SRYA 1AJPA 3AG2B 1DF4A 3OGCC 1V55C 5LHGA 5IYDO 1K5SA 2HJFC 3E2EA 2F43G 2UXXA 3WG7B 4ASUG 3ZN1A 1FXVA 3T1CA 1WPXA 5LGUA 5IY5C 4JYCA 2P7TC 5LHIA 2ZDIA 3FB6C 2GHYA 3QNEA 4LCUC 2OCCB 3E8HA 2EINC 3FB5C 1OCRB 2HFEC 3MHSC 4FJCC 5KUKA 4MVUA 1GO3F 4JTAB 1PD3A 3AG1B 3H01A 4I5SA 3RBZA 2H94A 2Y69C 5B1BB 5CMUA 3ZMZA 3ZN0A 5CN0A 4WF9V 4MVQA 5EBLC 1OCZC 4R50A 1ENVA 2ITDC 3K9AA 1W2BU 3OM3B 2X6BA 2DQ3A 4N23A 4UV8A 3AG4C 1JPXA 1RPRA 2DW4A 2XAQA 3E8FA 1JVMA 1FFTB 4MTOA 2ITCC 5IYBO 1NH2D 3OFNG 2WPDG 1K3EA 3KG2A 3CCVV 2PI5A 4TT3G 3SJQC 4XBFA 1DLBA 4YXWG 2ZD9A 3W7UA 3ABLC 3MD0A 1P4RA 2X6AA 1RM1B 2ZDIC 1ROPA 3SYAA 3FKSG 1YTFB 5IDJA 5CBFA 2IU0A 1P7BA 2MK3A 4UUJC 1M57B 2HLDG 2H8PC 2JJ1G 4UXNA 3F7YC 5H6RA 3OEHG 4PELA 3G6EV 1JOYA 4PDMA 3FYEB 2DWEC 1NJIW 1GM8A 2QEXV 2Q6AA 2W0FC 1S0VA 3NXSA 2QE7G 2WLHA 3LSQA 3ASNC 1PNLA 1VQ6V 3LSSA 5LBQA 1S77D 1OHHG 5L3BA 4WFBV 2EIJC 1THZA 2JEUA 1KC8W 3X2QB 1KP3A 3HPLC 3ML0A 1PKXA 3ZMVA 2X7RB 2P6JA 1M9NA 1NVPB 1K33A 1EZJA 4QPKA 2XAGA 1R6NA 1NKDA 2YSUB 2WLIA 1BL8A 4J9ZB 3STLC 3E35A 5B1AC 3WG7C 3OR7C 1VQPV 4X89A 1KQSU 3ZCCA 1WLEA 4MSWC 1K7DA 5B3SB 3I55V 1OCCB 3D3IA 2P67A 4HYOA 3E83A 1PNKA 2OCCC 1SERA 1Q7YW 4TWKA 1YITV 3K79A 1OCRC 3SYOA 3ZJZA 4MTXA 3K08A 2V1DA 4PA9A 2YEVB 4PA7A 2W6IG 1K97A 2Y48A 3AG1C 3DTUB 1GKFA 2LP7A 5HFMA 1TUEB 3I56V 1K5QA 2IJKA 1F51A 5B1BC 2WAMA 1G8MA 3OW2U 3JCZA 5KA5A 2Z5UA 3SYPA 2WWWA 3CCSV 2Z3YA 1JX9A 5L3GA 2OTLV 2A9HA 5B1AB 3UKMA 4WFAV 5H6QA 1QLEC 2W6JG 3OR6C 3E8GA 1FS0G 4TSFG 4JF3A 4KP4A 1JQ0A 2XAJA 4L87A 1RM1C 2M7WA 5LGTA 1GM7A 1K9MW 5LGNA 3BEHA 3LNMB 2JEXA 2GSMB 2KB1A 3SPJA 1YTFD 4U7NA 1SZTA 4UVBA 2DYRB 4ZKIA 1GMGA 2A79B 1GM9A 1OCOB 1ORQC 2ZR3A 2BOCC 3ZMTA 3OMNB 1M57C 5B1NA 1KP2A 2V7QG 2JDIG 2UXNA 3ZIAG 4JYBA 3CD6V 5L3CA 4LC1A 3SPIA 2ATKC 3FB8C 3TETA 4E2LA 1VQ9V 4PDRA 2DQ0A 1I5XA 1VQ7V 5GW7A 2LFRA 2XOKG 2HVKC 5EC1C 4MVRA 3IGAC 2DWDC 1YI2V 3K04A 3ZRVA 2EZOA 4PDLA 3JD3A 2IJJA 2EIKB 2P90A 3X2QC 4CZZA 2D3OW 1QLEB 3K06A 4R7CA 2HKOA 3W7TA 1OZ0A 4LP8A 1NVPD 4QPJA 1AROP 1ZWIC 1AJQA 4GX5A 4MVMA 1NQTA 4MW3A 3RVYA 3F5WC 1V54C 4MS2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4E2L A;  1ENV A;  1K34 A;  2X7R B;  3CYO A;  2P6J A;  1DF5 A;  3K9A A;  1F23 A;  2EBO A;  3CP1 A;  1K33 A;  1Y4M A;  2MK3 A;  3MHH C;  1I5X A;  4N23 A;  4JF3 A;  1JPX A;  1JQ0 A;  2LP7 A;  2OT5 A;  5HFM A;  2M7W A;  2EZP A;  1MOF A;  2EZO A;  1QCE A;  5H9C A;  4G2K A;  3B8M A;  3MHS C;  1Y66 A;  4FJC C;  3GWO A;  4JPR A;  5CN0 A;  1SZT A;  1QBZ A;  5KA5 A;  1DF4 A;  1QR8 A;  3P30 A;  1DLB A;  3H01 A;  4FK5 C;  1EBO A;  4JGS A;  3B77 A;  1QR9 A;  3M99 B;  4FIP C;  5KA6 A;  1MG1 A;  5HFL A;  5CMU A;  1I5Y A;  3WFV A;  3B8N A;  4N21 A; 
#chains in the Genus database with same CATH topology
 4FLV A;  5B3S C;  2CK3 G;  1UJW B;  3CCM V;  1MMM A;  2PYJ A;  2BSK A;  2E76 B;  2A7W A;  4HAM A;  4EFB A;  2UXC B;  1TVK B;  2VRZ A;  2QSA A;  2YDE A;  4CC6 A;  2PY5 A;  1I08 A;  4DUY O;  2HG5 C;  4ZHQ A;  5EBW C;  4Z1V A;  3B77 A;  4B3S O;  1FJG O;  1AI6 A;  4PA6 A;  3Q4H B;  3OTF A;  1H38 A;  4WFF A;  1S3J A;  2RN9 A;  1VQ8 V;  4LF4 O;  2AW9 A;  4J11 A;  1AB3 A;  4IHJ B;  4U7O A;  4LF7 O;  2E3C A;  4MW8 A;  3STZ C;  3CME V;  1EBO A;  1CEZ A;  3OD4 A;  3J80 N;  5F2V O;  3L70 H;  4B3S B;  2P06 A;  2IH1 C;  3FB7 C;  4DRX B;  2ZR2 A;  2ZXW B;  2LO1 A;  1FXK A;  1NBM G;  5LXT B;  3UM7 A;  3LSU A;  4JYY A;  4DV7 B;  3VQX A;  4QE9 A;  2PZS A;  1AI4 A;  4LF7 B;  3JD2 A;  5EK0 A;  1I5Y A;  3O65 A;  1Y74 A;  1IX9 A;  2AZ0 A;  2ADP A;  3OAA G;  2PUS A;  4JPR A;  3ZRW A;  1PPJ H;  1PP9 H;  3RT3 C;  2R9A A;  4I9W A;  3ASO B;  3D36 A;  4DV5 O;  1MOF A;  3B8M A;  4WFH A;  4DO2 A;  1XNQ B;  2QKC A;  2KQX A;  4UCS A;  1FAF A;  2XT9 A;  3L71 H;  4PDV A;  3LNN A;  1YSC A;  1NI8 A;  1IBK O;  4DV4 O;  2X0L A;  1FXK C;  1M56 C;  3T1H B;  3A8T A;  3BA8 A;  1Q86 W;  1QU7 A;  1W0K G;  2F66 C;  2QM4 A;  3HB3 B;  3HKC A;  4DV5 B;  1DGS A;  2CH7 A;  1NTK H;  2NLJ C;  2P4V A;  3RYF B;  2QWN B;  4NTX A;  2QTO A;  4JI1 B;  3WFV A;  4JI3 O;  4NKG B;  2JJ2 G;  1WP7 A;  3D36 C;  4DV4 B;  3RW0 A;  1R3K C;  3LDD A;  5CBG A;  2EIM B;  1T5E A;  1RFY A;  2AXT Z;  2E74 B;  5B1O A;  4JI7 B;  1YJ9 V;  1AJN A;  4DK1 A;  4LF5 O;  1IZ3 A;  1E79 G;  2OIE A;  2HEP A;  1H2L A;  3OT7 A;  3TXQ A;  3H1K H;  4FZ1 A;  2Y69 B;  4J7K A;  3EFF K;  2EZP A;  3CCE V;  1N33 O;  1VF5 B;  2E5L O;  4PI0 A;  1OCZ B;  4I7Z B;  4LBE C;  1BQZ A;  1SQX H;  2LFS A;  4DR3 O;  1U97 A;  1CP9 A;  1F4N A;  3AG3 C;  2WLL A;  4QJF B;  5IYZ B;  4DR1 B;  2MW2 B;  3AG2 C;  3JYC A;  2QA4 V;  4LF9 O;  1E1Q G;  1HR0 B;  5JH7 A;  4BIZ A;  3CXH F;  2OTJ V;  4GCZ A;  5IE9 A;  3SYQ A;  1BSM A;  5EZY A;  5KHH A;  1PL0 A;  4DV0 O;  5L3F A;  4LF8 O;  4F6R A;  2DYS C;  5GON A;  4JTD B;  3SPC A;  1M90 W;  1GN6 A;  2RQ6 A;  4X88 A;  5CA1 A;  3L72 H;  1LR1 A;  3ZHU A;  3C3S A;  1NTM H;  1LUW A;  4X66 B;  3OGC C;  1CXZ B;  4WBN A;  4EB6 B;  5IYD O;  4GKJ O;  2HJF C;  3FFQ A;  1D5N A;  3WG7 B;  4LF8 B;  3U10 A;  1KBH A;  5LYJ A;  3T1C A;  5LGU A;  4GZR B;  2ZDI A;  3FAV B;  2GUZ B;  2CAZ C;  3QNE A;  1FYJ A;  3AK2 A;  2VQF O;  2EIN C;  4J10 A;  2HFE C;  1Y76 B;  1VF6 C;  5KUK A;  1GO3 F;  4JTA B;  5IJ9 B;  1SKV A;  4TUY B;  3RBZ A;  5GTI Z;  2H94 A;  5JQG A;  4FFB B;  2Q7G A;  3ZN0 A;  4MVQ A;  3CRQ A;  2BTQ A;  2DQ3 A;  1ZL8 B;  4N23 A;  1EZV H;  1JMK C;  4OX9 B;  2Q7H A;  1UFI A;  4X64 B;  2PI5 A;  3SJQ C;  4BR6 A;  2Q73 A;  2ZDI C;  3FKS G;  5CBF A;  2QWO B;  1GRJ A;  2DJV A;  2MK3 A;  4UUJ C;  2L35 A;  4LFA B;  3OEH G;  4PEL A;  3G6E V;  1GAX A;  5BMV A;  3FYE B;  2Z0A A;  2DWE C;  2W0F C;  2P4K A;  4KL1 A;  4NXN B;  1JJO A;  4H0L B;  1PNL A;  2RDC A;  3TJT A;  3KCX A;  5LL6 Y;  2EIJ C;  4B3T B;  2JEU A;  1KC8 W;  2Q5Z A;  1KP3 A;  4X65 O;  4J7Z A;  2P6J A;  1M9N A;  2N74 A;  2XAG A;  4JI2 B;  5D5Q A;  1NKD A;  3A0B Z;  4J9Z B;  3STL C;  3OR7 C;  3RYI A;  1OCC B;  4CC5 A;  1SA0 A;  2JGD B;  1WJZ A;  3K5M A;  2JGU A;  1OCR C;  3SYO A;  3OGI B;  3RYC A;  2HJD A;  4PA9 A;  5DED A;  3D8C A;  3HR0 A;  3CB2 A;  3DTU B;  1GKF A;  2EUL A;  4X20 B;  5HFM A;  5KHK A;  1P49 A;  2WA4 A;  3JAK A;  3S3X A;  3DXR A;  5B1B C;  2YI9 A;  3ZHT A;  4W4L A;  3U11 A;  4CS2 A;  3IJ4 A;  4JYA O;  2Q0A A;  2Z5U A;  2WWW A;  3SR2 C;  2Z3Y A;  5KX5 A;  3UKM A;  5IJ0 A;  4TV8 A;  3OR6 C;  2GTS A;  4L87 A;  4FLW A;  2M7W A;  5LGT A;  1I0H A;  1GM7 A;  1K9M W;  5LGN A;  4NR1 A;  3LNM B;  4O4H A;  2ODM A;  2CTW A;  5JCO A;  4ZKI A;  4K0K B;  2HHH O;  2HP8 A;  4DR2 O;  1OCO B;  1ORQ C;  1M57 C;  3JAR B;  4UB8 Z;  4JYB A;  3FB8 C;  2JS3 A;  2YIB D;  1VQ7 V;  2HVK C;  5EC1 C;  3K04 A;  3ZRV A;  2VWK A;  2EIK B;  2P90 A;  1HNZ O;  4CZZ A;  4DR4 B;  1QLE B;  4YY3 O;  4U3F H;  2HKO A;  1OZ0 A;  4LP8 A;  4QPJ A;  5KHG A;  2HHH B;  1ZWI C;  3OTO O;  5AG2 A;  4DR2 B;  1AJQ A;  4NVP A;  4JI4 O;  1NQT A;  5IT9 N;  4MW3 A;  1OV9 A;  3RVY A;  3F5W C;  4MS2 A;  3L74 H;  5LMN B;  1WB7 A;  3HKE A;  3M8A A;  4B08 A;  4JV5 B;  4LNU A;  4CBC A;  2EIL B;  1H8E G;  1VQL V;  5H9C A;  1XNR B;  1Y66 A;  3JAT A;  1XEQ A;  1TGO A;  3SJB C;  3VBB A;  2OIG A;  3JAL A;  4FFK A;  2ZXW C;  3RVZ A;  4DK0 A;  4YY3 B;  4FIP C;  4B3R O;  3N27 A;  5HFL A;  3G4S V;  5LP6 A;  4D6T H;  4J42 A;  3ABU A;  4R6Z A;  3CCJ V;  2F4V B;  1HWY A;  2OT5 A;  1YDX A;  3QO8 A;  1FKA O;  3CRA A;  3E22 A;  1V54 B;  4TV9 B;  4X1Y A;  4AIL C;  4HZ3 A;  4AHC A;  1EN4 A;  1K92 A;  2VWJ A;  3QO5 A;  2CGN A;  3ETD A;  1KD1 W;  3C3T A;  2DYR C;  4UFZ A;  1HNX B;  3ICX A;  1NR7 A;  2YXY A;  4DV1 B;  4HBN A;  2AZ2 A;  2KSD A;  4IIJ A;  3BVO A;  3G6B A;  3CJH A;  2ZT9 B;  3ZX6 A;  4JAV A;  4BAY A;  2QWP B;  5LP6 C;  1H2K A;  1AR1 B;  3HKD B;  3L9D A;  4O4I A;  1QR9 A;  2ZCE A;  4KHP B;  3SJC C;  5LMU O;  2OYQ A;  2R9I A;  2N04 A;  3QO7 A;  2XHB A;  2Q9L A;  1H2M A;  2QTS A;  5C8Y A;  4X62 O;  3E86 A;  2ZIO A;  2EJ7 A;  4RO2 A;  1AI7 A;  1P7G A;  2CTQ A;  4JTC B;  2AHZ A;  3A0H Z;  3CXC U;  3P30 A;  1EFR G;  4UCV A;  1KU9 A;  2D2C B;  2EIM C;  3T2M A;  4Q6G A;  4D7T A;  5KMG A;  4MTG A;  5FLX N;  5DM6 V;  2B5U A;  1BHA A;  1N34 O;  3MHH C;  4O4L B;  2WSS G;  5TIS Z;  5J2U A;  2DMX A;  3CMA V;  2NR5 A;  2IU3 A;  3ABK B;  1X4T A;  4XDK A;  2EJR A;  1VAR A;  4EEQ A;  3JCU Z;  2FTK A;  4GKK O;  4O2A A;  3ETG A;  4IGG A;  4X9Q A;  4DV3 B;  4G28 B;  4PI2 A;  1K4D C;  1YVW A;  2WLK A;  2F95 B;  5KUM A;  4DXW A;  2QWQ B;  1V55 B;  1URF A;  1HNW B;  3BAB A;  1Y67 A;  3R65 A;  5FNV B;  1K4C C;  5J2T A;  4YJ2 B;  2UXD B;  2JVD A;  3E89 A;  1L0N H;  1K8A W;  3EXA A;  5IY5 B;  2JK5 C;  1M5I A;  4KFM A;  1RSO A;  4PA4 A;  2WLM A;  1MAB G;  1MSD A;  2CGO A;  1B6Q A;  3JAS B;  1Q90 D;  1BGY H;  1WA8 B;  2UUA O;  1NZ6 A;  1R3J C;  2KG7 B;  3ZMS A;  2ZQM A;  4LR3 A;  5J9P C;  3P3P A;  4DW0 A;  1PNM A;  3ETE A;  3K0G A;  5B66 Z;  1AVM A;  4Z2W A;  2ZNI A;  1SET A;  4G2K A;  4OPH A;  1VQ5 V;  3T4D A;  1TUB A;  4EFE A;  4YHH O;  3AG4 B;  2NNU A;  4FPP A;  1Z2G A;  3DGE A;  3BRC A;  1WN7 A;  4DUY B;  3TK1 A;  1N4C A;  1FJG B;  1KKD A;  3FYI B;  3I5D A;  2QKS A;  1JFF B;  4ICG A;  4GT1 A;  1Q6I A;  3DC5 A;  3ABM C;  3VQV A;  3CCQ V;  2QKA A;  4LF6 O;  1QCE A;  4YJ3 B;  2XAH A;  4LF4 B;  3E8B A;  1TAE A;  1QVF U;  2XAS A;  1B04 A;  3SJA C;  1GK9 A;  1QLN A;  3BA9 A;  3JAM N;  1NS1 A;  4A5U B;  1YEW A;  3IFX A;  5DN6 G;  5H5N A;  2OWO A;  2W0X A;  2R9R B;  3K03 A;  1Q81 W;  1J5E O;  5CA3 A;  1Q82 W;  3CCU V;  4MT8 A;  1S76 D;  1M1K W;  2L6L A;  3ZS8 C;  2P5O A;  1K5S A;  2F43 G;  1GN3 A;  2F93 B;  1EN6 A;  5LHI A;  5JVD A;  4LCU C;  2OCC B;  3E8H A;  4JI8 O;  1U96 A;  1FFX B;  3MHS C;  1KUQ A;  4K35 A;  1EN5 A;  3K59 A;  4ZOL A;  4I5S A;  1AIL A;  3QVN A;  2FL4 A;  5CMU A;  3ZMZ A;  5CN0 A;  4I0X B;  1IBK B;  1W2B U;  4UV8 A;  3AK1 A;  5CA0 A;  1JPX A;  3SDL A;  2DW4 A;  1G1X B;  4LWS B;  4HNA A;  3CCV V;  3ZED A;  1ZSP A;  4YXW G;  2ZD9 A;  3W7U A;  3ABL C;  3MD0 A;  3A2F A;  1P4R A;  1RM1 B;  3R66 A;  3MDS A;  3SYA A;  3CHX A;  1XBL A;  1BE3 H;  3HKB B;  2IU0 A;  3THO A;  4CH6 A;  4JI3 B;  1H2N A;  4UXN A;  4JAA A;  3F7Y C;  3WB0 A;  1JOY A;  3ETQ A;  1NJI W;  3NXS A;  4JI5 O;  4I4T B;  3ASN C;  4GYC B;  5LBQ A;  1IUR A;  4X1K A;  3PN1 A;  1THZ A;  3N2G A;  1XRE A;  4LF5 B;  1SS3 A;  3HPL C;  1PKX A;  3ZMV A;  1HW7 A;  2X7R B;  1NVP B;  3FX7 A;  2ZNJ A;  4TQD A;  1HP8 A;  1R6N A;  5ITZ A;  4NTW A;  1BL8 A;  3JAW A;  1GH6 A;  1VQP V;  5B3S B;  1WLE A;  3I55 V;  1IBM O;  1N33 B;  1KYO F;  2E5L B;  4O2B B;  2P67 A;  5K1X A;  1PNK A;  5LA6 A;  3T1Y O;  1RP3 B;  1VF6 A;  4TWK A;  1YIT V;  4J80 A;  4DR3 B;  5LOV A;  1BZK A;  2V1D A;  1R6T A;  4PA7 A;  3AG1 C;  1K97 A;  2YUA A;  1I7F A;  2LP7 A;  4O4J B;  4X1I B;  2CDY A;  4LF9 B;  4IL6 Z;  2WAM A;  1G8M A;  3JCZ A;  4L8J A;  4NTY A;  2JRI A;  3G67 A;  3SYP A;  5CB4 A;  4AI8 A;  3KCY A;  1JX9 A;  3UT5 A;  4DV0 B;  5L3G A;  2GDS A;  1ZUQ A;  3WU2 Z;  5B1A B;  2R72 A;  2ETN A;  4DR5 O;  3T1Y B;  4I55 B;  1QLE C;  2W6J G;  2Q4P A;  1WPB A;  4TSF G;  4KP4 A;  1JQ0 A;  1MNG A;  2BSK B;  4CS4 A;  2JEX A;  4U7N A;  1GMG A;  2A79 B;  3CRM A;  4FM2 A;  2ZR3 A;  4B3M O;  3OMN B;  5B1N A;  2UU9 O;  3VQY A;  1GN4 A;  4ZHQ B;  4GKJ B;  3ZIA G;  3CD6 V;  2ATK C;  3TET A;  1Q8I A;  2XOK G;  3RYH A;  4ZI7 A;  2EZO A;  4PDL A;  2IJJ A;  5IWA O;  1I94 O;  3X2Q C;  2D3O W;  3N2K A;  2VQF B;  2Y4T A;  2ZKO A;  1NVP D;  1IBL O;  4PD4 F;  2UU9 B;  4MVM A;  5EYP A;  3M7M X;  4H13 B;  4LH7 A;  1V54 C;  4B7K A;  1F4M A;  2EX3 A;  2LGW A;  3VQW A;  1ZX3 A;  4DV6 O;  1H2G A;  1PV0 A;  4R8C A;  4WFE A;  3SYC A;  4CS3 A;  1FXK B;  4BIU A;  1M56 B;  4I9Q A;  4GLX A;  2ZE5 A;  2C2A A;  2HR3 A;  3LDC A;  2IBZ H;  3U0Z A;  1BS3 A;  3T4Z A;  1UPG A;  3ZBH A;  1N0J A;  1XMO O;  1DF5 A;  1Y74 B;  2IJI A;  4U3J A;  3ZRW B;  3CCL V;  1K73 W;  2CE4 A;  2JIZ G;  1TA8 A;  5A2Q N;  3GWO A;  1F7Y A;  1QBZ A;  5EC2 C;  1R3L C;  2IJH A;  3B40 A;  1SQP H;  1VEW A;  1TVK A;  1XMQ O;  4ZBM A;  4W4K A;  4X65 B;  4P2Z A;  4QE7 A;  4RQE A;  1G4Y B;  4DR6 O;  1VQ4 V;  3CSX A;  1GTO A;  1N32 O;  3HKC B;  1VIB A;  4P9O A;  1GN2 A;  2CH7 B;  3BFR A;  1L8D A;  2QR4 A;  3OUS A;  3RFR A;  2P22 C;  3UO2 A;  4P30 A;  3RN4 A;  2Q68 A;  3K5N A;  2YXL A;  4IHJ A;  4BWA A;  3AEI A;  3AG3 B;  4DR7 O;  4WFG A;  3S3W A;  4NXM O;  4DR6 B;  1IXM A;  4LH6 A;  1DK1 A;  2DN9 A;  4JYA B;  5KA6 A;  4DRX A;  1S5L Z;  3IAY A;  1KKC A;  2YEV A;  5LXT A;  2DYS B;  2YXH A;  2YIC A;  3CPW U;  4FLX A;  1YHQ V;  2UXB O;  1SES A;  4RUF A;  1WB8 A;  3JD4 A;  4NXM B;  4JI0 O;  2ADQ B;  1PL4 A;  4WCE V;  2Y4U A;  3M99 B;  4XDJ A;  1XL4 A;  4X1K B;  1YZB A;  4LFC O;  2BE3 A;  4UCR A;  1DTO A;  4EKW A;  5GTH Z;  2XND G;  3ZRX A;  2WLL B;  3F5T A;  3LDE A;  3QF7 A;  1COW G;  5LHH A;  3RGB A;  3K9S A;  4ZIB A;  1VQM V;  3CC2 V;  5JH7 B;  4RUE A;  3JAW B;  2X6C A;  1XDC A;  2YS8 A;  3CEI A;  5EZY B;  1HNZ B;  4PA3 A;  1NT2 B;  1IXB A;  5EBM C;  4MTF A;  1ZLZ A;  2EIN B;  4F6R B;  4CH4 A;  2UUC O;  5LA6 B;  3EHB B;  4N21 A;  2BTO A;  5GON B;  3SPG A;  3OTO B;  1YF2 A;  3JD0 A;  2ZE6 A;  4JI4 B;  5L3D A;  2YID A;  4UVA A;  3CCR V;  4MVS A;  3W7S A;  3GB7 C;  3ZRS A;  1YIJ V;  3ZMU A;  3RWR D;  5CA1 B;  2G38 A;  2BOB C;  3ZHQ A;  4GX1 A;  3RYF A;  1SF9 A;  4BW9 A;  4WBN B;  3ASO C;  1WNS A;  1Q3E A;  2QDO A;  3P32 A;  4B3R B;  1XL6 A;  1BHB A;  1Y4M A;  5LYJ B;  3QTC A;  1VQK V;  2QGN A;  4OGQ B;  3B2E E;  1ZTE A;  5E79 Z;  4QIW F;  1Y6X A;  4P9P A;  1M4U A;  2B9Z A;  4FVM A;  4F4L A;  3H1H H;  4J7J A;  2F23 A;  2IH3 C;  2PI4 A;  2QM7 A;  4H33 A;  3G71 V;  1N36 O;  4RWU A;  5JQG B;  1LUV A;  3BY6 A;  1K34 A;  1VQO V;  2WLJ A;  4RAI A;  2V4D A;  2BTQ B;  2EIJ B;  4UCO A;  5JJE B;  1YJN V;  1L1F A;  5KAF Z;  3UQ8 A;  5BXZ A;  5LHG A;  1Z5W A;  4UCU A;  5IYZ A;  2UXX A;  4ASU G;  3ZN1 A;  2WA3 A;  5EIB D;  1V9P A;  4JYC A;  2P7T C;  1O9G A;  4K8Z A;  3FB6 C;  5LMU B;  3CRC A;  4BIO A;  1MA1 A;  3FB5 C;  4DV2 O;  1OCR B;  4X62 B;  2YC0 A;  4FLY A;  3K5O A;  1NTZ H;  3BAA A;  1B3Q A;  5BMV B;  3H01 A;  2Y69 C;  1XUQ A;  5B1B B;  1IDS A;  4WF9 V;  2UXC O;  1OCZ C;  4R50 A;  1ENV A;  1Z5V A;  2ITD C;  3OM3 B;  3J7A U;  1RPR A;  1N34 B;  2XAQ A;  3E8F A;  1JVM A;  2LW1 A;  5JWP A;  4KXR A;  1L0L H;  4EB6 A;  1OJH A;  3BPZ A;  3KG2 A;  3EVK A;  4TT3 G;  5KLV H;  1VP7 A;  4XBF A;  1SZX A;  3RYI B;  2X6A A;  1SA0 B;  1ROP A;  5JJN B;  5KHI A;  5IDJ A;  3FAV A;  4FZ0 A;  2R70 A;  1XI1 A;  2GUZ A;  4UCT A;  4GKK B;  2FML A;  1KMI Z;  4PHZ A;  1KB9 F;  1M57 B;  1W59 A;  3GVM A;  3RYC B;  4FLU A;  2JJ1 G;  1Y76 A;  2CTP A;  5H6R A;  1EM1 A;  2A3Q A;  2RMK B;  2PYL A;  3JAK B;  5IJ9 A;  2QEX V;  3DXR B;  4TUY A;  1S0V A;  4FFB A;  2LJ2 A;  1S77 D;  1OHH G;  5L3B A;  1A32 A;  4WFB V;  1SQF A;  4F6E A;  1QNM A;  4YIO A;  1X59 A;  4D7S A;  1ZL8 A;  5KX5 B;  1AR5 A;  4E4E A;  5IJ0 B;  4GUN A;  2UUA B;  4TV8 B;  4DV7 O;  1QHT A;  5H2F Z;  2YSU B;  2WLI A;  3E35 A;  5B1A C;  3WG7 C;  4X89 A;  3ZCC A;  1K7D A;  2KKW A;  2LGQ A;  2XUM A;  4O4H B;  1H2S B;  1MZE A;  3E83 A;  1SER A;  1Q7Y W;  4YHH B;  3K79 A;  2GBO A;  3ZJZ A;  2XTA A;  4MTX A;  3K08 A;  2YEV B;  1XNQ O;  2YIB A;  1TUE B;  1D5A A;  3OW2 U;  3DSQ A;  3TGU H;  2Y0I A;  1O9H A;  4LF6 B;  3BCC H;  3JSN A;  1SQQ H;  3T1H O;  1YXB A;  4WFA V;  4UB6 Z;  1JR9 A;  3E8G A;  1G6U A;  4JF3 A;  5BY1 A;  2XAJ A;  3HKE B;  4DW1 A;  2GSM B;  4LNU B;  3SGI A;  3SPJ A;  2JGD A;  2DYR B;  1J5E B;  1Q6H A;  4FLZ A;  3JAT B;  3ZMT A;  4JI1 O;  2PTM A;  2JDI G;  2UXN A;  3WB2 A;  4B7E A;  3JAL B;  5L3C A;  2IM9 A;  2YIA A;  4E2L A;  4PDR A;  4X20 A;  5LP6 B;  2DQ0 A;  1SQG A;  2QWR B;  1I5X A;  3L73 H;  3APQ A;  4JI7 O;  4MVR A;  2DWD C;  1FPO A;  3KZI Z;  4K8X A;  4JI8 B;  1HDJ A;  3E22 B;  4X1Y B;  1ARO P;  4GX5 A;  3B4S A;  3DC6 A;  1E1R G;  1OCC C;  3O9O A;  3JSL A;  1BMF G;  2E75 B;  5C93 A;  4IIJ B;  3CJH B;  3JAR A;  1QR8 A;  1NR1 A;  3D3Q A;  1FD9 A;  4J9Y B;  4PJ0 Z;  4Q20 A;  3F7V C;  4BW5 A;  2QM8 A;  5L3E A;  4DR1 O;  2QJ1 A;  1MZF A;  4O4I B;  3GWK C;  4I50 A;  1HR0 O;  2Q7E A;  2AHY A;  4JAS A;  4GX2 A;  5C8Y B;  2XAF A;  1JCH A;  2K1E A;  2ARH A;  3OUF A;  3FD9 A;  4FM0 A;  4JI5 B;  1AI5 A;  1KEC A;  5KMG B;  3MAQ A;  5FPR A;  4NYK A;  1H8H G;  3CC7 V;  4OXS A;  3CP1 A;  1S5H C;  1OCO C;  1AP5 A;  5E1A C;  3K3W A;  5J2U B;  4X66 O;  1M93 A;  1S5J A;  1NU1 H;  1IVS A;  2Y0P A;  1VQN V;  1VMG A;  3TCU A;  3IC7 A;  1BT8 A;  3AG7 A;  3OEE G;  1YJW V;  2ZIN A;  1IBM B;  5IYC O;  4OPA A;  4X8A A;  2EIK C;  3A0R A;  4O2A B;  1JJ2 U;  1Q5O A;  3PJS K;  2FKX A;  1D2D A;  3CE2 A;  3W7X A;  3NR7 A;  1XIL A;  2YI8 A;  4TV9 A;  2IW5 A;  2Q67 A;  5J2T B;  3CX5 F;  2JS5 A;  1LNQ A;  4XDL A;  2LQT A;  3ABM B;  1R73 A;  2EIL C;  5EIB C;  1RSO B;  4OX9 O;  4H37 A;  4DR5 B;  4X64 O;  1XQ8 A;  5KAI Z;  4MVO A;  3KKY A;  2ZIM A;  3HKD A;  4K3A A;  1MSW D;  1R3I C;  4FMT A;  4PV1 B;  3ZHR A;  1TUB B;  3L75 H;  4DYL A;  2ZE7 A;  4JGS A;  1WP8 A;  4NB5 A;  1R1B A;  1MG1 A;  5BZB A;  4B3M B;  2B1G A;  1JA8 A;  4TQF A;  3CC4 V;  4LFA O;  3VOU A;  4G27 B;  4Z1M G;  2EBO A;  3TXS A;  4JAU A;  4RQF A;  2HVJ C;  3W7W A;  2CTR A;  4NXN O;  2WLI B;  2ZE8 A;  1J95 A;  4B3T O;  5IWA B;  1I94 B;  2UUB O;  4FK5 C;  4DUZ O;  4AQY O;  2VS0 A;  2B1I A;  3LUT B;  2OCH A;  4QNH B;  1RPO A;  4O4L A;  3B8N A;  4LFB O;  1IBL B;  4JI2 O;  2Q69 A;  3OE7 G;  4UV9 A;  3OMA B;  3JD1 A;  1SQB H;  4JI6 O;  4DV6 B;  4MVZ A;  3H9V A;  1WAZ A;  4KUM A;  1S72 V;  3OMI B;  3C90 A;  1NH2 B;  1FXH A;  2UUB B;  4DUZ B;  1W0J G;  2CUG A;  4AQY B;  2NN4 A;  5FNV A;  4LFB B;  1F23 A;  3ABT A;  4JZG A;  4YJ2 A;  3ABL B;  3P3N A;  1BCC H;  5JVD B;  4UVC A;  1N8R W;  5KHJ A;  2AGA A;  1CPY A;  1XMO B;  3K5L A;  1PM9 A;  4JI6 B;  1XHX A;  4FM1 A;  1ZAU A;  3SPH A;  3JAS A;  4GX0 A;  2PF4 E;  1WA8 A;  1QQC A;  3Q4H A;  2KG7 A;  4ZOL B;  5FL7 G;  3ZHS A;  1QVG U;  4H44 B;  3CYO A;  2ILM A;  3K0D A;  3ASN B;  3ABK C;  3UO3 A;  2WLN A;  3CWB H;  2O57 A;  1XMQ B;  4K0K O;  5CA0 B;  5CBH A;  1R6K A;  2A0L A;  5B5E Z;  1SRY A;  1AJP A;  3AG2 B;  4HNA B;  1DF4 A;  1V55 C;  3E2E A;  1N32 B;  1JFF A;  1FXV A;  1WPX A;  5IY5 C;  3UCS C;  2GHY A;  4YJ3 A;  4DR4 O;  5K1P A;  1B06 A;  4FJC C;  2ZM6 O;  4J41 A;  4MVU A;  1PD3 A;  3AG1 B;  4DR7 B;  5LMN O;  5EBL C;  4JV5 O;  3N2G B;  2VQE O;  2F1M A;  2PGG A;  3K9A A;  4I50 B;  2X6B A;  3AG4 C;  1XNR O;  4QGP A;  3K57 A;  1FFT B;  4MTO A;  2ITC C;  5IYB O;  1NH2 D;  3OFN G;  2WPD G;  5ITZ B;  1K3E A;  3J81 N;  3H1I H;  2K9P A;  2RJZ A;  2ZM6 B;  1DLB A;  2UXB B;  2DE0 X;  1YTF B;  3H1J H;  4JI0 B;  4YIP A;  2F4V O;  3K58 A;  5LOV B;  1P7B A;  4LFC B;  5JCO C;  2HLD G;  1FFX A;  2H8P C;  2VQE B;  2M6Y A;  2DOS A;  2BCC H;  4PDM A;  1GM8 A;  2Q6A A;  1VF7 A;  2QE7 G;  2WLH A;  3LSQ A;  2GTA A;  3ZHV A;  1VQ6 V;  3LSS A;  5CB4 B;  4I0X A;  1HNX O;  4DV1 O;  3X2Q B;  3UT5 B;  3ML0 A;  3CS5 A;  2RCV A;  2UUC B;  2GV9 A;  1K33 A;  4LWS A;  1EZJ A;  4CH5 A;  4QPK A;  1Q6U A;  1KQS U;  3BHP A;  4MSW C;  5FPO A;  4FLT A;  4IYH A;  3D3I A;  1P84 F;  4KHP O;  1BQ0 A;  4HYO A;  3HKB A;  1Q43 A;  2OCC C;  1AP6 A;  1YCI A;  2FB5 A;  1SC5 B;  2H3O A;  1XOU A;  2W6I G;  1N0N A;  2LW7 A;  2Y48 A;  3I56 V;  1K5Q A;  2IJK A;  1F51 A;  3AK3 A;  3RYH B;  3QG5 A;  4ZI7 B;  4I4T A;  4ABM A;  2RNB A;  3IC9 A;  5KA5 A;  5BR8 O;  3N2K B;  5D5P A;  4IT5 A;  3CCS V;  4CH3 A;  1AR4 A;  2OTL V;  2A9H A;  3CRR A;  5JJJ B;  5H6Q A;  3WB1 A;  5EYP B;  1FS0 G;  1N36 B;  1RM1 C;  3BEH A;  2KB1 A;  1YTF D;  4O2B A;  1SZT A;  4UVB A;  5A9G A;  2A06 H;  1GM9 A;  2BOC C;  2N05 A;  3H1L H;  4DV3 O;  3APO A;  1KP2 A;  2V7Q G;  5BR8 B;  4IYI A;  1US6 A;  2Q8V A;  3G80 A;  1HNW O;  4LC1 A;  3SPI A;  1VQ9 V;  1SQV H;  2UXD O;  4O4J A;  2FYU H;  4X1I A;  4C7U A;  5GW7 A;  2LFR A;  3IGA C;  1YI2 V;  3JD3 A;  1XHZ A;  4U3J B;  2Q0O C;  4DV2 B;  4TOI A;  3K06 A;  4R7C A;  3W7T A;  4I55 A;  4JZ2 A;  3B09 A;  5DEC A; 
#chains in the Genus database with same CATH homology
 5B3S C;  1F4M A;  2CK3 G;  1UJW B;  3CCM V;  1E1R G;  1OCC C;  4HAM A;  1H2G A;  4R8C A;  1BMF G;  4WFE A;  3SYC A;  4CBC A;  2EIL B;  1H8E G;  5C93 A;  1VQL V;  5H9C A;  1FXK B;  1Y66 A;  4BIU A;  1M56 B;  2C2A A;  2HR3 A;  3LDC A;  1QR8 A;  3VBB A;  2HG5 C;  1NR1 A;  2ZXW C;  3RVZ A;  5EBW C;  3B77 A;  4J9Y B;  4Q20 A;  3F7V C;  4BW5 A;  2QM8 A;  4FIP C;  5L3E A;  3T4Z A;  1AI6 A;  5HFL A;  3G4S V;  4PA6 A;  1DF5 A;  3ABU A;  2IJI A;  4R6Z A;  2AHY A;  1H38 A;  4WFF A;  3CCJ V;  1S3J A;  1VQ8 V;  1HWY A;  2OT5 A;  3QO8 A;  4JAS A;  3ZRW B;  4GX2 A;  3CCL V;  1K73 W;  2JIZ G;  3GWO A;  4U7O A;  2XAF A;  1QBZ A;  1V54 B;  4HZ3 A;  5EC2 C;  1K92 A;  4MW8 A;  1R3L C;  3STZ C;  2IJH A;  3CME V;  1EBO A;  1JCH A;  1CEZ A;  2K1E A;  3QO5 A;  3OUF A;  1AI5 A;  3ETD A;  1KD1 W;  1KEC A;  2IH1 C;  3FB7 C;  2DYR C;  1H8H G;  2ZR2 A;  4ZBM A;  4OXS A;  1NR7 A;  3CP1 A;  3CC7 V;  1S5H C;  1OCO C;  2ZXW B;  4P2Z A;  1FXK A;  5E1A C;  1NBM G;  4QE7 A;  4RQE A;  1G4Y B;  3K3W A;  3UM7 A;  1VQ4 V;  1VQN V;  4JAV A;  4BAY A;  4QE9 A;  3TCU A;  1GTO A;  3IC7 A;  1AR1 B;  3OEE G;  1YJW V;  4P9O A;  1QR9 A;  1AI4 A;  5IYC O;  3JD2 A;  5EK0 A;  1I5Y A;  4X8A A;  2EIK C;  3OUS A;  3A0R A;  3OAA G;  2R9I A;  1JJ2 U;  3QO7 A;  4JPR A;  4P30 A;  2Q68 A;  3PJS K;  3ZRW A;  3E86 A;  3W7X A;  4I9W A;  3ASO B;  3D36 A;  3AEI A;  3AG3 B;  1MOF A;  4RO2 A;  1AI7 A;  2IW5 A;  2Q67 A;  3B8M A;  4WFG A;  4WFH A;  4DO2 A;  1LNQ A;  1IXM A;  4JTC B;  2AHZ A;  4XDL A;  3CXC U;  3P30 A;  1EFR G;  4PDV A;  1YSC A;  2EIM C;  3T2M A;  3ABM B;  4MTG A;  5KA6 A;  1R73 A;  2EIL C;  5DM6 V;  2X0L A;  1FXK C;  2YEV A;  2B5U A;  1BHA A;  1M56 C;  4H37 A;  3MHH C;  2WSS G;  1Q86 W;  1W0K G;  2DYS B;  3HB3 B;  3CMA V;  3CPW U;  4MVO A;  1YHQ V;  1SES A;  4RUF A;  3JD4 A;  1MSW D;  1R3I C;  4FMT A;  2IU3 A;  3ABK B;  4XDK A;  2EJR A;  4JGS A;  4WCE V;  3M99 B;  2FTK A;  1MG1 A;  2NLJ C;  3ETG A;  1XL4 A;  4XDJ A;  5BZB A;  2QTO A;  3WFV A;  4G28 B;  2B1G A;  1K4D C;  4EKW A;  1DTO A;  2JJ2 G;  2WLK A;  5KUM A;  2XND G;  3ZRX A;  4DXW A;  3CC4 V;  3VOU A;  4G27 B;  2WLL B;  3RW0 A;  4Z1M G;  1V55 B;  2EBO A;  3LDE A;  1R3K C;  1COW G;  3LDD A;  5CBG A;  3R65 A;  4JAU A;  2EIM B;  4RQF A;  5LHH A;  2HVJ C;  1K4C C;  3W7W A;  1VQM V;  3CC2 V;  3E89 A;  1K8A W;  4RUE A;  5B1O A;  2WLI B;  5IY5 B;  2JK5 C;  2X6C A;  1J95 A;  1YJ9 V;  1AJN A;  4KFM A;  4PA3 A;  1E79 G;  4FK5 C;  4PA4 A;  2WLM A;  4MTF A;  5EBM C;  1MAB G;  2B1I A;  2EIN B;  3LUT B;  1B6Q A;  4QNH B;  1RPO A;  3B8N A;  3EHB B;  4N21 A;  1R3J C;  3ZMS A;  3SPG A;  3JD0 A;  2ZQM A;  5J9P C;  2Q69 A;  3OE7 G;  4UV9 A;  5L3D A;  3OMA B;  4UVA A;  3CCR V;  2Y69 B;  4MVS A;  1PNM A;  3ETE A;  3K0G A;  3EFF K;  3GB7 C;  3JD1 A;  3ZRS A;  3W7S A;  2EZP A;  3ZMU A;  1YIJ V;  3CCE V;  1SET A;  4G2K A;  4MVZ A;  1VQ5 V;  1OCZ B;  2BOB C;  3T4D A;  4LBE C;  4GX1 A;  4KUM A;  3AG4 B;  2NNU A;  2LFS A;  1S72 V;  3OMI B;  4FPP A;  3DGE A;  1NH2 B;  1FXH A;  3ASO C;  1CP9 A;  1F4N A;  1W0J G;  2WLL A;  3AG3 C;  4QJF B;  3P32 A;  3TK1 A;  1KKD A;  3FYI B;  1XL6 A;  2QKS A;  3AG2 C;  3JYC A;  1BHB A;  2QA4 V;  1F23 A;  1Y4M A;  3ABT A;  1E1Q G;  4GT1 A;  3ABL B;  4UVC A;  4BIZ A;  1VQK V;  1N8R W;  1CPY A;  3ABM C;  2OTJ V;  4GCZ A;  4QIW F;  3CCQ V;  1QCE A;  3SYQ A;  4P9P A;  2XAH A;  3E8B A;  4F4L A;  1QVF U;  1PL0 A;  2XAS A;  3SPH A;  5L3F A;  1GK9 A;  4GX0 A;  2DYS C;  1QLN A;  2IH3 C;  4JTD B;  5FL7 G;  1QVG U;  2PI4 A;  2QM7 A;  3IFX A;  5DN6 G;  4H33 A;  3G71 V;  3SPC A;  1M90 W;  3BY6 A;  1K34 A;  3CYO A;  2R9R B;  3K03 A;  1VQO V;  2WLJ A;  4RAI A;  3K0D A;  3ASN B;  3ABK C;  4X88 A;  2WLN A;  1Q81 W;  2EIJ B;  5CBH A;  1R6K A;  2A0L A;  5CA3 A;  1YJN V;  1Q82 W;  3CCU V;  4MT8 A;  1L1F A;  1S76 D;  1M1K W;  1SRY A;  1AJP A;  3AG2 B;  1DF4 A;  3OGC C;  1V55 C;  5LHG A;  5IYD O;  1K5S A;  2HJF C;  3E2E A;  2F43 G;  2UXX A;  3WG7 B;  4ASU G;  3ZN1 A;  1FXV A;  3T1C A;  1WPX A;  5LGU A;  5IY5 C;  4JYC A;  2P7T C;  5LHI A;  2ZDI A;  3FB6 C;  2GHY A;  3QNE A;  4LCU C;  2OCC B;  3E8H A;  2EIN C;  3FB5 C;  1OCR B;  2HFE C;  3MHS C;  4FJC C;  5KUK A;  4MVU A;  1GO3 F;  4JTA B;  1PD3 A;  3AG1 B;  3H01 A;  4I5S A;  3RBZ A;  2H94 A;  2Y69 C;  5B1B B;  5CMU A;  3ZMZ A;  3ZN0 A;  5CN0 A;  4WF9 V;  4MVQ A;  5EBL C;  1OCZ C;  4R50 A;  1ENV A;  2ITD C;  3K9A A;  1W2B U;  3OM3 B;  2X6B A;  2DQ3 A;  4N23 A;  4UV8 A;  3AG4 C;  1JPX A;  1RPR A;  2DW4 A;  2XAQ A;  3E8F A;  1JVM A;  1FFT B;  4MTO A;  2ITC C;  5IYB O;  1NH2 D;  3OFN G;  2WPD G;  1K3E A;  3KG2 A;  3CCV V;  2PI5 A;  4TT3 G;  3SJQ C;  4XBF A;  1DLB A;  4YXW G;  2ZD9 A;  3W7U A;  3ABL C;  3MD0 A;  1P4R A;  2X6A A;  1RM1 B;  2ZDI C;  1ROP A;  3SYA A;  3FKS G;  1YTF B;  5IDJ A;  5CBF A;  2IU0 A;  1P7B A;  2MK3 A;  4UUJ C;  1M57 B;  2HLD G;  2H8P C;  2JJ1 G;  4UXN A;  3F7Y C;  5H6R A;  3OEH G;  4PEL A;  3G6E V;  1JOY A;  4PDM A;  3FYE B;  2DWE C;  1NJI W;  1GM8 A;  2QEX V;  2Q6A A;  2W0F C;  1S0V A;  3NXS A;  2QE7 G;  2WLH A;  3LSQ A;  3ASN C;  1PNL A;  1VQ6 V;  3LSS A;  5LBQ A;  1S77 D;  1OHH G;  5L3B A;  4WFB V;  2EIJ C;  1THZ A;  2JEU A;  1KC8 W;  3X2Q B;  1KP3 A;  3HPL C;  3ML0 A;  1PKX A;  3ZMV A;  2X7R B;  2P6J A;  1M9N A;  1NVP B;  1K33 A;  1EZJ A;  4QPK A;  2XAG A;  1R6N A;  1NKD A;  2YSU B;  2WLI A;  1BL8 A;  4J9Z B;  3STL C;  3E35 A;  5B1A C;  3WG7 C;  3OR7 C;  1VQP V;  4X89 A;  1KQS U;  3ZCC A;  1WLE A;  4MSW C;  1K7D A;  5B3S B;  3I55 V;  1OCC B;  3D3I A;  2P67 A;  4HYO A;  3E83 A;  1PNK A;  2OCC C;  1SER A;  1Q7Y W;  4TWK A;  1YIT V;  3K79 A;  1OCR C;  3SYO A;  3ZJZ A;  4MTX A;  3K08 A;  2V1D A;  4PA9 A;  2YEV B;  4PA7 A;  2W6I G;  1K97 A;  2Y48 A;  3AG1 C;  3DTU B;  1GKF A;  2LP7 A;  5HFM A;  1TUE B;  3I56 V;  1K5Q A;  2IJK A;  1F51 A;  5B1B C;  2WAM A;  1G8M A;  3OW2 U;  3JCZ A;  5KA5 A;  2Z5U A;  3SYP A;  2WWW A;  3CCS V;  2Z3Y A;  1JX9 A;  5L3G A;  2OTL V;  2A9H A;  5B1A B;  3UKM A;  4WFA V;  5H6Q A;  1QLE C;  2W6J G;  3OR6 C;  3E8G A;  1FS0 G;  4TSF G;  4JF3 A;  4KP4 A;  1JQ0 A;  2XAJ A;  4L87 A;  1RM1 C;  2M7W A;  5LGT A;  1GM7 A;  1K9M W;  5LGN A;  3BEH A;  3LNM B;  2JEX A;  2GSM B;  2KB1 A;  3SPJ A;  1YTF D;  4U7N A;  1SZT A;  4UVB A;  2DYR B;  4ZKI A;  1GMG A;  2A79 B;  1GM9 A;  1OCO B;  1ORQ C;  2ZR3 A;  2BOC C;  3ZMT A;  3OMN B;  1M57 C;  5B1N A;  1KP2 A;  2V7Q G;  2JDI G;  2UXN A;  3ZIA G;  4JYB A;  3CD6 V;  5L3C A;  4LC1 A;  3SPI A;  2ATK C;  3FB8 C;  3TET A;  4E2L A;  1VQ9 V;  4PDR A;  2DQ0 A;  1I5X A;  1VQ7 V;  5GW7 A;  2LFR A;  2XOK G;  2HVK C;  5EC1 C;  4MVR A;  3IGA C;  2DWD C;  1YI2 V;  3K04 A;  3ZRV A;  2EZO A;  4PDL A;  3JD3 A;  2IJJ A;  2EIK B;  2P90 A;  3X2Q C;  4CZZ A;  2D3O W;  1QLE B;  3K06 A;  4R7C A;  2HKO A;  3W7T A;  1OZ0 A;  4LP8 A;  1NVP D;  4QPJ A;  1ARO P;  1ZWI C;  1AJQ A;  4GX5 A;  4MVM A;  1NQT A;  4MW3 A;  3RVY A;  3F5W C;  1V54 C;  4MS2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...