2OT5A

Crystal structure of the hiv gp41 core with the enfuvirtide resistance mutation n43d
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
67
structure length
67
Chain Sequence
b'SGIVQQQNDLLRAIEAQQHLLQLTVWGIKQLQARSGGRGGWMEWDREINNYTSLIHSLIEESQNQQE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 gp41 glycoprotein
molecule tags Viral protein
source organism Human immunodeficiency virus type 1
publication title Impact of the enfuvirtide resistance mutation N43D and the associated baseline polymorphism E137K on peptide sensitivity and six-helix bundle structure.
pubmed doi rcsb
total genus 29
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 2007-02-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2ot5A00
1K33A 3M99B 1K34A 2LP7A 5HFMA 5KA5A 2X7RB 1JPXA 1DLBA 1MG1A 1QCEA 5KA6A 1I5XA 1Y66A 1SZTA 2EBOA 2M7WA 3B8NA 1DF4A 1ENVA 3GWOA 4FK5C 3MHSC 3CYOA 1QBZA 5CMUA 1F23A 3WFVA 1DF5A 1I5YA 1EBOA 2EZOA 1QR9A 2P6JA 4N23A 1Y4MA 2OT5A 4FJCC 5CN0A 4JGSA 2MK3A 4FIPC 2EZPA 4JF3A 4JPRA 1QR8A 4E2LA 3K9AA 3CP1A 3H01A 1JQ0A 1MOFA 3B77A 3B8MA 3MHHC 4G2KA 4N21A 3P30A 5H9CA 5HFLA
chains in the Genus database with same CATH superfamily
3B09A 4IYIA 5FPOA 2NLJC 2LO1A 1VQ6V 3CCUV 2EIMB 3OMNB 1GN4A 5FL7G 4JYAB 1E1RG 4HZ3A 1VQ4V 1RP3B 4JGSA 1RSOB 1BL8A 2UU9B 4X1KA 1Z2GA 3Q4HA 3L71H 5HFLA 4F6EA 1QU7A 1M57C 3JSNA 4K35A 2HKOA 3L74H 2QWOB 2WLJA 4DR1B 4NR1A 4P30A 4AQYB 3ETDA 3K03A 3OAAG 4TUYB 2PY5A 2Z0AA 1XBLA 2N74A 1BMFG 1KECA 3MAQA 1URFA 4UCOA 1VQ8V 4P9PA 2CGNA 1K5SA 1PD3A 5J2TB 2OYQA 5LXTB 4B3TO 2Q8VA 1V9PA 5CA1A 2HJFC 2QM8A 5BZBA 4DV1O 3CYOA 3CC4V 1VQKV 2LJ2A 1XQ8A 4KUMA 2GDSA 4KP4A 1XMQO 1NU1H 3H1LH 1D2DA 3LSSA 3WB2A 2WAMA 1VARA 1OCRC 5L3GA 4U3JA 3K5MA 2QTSA 3R66A 5B1AC 2BSKA 4I0XA 1NR7A 2G38A 4O2AB 1K3EA 2VQEB 1K4DC 4I9WA 3BA8A 4BAYA 5ITZB 3WG7B 1KP2A 1IXMA 1TGOA 1ZSPA 4OGQB 4X65B 1FKAO 4LNUA 3N2KB 3QG5A 2WLIA 1VQ9V 1ZWIC 2HJDA 1JOYA 2K1EA 5GONB 1OCOB 1K97A 4QGPA 1FJGO 1YXBA 4DUYB 1CXZB 2CK3G 4K8ZA 3JALA 1PNMA 3WB1A 5CA3A 5KHHA 1JQ0A 4GX0A 2C2AA 2KB1A 1FXHA 4UCVA 4FPPA 3AG4B 2JGDA 4AHCA 1H2NA 2B5UA 3ZHSA 5IY5B 3DC5A 1M56B 2M6YA 5DM6V 1WB7A 1VP7A 1VQMV 3VOUA 3WFVA 2ZIMA 4JI4O 4H33A 4JI7B 1JX9A 3SYOA 4JYBA 4BR6A 4JF3A 3RT3C 3W7UA 3SJBC 2ZE7A 5KX5A 3P30A 4NYKA 4WBNA 3T1YB 1NS1A 4WFGA 3TGUH 5CBHA 2ZQMA 2OWOA 3STZC 3OUSA 1KC8W 5L3CA 4DR7O 2VWJA 2VQFO 2H94A 4MTXA 4PDRA 2BOCC 1NVPD 2Y4UA 1EM1A 5LHGA 4TV8A 2VQFB 4DR7B 5LA6A 1SERA 1QLEC 4NB5A 1NZ6A 4HAMA 1B04A 2QR4A 1XDCA 2Q68A 2WSSG 4X8AA 5LP6C 5KUKA 3ZMZA 4ICGA 3CXCU 2ZNIA 4QIWF 4LFCO 2ZM6O 3EXAA 1XMOB 5EIBD 1R3JC 2D2CB 4JI7O 3HKEB 4X66O 5CBFA 1S77D 1I5XA 1PP9H 1XOUA 4I4TA 4NXNB 4LWSA 4DR5O 4O4IA 1PM9A 1BSMA 1ZL8A 1SKVA 5BR8O 4UV8A 2AHYA 3SPGA 4X62B 1Y74A 1S3JA 2WLKA 3AG1C 2B9ZA 4U7NA 2Q7EA 3FKSG 1QNMA 3K59A 2UUCO 4GT1A 1GM8A 1J5EO 1G4YB 3G6EV 1RSOA 4O4JB 1Q6HA 3JAKA 2YDEA 3I55V 4UCTA 3E22B 2DMXA 5H6RA 4TV9A 2B1IA 1HNXB 4FMTA 3IJ4A 3B8MA 3G71V 3JD1A 3SJCC 4DUZB 2ZDIC 1SF9A 3QNEA 2XAGA 1YHQV 4L87A 1HP8A 4QPKA 3CRRA 1AVMA 5BXZA 1JFFA 1RM1C 3ZEDA 3ZRSA 5A2QN 3WU2Z 4CH5A 4JPRA 2EILB 5E79Z 4IGGA 3RWRD 1Y74B 1WNSA 4DV4O 3IC7A 2P67A 1N34B 1NTMH 1YITV 1WA8B 5FNVB 1SZTA 1DF4A 3K9SA 3JD2A 2QE7G 4JI6O 4J9ZB 1PNLA 3JALB 2DOSA 4MVQA 1NKDA 3T1HO 1AI5A 4NVPA 1XHZA 1H38A 2ADPA 3CJHB 4DYLA 4B3MB 4YY3O 3MHSC 1WJZA 4UB8Z 3H1JH 1YZBA 2YEVB 2ZXWC 3CRMA 4EFBA 1EBOA 1LUWA 1M93A 1ROPA 2OCHA 4TQFA 4UFZA 1EN4A 5H2FZ 1M5IA 3OEEG 1R3IC 2P22C 4YJ2B 1SRYA 4ZBMA 3CX5F 3RVZA 1PNKA 2QSAA 1EN5A 3K0DA 1VF6A 2L35A 1X4TA 2DE0X 1AJQA 1P7GA 4NTWA 4CH3A 1I94B 3ZRWA 2LW1A 3VQVA 4UVBA 5GW7A 2CE4A 4GUNA 3T1HB 4CS4A 1GK9A 4R7CA 1R3KC 2DYSC 3PN1A 4DXWA 3FD9A 3L70H 4ZHQA 4LNUB 2CAZC 2BOBC 2QM7A 4EKWA 1P4RA 3LSUA 3UT5A 2ZIOA 2HR3A 3EVKA 3CMAV 2PGGA 2EIKB 1SZXA 1K92A 3CRAA 3BRCA 4LF5O 3ZMUA 3TK1A 5H6QA 3SJQC 1N36O 1GH6A 4FM1A 1B06A 4J80A 5JCOA 2CTRA 3N2GB 3OT7A 2W0XA 3ZMSA 2QWRB 4A5UB 1OZ0A 5AG2A 2Q5ZA 4NXMO 4DUZO 4LF9B 4IHJB 1SQFA 3ZRVA 3LNMB 5CA0B 4KHPB 4LP8A 2RJZA 5B1NA 1YIJV 2IW5A 5H5NA 4FLXA 3E8GA 2JGDB 1K73W 3OD4A 5LBQA 2BTQB 2F66C 1S5LZ 4B7KA 1KU9A 4DRXA 3T4ZA 4DV7O 2HVKC 4IYHA 4ZOLA 3MD0A 4Q6GA 1V55B 1SETA 2VWKA 2WLLA 3QVNA 2WLIB 2XAQA 1BGYH 3C3SA 4JV5O 5JH7A 4DV4B 1IBKB 2DYRC 1JFFB 4X64B 1M90W 5K1PA 4F4LA 3F5TA 2BCCH 2P06A 1OCRB 3OR7C 3HKDA 1YVWA 4X66B 1PV0A 4F6RA 4W4LA 4FLTA 3FB8C 4N23A 2QWNB 3RYHB 5B1BC 2ZM6B 1QLNA 3HKEA 1GN3A 5B3SC 3VQWA 2E3CA 1I08A 5IT9N 4JZGA 1E1QG 3K79A 3WG7C 3JAKB 4ZI7A 3OMAB 1HNXO 2CH7B 2ADQB 4IHJA 2VS0A 1U97A 1G6UA 1F4NA 3ZCCA 2HEPA 3M8AA 4PA4A 4FM2A 2PF4E 4FFKA 2F95B 4X1KB 1KYOF 4C7UA 1FFXB 1TVKA 1IBMB 1QCEA 4O4HB 3OTOB 4OXSA 3ASNC 3CCEV 2QKAA 4RUEA 4GCZA 3N27A 3E35A 2E75B 3E22A 2FTKA 1YTFB 2FB5A 2DN9A 1RFYA 4Z1VA 5LGNA 3UKMA 1XMOO 1HR0O 3ZRXA 1WLEA 2IM9A 5IWAB 4LFBB 3N2KA 5L3DA 3OM3B 4J9YB 4MS2A 2VRZA 5CN0A 4WFHA 3W7WA 1BHAA 3FAVA 3ETQA 1W59A 1OCOC 3CP1A 3CCLV 3SPHA 3AG3C 5D5QA 4AILC 1EZJA 2GHYA 1XNQB 3B40A 1AI7A 3D3IA 2YICA 4X1IB 1KP3A 1KMIZ 3EFFK 1KUQA 3CC2V 3UT5B 5BY1A 4R6ZA 2KKWA 1VQNV 4JI0O 1I7FA 3FX7A 2JJ2G 1SS3A 4OX9O 2P90A 5LMUO 1BHBA 1BQZA 1JCHA 3JD4A 3NR7A 3D36A 3KG2A 1DTOA 3QO7A 1N33B 1AB3A 4X20B 5IYCO 1NVPB 1T5EA 2UXDO 1GN2A 3CXHF 1D5AA 3D36C 1W0KG 5B66Z 3ML0A 4D7SA 2XNDG 4BIZA 3FYIB 3PJSK 1NH2D 3KCYA 3IAYA 4JAAA 2A0LA 3EHBB 4DV1B 4PI0A 4MVRA 3JASB 1EN6A 3LDEA 3CCMV 4DUYO 5LMUB 2IH3C 4UCUA 4B3TB 4DV7B 2WA4A 5K1XA 4OX9B 2A9HA 4NTYA 5KUMA 4DK0A 1YJ9V 5GTIZ 1QVGU 4JAVA 1M9NA 2A3QA 3HKBB 2OTLV 2QDOA 2Z3YA 4CC5A 2EBOA 4I0XB 5EYPA 4I9QA 4DR3B 4BIOA 4RQFA 1ENVA 1BE3H 4KHPO 4O4LB 4TT3G 2VQEO 3GWKC 1KD1W 1XI1A 3HKDB 4D6TH 4JI5O 3BCCH 2GV9A 3E8BA 4TSFG 1F4MA 5JVDB 4UUJC 3RYFA 3U11A 4YHHB 4Z2WA 2XHBA 1UJWB 5D5PA 1AR5A 2F23A 4KFMA 2AZ2A 2ZE6A 5JCOC 1XMQB 3K58A 1TA8A 4UCRA 4FFBB 2V1DA 2IJHA 4IL6Z 5LYJB 4O4LA 1OCCC 2DWEC 1XL6A 3X2QC 4JI8O 2OIEA 2UXCO 4LF8B 3K0GA 2XOKG 1JJ2U 4JYCA 1K7DA 2Y0PA 5J9PC 5LP6B 3SYAA 1SC5B 1TVKB 3APOA 4MW8A 2ITDC 4PHZA 1GM7A 4PA6A 3FYEB 5B3SB 1IZ3A 3UO2A 2FL4A 4LF7B 1IBMO 3T1CA 2P6JA 2WWWA 3K5NA 4PI2A 3Q4HB 1RM1B 4CC6A 3CD6V 4DV3O 1RPRA 1Y6XA 2QKSA 4IIJA 2DW4A 2V7QG 2UUAB 5LXTA 2M7WA 1AR4A 3GWOA 3SPCA 3G67A 3RYHA 3W7SA 4J11A 4LF4O 2JRIA 3P32A 2YIBD 3JYCA 1ZTEA 3P3NA 4YY3B 4O4JA 4J7ZA 1K4CC 2ZD9A 4MVOA 3FB5C 3ZHUA 2RN9A 1Z5WA 1JJOA 2ETNA 4X64O 1Q86W 4DR6B 5IJ0B 1G8MA 2QM4A 3W7XA 4JI6B 1IXBA 3OE7G 2EZPA 4RUFA 4YIPA 1OCZB 4J41A 5ITZA 3ZIAG 4EB6A 1MSWD 2ATKC 4K0KO 3ZX6A 1S5JA 2Q7GA 2EJRA 1H2MA 3HR0A 3AK1A 1Q90D 1US6A 1GTOA 1AI4A 2YC0A 1D5NA 3SR2C 1QR8A 4JI2O 2FKXA 1H2SB 5LHHA 3L72H 2DWDC 2JDIG 1WP8A 2Q69A 4BW5A 5KHJA 1A32A 1IX9A 1F23A 4H44B 5JJJB 4DV6O 4DV5O 1XREA 4DV3B 3ASOC 5DN6G 1WA8A 1J5EB 2RQ6A 2UUBB 1H2GA 1FD9A 1PL4A 4GKKO 5KHIA 3ZJZA 2X6AA 2YIAA 3AG3B 4RAIA 1V55C 4G28B 4NTXA 4X62O 5BR8B 3BY6A 2F4VO 4B3SO 5JVDA 4DR6O 3S3XA 4DR5B 4NXNO 3G80A 1VF6C 3A0BZ 4UV9A 5LOVB 1Q6IA 5L3FA 5IDJA 1RPOA 3CCSV 4J10A 4YHHO 1MMMA 1Y76A 4TUYA 1AILA 2XAHA 1MABG 4R8CA 2Q0OC 2EIKC 1K33A 4JTDB 5HFMA 2H3OA 2E76B 1TUEB 3TETA 4DR3O 4FZ1A 1V54C 1EFRG 1FYJA 1YEWA 1GMGA 5J2UB 2PI5A 1S0VA 4ABMA 4FZ0A 2ZT9B 2QWPB 2MW2B 4JI1O 4B3RB 2R9RB 1P49A 3R65A 1MA1A 1KKDA 4JASA 2WLMA 1OCCB 4F6RB 1YJNV 1E79G 3BPZA 3JATB 4LH7A 2EIJC 1NH2B 2P4VA 3CEIA 5JQGA 3VQYA 5KHGA 2UXCB 5CBGA 4JI8B 1BT8A 1SQBH 1VF5B 1SESA 2OIGA 1N34O 4JI4B 2OCCB 4RO2A 1N4CA 3OW2U 3OEHG 3K9AA 2ILMA 3SDLA 2DQ0A 3J7AU 2ZCEA 5LA6B 4G2KA 3CB2A 3DXRB 4QE9A 5B1OA 1Q7YW 3DSQA 5LP6A 4CH6A 3ABLB 3JARA 4FVMA 4JZ2A 2YXHA 3AG1B 2EINB 1L0LH 2NR5A 4TV9B 2LQTA 2YIDA 2ITCC 3IGAC 2RMKB 3CCQV 3MDSA 1Y67A 4JI0B 1AJPA 4YXWG 4CZZA 4PELA 4OPAA 3M99B 5DEDA 3RYCA 4QJFB 3I56V 3RGBA 1SQVH 3OMIB 2XASA 2A06H 1TUBA 3ZHRA 1Q3EA 4O4IB 2MK3A 5LGTA 2NNUA 1H2LA 4E4EA 3UO3A 1L1FA 5CB4B 3BEHA 5CB4A 1GRJA 3I5DA 4ASUG 4JI3O 4MVMA 4WCEV 2ZINA 1THZA 2UXDB 2EILC 1VQPV 3A0RA 4PJ0Z 1N33O 2WPDG 1CPYA 4RQEA 4DK1A 2ZE5A 1NQTA 2RCVA 2KG7A 3F5WC 5KX5B 3UM7A 3CJHA 1MOFA 1ORQC 3ETEA 3ZN0A 3CRQA 4EFEA 3OFNG 1JPXA 3ZRWB 3L73H 2X0LA 1UPGA 4TWKA 3X2QB 3OTOO 3IC9A 4O2AA 3O65A 4O4HA 3AEIA 4FFBA 2CTWA 2V4DA 5KA5A 4H0LB 2NN4A 3ASOB 4O2BA 1LR1A 3THOA 4GLXA 2KG7B 3OR6C 4GX1A 1WPXA 3O9OA 3HB3B 4P9OA 1R3LC 3OGCC 1UFIA 4DW1A 4BIUA 2AZ0A 5A9GA 1KKCA 3G6BA 4I55A 4GKJB 1NTKH 2E5LO 3BFRA 3A0HZ 2DYSB 4I4TB 2GUZB 5LL6Y 1W0JG 1IBKO 1HNWO 5CMUA 4UCSA 4DR2B 1Q8IA 4JV5B 2GBOA 5KAIZ 4FJCC 4MTFA 5B1AB 2DJVA 3QO8A 5GTHZ 4PD4F 1O9GA 3GB7C 3ZMVA 3OUFA 2CTPA 2WLHA 1Q5OA 1F51A 4GKKB 2PYLA 3RN4A 2FYUH 3K57A 3HKCA 4DV0B 5KMGA 2O57A 2UXBO 1L8DA 3JATA 5CA1B 1JR9A 1Y76B 4RWUA 2EJ7A 2LGWA 1BQ0A 4K3AA 1S72V 4PA9A 5C93A 4WFBV 4H13B 4CS3A 2AHZA 1AP5A 1N8RW 1XUQA 4MW3A 2PYJA 1ZLZA 5DECA 1WPBA 4ZKIA 4LFAB 3DXRA 4FM0A 1U96A 3DTUB 1P7BA 2IJKA 3LSQA 4I7ZB 2QEXV 5IE9A 2W0FC 2Q9LA 1QR9A 4UB6Z 4ZHQB 3E86A 3CE2A 4DR4B 1Q81W 2OCCC 1H8HG 3LNNA 3E8HA 2ZE8A 5KLVH 1DGSA 3KKYA 4YJ3A 5BMVB 4FLVA 3ZS8C 2Q7HA 4X1IA 5LYJA 4HBNA 4G27B 2JEXA 2LW7A 1KQSU 2Q0AA 3CPWU 1NT2B 3L9DA 4MSWC 1COWG 3H9VA 2Q4PA 2IJJA 3BABA 2AXTZ 1DK1A 5IJ0A 3BHPA 2A79B 2Z5UA 1R6NA 5B1BB 1SQQH 4DR1O 4CS2A 3E83A 2LGQA 1H2KA 3SPIA 1M4UA 4LF9O 4WFFA 1QLEB 1G1XB 1Y4MA 1ZL8B 4I50B 1AJNA 1SA0B 4HYOA 2LFRA 4X20A 4LCUC 4U3FH 2P4KA 3UCSC 2EX3A 2W6JG 1W2BU 1N36B 2Q6AA 4LF7O 2ZNJA 1EZVH 3CS5A 3SYPA 3ABKC 3AK3A 3H01A 4MVSA 4DV2O 3H1IH 2Y48A 4B3SB 1J95A 2Q67A 2F4VB 1FFTB 4TV8B 1IVSA 4DV2B 3JAMN 4KL1A 4FK5C 1X59A 1WP7A 3RW0A 1QBZA 4X9QA 4JTCB 1YI2V 2UXNA 1I94O 3SYCA 4LF6O 2Y69B 3B77A 4ZIBA 4D7TA 1GKFA 2HG5C 3K5LA 4MVZA 4DV6B 1K34A 2ZR3A 2R9AA 4U7OA 5F2VO 1IDSA 4BW9A 2Y4TA 2N04A 2HVJC 1VQ5V 3ZBHA 2N05A 3ZN1A 4Q20A 1N32B 4JI2B 1HNZB 1MZFA 1XHXA 2EINC 3UQ8A 2UXXA 4P2ZA 1MG1A 3ICXA 1WN7A 4DV0O 4HNAA 4HNAB 2R70A 3J81N 5FNVA 4J7JA 4KXRA 4TOIA 3AG2B 3FFQA 4U3JB 3TJTA 3K5OA 2AGAA 3JAWB 5EC1C 1M56C 4E2LA 4PDVA 1JA8A 1R6KA 4FLUA 5IJ9B 4MTOA 4NKGB 5JH7B 4DR2O 2LP7A 2WA3A 5JJNB 1VQ7V 4DR4O 3E89A 1BZKA 1LUVA 3U0ZA 1NJIW 2JS5A 4UXNA 3JCUZ 4QE7A 4GX5A 1H8EG 1K8AW 4LFCB 5BMVA 2CTQA 3K08A 5E1AC 2A7WA 4LFAO 4CBCA 1HW7A 2X6CA 5EBMC 1FFXA 1AR1B 4W4KA 4MTGA 1HWYA 3ZHVA 3ABTA 1AP6A 1GM9A 4WBNB 4DO2A 3ABMC 1VMGA 2EZOA 1M57B 4YIOA 1Z5VA 4XDJA 1FXKC 3BA9A 4QPJA 2UXBB 2RNBA 4MT8A 1Q43A 2JIZG 2P7TC 2PUSA 3JD0A 1L0NH 1AI6A 1K5QA 3CMEV 2UUCB 1VIBA 1YCIA 5IYZA 3WB0A 1XNQO 1YF2A 3ABUA 5FLXN 2GUZA 4PDMA 4J42A 1JVMA 3ABLC 2F93B 2YI8A 4LC1A 5LMNB 4FLZA 2HHHB 4LFBO 5IWAO 4LF8O 5L3EA 2E5LB 4GKJO 1HR0B 2QJ1A 1O9HA 2IBZH 1ZAUA 2PI4A 1KBHA 2DQ3A 5GONA 3RYCB 1DLBA 1XEQA 4GX2A 2XAJA 2PZSA 1CP9A 5EC2C 1N0NA 4JAUA 5LMNO 4ZOLB 3JAWA 2CUGA 3VQXA 4J7KA 4JTAB 4PA7A 1PL0A 4JI5B 1Q6UA 2FMLA 2BTOA 5L3BA 3RYIB 2OTJV 3JD3A 2YXLA 4XDKA 1R6TA 4I50A 3RVYA 4LR3A 5IYZB 1FS0G 4IIJB 4MVUA 4X65O 3CWBH 3VBBA 2HFEC 2QWQB 1YSCA 3E8FA 2BE3A 2QTOA 1MNGA 3N2GA 3T1YO 3QTCA 1MZEA 1R1BA 5IYDO 2B1GA 5KA6A 3ABKB 2KQXA 2HP8A 3LDDA 5KAFZ 2XTAA 2YIBA 3SYQA 2H8PC 2DYRB 4WF9V 4XDLA 3RYIA 4EB6B 4FIPC 1SA0A 2JS3A 3ZHTA 4Z1MG 4L8JA 4AI8A 4CH4A 3JARB 1TAEA 3K3WA 3B2EE 4JI3B 5JJEB 3LDCA 3ZHQA 2JJ1G 5J2UA 1GAXA 1VEWA 1SQGA 3DC6A 1CEZA 2GTAA 2ZR2A 4LH6A 3G4SV 2LFSA 1BS3A 3TXSA 3LUTB 2L6LA 5LGUA 1OCZC 3OGIB 3SJAC 1NR1A 5FPRA 4IT5A 5EBLC 2F1MA 3RYFB 3K04A 1FJGB 1OHHG 2WLLB 5JQGB 3BVOA 4JYYA 4FLYA 3CRCA 4B3RO 4JI1B 2CGOA 2EIMC 2ZXWB 4X1YB 3CCVV 4N21A 4GZRB 3L75H 4XBFA 1VQOV 4K8XA 1WAZA 5EYPB 2BSKB 1XILA 4I5SA 3K06A 1IURA 3FAVB 3HKBA 3RFRA 3U10A 1DF5A 1I5YA 2R72A 3HKCB 4FLWA 4TQDA 2X6BA 2UU9O 5EK0A 1SQXH 1AROP 2IJIA 4X88A 4JYAO 1QVFU 2JEUA 4GYCB 2F43G 1ZUQA 2CH7A 4LF6B 3ETGA 2WLNA 3H1HH 3GVMA 3CCJV 3JSLA 4QNHB 3FB6C 2R9IA 2OT5A 3QF7A 4PDLA 2XUMA 2YXYA 3BAAA 5EIBC 1QHTA 2QGNA 2YS8A 2ARHA 1B3QA 5LOVA 1Q82W 2ODMA 2HHHO 1NTZH 3QO5A 1VQLV 1YTFD 1PPJH 1FPOA 5CA0A 2QKCA 3C90A 2JVDA 4X89A 2ZDIA 2PTMA 1S5HC 2UUBO 1BCCH 1IBLB 3A2FA 3AG4C 5IJ9A 4AQYO 4B7EA 4O2BB 1QQCA 3FB7C 5B5EZ 3DGEA 5KHKA 2GTSA 2XAFA 3IFXA 2Q73A 4OPHA 3JCZA 2X7RB 3M7MX 5J2TA 4LWSB 2K9PA 3S3WA 3KCXA 3TXQA 1LNQA 1OJHA 2W6IG 4H37A 1FAFA 1I0HA 2BTQA 2EULA 1NBMG 4R50A 3B4SA 3AG7A 4X1YA 1PKXA 3D8CA 4YJ2A 4B3MO 5KMGB 3H1KH 3CC7V 2D3OW 1XNRB 2IU3A 2RDCA 1V54B 3E2EA 3P3PA 1OV9A 4PA3A 1Y66A 4EEQA 2ZKOA 3W7TA 4DW0A 4K0KB 2CDYA 2JGUA 3F7VC 1P84F 1FXVA 1NI8A 3CSXA 5IY5C 4DRXB 3TCUA 3OTFA 2EIJB 1M1KW 5JWPA 1YJWV 1VF7A 4I55B 1ZX3A 1FXKA 1FXKB 3T4DA 1WB8A 1JMKC 1XL4A 2Y69C 2YI9A 2JK5C 3A8TA 5EZYA 4YJ3B 4B08A 1SQPH 2KSDA 2IH1C 3RBZA 4DV5B 5LHIA 2HLDG 5C8YA 2AW9A 2YEVA 3SPJA 2IU0A 1XNRO 5EBWC 1HNZO 3JASA 3AK2A 4BWAA 3HPLC 1HDJA 4LBEC 1N32O 2QA4V 3NXSA 4LF4B 1MSDA 4NXMB 3C3TA 4UVCA 4ZI7B 1YDXA 5IYBO 3B8NA 1B6QA 1GO3F 3APQA 2UUAO 5TISZ 3ZMTA 3KZIZ 1S76D 3ASNB 3CHXA 3F7YC 3SGIA 3STLC 2YSUB 2Y0IA 3MHHC 3AG2C 1IBLO 1TUBB 2GSMB 4LF5B 3D3QA 2XT9A 3ABMB 1F7YA 4WFAV 4PV1B 1K9MW 2E74B 1KB9F 1HNWB 4UVAA 5C8YB 1N0JA 3CCRV 2P5OA 1R73A 4WFEA 3J80N 2YUAA 5EZYB 5H9CA 3T2MA 1GN6A
chains in the Genus database with same CATH topology
2UXXA 1K73W 2NLJC 4P2ZA 4UV9A 1MG1A 5LBQA 1VQ6V 3CCUV 2EIMB 3OMNB 5FL7G 5L3FA 5IDJA 3T4ZA 1RPOA 3CCSV 2HVKC 1E1RG 3AG2B 4HZ3A 1VQ4V 2XAHA 4JGSA 5EC1C 1M56C 1BL8A 4E2LA 3MD0A 4PDVA 1MABG 1R6KA 1SETA 1V55B 2WLLA 2WLIB 4MTOA 2XAQA 4R8CA 5HFLA 2EIKC 1K33A 1M57C 2HKOA 2LP7A 4JTDB 5HFMA 1VQ7V 3E89A 2DYRC 2WLJA 1NJIW 1M90W 4F4LA 1TUEB 4P30A 3TETA 3ETDA 3K03A 3OAAG 1OCRB 3OR7C 1V54C 4UXNA 4QE7A 1EFRG 1BMFG 1GMGA 1KECA 1H8EG 3FB8C 4GX5A 4N23A 1K8AW 2PI5A 1S0VA 5B1BC 2R9RB 1VQ8V 4P9PA 1K5SA 3K08A 1PD3A 3R65A 1QLNA 5E1AC 5B3SC 1KKDA 4JASA 2WLMA 1OCCB 2X6CA 4CBCA 1YJNV 5EBMC 1E79G 1E1QG 3K79A 3WG7C 1AR1B 2HJFC 2EIJC 1NH2B 2QM8A 3OMAB 4MTGA 1HWYA 5BZBA 5CBGA 3ABTA 3CYOA 3CC4V 1SESA 1VQKV 1GM9A 4DO2A 3ABMC 4KUMA 1F4NA 2EZOA 2OCCB 3ZCCA 4RO2A 1M57B 3OW2U 4KP4A 1FXKC 4XDJA 4QPJA 3OEHG 4PA4A 3K9AA 4MT8A 3LSSA 2JIZG 2DQ0A 2P7TC 3JD0A 1AI6A 2WAMA 4G2KA 1K5QA 4QE9A 5B1OA 1OCRC 3CMEV 1Q7YW 5L3GA 3ABLB 1QCEA 3ABUA 4OXSA 3ASNC 5B1AC 3CCEV 3AG1B 2EINB 4PDMA 1JVMA 1NR7A 3ABLC 4RUEA 1K3EA 4GCZA 1K4DC 4I9WA 4BAYA 2ITCC 3E35A 4LC1A 3IGAC 3WG7B 1KP2A 1IXMA 2FTKA 3CCQV 5L3EA 1YTFB 1AJPA 4YXWG 4CZZA 4PELA 3M99B 2PI4A 5LGNA 2DQ3A 3UKMA 1DLBA 2WLIA 4GX2A 3ZRXA 1WLEA 1VQ9V 1ZWIC 2XAJA 1CP9A 5EC2C 4QJFB 1JOYA 2K1EA 4JAUA 3I56V 5L3DA 1OCOB 3OM3B 3OMIB 1K97A 4J9YB 2XASA 4MS2A 2CK3G 5CN0A 4WFHA 3W7WA 4JTAB 1BHAA 2MK3A 5LGTA 1PNMA 2NNUA 4PA7A 5CA3A 1OCOC 3CP1A 3CCLV 3SPHA 3AG3C 1JQ0A 1EZJA 1PL0A 4GX0A 2C2AA 2GHYA 2KB1A 1AI7A 3D3IA 1L1FA 1FXHA 5L3BA 4FPPA 3BEHA 3JD3A 1KP3A 3AG4B 2OTJV 2B5UA 4ASUG 5IY5B 4MVMA 4WCEV 4XDKA 3EFFK 1M56B 3CC2V 1THZA 5DM6V 2EILC 1VQPV 3RVYA 3A0RA 1VQMV 3VOUA 1FS0G 2WPDG 1CPYA 3WFVA 4MVUA 4H33A 1JX9A 4R6ZA 4RQEA 3VBBA 3SYOA 1VQNV 2HFEC 4JYBA 1NQTA 4JF3A 3E8FA 1YSCA 3F5WC 3W7UA 3UM7A 2JJ2G 1MOFA 2QTOA 1ORQC 3ETEA 3ZN0A 3P30A 2P90A 1BHBA 1JCHA 5IYDO 4WFGA 3OFNG 1JPXA 5CBHA 3JD4A 2B1GA 3ZRWB 5KA6A 3ABKB 2ZQMA 3STZC 3LDDA 3D36A 2X0LA 3OUSA 4TWKA 3X2QB 1KC8W 5L3CA 3KG2A 1DTOA 3SYQA 2H8PC 2DYRB 4WF9V 3QO7A 4XDLA 2H94A 5IYCO 4MTXA 4PDRA 4FIPC 1NVPB 4Z1MG 2BOCC 1NVPD 3K3WA 1W0KG 5LHGA 3AEIA 3LDCA 3ML0A 2JJ1G 2XNDG 4BIZA 3FYIB 3PJSK 1CEZA 1NH2D 2ZR2A 1SERA 5KA5A 1QLEC 3ASOB 2A0LA 3EHBB 4HAMA 2LFSA 3G4SV 3LUTB 4MVRA 2Q68A 5LGUA 1OCZC 2WSSG 3OR6C 4GX1A 3LDEA 4X8AA 1WPXA 5KUKA 3ZMZA 1NR1A 3HB3B 3CCMV 4P9OA 1R3LC 2IH3C 5EBLC 3K04A 1OHHG 2WLLB 3CXCU 2A9HA 3OGCC 5KUMA 1YJ9V 4QIWF 2EIMC 1QVGU 4BIUA 2ZXWB 3CCVV 4N21A 4JAVA 1R3JC 1M9NA 4XBFA 2OTLV 1VQOV 5CBFA 2Z3YA 1S77D 1I5XA 2EBOA 2DYSB 4RQFA 1ENVA 4I5SA 3K06A 1W0JG 4TT3G 5CMUA 1KD1W 1DF5A 1I5YA 4FJCC 4UV8A 2AHYA 4MTFA 3SPGA 5B1AB 1S3JA 2WLKA 3E8BA 4TSFG 3AG1C 3QO8A 1F4MA 2X6BA 4U7NA 3GB7C 5EK0A 3OUFA 3ZMVA 1AROP 4UUJC 2WLHA 3FKSG 1F51A 2IJIA 4X88A 1QVFU 2JEUA 1UJWB 4GT1A 1GM8A 2F43G 1G4YB 3G6EV 4KFMA 3ETGA 2WLNA 3I55V 3CCJV 2V1DA 2IJHA 4QNHB 5H6RA 3FB6C 2R9IA 2OT5A 4PDLA 1OCCC 2DWEC 2B1IA 1XL6A 1S72V 3X2QC 4PA9A 5C93A 4WFBV 4FMTA 2AHZA 1Q82W 1N8RW 3B8MA 3K0GA 4MW3A 3G71V 2XOKG 1JJ2U 3JD1A 3QO5A 4JYCA 1K7DA 4ZKIA 5J9PC 3SYAA 2ZDIC 4MW8A 3DTUB 3QNEA 2XAGA 1P7BA 2ITDC 1VQLV 1YTFD 1YHQV 4L87A 4QPKA 2IJKA 1GM7A 3LSQA 4PA6A 3FYEB 5B3SB 2QEXV 2W0FC 1RM1C 4X89A 2ZDIA 3ZRSA 3T1CA 1QR9A 2P6JA 1S5HC 2WWWA 3AG4C 4JPRA 2EILB 1RM1B 3E86A 3FB7C 3CD6V 3DGEA 1Q81W 1RPRA 2OCCC 1H8HG 2XAFA 3IC7A 2QKSA 2P67A 3IFXA 2DW4A 3E8HA 2X7RB 3JCZA 2V7QG 1YITV 1SZTA 2M7WA 1DF4A 3GWOA 3SPCA 1LNQA 2W6IG 4H37A 3JD2A 2QE7G 4J9ZB 3W7SA 3P32A 3JYCA 1NBMG 4R50A 4G27B 2JEXA 1PNLA 1KQSU 1PKXA 3CPWU 4MSWC 1COWG 4MVQA 1NKDA 2IJJA 3CC7V 2D3OW 1K4CC 2ZD9A 4MVOA 2IU3A 1AI5A 3FB5C 1V54B 1H38A 2A79B 3E2EA 2Z5UA 4PA3A 1Y66A 1R6NA 5B1BB 3E83A 3MHSC 3W7TA 1Q86W 3SPIA 2YEVB 2ZXWC 1EBOA 4WFFA 3F7VC 1G8MA 1QLEB 1ROPA 1Y4MA 3W7XA 1FXVA 3OE7G 2EZPA 4RUFA 3OEEG 1R3IC 5IY5C 3TCUA 1OCZB 2EIJB 1SRYA 1M1KW 4ZBMA 1AJNA 4HYOA 2LFRA 3RVZA 1PNKA 3ZIAG 1YJWV 4LCUC 3K0DA 1FXKA 1FXKB 1MSWD 2ATKC 3T4DA 1XL4A 2Y69C 2W6JG 2JK5C 1AJQA 2EJRA 2IH1C 1W2BU 3RBZA 3ZRWA 5LHIA 2HLDG 1GTOA 2Q6AA 4UVBA 5GW7A 1AI4A 2YEVA 3SPJA 2IU0A 1GK9A 5EBWC 4R7CA 1R3KC 2DYSC 4DXWA 1QR8A 3HPLC 3ABKC 3H01A 3SYPA 4LBEC 4MVSA 5LHHA 2QA4V 2Y48A 3NXSA 1J95A 2DWDC 2BOBC 2Q67A 2QM7A 4EKWA 1P4RA 1FFTB 4UVCA 2HR3A 2JDIG 5IYBO 3CMAV 3B8NA 1B6QA 4FK5C 1GO3F 2EIKB 2Q69A 3RW0A 4BW5A 1K92A 1QBZA 1F23A 3ZMTA 3ZMUA 4JTCB 3TK1A 1YI2V 2UXNA 1S76D 3ASNB 5H6QA 3SJQC 3F7YC 3SYCA 3ASOC 3STLC 2Y69B 2YSUB 5DN6G 3B77A 3MHHC 3AG2C 1GKFA 2HG5C 2GSMB 1H2GA 4MVZA 1K34A 2ZR3A 3ZJZA 3ABMB 2X6AA 3AG3B 4U7OA 4RAIA 3ZMSA 1V55C 1OZ0A 4WFAV 4G28B 1K9MW 3BY6A 2HVJC 1VQ5V 3ZRVA 4UVAA 3LNMB 3CCRV 3ZN1A 4Q20A 1R73A 4WFEA 4LP8A 1YIJV 5B1NA 2IW5A 5H9CA 3T2MA 3E8GA 2EINC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K33 A;  3M99 B;  1K34 A;  2LP7 A;  5HFM A;  5KA5 A;  2X7R B;  1JPX A;  1DLB A;  1MG1 A;  1QCE A;  5KA6 A;  1I5X A;  1Y66 A;  1SZT A;  2EBO A;  2M7W A;  3B8N A;  1DF4 A;  1ENV A;  3GWO A;  4FK5 C;  3MHS C;  3CYO A;  1QBZ A;  5CMU A;  1F23 A;  3WFV A;  1DF5 A;  1I5Y A;  1EBO A;  2EZO A;  1QR9 A;  2P6J A;  4N23 A;  1Y4M A;  2OT5 A;  4FJC C;  5CN0 A;  4JGS A;  2MK3 A;  4FIP C;  2EZP A;  4JF3 A;  4JPR A;  1QR8 A;  4E2L A;  3K9A A;  3CP1 A;  3H01 A;  1JQ0 A;  1MOF A;  3B77 A;  3B8M A;  3MHH C;  4G2K A;  4N21 A;  3P30 A;  5H9C A;  5HFL A; 
#chains in the Genus database with same CATH topology
 3B09 A;  4IYI A;  5FPO A;  2NLJ C;  2LO1 A;  1VQ6 V;  3CCU V;  2EIM B;  3OMN B;  1GN4 A;  5FL7 G;  4JYA B;  1E1R G;  4HZ3 A;  1VQ4 V;  1RP3 B;  4JGS A;  1RSO B;  1BL8 A;  2UU9 B;  4X1K A;  1Z2G A;  3Q4H A;  3L71 H;  5HFL A;  4F6E A;  1QU7 A;  1M57 C;  3JSN A;  4K35 A;  2HKO A;  3L74 H;  2QWO B;  2WLJ A;  4DR1 B;  4NR1 A;  4P30 A;  4AQY B;  3ETD A;  3K03 A;  3OAA G;  4TUY B;  2PY5 A;  2Z0A A;  1XBL A;  2N74 A;  1BMF G;  1KEC A;  3MAQ A;  1URF A;  4UCO A;  1VQ8 V;  4P9P A;  2CGN A;  1K5S A;  1PD3 A;  5J2T B;  2OYQ A;  5LXT B;  4B3T O;  2Q8V A;  1V9P A;  5CA1 A;  2HJF C;  2QM8 A;  5BZB A;  4DV1 O;  3CYO A;  3CC4 V;  1VQK V;  2LJ2 A;  1XQ8 A;  4KUM A;  2GDS A;  4KP4 A;  1XMQ O;  1NU1 H;  3H1L H;  1D2D A;  3LSS A;  3WB2 A;  2WAM A;  1VAR A;  1OCR C;  5L3G A;  4U3J A;  3K5M A;  2QTS A;  3R66 A;  5B1A C;  2BSK A;  4I0X A;  1NR7 A;  2G38 A;  4O2A B;  1K3E A;  2VQE B;  1K4D C;  4I9W A;  3BA8 A;  4BAY A;  5ITZ B;  3WG7 B;  1KP2 A;  1IXM A;  1TGO A;  1ZSP A;  4OGQ B;  4X65 B;  1FKA O;  4LNU A;  3N2K B;  3QG5 A;  2WLI A;  1VQ9 V;  1ZWI C;  2HJD A;  1JOY A;  2K1E A;  5GON B;  1OCO B;  1K97 A;  4QGP A;  1FJG O;  1YXB A;  4DUY B;  1CXZ B;  2CK3 G;  4K8Z A;  3JAL A;  1PNM A;  3WB1 A;  5CA3 A;  5KHH A;  1JQ0 A;  4GX0 A;  2C2A A;  2KB1 A;  1FXH A;  4UCV A;  4FPP A;  3AG4 B;  2JGD A;  4AHC A;  1H2N A;  2B5U A;  3ZHS A;  5IY5 B;  3DC5 A;  1M56 B;  2M6Y A;  5DM6 V;  1WB7 A;  1VP7 A;  1VQM V;  3VOU A;  3WFV A;  2ZIM A;  4JI4 O;  4H33 A;  4JI7 B;  1JX9 A;  3SYO A;  4JYB A;  4BR6 A;  4JF3 A;  3RT3 C;  3W7U A;  3SJB C;  2ZE7 A;  5KX5 A;  3P30 A;  4NYK A;  4WBN A;  3T1Y B;  1NS1 A;  4WFG A;  3TGU H;  5CBH A;  2ZQM A;  2OWO A;  3STZ C;  3OUS A;  1KC8 W;  5L3C A;  4DR7 O;  2VWJ A;  2VQF O;  2H94 A;  4MTX A;  4PDR A;  2BOC C;  1NVP D;  2Y4U A;  1EM1 A;  5LHG A;  4TV8 A;  2VQF B;  4DR7 B;  5LA6 A;  1SER A;  1QLE C;  4NB5 A;  1NZ6 A;  4HAM A;  1B04 A;  2QR4 A;  1XDC A;  2Q68 A;  2WSS G;  4X8A A;  5LP6 C;  5KUK A;  3ZMZ A;  4ICG A;  3CXC U;  2ZNI A;  4QIW F;  4LFC O;  2ZM6 O;  3EXA A;  1XMO B;  5EIB D;  1R3J C;  2D2C B;  4JI7 O;  3HKE B;  4X66 O;  5CBF A;  1S77 D;  1I5X A;  1PP9 H;  1XOU A;  4I4T A;  4NXN B;  4LWS A;  4DR5 O;  4O4I A;  1PM9 A;  1BSM A;  1ZL8 A;  1SKV A;  5BR8 O;  4UV8 A;  2AHY A;  3SPG A;  4X62 B;  1Y74 A;  1S3J A;  2WLK A;  3AG1 C;  2B9Z A;  4U7N A;  2Q7E A;  3FKS G;  1QNM A;  3K59 A;  2UUC O;  4GT1 A;  1GM8 A;  1J5E O;  1G4Y B;  3G6E V;  1RSO A;  4O4J B;  1Q6H A;  3JAK A;  2YDE A;  3I55 V;  4UCT A;  3E22 B;  2DMX A;  5H6R A;  4TV9 A;  2B1I A;  1HNX B;  4FMT A;  3IJ4 A;  3B8M A;  3G71 V;  3JD1 A;  3SJC C;  4DUZ B;  2ZDI C;  1SF9 A;  3QNE A;  2XAG A;  1YHQ V;  4L87 A;  1HP8 A;  4QPK A;  3CRR A;  1AVM A;  5BXZ A;  1JFF A;  1RM1 C;  3ZED A;  3ZRS A;  5A2Q N;  3WU2 Z;  4CH5 A;  4JPR A;  2EIL B;  5E79 Z;  4IGG A;  3RWR D;  1Y74 B;  1WNS A;  4DV4 O;  3IC7 A;  2P67 A;  1N34 B;  1NTM H;  1YIT V;  1WA8 B;  5FNV B;  1SZT A;  1DF4 A;  3K9S A;  3JD2 A;  2QE7 G;  4JI6 O;  4J9Z B;  1PNL A;  3JAL B;  2DOS A;  4MVQ A;  1NKD A;  3T1H O;  1AI5 A;  4NVP A;  1XHZ A;  1H38 A;  2ADP A;  3CJH B;  4DYL A;  4B3M B;  4YY3 O;  3MHS C;  1WJZ A;  4UB8 Z;  3H1J H;  1YZB A;  2YEV B;  2ZXW C;  3CRM A;  4EFB A;  1EBO A;  1LUW A;  1M93 A;  1ROP A;  2OCH A;  4TQF A;  4UFZ A;  1EN4 A;  5H2F Z;  1M5I A;  3OEE G;  1R3I C;  2P22 C;  4YJ2 B;  1SRY A;  4ZBM A;  3CX5 F;  3RVZ A;  1PNK A;  2QSA A;  1EN5 A;  3K0D A;  1VF6 A;  2L35 A;  1X4T A;  2DE0 X;  1AJQ A;  1P7G A;  4NTW A;  4CH3 A;  1I94 B;  3ZRW A;  2LW1 A;  3VQV A;  4UVB A;  5GW7 A;  2CE4 A;  4GUN A;  3T1H B;  4CS4 A;  1GK9 A;  4R7C A;  1R3K C;  2DYS C;  3PN1 A;  4DXW A;  3FD9 A;  3L70 H;  4ZHQ A;  4LNU B;  2CAZ C;  2BOB C;  2QM7 A;  4EKW A;  1P4R A;  3LSU A;  3UT5 A;  2ZIO A;  2HR3 A;  3EVK A;  3CMA V;  2PGG A;  2EIK B;  1SZX A;  1K92 A;  3CRA A;  3BRC A;  4LF5 O;  3ZMU A;  3TK1 A;  5H6Q A;  3SJQ C;  1N36 O;  1GH6 A;  4FM1 A;  1B06 A;  4J80 A;  5JCO A;  2CTR A;  3N2G B;  3OT7 A;  2W0X A;  3ZMS A;  2QWR B;  4A5U B;  1OZ0 A;  5AG2 A;  2Q5Z A;  4NXM O;  4DUZ O;  4LF9 B;  4IHJ B;  1SQF A;  3ZRV A;  3LNM B;  5CA0 B;  4KHP B;  4LP8 A;  2RJZ A;  5B1N A;  1YIJ V;  2IW5 A;  5H5N A;  4FLX A;  3E8G A;  2JGD B;  1K73 W;  3OD4 A;  5LBQ A;  2BTQ B;  2F66 C;  1S5L Z;  4B7K A;  1KU9 A;  4DRX A;  3T4Z A;  4DV7 O;  2HVK C;  4IYH A;  4ZOL A;  3MD0 A;  4Q6G A;  1V55 B;  1SET A;  2VWK A;  2WLL A;  3QVN A;  2WLI B;  2XAQ A;  1BGY H;  3C3S A;  4JV5 O;  5JH7 A;  4DV4 B;  1IBK B;  2DYR C;  1JFF B;  4X64 B;  1M90 W;  5K1P A;  4F4L A;  3F5T A;  2BCC H;  2P06 A;  1OCR B;  3OR7 C;  3HKD A;  1YVW A;  4X66 B;  1PV0 A;  4F6R A;  4W4L A;  4FLT A;  3FB8 C;  4N23 A;  2QWN B;  3RYH B;  5B1B C;  2ZM6 B;  1QLN A;  3HKE A;  1GN3 A;  5B3S C;  3VQW A;  2E3C A;  1I08 A;  5IT9 N;  4JZG A;  1E1Q G;  3K79 A;  3WG7 C;  3JAK B;  4ZI7 A;  3OMA B;  1HNX O;  2CH7 B;  2ADQ B;  4IHJ A;  2VS0 A;  1U97 A;  1G6U A;  1F4N A;  3ZCC A;  2HEP A;  3M8A A;  4PA4 A;  4FM2 A;  2PF4 E;  4FFK A;  2F95 B;  4X1K B;  1KYO F;  4C7U A;  1FFX B;  1TVK A;  1IBM B;  1QCE A;  4O4H B;  3OTO B;  4OXS A;  3ASN C;  3CCE V;  2QKA A;  4RUE A;  4GCZ A;  3N27 A;  3E35 A;  2E75 B;  3E22 A;  2FTK A;  1YTF B;  2FB5 A;  2DN9 A;  1RFY A;  4Z1V A;  5LGN A;  3UKM A;  1XMO O;  1HR0 O;  3ZRX A;  1WLE A;  2IM9 A;  5IWA B;  4LFB B;  3N2K A;  5L3D A;  3OM3 B;  4J9Y B;  4MS2 A;  2VRZ A;  5CN0 A;  4WFH A;  3W7W A;  1BHA A;  3FAV A;  3ETQ A;  1W59 A;  1OCO C;  3CP1 A;  3CCL V;  3SPH A;  3AG3 C;  5D5Q A;  4AIL C;  1EZJ A;  2GHY A;  1XNQ B;  3B40 A;  1AI7 A;  3D3I A;  2YIC A;  4X1I B;  1KP3 A;  1KMI Z;  3EFF K;  1KUQ A;  3CC2 V;  3UT5 B;  5BY1 A;  4R6Z A;  2KKW A;  1VQN V;  4JI0 O;  1I7F A;  3FX7 A;  2JJ2 G;  1SS3 A;  4OX9 O;  2P90 A;  5LMU O;  1BHB A;  1BQZ A;  1JCH A;  3JD4 A;  3NR7 A;  3D36 A;  3KG2 A;  1DTO A;  3QO7 A;  1N33 B;  1AB3 A;  4X20 B;  5IYC O;  1NVP B;  1T5E A;  2UXD O;  1GN2 A;  3CXH F;  1D5A A;  3D36 C;  1W0K G;  5B66 Z;  3ML0 A;  4D7S A;  2XND G;  4BIZ A;  3FYI B;  3PJS K;  1NH2 D;  3KCY A;  3IAY A;  4JAA A;  2A0L A;  3EHB B;  4DV1 B;  4PI0 A;  4MVR A;  3JAS B;  1EN6 A;  3LDE A;  3CCM V;  4DUY O;  5LMU B;  2IH3 C;  4UCU A;  4B3T B;  4DV7 B;  2WA4 A;  5K1X A;  4OX9 B;  2A9H A;  4NTY A;  5KUM A;  4DK0 A;  1YJ9 V;  5GTI Z;  1QVG U;  4JAV A;  1M9N A;  2A3Q A;  3HKB B;  2OTL V;  2QDO A;  2Z3Y A;  4CC5 A;  2EBO A;  4I0X B;  5EYP A;  4I9Q A;  4DR3 B;  4BIO A;  4RQF A;  1ENV A;  1BE3 H;  4KHP O;  4O4L B;  4TT3 G;  2VQE O;  3GWK C;  1KD1 W;  1XI1 A;  3HKD B;  4D6T H;  4JI5 O;  3BCC H;  2GV9 A;  3E8B A;  4TSF G;  1F4M A;  5JVD B;  4UUJ C;  3RYF A;  3U11 A;  4YHH B;  4Z2W A;  2XHB A;  1UJW B;  5D5P A;  1AR5 A;  2F23 A;  4KFM A;  2AZ2 A;  2ZE6 A;  5JCO C;  1XMQ B;  3K58 A;  1TA8 A;  4UCR A;  4FFB B;  2V1D A;  2IJH A;  4IL6 Z;  5LYJ B;  4O4L A;  1OCC C;  2DWE C;  1XL6 A;  3X2Q C;  4JI8 O;  2OIE A;  2UXC O;  4LF8 B;  3K0G A;  2XOK G;  1JJ2 U;  4JYC A;  1K7D A;  2Y0P A;  5J9P C;  5LP6 B;  3SYA A;  1SC5 B;  1TVK B;  3APO A;  4MW8 A;  2ITD C;  4PHZ A;  1GM7 A;  4PA6 A;  3FYE B;  5B3S B;  1IZ3 A;  3UO2 A;  2FL4 A;  4LF7 B;  1IBM O;  3T1C A;  2P6J A;  2WWW A;  3K5N A;  4PI2 A;  3Q4H B;  1RM1 B;  4CC6 A;  3CD6 V;  4DV3 O;  1RPR A;  1Y6X A;  2QKS A;  4IIJ A;  2DW4 A;  2V7Q G;  2UUA B;  5LXT A;  2M7W A;  1AR4 A;  3GWO A;  3SPC A;  3G67 A;  3RYH A;  3W7S A;  4J11 A;  4LF4 O;  2JRI A;  3P32 A;  2YIB D;  3JYC A;  1ZTE A;  3P3N A;  4YY3 B;  4O4J A;  4J7Z A;  1K4C C;  2ZD9 A;  4MVO A;  3FB5 C;  3ZHU A;  2RN9 A;  1Z5W A;  1JJO A;  2ETN A;  4X64 O;  1Q86 W;  4DR6 B;  5IJ0 B;  1G8M A;  2QM4 A;  3W7X A;  4JI6 B;  1IXB A;  3OE7 G;  2EZP A;  4RUF A;  4YIP A;  1OCZ B;  4J41 A;  5ITZ A;  3ZIA G;  4EB6 A;  1MSW D;  2ATK C;  4K0K O;  3ZX6 A;  1S5J A;  2Q7G A;  2EJR A;  1H2M A;  3HR0 A;  3AK1 A;  1Q90 D;  1US6 A;  1GTO A;  1AI4 A;  2YC0 A;  1D5N A;  3SR2 C;  1QR8 A;  4JI2 O;  2FKX A;  1H2S B;  5LHH A;  3L72 H;  2DWD C;  2JDI G;  1WP8 A;  2Q69 A;  4BW5 A;  5KHJ A;  1A32 A;  1IX9 A;  1F23 A;  4H44 B;  5JJJ B;  4DV6 O;  4DV5 O;  1XRE A;  4DV3 B;  3ASO C;  5DN6 G;  1WA8 A;  1J5E B;  2RQ6 A;  2UUB B;  1H2G A;  1FD9 A;  1PL4 A;  4GKK O;  5KHI A;  3ZJZ A;  2X6A A;  2YIA A;  3AG3 B;  4RAI A;  1V55 C;  4G28 B;  4NTX A;  4X62 O;  5BR8 B;  3BY6 A;  2F4V O;  4B3S O;  5JVD A;  4DR6 O;  3S3X A;  4DR5 B;  4NXN O;  3G80 A;  1VF6 C;  3A0B Z;  4UV9 A;  5LOV B;  1Q6I A;  5L3F A;  5IDJ A;  1RPO A;  3CCS V;  4J10 A;  4YHH O;  1MMM A;  1Y76 A;  4TUY A;  1AIL A;  2XAH A;  1MAB G;  4R8C A;  2Q0O C;  2EIK C;  1K33 A;  4JTD B;  5HFM A;  2H3O A;  2E76 B;  1TUE B;  3TET A;  4DR3 O;  4FZ1 A;  1V54 C;  1EFR G;  1FYJ A;  1YEW A;  1GMG A;  5J2U B;  2PI5 A;  1S0V A;  4ABM A;  4FZ0 A;  2ZT9 B;  2QWP B;  2MW2 B;  4JI1 O;  4B3R B;  2R9R B;  1P49 A;  3R65 A;  1MA1 A;  1KKD A;  4JAS A;  2WLM A;  1OCC B;  4F6R B;  1YJN V;  1E79 G;  3BPZ A;  3JAT B;  4LH7 A;  2EIJ C;  1NH2 B;  2P4V A;  3CEI A;  5JQG A;  3VQY A;  5KHG A;  2UXC B;  5CBG A;  4JI8 B;  1BT8 A;  1SQB H;  1VF5 B;  1SES A;  2OIG A;  1N34 O;  4JI4 B;  2OCC B;  4RO2 A;  1N4C A;  3OW2 U;  3OEH G;  3K9A A;  2ILM A;  3SDL A;  2DQ0 A;  3J7A U;  2ZCE A;  5LA6 B;  4G2K A;  3CB2 A;  3DXR B;  4QE9 A;  5B1O A;  1Q7Y W;  3DSQ A;  5LP6 A;  4CH6 A;  3ABL B;  3JAR A;  4FVM A;  4JZ2 A;  2YXH A;  3AG1 B;  2EIN B;  1L0L H;  2NR5 A;  4TV9 B;  2LQT A;  2YID A;  2ITC C;  3IGA C;  2RMK B;  3CCQ V;  3MDS A;  1Y67 A;  4JI0 B;  1AJP A;  4YXW G;  4CZZ A;  4PEL A;  4OPA A;  3M99 B;  5DED A;  3RYC A;  4QJF B;  3I56 V;  3RGB A;  1SQV H;  3OMI B;  2XAS A;  2A06 H;  1TUB A;  3ZHR A;  1Q3E A;  4O4I B;  2MK3 A;  5LGT A;  2NNU A;  1H2L A;  4E4E A;  3UO3 A;  1L1F A;  5CB4 B;  3BEH A;  5CB4 A;  1GRJ A;  3I5D A;  4ASU G;  4JI3 O;  4MVM A;  4WCE V;  2ZIN A;  1THZ A;  2UXD B;  2EIL C;  1VQP V;  3A0R A;  4PJ0 Z;  1N33 O;  2WPD G;  1CPY A;  4RQE A;  4DK1 A;  2ZE5 A;  1NQT A;  2RCV A;  2KG7 A;  3F5W C;  5KX5 B;  3UM7 A;  3CJH A;  1MOF A;  1ORQ C;  3ETE A;  3ZN0 A;  3CRQ A;  4EFE A;  3OFN G;  1JPX A;  3ZRW B;  3L73 H;  2X0L A;  1UPG A;  4TWK A;  3X2Q B;  3OTO O;  3IC9 A;  4O2A A;  3O65 A;  4O4H A;  3AEI A;  4FFB A;  2CTW A;  2V4D A;  5KA5 A;  4H0L B;  2NN4 A;  3ASO B;  4O2B A;  1LR1 A;  3THO A;  4GLX A;  2KG7 B;  3OR6 C;  4GX1 A;  1WPX A;  3O9O A;  3HB3 B;  4P9O A;  1R3L C;  3OGC C;  1UFI A;  4DW1 A;  4BIU A;  2AZ0 A;  5A9G A;  1KKC A;  3G6B A;  4I55 A;  4GKJ B;  1NTK H;  2E5L O;  3BFR A;  3A0H Z;  2DYS B;  4I4T B;  2GUZ B;  5LL6 Y;  1W0J G;  1IBK O;  1HNW O;  5CMU A;  4UCS A;  4DR2 B;  1Q8I A;  4JV5 B;  2GBO A;  5KAI Z;  4FJC C;  4MTF A;  5B1A B;  2DJV A;  3QO8 A;  5GTH Z;  4PD4 F;  1O9G A;  3GB7 C;  3ZMV A;  3OUF A;  2CTP A;  2WLH A;  1Q5O A;  1F51 A;  4GKK B;  2PYL A;  3RN4 A;  2FYU H;  3K57 A;  3HKC A;  4DV0 B;  5KMG A;  2O57 A;  2UXB O;  1L8D A;  3JAT A;  5CA1 B;  1JR9 A;  1Y76 B;  4RWU A;  2EJ7 A;  2LGW A;  1BQ0 A;  4K3A A;  1S72 V;  4PA9 A;  5C93 A;  4WFB V;  4H13 B;  4CS3 A;  2AHZ A;  1AP5 A;  1N8R W;  1XUQ A;  4MW3 A;  2PYJ A;  1ZLZ A;  5DEC A;  1WPB A;  4ZKI A;  4LFA B;  3DXR A;  4FM0 A;  1U96 A;  3DTU B;  1P7B A;  2IJK A;  3LSQ A;  4I7Z B;  2QEX V;  5IE9 A;  2W0F C;  2Q9L A;  1QR9 A;  4UB6 Z;  4ZHQ B;  3E86 A;  3CE2 A;  4DR4 B;  1Q81 W;  2OCC C;  1H8H G;  3LNN A;  3E8H A;  2ZE8 A;  5KLV H;  1DGS A;  3KKY A;  4YJ3 A;  5BMV B;  4FLV A;  3ZS8 C;  2Q7H A;  4X1I A;  5LYJ A;  4HBN A;  4G27 B;  2JEX A;  2LW7 A;  1KQS U;  2Q0A A;  3CPW U;  1NT2 B;  3L9D A;  4MSW C;  1COW G;  3H9V A;  2Q4P A;  2IJJ A;  3BAB A;  2AXT Z;  1DK1 A;  5IJ0 A;  3BHP A;  2A79 B;  2Z5U A;  1R6N A;  5B1B B;  1SQQ H;  4DR1 O;  4CS2 A;  3E83 A;  2LGQ A;  1H2K A;  3SPI A;  1M4U A;  4LF9 O;  4WFF A;  1QLE B;  1G1X B;  1Y4M A;  1ZL8 B;  4I50 B;  1AJN A;  1SA0 B;  4HYO A;  2LFR A;  4X20 A;  4LCU C;  4U3F H;  2P4K A;  3UCS C;  2EX3 A;  2W6J G;  1W2B U;  1N36 B;  2Q6A A;  4LF7 O;  2ZNJ A;  1EZV H;  3CS5 A;  3SYP A;  3ABK C;  3AK3 A;  3H01 A;  4MVS A;  4DV2 O;  3H1I H;  2Y48 A;  4B3S B;  1J95 A;  2Q67 A;  2F4V B;  1FFT B;  4TV8 B;  1IVS A;  4DV2 B;  3JAM N;  4KL1 A;  4FK5 C;  1X59 A;  1WP7 A;  3RW0 A;  1QBZ A;  4X9Q A;  4JTC B;  1YI2 V;  2UXN A;  1I94 O;  3SYC A;  4LF6 O;  2Y69 B;  3B77 A;  4ZIB A;  4D7T A;  1GKF A;  2HG5 C;  3K5L A;  4MVZ A;  4DV6 B;  1K34 A;  2ZR3 A;  2R9A A;  4U7O A;  5F2V O;  1IDS A;  4BW9 A;  2Y4T A;  2N04 A;  2HVJ C;  1VQ5 V;  3ZBH A;  2N05 A;  3ZN1 A;  4Q20 A;  1N32 B;  4JI2 B;  1HNZ B;  1MZF A;  1XHX A;  2EIN C;  3UQ8 A;  2UXX A;  4P2Z A;  1MG1 A;  3ICX A;  1WN7 A;  4DV0 O;  4HNA A;  4HNA B;  2R70 A;  3J81 N;  5FNV A;  4J7J A;  4KXR A;  4TOI A;  3AG2 B;  3FFQ A;  4U3J B;  3TJT A;  3K5O A;  2AGA A;  3JAW B;  5EC1 C;  1M56 C;  4E2L A;  4PDV A;  1JA8 A;  1R6K A;  4FLU A;  5IJ9 B;  4MTO A;  4NKG B;  5JH7 B;  4DR2 O;  2LP7 A;  2WA3 A;  5JJN B;  1VQ7 V;  4DR4 O;  3E89 A;  1BZK A;  1LUV A;  3U0Z A;  1NJI W;  2JS5 A;  4UXN A;  3JCU Z;  4QE7 A;  4GX5 A;  1H8E G;  1K8A W;  4LFC B;  5BMV A;  2CTQ A;  3K08 A;  5E1A C;  2A7W A;  4LFA O;  4CBC A;  1HW7 A;  2X6C A;  5EBM C;  1FFX A;  1AR1 B;  4W4K A;  4MTG A;  1HWY A;  3ZHV A;  3ABT A;  1AP6 A;  1GM9 A;  4WBN B;  4DO2 A;  3ABM C;  1VMG A;  2EZO A;  1M57 B;  4YIO A;  1Z5V A;  4XDJ A;  1FXK C;  3BA9 A;  4QPJ A;  2UXB B;  2RNB A;  4MT8 A;  1Q43 A;  2JIZ G;  2P7T C;  2PUS A;  3JD0 A;  1L0N H;  1AI6 A;  1K5Q A;  3CME V;  2UUC B;  1VIB A;  1YCI A;  5IYZ A;  3WB0 A;  1XNQ O;  1YF2 A;  3ABU A;  5FLX N;  2GUZ A;  4PDM A;  4J42 A;  1JVM A;  3ABL C;  2F93 B;  2YI8 A;  4LC1 A;  5LMN B;  4FLZ A;  2HHH B;  4LFB O;  5IWA O;  4LF8 O;  5L3E A;  2E5L B;  4GKJ O;  1HR0 B;  2QJ1 A;  1O9H A;  2IBZ H;  1ZAU A;  2PI4 A;  1KBH A;  2DQ3 A;  5GON A;  3RYC B;  1DLB A;  1XEQ A;  4GX2 A;  2XAJ A;  2PZS A;  1CP9 A;  5EC2 C;  1N0N A;  4JAU A;  5LMN O;  4ZOL B;  3JAW A;  2CUG A;  3VQX A;  4J7K A;  4JTA B;  4PA7 A;  1PL0 A;  4JI5 B;  1Q6U A;  2FML A;  2BTO A;  5L3B A;  3RYI B;  2OTJ V;  3JD3 A;  2YXL A;  4XDK A;  1R6T A;  4I50 A;  3RVY A;  4LR3 A;  5IYZ B;  1FS0 G;  4IIJ B;  4MVU A;  4X65 O;  3CWB H;  3VBB A;  2HFE C;  2QWQ B;  1YSC A;  3E8F A;  2BE3 A;  2QTO A;  1MNG A;  3N2G A;  3T1Y O;  3QTC A;  1MZE A;  1R1B A;  5IYD O;  2B1G A;  5KA6 A;  3ABK B;  2KQX A;  2HP8 A;  3LDD A;  5KAF Z;  2XTA A;  2YIB A;  3SYQ A;  2H8P C;  2DYR B;  4WF9 V;  4XDL A;  3RYI A;  4EB6 B;  4FIP C;  1SA0 A;  2JS3 A;  3ZHT A;  4Z1M G;  4L8J A;  4AI8 A;  4CH4 A;  3JAR B;  1TAE A;  3K3W A;  3B2E E;  4JI3 B;  5JJE B;  3LDC A;  3ZHQ A;  2JJ1 G;  5J2U A;  1GAX A;  1VEW A;  1SQG A;  3DC6 A;  1CEZ A;  2GTA A;  2ZR2 A;  4LH6 A;  3G4S V;  2LFS A;  1BS3 A;  3TXS A;  3LUT B;  2L6L A;  5LGU A;  1OCZ C;  3OGI B;  3SJA C;  1NR1 A;  5FPR A;  4IT5 A;  5EBL C;  2F1M A;  3RYF B;  3K04 A;  1FJG B;  1OHH G;  2WLL B;  5JQG B;  3BVO A;  4JYY A;  4FLY A;  3CRC A;  4B3R O;  4JI1 B;  2CGO A;  2EIM C;  2ZXW B;  4X1Y B;  3CCV V;  4N21 A;  4GZR B;  3L75 H;  4XBF A;  1VQO V;  4K8X A;  1WAZ A;  5EYP B;  2BSK B;  1XIL A;  4I5S A;  3K06 A;  1IUR A;  3FAV B;  3HKB A;  3RFR A;  3U10 A;  1DF5 A;  1I5Y A;  2R72 A;  3HKC B;  4FLW A;  4TQD A;  2X6B A;  2UU9 O;  5EK0 A;  1SQX H;  1ARO P;  2IJI A;  4X88 A;  4JYA O;  1QVF U;  2JEU A;  4GYC B;  2F43 G;  1ZUQ A;  2CH7 A;  4LF6 B;  3ETG A;  2WLN A;  3H1H H;  3GVM A;  3CCJ V;  3JSL A;  4QNH B;  3FB6 C;  2R9I A;  2OT5 A;  3QF7 A;  4PDL A;  2XUM A;  2YXY A;  3BAA A;  5EIB C;  1QHT A;  2QGN A;  2YS8 A;  2ARH A;  1B3Q A;  5LOV A;  1Q82 W;  2ODM A;  2HHH O;  1NTZ H;  3QO5 A;  1VQL V;  1YTF D;  1PPJ H;  1FPO A;  5CA0 A;  2QKC A;  3C90 A;  2JVD A;  4X89 A;  2ZDI A;  2PTM A;  1S5H C;  2UUB O;  1BCC H;  1IBL B;  3A2F A;  3AG4 C;  5IJ9 A;  4AQY O;  4B7E A;  4O2B B;  1QQC A;  3FB7 C;  5B5E Z;  3DGE A;  5KHK A;  2GTS A;  2XAF A;  3IFX A;  2Q73 A;  4OPH A;  3JCZ A;  2X7R B;  3M7M X;  5J2T A;  4LWS B;  2K9P A;  3S3W A;  3KCX A;  3TXQ A;  1LNQ A;  1OJH A;  2W6I G;  4H37 A;  1FAF A;  1I0H A;  2BTQ A;  2EUL A;  1NBM G;  4R50 A;  3B4S A;  3AG7 A;  4X1Y A;  1PKX A;  3D8C A;  4YJ2 A;  4B3M O;  5KMG B;  3H1K H;  3CC7 V;  2D3O W;  1XNR B;  2IU3 A;  2RDC A;  1V54 B;  3E2E A;  3P3P A;  1OV9 A;  4PA3 A;  1Y66 A;  4EEQ A;  2ZKO A;  3W7T A;  4DW0 A;  4K0K B;  2CDY A;  2JGU A;  3F7V C;  1P84 F;  1FXV A;  1NI8 A;  3CSX A;  5IY5 C;  4DRX B;  3TCU A;  3OTF A;  2EIJ B;  1M1K W;  5JWP A;  1YJW V;  1VF7 A;  4I55 B;  1ZX3 A;  1FXK A;  1FXK B;  3T4D A;  1WB8 A;  1JMK C;  1XL4 A;  2Y69 C;  2YI9 A;  2JK5 C;  3A8T A;  5EZY A;  4YJ3 B;  4B08 A;  1SQP H;  2KSD A;  2IH1 C;  3RBZ A;  4DV5 B;  5LHI A;  2HLD G;  5C8Y A;  2AW9 A;  2YEV A;  3SPJ A;  2IU0 A;  1XNR O;  5EBW C;  1HNZ O;  3JAS A;  3AK2 A;  4BWA A;  3HPL C;  1HDJ A;  4LBE C;  1N32 O;  2QA4 V;  3NXS A;  4LF4 B;  1MSD A;  4NXM B;  3C3T A;  4UVC A;  4ZI7 B;  1YDX A;  5IYB O;  3B8N A;  1B6Q A;  1GO3 F;  3APQ A;  2UUA O;  5TIS Z;  3ZMT A;  3KZI Z;  1S76 D;  3ASN B;  3CHX A;  3F7Y C;  3SGI A;  3STL C;  2YSU B;  2Y0I A;  3MHH C;  3AG2 C;  1IBL O;  1TUB B;  2GSM B;  4LF5 B;  3D3Q A;  2XT9 A;  3ABM B;  1F7Y A;  4WFA V;  4PV1 B;  1K9M W;  2E74 B;  1KB9 F;  1HNW B;  4UVA A;  5C8Y B;  1N0J A;  3CCR V;  2P5O A;  1R73 A;  4WFE A;  3J80 N;  2YUA A;  5EZY B;  5H9C A;  3T2M A;  1GN6 A; 
#chains in the Genus database with same CATH homology
 2UXX A;  1K73 W;  2NLJ C;  4P2Z A;  4UV9 A;  1MG1 A;  5LBQ A;  1VQ6 V;  3CCU V;  2EIM B;  3OMN B;  5FL7 G;  5L3F A;  5IDJ A;  3T4Z A;  1RPO A;  3CCS V;  2HVK C;  1E1R G;  3AG2 B;  4HZ3 A;  1VQ4 V;  2XAH A;  4JGS A;  5EC1 C;  1M56 C;  1BL8 A;  4E2L A;  3MD0 A;  4PDV A;  1MAB G;  1R6K A;  1SET A;  1V55 B;  2WLL A;  2WLI B;  4MTO A;  2XAQ A;  4R8C A;  5HFL A;  2EIK C;  1K33 A;  1M57 C;  2HKO A;  2LP7 A;  4JTD B;  5HFM A;  1VQ7 V;  3E89 A;  2DYR C;  2WLJ A;  1NJI W;  1M90 W;  4F4L A;  1TUE B;  4P30 A;  3TET A;  3ETD A;  3K03 A;  3OAA G;  1OCR B;  3OR7 C;  1V54 C;  4UXN A;  4QE7 A;  1EFR G;  1BMF G;  1GMG A;  1KEC A;  1H8E G;  3FB8 C;  4GX5 A;  4N23 A;  1K8A W;  2PI5 A;  1S0V A;  5B1B C;  2R9R B;  1VQ8 V;  4P9P A;  1K5S A;  3K08 A;  1PD3 A;  3R65 A;  1QLN A;  5E1A C;  5B3S C;  1KKD A;  4JAS A;  2WLM A;  1OCC B;  2X6C A;  4CBC A;  1YJN V;  5EBM C;  1E79 G;  1E1Q G;  3K79 A;  3WG7 C;  1AR1 B;  2HJF C;  2EIJ C;  1NH2 B;  2QM8 A;  3OMA B;  4MTG A;  1HWY A;  5BZB A;  5CBG A;  3ABT A;  3CYO A;  3CC4 V;  1SES A;  1VQK V;  1GM9 A;  4DO2 A;  3ABM C;  4KUM A;  1F4N A;  2EZO A;  2OCC B;  3ZCC A;  4RO2 A;  1M57 B;  3OW2 U;  4KP4 A;  1FXK C;  4XDJ A;  4QPJ A;  3OEH G;  4PA4 A;  3K9A A;  4MT8 A;  3LSS A;  2JIZ G;  2DQ0 A;  2P7T C;  3JD0 A;  1AI6 A;  2WAM A;  4G2K A;  1K5Q A;  4QE9 A;  5B1O A;  1OCR C;  3CME V;  1Q7Y W;  5L3G A;  3ABL B;  1QCE A;  3ABU A;  4OXS A;  3ASN C;  5B1A C;  3CCE V;  3AG1 B;  2EIN B;  4PDM A;  1JVM A;  1NR7 A;  3ABL C;  4RUE A;  1K3E A;  4GCZ A;  1K4D C;  4I9W A;  4BAY A;  2ITC C;  3E35 A;  4LC1 A;  3IGA C;  3WG7 B;  1KP2 A;  1IXM A;  2FTK A;  3CCQ V;  5L3E A;  1YTF B;  1AJP A;  4YXW G;  4CZZ A;  4PEL A;  3M99 B;  2PI4 A;  5LGN A;  2DQ3 A;  3UKM A;  1DLB A;  2WLI A;  4GX2 A;  3ZRX A;  1WLE A;  1VQ9 V;  1ZWI C;  2XAJ A;  1CP9 A;  5EC2 C;  4QJF B;  1JOY A;  2K1E A;  4JAU A;  3I56 V;  5L3D A;  1OCO B;  3OM3 B;  3OMI B;  1K97 A;  4J9Y B;  2XAS A;  4MS2 A;  2CK3 G;  5CN0 A;  4WFH A;  3W7W A;  4JTA B;  1BHA A;  2MK3 A;  5LGT A;  1PNM A;  2NNU A;  4PA7 A;  5CA3 A;  1OCO C;  3CP1 A;  3CCL V;  3SPH A;  3AG3 C;  1JQ0 A;  1EZJ A;  1PL0 A;  4GX0 A;  2C2A A;  2GHY A;  2KB1 A;  1AI7 A;  3D3I A;  1L1F A;  1FXH A;  5L3B A;  4FPP A;  3BEH A;  3JD3 A;  1KP3 A;  3AG4 B;  2OTJ V;  2B5U A;  4ASU G;  5IY5 B;  4MVM A;  4WCE V;  4XDK A;  3EFF K;  1M56 B;  3CC2 V;  1THZ A;  5DM6 V;  2EIL C;  1VQP V;  3RVY A;  3A0R A;  1VQM V;  3VOU A;  1FS0 G;  2WPD G;  1CPY A;  3WFV A;  4MVU A;  4H33 A;  1JX9 A;  4R6Z A;  4RQE A;  3VBB A;  3SYO A;  1VQN V;  2HFE C;  4JYB A;  1NQT A;  4JF3 A;  3E8F A;  1YSC A;  3F5W C;  3W7U A;  3UM7 A;  2JJ2 G;  1MOF A;  2QTO A;  1ORQ C;  3ETE A;  3ZN0 A;  3P30 A;  2P90 A;  1BHB A;  1JCH A;  5IYD O;  4WFG A;  3OFN G;  1JPX A;  5CBH A;  3JD4 A;  2B1G A;  3ZRW B;  5KA6 A;  3ABK B;  2ZQM A;  3STZ C;  3LDD A;  3D36 A;  2X0L A;  3OUS A;  4TWK A;  3X2Q B;  1KC8 W;  5L3C A;  3KG2 A;  1DTO A;  3SYQ A;  2H8P C;  2DYR B;  4WF9 V;  3QO7 A;  4XDL A;  2H94 A;  5IYC O;  4MTX A;  4PDR A;  4FIP C;  1NVP B;  4Z1M G;  2BOC C;  1NVP D;  3K3W A;  1W0K G;  5LHG A;  3AEI A;  3LDC A;  3ML0 A;  2JJ1 G;  2XND G;  4BIZ A;  3FYI B;  3PJS K;  1CEZ A;  1NH2 D;  2ZR2 A;  1SER A;  5KA5 A;  1QLE C;  3ASO B;  2A0L A;  3EHB B;  4HAM A;  2LFS A;  3G4S V;  3LUT B;  4MVR A;  2Q68 A;  5LGU A;  1OCZ C;  2WSS G;  3OR6 C;  4GX1 A;  3LDE A;  4X8A A;  1WPX A;  5KUK A;  3ZMZ A;  1NR1 A;  3HB3 B;  3CCM V;  4P9O A;  1R3L C;  2IH3 C;  5EBL C;  3K04 A;  1OHH G;  2WLL B;  3CXC U;  2A9H A;  3OGC C;  5KUM A;  1YJ9 V;  4QIW F;  2EIM C;  1QVG U;  4BIU A;  2ZXW B;  3CCV V;  4N21 A;  4JAV A;  1R3J C;  1M9N A;  4XBF A;  2OTL V;  1VQO V;  5CBF A;  2Z3Y A;  1S77 D;  1I5X A;  2EBO A;  2DYS B;  4RQF A;  1ENV A;  4I5S A;  3K06 A;  1W0J G;  4TT3 G;  5CMU A;  1KD1 W;  1DF5 A;  1I5Y A;  4FJC C;  4UV8 A;  2AHY A;  4MTF A;  3SPG A;  5B1A B;  1S3J A;  2WLK A;  3E8B A;  4TSF G;  3AG1 C;  3QO8 A;  1F4M A;  2X6B A;  4U7N A;  3GB7 C;  5EK0 A;  3OUF A;  3ZMV A;  1ARO P;  4UUJ C;  2WLH A;  3FKS G;  1F51 A;  2IJI A;  4X88 A;  1QVF U;  2JEU A;  1UJW B;  4GT1 A;  1GM8 A;  2F43 G;  1G4Y B;  3G6E V;  4KFM A;  3ETG A;  2WLN A;  3I55 V;  3CCJ V;  2V1D A;  2IJH A;  4QNH B;  5H6R A;  3FB6 C;  2R9I A;  2OT5 A;  4PDL A;  1OCC C;  2DWE C;  2B1I A;  1XL6 A;  1S72 V;  3X2Q C;  4PA9 A;  5C93 A;  4WFB V;  4FMT A;  2AHZ A;  1Q82 W;  1N8R W;  3B8M A;  3K0G A;  4MW3 A;  3G71 V;  2XOK G;  1JJ2 U;  3JD1 A;  3QO5 A;  4JYC A;  1K7D A;  4ZKI A;  5J9P C;  3SYA A;  2ZDI C;  4MW8 A;  3DTU B;  3QNE A;  2XAG A;  1P7B A;  2ITD C;  1VQL V;  1YTF D;  1YHQ V;  4L87 A;  4QPK A;  2IJK A;  1GM7 A;  3LSQ A;  4PA6 A;  3FYE B;  5B3S B;  2QEX V;  2W0F C;  1RM1 C;  4X89 A;  2ZDI A;  3ZRS A;  3T1C A;  1QR9 A;  2P6J A;  1S5H C;  2WWW A;  3AG4 C;  4JPR A;  2EIL B;  1RM1 B;  3E86 A;  3FB7 C;  3CD6 V;  3DGE A;  1Q81 W;  1RPR A;  2OCC C;  1H8H G;  2XAF A;  3IC7 A;  2QKS A;  2P67 A;  3IFX A;  2DW4 A;  3E8H A;  2X7R B;  3JCZ A;  2V7Q G;  1YIT V;  1SZT A;  2M7W A;  1DF4 A;  3GWO A;  3SPC A;  1LNQ A;  2W6I G;  4H37 A;  3JD2 A;  2QE7 G;  4J9Z B;  3W7S A;  3P32 A;  3JYC A;  1NBM G;  4R50 A;  4G27 B;  2JEX A;  1PNL A;  1KQS U;  1PKX A;  3CPW U;  4MSW C;  1COW G;  4MVQ A;  1NKD A;  2IJJ A;  3CC7 V;  2D3O W;  1K4C C;  2ZD9 A;  4MVO A;  2IU3 A;  1AI5 A;  3FB5 C;  1V54 B;  1H38 A;  2A79 B;  3E2E A;  2Z5U A;  4PA3 A;  1Y66 A;  1R6N A;  5B1B B;  3E83 A;  3MHS C;  3W7T A;  1Q86 W;  3SPI A;  2YEV B;  2ZXW C;  1EBO A;  4WFF A;  3F7V C;  1G8M A;  1QLE B;  1ROP A;  1Y4M A;  3W7X A;  1FXV A;  3OE7 G;  2EZP A;  4RUF A;  3OEE G;  1R3I C;  5IY5 C;  3TCU A;  1OCZ B;  2EIJ B;  1SRY A;  1M1K W;  4ZBM A;  1AJN A;  4HYO A;  2LFR A;  3RVZ A;  1PNK A;  3ZIA G;  1YJW V;  4LCU C;  3K0D A;  1FXK A;  1FXK B;  1MSW D;  2ATK C;  3T4D A;  1XL4 A;  2Y69 C;  2W6J G;  2JK5 C;  1AJQ A;  2EJR A;  2IH1 C;  1W2B U;  3RBZ A;  3ZRW A;  5LHI A;  2HLD G;  1GTO A;  2Q6A A;  4UVB A;  5GW7 A;  1AI4 A;  2YEV A;  3SPJ A;  2IU0 A;  1GK9 A;  5EBW C;  4R7C A;  1R3K C;  2DYS C;  4DXW A;  1QR8 A;  3HPL C;  3ABK C;  3H01 A;  3SYP A;  4LBE C;  4MVS A;  5LHH A;  2QA4 V;  2Y48 A;  3NXS A;  1J95 A;  2DWD C;  2BOB C;  2Q67 A;  2QM7 A;  4EKW A;  1P4R A;  1FFT B;  4UVC A;  2HR3 A;  2JDI G;  5IYB O;  3CMA V;  3B8N A;  1B6Q A;  4FK5 C;  1GO3 F;  2EIK B;  2Q69 A;  3RW0 A;  4BW5 A;  1K92 A;  1QBZ A;  1F23 A;  3ZMT A;  3ZMU A;  4JTC B;  3TK1 A;  1YI2 V;  2UXN A;  1S76 D;  3ASN B;  5H6Q A;  3SJQ C;  3F7Y C;  3SYC A;  3ASO C;  3STL C;  2Y69 B;  2YSU B;  5DN6 G;  3B77 A;  3MHH C;  3AG2 C;  1GKF A;  2HG5 C;  2GSM B;  1H2G A;  4MVZ A;  1K34 A;  2ZR3 A;  3ZJZ A;  3ABM B;  2X6A A;  3AG3 B;  4U7O A;  4RAI A;  3ZMS A;  1V55 C;  1OZ0 A;  4WFA V;  4G28 B;  1K9M W;  3BY6 A;  2HVJ C;  1VQ5 V;  3ZRV A;  4UVA A;  3LNM B;  3CCR V;  3ZN1 A;  4Q20 A;  1R73 A;  4WFE A;  4LP8 A;  1YIJ V;  5B1N A;  2IW5 A;  5H9C A;  3T2M A;  3E8G A;  2EIN C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...