2OT7A

Crystal structure of jmjd2a complexed with histone h3 peptide monomethylated at lys9
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
349
structure length
349
Chain Sequence
TLNPSARIMTFYPTMEEFRNFSRYIAYIESQGAHRAGLAKVVPPKEWKPRASYDDIDDLVIPAPIQQLVTGQSGLFTQYNIQKKAMTVREFRKIANSDKYCTPRYSEFEELERKYWKNLTFNPPIYGADVNGTLYEKHVDEWNIGRLRTILDLVEKESGITIEGVNTPYLYFGMWKTSFAWHTEDMDLYSINYLHFGEPKSWYSVPPEHGKRLERLAKGFFPGSAQSCEAFLRHKMTLISPLMLKKYGIPFDKVTQEAGEFMITFPYGYHAGFNHGFNCAESTNFATRRWIEYGKQAVLCSCRKDMVKISMDVFVRKFQPERYKLWKAGKDNTVIDHTLPTPEAAEFLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords JmjC domain-containing histone demethylation protein 3A
publication title Crystal structures of histone demethylase JMJD2A reveal basis for substrate specificity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 111
structure length 349
sequence length 349
chains with identical sequence B
ec nomenclature ec 1.14.11.-:
pdb deposition date 2007-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF02375 JmjN jmjN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 2ot7A01
3N9OA 5FYHA 2YBSA 3PUAA 5FZIA 4E4HA 4CUGA 5FYYA 2Q8CA 5A80A 5IVYA 4HOOA 3PU3A 3PUQA 5FZ9A 4V2VA 2OT7A 4GJYA 5FJKA 4D6SA 3AVRA 3PDQA 2OX0A 4QXBA 5FXXA 5FZ4A 5FZ0A 5KR7A 5IVJA 5FY4A 5F5AA 2OQ6A 4Y33A 3N9LA 5FY1A 5IWFA 2Q8EA 2P5BA 3KV5A 4V2WA 4QXCA 5FXWA 2PXJA 5LW9A 4Y4RA 2XXZA 5LY1A 2YBPA 2YU2A 5F2SA 4GD4A 5FPBA 5FPUA 5E6HA 4DO0A 4BISA 5LWBA 4URAA 4XDOA 3NJYA 3K2OA 4XDPA 5FZ1A 5FZCA 5FY5A 5A7WB 2XMLA 4AI9A 5FZ3A 4GAZA 3N9NA 4DIQA 4QX7A 5A7SA 2YPDA 2WWUA 5A3WA 3PTRB 5A7WA 4AAPA 2XDVA 2OQ7A 3N9MA 5FZBA 3LD8A 4IGPA 5F32A 5FWEA 5FZEA 5F3EA 5FPLA 3U4SA 5FZ6A 5A3TA 5FXZA 5F5CA 3KV6A 5FZHA 3PUSA 5IVBA 5A7QA 3K3NA 5FUPA 5FYCA 5FZKA 5FP9A 5A1FA 5A7OA 5FZGA 4UF0B 4Y3OA 5F5IA 5FP4A 2XUEA 5FY9A 5FYMA 3ZLIA 3ZPOA 3PURA 3OPWA 4LIVA 3UYJA 4IGQA 3KVBA 3N9QA 4CCJA 4D6QA 5F39A 4EYUA 4UF0A 5FZ7A 5FY8A 5ANQA 5FJHA 4EZ4A 3K3OA 5FP7A 5IW0A 4GJZA 4BXFA 5F3CA 4CCNA 4CSWA 3RVHA 4CCLA 5FZDA 3LDBA 5F2WA 3N9PA 5A1LA 4LITA 3KV9A 4D6RA 5FBJA 5FZFA 5FYUA 4EZHA 5K4LA 2YBKA 5FYIA 5FYZA 4BU2A 5F3GA 4QWNA 5FZLA 5FYVA 5FP3A 5FV3A 4CCMA 5A7NA 5FPAA 2WWJA 2OS2A 5IVFA 4CCOA 5IVCA 4NUBA 5IVEA 5FYSA 5FWJA 5A3PA 3AVSA 5FY7A 4QXHA 4C8DA 3U78A 4QU1A 3PU8A 2Q8DA 4HONA 5F3IA 3AL5A 3KVAA 5FXVA 4CCKA 5A3NA 2W2IA 5FZ8A 2VD7A 4LIUA 1VRBA 4QX8A 5A7PA 5F37A 5LY2A 5FZOB 5FPVA 5ISLA 2GP5A 2YU1A 5FUNA 4TN7A 5FP8A 3OPTA 4LXLA 4ASKA 3DXTA 5IVVA 3DXUA 5FZMA 5FYTA 4IGOA 5FZAA 3KV4A 5FZOA 5FYBA 3AL6A 2GP3A 5CEHA 5FY0A
chains in the Genus database with same CATH superfamily
3E6DA 2PHLA 3LGRA 2RJKA 2ERFA 5J37A 1DBNA 3IMNA 1W8HA 4B7EA 1QWRA 4JC1A 4XXAA 4Z2AA 1YCIA 2UWBA 4FBFA 1GKBA 4XW3A 3LDKA 4GJYA 2VZTA 2IXLA 2PTMA 4QXKA 4AEMA 5FXXA 2HLEA 4COZA 4BQWA 1WW4A 2RG4A 4AF9A 4N7IA 4ITCA 1GNHA 2P5BA 2EA7A 4QM8A 2RMU3 1ENXA 1PIV2 4LBJA 1AYN1 4XYXA 2E33A 3AZWA 1G86A 1VBE3 1W8TA 1EPZA 5ABJC 2QE3A 4I30A 5GZCA 5CA6A 4QDRA 3L9JT 5JXGA 2IVJA 1JHNA 4HBNA 5FPXA 4LBQA 2XVLA 4ZKTB 4XETA 1JZ2A 2VVFA 4Q29A 3H50A 4N43A 4Q4V2 5LWBA 3HIFA 3VBFC 5I0TA 2DDUA 3IM0A 1AHSA 1GZTA 4LO6B 2QQVA 1S55A 4FPHA 2ZGRA 4L9BA 5HI0A 5JSOA 3VBOC 5A7SA 4GQ7A 2XGXA 4K6BA 4XIOA 4HK9A 1RGSA 2Q1FA 4KNCA 5FK8A 3CZUA 1A78A 3LOIA 4BQ1A 2ARCA 4CP9B 3B00A 2BWCA 4R9BA 1UKRA 2A75A 3SISA 1B35B 3Q8BA 1AJOA 1CWPA 2A6XA 4LO7A 2VO5A 3OUJA 3CO2A 1HRI1 1VBC1 1S0EA 5IK7A 2OXBA 3WG4A 2J1AA 4SBVA 1H1MA 3HD8B 1RUI2 3KSCA 2HWC1 4OI1A 3DL3A 1FPN1 1G9FA 3KVBA 2QBXA 3LFMA 1I5ZA 1PGW1 4XPVA 3PTYA 4MXWA 5FJHA 3OEBA 1MQTC 4WM8C 4Q0UA 3BU7A 1RTVA 4NMIA 4RHV1 1NG0A 2DVBA 5D8AA 1IHMA 1JOBA 1UKGA 4A7YA 4CUBA 1LHOA 4MADA 4XC9A 3AX4A 3WVJA 2PFWA 3MLLA 1OSGA 3CNAA 2RJLA 3OY8B 2JDZA 4M3CF 1PO21 5FOBB 1JN2P 1PK6B 4QWNA 3SH5A 1PM4A 4OZOA 3IMMA 4Y22A 5CFCC 5CAZA 5JVVA 3FHIB 3UV9A 3WD5A 2VGDA 2VMEA 5IVFA 1IPJA 3RZKA 1UPIA 5A3PA 5C8CC 1LEMA 4URTA 1FT9A 2O14A 4XJ9A 1OURA 3JQXA 1W90A 4GMP1 2WZR3 1CX1A 2ZGTA 4DRRA 2D3RA 2X5IC 1G9AA 5G05L 5EZWA 1MVQA 2VOKA 2XLFA 4BM8A 4PF5A 5EJZB 2X05A 1CZVA 2EAKA 2R071 4LMFA 4L0PA 2VTFA 4Z1VA 4XJZA 4FOVA 3VZMA 1WD3A 3UKTA 4AZZA 4CDQC 4O7XA 5KHKA 1AL21 4PIXA 4DUVA 2WA3A 4ZXKA 1ZBA1 2WINB 5A70A 5FZOA 4CDUB 4QPWA 3UETA 5ANNA 1BEV1 5IT6A 3DPRC 2H6CA 2E7TA 4FPYA 5DDJ2 4AI8A 4J1WA 4LTAA 1ZBE2 4Q4X1 2ZGNA 4CEYC 4YFWA 4XQ4A 4CU7A 1GQGA 5JAXA 4P9LA 5J98B 3ZXDA 1V6LA 3LA2A 2NPIA 1OOPB 1Q3EA 4GWNA 5FLHA 4CEWC 2ZGSA 4QPYA 3VBHB 2AEYA 3IIAA 5KR7A 4JGYC 5IVJA 2HWD1 4FFFA 1OXCA 2CGNA 3DUIA 4KWKA 5BNOC 2VBBA 4Y1UA 3J7HA 1FOD2 4ZPIA 3O1SA 3BTYA 4NJ4A 4I0AA 5HBAA 1HXS3 1OMIA 3LEIA 1PVC2 4FP2A 5JI9A 4IE0A 1ULFA 3JBG3 3THDA 3UKNA 1HRI3 3CJIA 3VKOA 2DCYA 2WS91 1XXNA 5A1AA 5C70A 4WBBA 1W6OB 3RGBA 3SMHA 3MICA 3X29B 1FMD3 1IS3A 5A7WB 1JZ6A 3WINE 2VCAA 3MYXA 3ZFFC 4DIQA 2D44A 4XQDA 2RM23 4N90A 1SACA 2OKXA 3A0KA 2VAUA 2YPDA 4AOCA 4FOYA 1NZCA 5C4WC 4LBMA 1SHWB 4XVHA 4TTGA 2J1TA 3HWJA 1JS9A 3INAA 4JVAA 5FPLA 4OQ9A 5IK4A 2ZCWA 3VBSC 3KV6A 4NPLA 1AYN2 4C0HA 1UIKA 3ZKYA 3PMEA 4M3CA 2Z2SB 5AC92 1QJY2 1G8WA 2HWE2 5FUPA 3SCGA 3WSOA 5LASA 4Q0PA 2UYAA 3OJBA 2ILMA 3JU9A 1HRV1 1EY2A 1ONAA 2LUWA 2VULA 2VVEA 2B46X 4COVA 2WYSA 3B69A 3KF3A 4UFKA 4EYUA 5FZ7A 4YZ1A 2ID4A 4YVSA 3SXWA 3ZFEC 3K3OA 4Z07A 2WO2A 1SLIA 2R49A 1KEXA 2Y26A 5IYYA 1DDLA 4PQ9A 5IK8A 4XABA 2R073 3WF0A 2ZX2A 4CCLA 2C5DA 1RUC1 3O5SA 4IEVA 3NNFA 1UX7A 1Y43B 3BALA 2R0HA 4BQXA 4E2QA 3RRDA 3UT0A 2JEMA 4QAWA 5F6LB 4BU2A 1S0BA 5FV3A 2GAUA 5KXCA 4E4DX 3ZXLA 3H7JA 5CVRA 3U07A 5FK7A 2EIGA 5FWJA 2E63A 1VP6A 1XNCA 2MEV1 4GH4B 5HCBA 4LBQD 1VRH3 5BNPC 5GLTA 1FPN2 3SHRA 2P3KA 4K8RB 5GJ6A 4YVWA 1UYPA 1QDCA 1YXWA 2HWD3 3RMYA 3MIGA 3POSA 3UL2A 4A41A 5DMYA 2P34A 2QZ3A 4RHV2 3NKGA 1ODMA 4M01A 5GLUA 1JYXA 1OD5A 3T2QA 3RDIA 4Q4W1 3HR9A 4UBGA 1JU4A 4Y5SA 3ZM8A 4ATEA 1UZZA 2Z42A 4B29A 3EQEA 2B9VA 4IGOA 5L9BA 1TME1 2F17A 2ZGLA 3VUOA 3J8F1 1H6YA 5FY0A 2CNAA 5I8YA 3H8UA 3NRUA 1X7NA 1IPSA 4GWMA 2OA2A 1QJU1 5CFDB 2FZ2A 2VZRA 3UGHA 1RC6A 4CP2A 3AZVA 5EXOA 3AFKA 4PDWA 5C3SA 4HT1T 4LEJA 5HCHA 1ZRCA 2B5HA 4CVUA 3N7JA 1I5PA 2BOJA 3KD4A 1GZWA 2R061 5JOWA 3RG0A 1W6NB 1F4AA 2ORZA 2ZEWA 1A6CA 2PAMA 1QF3A 2XJSA 1N3QA 1ULPA 2OQ6A 3IDCB 3GZTB 4Y20B 4YGEA 3ES4A 2VUDA 3ZSMA 4XDQA 4DRVA 5A3LA 2IXIA 4BIFA 1DU3D 2X8KA 1AL22 3OBTA 5I0SA 4PHZA 4GXLA 2ZABA 1RUG2 2ZGQA 2VOVA 4WVZA 2GN3A 2ZZJA 5FCCA 1BEV2 5H9PA 5L9VA 1YFUA 2YROA 2XR4A 4FVVA 4OULA 3JXSA 5GLVA 1JOPA 3FBMA 4LHNA 5A3UA 3NJYA 1GOGA 3VDDA 2AC1A 3IBMA 4ZS3A 2EXIA 5FY5A 4AI9A 1GP4A 2GNBA 2WQZC 4LO8A 1CJPA 1MZEA 1BQPA 1RUE2 2D6KA 3OYWB 1NQDA 2LRPA 3NNLA 4MGYE 3GHNA 1LESA 4QPIA 1S0IA 5FKBA 1XE8A 3VBRC 3PTRB 2BQPA 4CUAA 2NZ9A 3E6CC 1APNA 4WVVA 4P5YA 4XHBA 3I97A 3KCCA 4HFSA 4MO3M 5FZEA 3BVCA 3RQ0A 2P6CA 3TNQA 5A32A 2H0VA 3TN93 3I2GA 3R4SA 2VCBA 1US2A 3B93A 3VN4A 1NY71 5FY9A 2ZEYA 1VB2A 4Y26A 2OPKA 3LPGA 1D0HA 1ST8A 4XZUG 5E89A 1GMMA 3T4VA 1VE0A 1YQ8A 2WNVA 4QKFA 2K46A 5EPAA 5F8PA 3V0BA 3RZMA 4E4ZA 2WN3A 1LKNA 3AYAA 4MLOA 4KWLA 5GM0A 3WQ7A 3VKLA 2YMZA 4JHTA 2EALA 1YC61 4YZ2A 3ACIA 1EV11 1SDDB 3JCIA 4BQ4A 3BOPA 2Q8OA 4CCNA 2CY6A 4P9IA 2P6HA 4JQRA 5T5PA 3JD71 2HEWF 1LOAA 4WVWA 3RI9A 2VZ3A 2NLRA 3TEZA 3U1XA 2A6ZA 3MDPA 1K12A 1H8TA 3Q8CA 4M0NA 5M0TA 4FPJA 5KHHA 1Z7S1 5H9RA 2V09A 4LOTA 5C5TA 5DN2A 3ILNA 4EWEA 4I3PA 1EYBA 2ZEXA 1ULEA 3N4MA 1NA1B 3HBKA 1WMFA 1R081 4PI2A 1HQLA 4IEUA 4X8NA 1G9BA 4ZS2A 1NAEA 4IERA 4K3UA 4Y5TA 2R063 2QCSB 1FX5A 5E16A 5CISA 1E5IA 3C7GA 5IFPA 1TQ5A 5FZ8A 2VMCA 2VD7A 3DN7A 4XF0A 2FDHA 4M4RA 3OB8A 1WMEA 1RHI1 2V72A 2YC0A 3O14A 4ZY9A 1RUC2 1OLQA 3OPTA 3OGVA 4F83A 4BXSV 2C9KA 2UY8A 4LORA 3CL1A 2XOMA 4ASLA 5CKQA 5IVYA 4MYEA 1DGRN 3IZOA 4Z92B 3ETQA 4AFCA 2YB7A 1M4WA 3NJZA 4LE4A 1F31A 2PA7A 5FYYA 2QJVA 3D0JA 2PYTA 3WW3A 1JUIA 4Z8BA 3PUQA 1W8WA 4KWJA 2R041 5FMOS 4BK4A 3HT2A 1C8M1 4IE4A 2VMFA 2CL2A 3FFZA 5FFOC 4LJHA 3K77A 3BTXA 4CZSA 1TMF3 2R0FA 1JOJA 3N9LA 3LKJA 1RYYA 3H1WA 2OZJA 3A23A 3WZ1A 2E9QA 1OI6A 2BNNA 4FOWA 2J1RA 4Q4W2 2E26A 5C8WA 2VOXA 4CU9A 5LY1A 3ZPYA 3MFCA 1REEA 4LLOA 4XFFA 4UFLA 3T3YA 4CP9A 5JSPA 3HNBM 5LA0A 4RS5B 5DAQA 2F6BA 2DF7A 2QZ2A 5KXBA 2Y33A 4NHKA 3RPQA 3J8F2 4CCDA 2OUHA 1J3RA 2ORXA 4KG0A 4NHXA 1UL9A 3N7LA 2WABA 3EMRA 2FHRA 4KH9A 1O3RA 4FPGA 4Q4Y1 1RUJ1 4DMIA 3AP6A 1WBLA 2IUWA 2LW8A 4NIGA 1BYHA 5FZ3A 2BDRA 1DZRA 2KD7A 2PAKA 1U12A 3O7OA 1X9TA 2VOWA 3ZVXA 3B5LB 1RUD1 2I07B 4R9DA 2Z79A 3U37A 3ZFGA 4IV1A 4AK3A 2XVKA 5F5QA 4AAPA 4F8AA 1X33A 1O3TA 5KXEA 3GYDA 4TYSA 1MEC1 5EIYB 3WUCA 4TZDA 1B09A 1ZRDA 1VBA3 4OMCA 1D4VB 2WDBA 4AVVA 1UO9A 2FMDA 3GM8A 5T3NA 2V4AA 5A7OA 3U75A 3ZPOA 2JX9A 1CD3G 4DFSA 1PK6A 1AYM1 3GZEA 3M1HA 2E7AA 4D0QA 1QJEA 5ACA1 3IWZA 3HVDA 2DCZA 1F15A 2XJTA 5JXHA 1QNYA 4EZ4A 2FDIA 1SBEA 2VU9A 3WEZA 1GFF2 3H3ZA 4NIDA 3GZUC 1W3VA 1EAH3 1FI2A 1F2NA 3AZXA 3T0DA 1RHI3 3DYOA 4C0BA 4IQPA 2Q4SA 2R1DA 3EXUA 2N7GA 3NAPC 4GB31 5FBJA 5ABJB 5FYUA 4LBKA 5J3UA 5I8SA 4C90A 3B94A 1E57A 2UY9A 1Z0HA 1UMZA 5FBZA 2DTYA 3POJA 1XE7A 2BNOA 2WWJA 4JDNA 5I8TA 1UZVA 2EF6A 2GMPA 2FZ1A 4CCOA 3U4XA 4NUBA 4RR3A 4W50A 5LBFA 4INDA 3AKTA 3PLQA 4DXTA 1NE6A 4QXHA 3VBFB 3U78A 3I54A 5FO7B 5L7OA 4EWDA 1BBT2 3SKVA 3KVAA 5FXVA 4AFMA 1QMJA 1IS4A 1UQXA 1ZX5A 3VBOB 3WW1A 4FQ4A 1N1VA 1W8FA 1OOPA 1EV12 3Q8EA 3TNPB 1AR91 5F37A 5FPVA 3VBHA 4MGTA 5E1RA 3AP4A 3FX3A 4RN5A 5IAVA 4ASKA 2XLGA 2D7FA 3DXTA 3JD72 2W46A 4QX3A 1G9DA 2ZA9A 3AKQA 2HYKA 1GNZA 1QNWA 2IXHA 2P37A 2WA4A 3Q8AA 4N9IA 2ARBA 4RD7A 5SV8A 1DQ1A 1ZZ9A 1RUJ3 3I59A 4CUGA 2BWAA 3WNPA 1SCSA 2QQOA 2W1QA 4RQPC 3KLSA 1LU1A 1A34A 1RB8G 4PLMA 1XNDA 1O3SA 1JBCA 3MUZ1 4NOTA 1HJFA 1MQTB 4J1XA 5JXIA 1JZ7A 1W28A 2XHKA 1LGNA 3QBQA 2JB8A 1RUD3 5FY4A 1XQNA 3VKMA 5F5AA 1IQDC 4KQ7A 5LBCA 1AX2A 4HL0A 4P00B 4XACA 2Q8EA 4AEDA 1W2OA 3IB3A 4MGQA 3TAYA 4DQAA 1PIV1 5CNAA 2ARAA 4ARXA 1JZ8A 2ETEA 5FMCA 4OYUA 4ATFA 2AREA 3KGLA 3VHNA 1DLCA 1SLBA 1W6MB 3CQOA 4NPRA 4HETA 5CFCB 1W03A 3E6BA 4PT6A 4XBQA 2GMMA 3HN3A 4K7JA 1CN1A 1QJX1 4W6WA 4UBHA 4Q4V1 4IV3C 2XLAA 4ZHNA 3GJAA 5BNNC 2DU1A 1GICA 2RDQA 5FDBA 3GJBA 3RZZA 2IWGB 2FDJA 1RVF2 3A21A 4JGZB 4CUCA 5JPNB 1NCRC 1OF4A 2R042 4GULA 2ADDA 1C8M2 4M00A 1N1SA 2XDVA 3RZGA 5F32A 5DUXA 1URXA 1POV1 4Y1YA 5DZFA 1JI6A 3KS7A 4IUGA 1QXRA 5F5CA 5FREA 4AHXA 4X6QB 2DVFA 2WO3A 5FQ0B 4AI0A 5J96B 1OPOA 1D4M3 1X82A 2W95A 5FYCA 1ZRIA 5LBBA 1R1A1 1CVNA 3DPRB 2HBTA 5FYMA 1K42A 1RUI1 1DHKB 4QDQA 3VZNA 1PMIA 2VNRA 2W94A 1DZQA 1S0JA 5LA9A 4ZZ5A 4FSJA 1ODNA 2X53S 3FUOA 3JB4C 4OHWA 3FJSA 1PX4A 3R0RA 2V5YA 4BPZA 2VQUA 5JPMB 3POWA 4NWWA 5LRSA 3CJXA 1QQP2 4JGYB 4GIQA 1GZ9A 1JHJA 5CKNA 2QQKA 1DQ2A 1TE1B 3ZN4A 1MZ6A 2J22A 4P08A 4YGCA 1K5MA 4UW6A 3KT7A 1H2MA 1VLNA 1CESA 1RIRA 2RDRA 2QQPA 1OA4A 5K4LA 4NE9A 4N43C 1MEC2 2HWB3 3AMPA 5FKCA 1IKPA 5FP3A 2RS52 4Q2FA 1S1AA 2XBO2 2OS2A 4JX0A 3H8OA 3RWKX 3T4HB 2Q0AA 3ILRA 4BOWA 1IZ3A 1JYIA 2O0OA 2Q30A 1RMU2 3H42B 5KHGA 2Q8DA 5CFDA 3ZFFB 1LECA 4CCKA 2MPFA 2R1BA 2UURA 1ENSA 4QX8A 4LKEA 2JDPA 3KT1A 4NHMA 1GUIA 4TLFA 5C4WB 1PIV3 2XJVA 1C5HA 1SLTA 3D82A 5LZ6A 3OCPA 4DUWA 3I2OA 1QJFA 2B42B 3K4DA 4E2SA 1BJQA 3PVNA 4GB32 3ZXEA 4MH0E 4R4ZA 5FLJA 2VR4A 4XUPA 3I3MA 3HAGA 1IS6A 2RDNA 5APAA 2RS31 5FMBA 2UU8A 1TNFA 3HMYA 4XILA 3VKFC 3S7EA 3WNXA 3UKVA 1ZBE1 5FZIA 2JG8B 3LB9A 1HB3A 2Q8CA 4FTBA 3O12A 3PU3A 1Q5OA 5D8AC 1XNBA 4BMEA 2OW4A 5FJKA 1NOVA 1X36A 3E1F1 3GBFA 1NE4A 1SLAA 3P3PA 2JICA 2P3JA 2VZVA 3VL8A 4JAAA 1FOD1 1HQNA 1PMHX 1MR5A 2C26A 1AR92 3IPVB 4LNVA 1UXZA 4JDOA 4S2DA 4V2WA 3ZSLA 5C3OA 5JWPA 2LROA 2EXHA 1J59A 4A44A 1PVC1 4BCUA 4XXPA 1VIWB 2PLV3 4RGGA 4XJAA 3WNKA 2PHWA 4PCRA 4TWTA 1UOGA 4XEZA 1Y9GA 3MF6A 5DAWA 2Q1MA 2WLPA 3M8LA 1W6PB 2J1VA 1E5RA 2CGPA 2HBUA 2Y34A 1ZA7A 3AYCA 3HJRA 1FATA 3T09A 5C6CA 2GC3A 4S2FA 4LT5A 2D5FA 2X29A 4AHZA 3R6SA 1V9U1 2CU5A 1OKOA 2UWCA 5GLWA 1HN1A 1K5JA 1VB4A 1ZYBA 1GQHA 3FZ3A 2HEYF 1I6XA 4COUA 1RUH3 4PQQA 3ST7A 5IK5A 4MX3A 5FXZA 3WLUA 3B9CA 1N1TA 1P8JA 5AC91 1QJY1 2W87A 1W9WA 2HWE1 3QH6A 3BI3A 3ZYRA 1QOSA 1S0GA 3MW4A 4O9EA 4XHXA 1AX1A 4Y3OA 2AACA 3EBRA 2DV9A 1CONA 1LEDA 1YHFA 1QJX2 5B2GB 3I4IA 1DFQA 1UF2C 1DG6A 1W0PA 5FTTC 2AYHA 2DUOA 1WZXA 1OPMA 3ZYIB 3O1OA 3DYMA 3HOBA 5E88A 2V5DA 2JG9A 4FAGA 2JDKA 1TVGA 5F3CA 5CB7A 1PGSA 2BYVE 2FCUA 4HPKA 3ZXKA 5L36A 3NV3A 2PN5A 1YIPA 2P3IA 2WWSA 3CJIC 4KU7A 3RJRA 4HVQA 2JD9A 3ILFA 4LK7A 3WOGA 4R4XA 4IE6A 4PIYA 5LRRA 1GLHA 5C3QA 5C3RA 1COV1 2QVSB 3OOXA 4PLOA 2F4LA 4XMAA 3WQ0A 5I91A 2PHDA 4CU8A 5DDJ3 3PIJA 1UOBA 4NROA 1W8NA 3AFGA 1R1A2 3MLKA 4L92A 4Q1PA 4OI2A 1KJRA 1YO8A 3AVSA 1RUF1 4N53A 5B4NA 2QQNA 2OVUA 4UWDA 2BERA 2D5HA 4WM7A 3H8RA 5DXDA 3IDEA 3VZJA 2GMEA 4UFJA 4Q27A 4ZU5A 3N35A 3VBRB 3M3EA 3J7NA 3QLQA 1RINA 2Y8KA 4Q0SA 2GP5A 4FI9A 1J1TA 4AI2A 3TBDA 3LA7A 1GZCA 2V4VA 2QTWB 1PVC3 2D6PA 2E7QA 4D7YA 1BZWA 1H1AA 2GH8A 2XJUA 3K4AA 1OH4A 4AVSA 1WW7A 2EICA 4LA3A 4ET7A 1V6JA 4QQHA 4K21A 2W5FA 5CU1A 3PUAA 4YVSC 3BN6A 1ACCA 3PJYA 3MZHA 1WCQA 3ATGA 4OUSA 4RS5A 2YDEA 3ZOIA 3ACHA 1DQ4A 1L7QA 3EJKA 3C7EA 4L97A 1O8PA 1J84A 3PDQA 4YPJA 3DCQA 5HXMA 3LSEA 1WWYA 1UPSA 2ZS6B 5LK7B 4EN0A 5FY1A 2Y6FA 1WGPA 3H0OA 4LBNA 3MFAA 2QQUA 4WVMB 4CDXB 3WXPA 1ND2B 2RMU2 4KU8A 3P6BA 1AYN3 3AP7A 1H30A 2KM2A 5AC93 1QJY3 1AR61 4U2AA 2FQPA 4XJWA 2AH2A 1W9SA 2LS6A 2NQYA 2YBPA 3DGTA 3H1MA 4RA0A 1RUG1 1H2NA 2VBDA 5F2SA 4EN7B 5JIUA 4EQVA 3ZSEA 2RS32 3CZJA 4L8QA 3A7QA 1S4CA 1X8MA 3NNMA 4YVWC 1ZZBA 3M3IA 4OUMA 1HV0A 2NP0A 1H1IA 1CAVB 3K75B 1T6GC 3PMSA 4XDPA 3A0NA 5FPZA 2XMLA 4QDSA 2WO1A 2W47A 4XFCA 1RUE1 2J1SA 3THTA 4WZFA 1PGL2 1GQPA 1W99A 1JYWA 1MS8A 2JXAA 3J7LA 1UOFA 4EE2A 2YGMA 3QOPA 4IGPA 5FWEA 4FXKB 1EUUA 3R4UA 2ZGKA 4HMZA 1REDA 1XOYA 5FMDA 4UW5A 5A7QA 4H2AA 4PDWC 3VD4A 1PMJX 3LA3A 1VBC3 5F5IA 5FP4A 4NN0A 2XUEA 3C8XA 4XF3A 1BCXA 4B1LA 4AFBA 1SFNA 4QKNA 2P4EA 1D0GA 3RYPA 2HWC3 2VNGA 4HK8A 4IGQA 3VDBA 1FPN3 1DGRA 4C1WA 5KXDA 3B7MA 5DUUA 5DZGA 2CTVA 4N9HA 3V0AB 2R16A 2WNUA 1XYPA 1V9U2 4RHV3 2KA3A 3J4UH 4GWIA 2C9AA 2DFBA 1XC6A 2UYBA 5DG2A 1YEWA 4CE8A 1PZ8A 2D6NA 2RDSA 3KQRA 1CQ9A 5IUQA 2DTWA 1JU3A 1PO23 1LULA 1YQ5A 5FZLA 1VMFA 4UYBA 3NKTA 3O1MA 4NR1A 3O0VA 3VDDC 3S6PA 2WN2A 4E8CA 2VBPA 1KS5A 5A33B 4OHYA 4LE3A 5IVCA 3KHCA 2VUAA 2WJSA 4A7ZA 3D8CA 1D7PM 2MHFA 4YRDA 4QPIC 5K0UA 1NCQB 1QGLA 3A4UA 1W2UA 4JV4A 4GMP3 5F3IA 4RYDA 4AXOA 1WLTA 1PX3A 2FCVA 1O59A 4H7MA 4JTOA 1FV3A 4ZU7A 1VRBA 2VL4A 1UMIA 2HWF1 4QGNA 1ZZCA 5FO8B 1N3PA 1LHVA 1MS9A 5BYNA 4FQZA 4LUKA 1W8OA 3HPNA 4LXLA 2A71A 3BKZA 1ZZ7A 1AL23 1Y3TA 2C1FA 2OIIA 4XOGA 1LHWA 1ZBA3 2WNVC 2ZOEB 1W04A 2W52A 1COV2 3P1IA 3TEWA 4QMAA 2XL9A 1BEV3 3ACFA 2YBSA 4FFGA 1YLLA 1LU2A 2G9FA 3J7MA 5HCAA 4Q4X3 1ULCA 1WMXA 2RS12 2DYCA 4KG8A 2WT1A 5A80A 2EXKA 1WD4A 3VL9A 3RI8A 5JZGB 1RUF2 4QKDA 3CHXA 5E8AA 4YG3A 1RUE3 1ENQA 1L7RA 1IS5A 4FAHA 1VBD2 3LZZA 3VDAA 2VMDA 1VAKA 1HQWA 1W0OA 1QEXA 2X09A 1FNZA 1H8TC 3KMHA 1YWKA 3MW2A 4JGZA 5FAXA 3VD7A 4E9KA 2GC2A 2E32A 2ADEA 2RE9A 5CIRA 2PXJA 3ES1A 3NAPB 3WP6A 5LW9A 4OHXA 1T6BX 1HXS2 2VQ0A 3O1PA 1Q8PA 4I02A 4DS0A 3H9AA 3OF1A 4HZFA 3O0XA 4IE7A 1WLCA 3JBG2 4PIZA 4BJ0A 3ITQA 1MS4A 3T1LA 3LEKA 5A3MA 2BZDA 2WS93 3QACA 4I0WB 1O4TA 4EN9B 1LOFA 5DZEA 2VECA 1H0BA 4K8FA 4YW3A 4URAA 2H6BA 1FMD2 4IW3A 4UW3A 1LOBA 3G6JB 1U5XA 1NLQA 2P1BA 1J1LA 2VOTA 1LOGA 3B01A 3SCFA 3VBUA 1CX4A 3AJYA 3ZIXA 3ZN6A 4CXXA 3C2UA 2XKOA 2ARXA 2SBAA 2RM22 3LCPA 4ARYA 5GKAC 2BPA2 4AI3A 3OD0A 5DAVA 4YM2A 3HT1A 3ZDVA 1YI9A 1IPKA 4UFHA 2HKXA 5J48A 1W2AX 1PO12 5D1IA 1O6UA 1AR62 2NMOA 3MGUA 3Q9OA 3RS6A 2BVVA 5I93A 4NIHA 4CDWA 4LIVA 3OTFA 4UFMA 1HRV3 3OBAA 1IG0A 4RQPB 1V6MA 1OFNA 5GALA 3UGFA 4B4RA 4UF0A 1ZREA 5JOZA 4HXCA 5CKMA 2B4KA 3RWNA 1XNKA 3IAQA 3H8XA 1UCXA 2GNTA 1ND3A 3SH4A 3CMGA 1HN0A 2QDRA 1ZRRA 1RUC3 3NSTA 4MHRA 2JKBA 2P3YA 3T1MA 3E5UA 5J7MA 2Z69A 4L99A 1JZ4A 4COYA 3GALA 3WG3A 2RVAA 3M2MA 1Z78A 1BKZA 4W6YA 1W06A 5F3GA 4C1XA 2WFPA 1UZWA 4DZGA 5BNQA 1FNYA 1OLME 1HDKA 4BWOA 1SPPB 2DBIA 1VMJA 4FFHA 2FDGA 2K2SA 4FPLA 3TEXA 2GN7A 5BNNB 1S2KA 4C8DA 2MEV3 5C7GA 3OD4A 3M70A 1XJAA 1VRH2 2WAOA 4IV1C 1BBT1 4ZU4A 2K9ZA 3ZFGC 5C9AA 2JG8A 4J6GA 4KMQA 1W9FA 2BVBA 2ZEZA 4O9GA 3ME2A 3WHTA 1GSLA 3BUCA 1MZ5A 4BYYA 1W6QA 1W9YA 3WNNA 3AP5A 4MUVA 4Q4W3 1OT5A 4XF9A 1LENA 1OH3A 1XNTA 1PK6C 4PI0A 5D21A 1SZBA 5JI7A 1Q8VA 4MHUA 1TME3 3WDVA 3AYEA 2ZX1A 3TWIA 5EFUA 3O0WA 3J8F3 1OQ1A 3ALQA 4TLGA 3MHZA 3N3HA 2XWBB 3WP4A 1QJU3 1QJZA 2XB6C 2Y6GA 4P9GA 4HOOA 5KHJA 4O65A 1W6PA 3VZKA 4RL7A 4ASMB 2WFF2 5H9SA 4K1YA 3W59A 2VC9A 4LHKA 3RZHA 2BGCA 2IZWA 2Y6KA 1LTEA 1W05A 2ET1A 3V65A 2BUKA 1GR3A 3AXDA 2HWF2 3USUB 1AF9A 2C0ZA 4BLIA 2EAAA 4LBQB 3FUQA 4DXSA 1CPNA 4U36A 2AENA 2IXKA 5C5UA 3OUIA 4RR3C 1XSRA 2VNOA 5GZGA 4FO9A 3ZYGA 5L7OC 3LWCA 3AB0A 2QKDA 1JODA 2HYXA 1W8ZA 2YG0A 4MGZE 4YZ3A 5EQUA 3WW4A 4Z82A 3ZO0B 2ZGOA 1LAJA 1OOPC 1XPWA 5FZCA 1RVF1 1OUXA 4W8JA 2BBAA 4G3YC 1NUKA 3VBHC 1XSQA 2G4IA 1HB1A 2DURA 2WZPP 3WDUA 5K7PA 2PHFA 3I3BA 2DBNA 3ZMOA 4IEXA 1PM7A 2A6YA 1YJLA 2VTXJ 5SV5A 5JR2A 2YC4A 3FC0A 2PQSA 1CGPA 4LHSA 3U4SA 2B9UA 1DCSA 2ZHNA 3LE0A 1POV0 3BB6A 2ZXQA 4XMIA 2BTVC 3T30A 1AXZA 4FPEA 4HKWA 3TN92 1REFA 2VUCA 3K3NA 4IEZA 2XWJB 3VHPA 4D69A 4YW7A 3FHAA 4P9YA 1UY0A 2A3WA 4FXGB 2ZZQA 4FCAA 4MXWB 3RFRA 1I9RA 1B35A 5BUVA 2RJ2A 1ULDA 5FUIA 3O1VA 1AR72 2W39A 5D8AB 3V56A 1BBT3 4HKOA 4AG4A 2CHHA 2XUMA 4AEDC 3GGLA 3GDBA 4BQ3A 3UGGA 5T5JA 2WZ8A 4YFZA 3WV6A 1QQP1 2C6SA 2VPVA 4YNIA 3WQBA 2XJRA 2FDKA 1EV13 1Q8QA 1O4ZA 2JDMA 2A3XA 4QPGB 5G04L 1UY2A 4Y22B 4O61A 5FZDA 1U5YA 1J3PA 3JD73 2TUNA 3UESA 1RXGA 4XAEA 4Q8KA 2RS51 1Z7S3 4LKDA 2JE7A 4ISQA 5A6ZA 2XBO1 5FPAA 3ROUA 5DUWA 1R092 2VG9A 3OY8A 5IVEA 2QQLA 1OA3A 1R083 3WCRA 2GC0A 1IOAA 1UAIA 1RMU1 3H1YA 4FOQA 5D2AA 3GF6A 4FPFA 3GBWA 2BFUL 1QKQA 2A1XA 2JKXA 2W2IA 1VMHA 4YARA 1F9KA 5GZDA 4LIUA 4QGMA 5L19A 2EIBA 5FZOB 1IKQA 4MZUA 3S0MA 3SQOA 4FTEA 5FMOL 3FE5A 4CRQA 5IVVA 3DXUA 3LSDA 3KGZA 3DF0A 1H2KA 3KV4A 4XFBA 4CDXA 1ND2A 5T5OA 3TEYA 3EHKA 1KQRA 1CR7A 4WV8A 3I3QA 5CG9A 3GXUA 5I0DA 4NRPA 3BTZA 5T54A 3GNEA 1YQCA 5JSRA 4OVEA 3B3QE 3OSDA 4NHLA 2VNVA 4CDUA 4NPMA 4R9AA 3R4DB 1C8NA 2BBVA 1SDWA 4K20A 4QB1A 1UU6A 2R043 3CKHA 1QXPA 4K9SA 2O8OA 1FYUA 2DVAA 3NV4A 1C8M3 1K5MC 1O7FA 4B4QA 1U5IA 2JIJA 3VHOA 2DFCA 1C3HA 4KGQA 3O1RA 4YM1A 1NQJA 4LA2A 3EB7A 3E5XA 3K48A 5EYXA 1HX6A 2ZHKA 3I2JA 3MBWA 4Y1XA 4BB3A 4Y4RA 4EJRA 1C5IA 4Q26A 5FPBA 2C24A 3ZXGA 1ASJ1 5CFDC 5FPUA 2UWAA 3SLIA 1CJDA 1WA6X 1GBGA 3GBGA 2W1WA 1UZYA 2WYFA 1ENRA 4GKXA 4HVRA 4Q4Y3 4XDOA 4LPLA 5FZ1A 5LATA 2YHJA 1WA4A 3APBA 3MPPG 3WDYA 1HB4A 1W6OA 1E5HA 1QQP3 1WCKA 2JJ6A 4WM8B 4A42A 2WSVA 2JDHA 5F9TA 2P2KA 2WWUA 3PUHA 4M3CB 5A7WA 1C57A 1GWKA 3POEA 2RR11 3N9MA 3NQHA 3LD8A 3ZSJA 3WF4A 1GOFA 1Q8SA 3W5NA 3V0AA 1FAYA 2ZX4A 5JZGC 1MEC3 3ORJA 3DKWA 3NMBA 1VBA2 1X50A 3P5BA 1S0FA 1R1ZA 5TSWA 3I7DA 2XBO3 5FZKA 4DEVA 3MIFA 4YVSB 1H8VA 3PURA 1AYM3 4LKFA 3UYJA 5ACA3 2D93A 4I01A 1ZZ6A 1T2XA 2AR6A 3N9QA 1PVXA 5C8CB 2G1MA 3WX5A 2VZPA 3SH3A 5IW0A 2WSUA 2X5IB 2ATFA 1AVBA 1NCQA 4LBLA 5JUVA 5EP9A 1GYKA 4DEQA 3NVCA 2WBKA 2R6QA 5F2WA 3KV9A 1MZFA 2GALA 4GB33 4AVAA 1R64A 2OYZA 4CDQB 1ULOA 4EZHA 4JKKA 2YBKA 4OHZA 3BYWA 1OLRA 3POBA 4CCMA 3MEPA 3T0AA 2VTXA 3POIA 2IFWA 1ALYA 4YVWB 2HH9A 1VALA 4CEYB 3IIIA 4M3CE 4UFIA 3GZAA 2CDPA 3FFQA 2HEVF 2XL7A 2GH2A 4S2GA 3ZYJB 5KHIA 4H55A 3BU0A 3JUUA 1SEFA 2YGLA 3AL5A 3LQCA 4CEWB 4DPNA 5JZGA 4OI4A 4QX0A 4GH4A 4Q0QA 2NN8A 4B3NA 1AR93 2A3YA 3ABZA 1VJ2A 4YW5A 5BNOB 3DECA 4OCTA 2XPJA 5JOYA 5FUNA 1CZSA 1UWWA 3AM2A 3R05A 2JENA 2OZ6A 1JMUB 4BZ4A 5FZAA 3PHMA 4PDWB 3AMHA 2L9LA 3HQRA 1HV1A 2VZQA 4JDMA 5CG8A 2VMHA 1GZWB 2W08A 3VLBB 2OPWA 3POGA 4E4HA 4PBPA 1YQ6A 3GHMA 4AAXA 2JG9C 2ZHMA 1OF3A 4S2HA 4QHOA 2C4XA 1ZM1A 2PHXA 4YG0A 1OQDA 2SLIA 1XBFA 5FIXA 3KHBA 2WAAA 2ZMKA 3OGJA 1AXKA 3BPSA 4ES9A 4NIIA 2R30A 1SFYA 1UZ0A 2VUJA 3CIHA 4Z2WA 4LULA 4QXCA 2RMU1 1KD7A 4KWUA 1LODA 1W6NA 3D3AA 3ZN5A 1GP6A 1DQ6A 1VBE1 3VBSB 4B4PA 3H3UA 4XJ8A 2DU0A 1CPMA 1GWMA 2EIEA 2YU2A 4N53C 4Y20A 1YRZA 4UT5A 1QJX3 4WM7C 1VPHA 4Q4V3 3WCSA 1W9TA 4IETA 3AP9A 3AZZA 4UI9L 1OQEA 3MIEA 1N3OA 1GOHA 1VBB2 3CU7A 4NVPA 2VY0A 1J58A 4YZ5A 2XHNA 3IAPA 4M0HA 2H0BA 3THPA 1DGLA 3ZFEB 1PGL1 3LAGA 3M3CA 5A32B 4RFT0 3F95A 4QD2A 3W58A 5A3WA 3WNOA 4OI0A 3MF9A 2VMGA 2DWRA 3OYWA 4OMDA 1POV3 2W1UA 3W5MA 4G9SB 5A3OA 1M06G 5J36A 1JUHA 3WG2A 2WNVB 4RS5C 1PZ9A 2ZMNA 1R1A3 1LJ7A 1HLCA 4QQPA 3ZLIA 1KITA 1UYZA 2D43A 1RUI3 1ASJ2 2DVDA 4KL1A 4E8DA 3RZJA 4IEYA 1RUNA 5FR3A 3MW3A 3M7AA 5T52A 5F39A 1Y7BA 1SPPA 5BNPB 3S57A 2FBEA 4UXAA 2YXSA 1V0AA 2GZWA 3OEAA 1BMV1 4BXFA 1DGWA 4XFHA 4K40A 5LCWL 3EYPA 1MS5A 1QHDA 1QH7A 4Q8LA 2RR12 5AVAA 5A1LA 1QOOA 3OPZA 4CP1A 2WNOA 3BCWA 4HVOA 3KCXA 4JKMA 3KCYA 3O1TA 5T55A 4YGDA 3I2IA 2TEPA 4HG6B 4XFGA 4L11A 4I2OA 1WBFA 3PVEA 4ONUA 2GDFA 3USSA 1UU4A 4P02B 3WF2A 1HKDA 4QU1A 4XFAA 3ON7A 1A8MA 3SITA 4EN6B 1NA1A 1V6IA 2WZR1 3ZYBA 2AZ5A 1LGBA 1OHFA 2AEZA 3CDZB 2OUJA 3T08A 2ZGUA 1BVP1 3NV1A 4LOSA 3LEMA 1AJKA 2D6LX 2YU1A 4CP0A 4AE2A 4CTEA 2FD8A 1EPWA 4K1ZA 5FYTA 5LB6A 2DVGA 2ZGMA 3OBRA 1C1FA 1Q43A 3USUA 1CIYA 3ZYPA 2QQMA 2RS33 2GP3A 3CF6E 4GKYA 2FCTA 3MIDA 3UK9A 3HNMA 5FYHA 4A7KA 4F3JA 1S2EA 1JZ3A 4MGSA 2Y0OA 3DEMA 1ZBE3 5DPNA 2RS11 3EO6A 4H14A 3T0BA 3VKNA 1X9PA 1V6NA 4HKLA 3VD3A 5IFTA 3AMNA 2WNUC 3J9SA 4NAOA 1AR82 1OBNA 3NNGA 3WW2A 1O3QA 4P5HA 5A6QA 1ZRFA 3C7FA 5CYYA 1VBD1 2EXJA 1SBFA 4ZONA 4PF1A 2QFEA 4CCEA 5HV4A 3TB0A 2R32A 4AFAA 5K9YA 2JDAA 3BODA 1UMHA 3OGGA 1F5JA 1FOD3 1YIFA 1QXJA 2WC2A 4IXLA 4QB2A 2YC2A 1HXS1 1NLRA 4E4SA 2PLV2 2VQTA 3BGAA 3JBG1 3PNAA 1UXXX 2BW8A 2YZ4A 4RSUA 3RYKA 5BV6A 5JCTA 5K0UC 1G6NA 3IT8A 2ZGPA 4QU2A 4XJUA 2O8QA 5LBEA 4BISA 2JDYA 3RJ2X 2E31A 1FMD1 1LHNA 1VAVA 1VR3A 4TXWA 3J26N 3ZFGB 4IV1B 4OLLA 5F7UA 3N9NA 3MO4A 3THCA 1V9U3 2ENRA 2RM21 2VZOA 4JQTA 5DABA 1CAUB 3HNYM 5FRAA 5CZKA 4NAMA 4KI5M 4ISRA 1RUH2 5JMCA 5F3EA 2QDNA 2I74A 5FZ6A 1DYKA 1N47A 2Y6JA 2X10A 4QPGA 4H3WA 4A6OA 4CPBA 2CV6A 1I1EA 1PO11 1VBE2 1F35A 2HWE3 3QH7A 4QHBA 1KXGA 3ZX7A 1FV2A 5FP9A 1A3KA 2W91A 3FL7A 3WDTA 4DXRA 3WP5A 5KC6A 4LK6A 3TOJA 1AZDA 1GU3A 1TG7A 4PLNA 4JGZC 5ANQA 5DUVA 2ZPXA 3D4KA 1O4YA 3GCXA 2LTNA 1OFSA 1XRUA 3ZMNA 2D6OX 1OD3A 2VZUA 1LOFC 2WT0A 3TRSB 1US3A 4RR3B 2A6VA 1COV3 3FBYA 2CYFA 3OUHA 4IDZA 4JHZA 5IATA 2WT2A 2Y0IA 1UY3A 1OUSA 5FO9B 2VJXA 2QQJA 3F2ZA 2W92A 4GZ9A 5AVPA 5L7OB 1XU1A 2WRAA 1Y9QA 2J42A 2RS13 3VBUC 3POYA 5ABJA 4I09A 3OBZA 1W3XA 4XF4A 3NW4A 5B4XA 1RUF3 1VRH1 2W1SA 5T50A 4XAAA 1VBD3 2XQXA 2NMNA 3FLRA 3QCWA 4IEPA 5L9RA 2XG3A 1YJKA 2WUHA 3VDCA 5A3NA 3MI8A 3E97A 3WNLA 4P14A 4QB6A 2O1QA 3VBFA 4AVBA 2ZAHA 4MG2A 2DCTA 1BMV2 4ZXEA 1KJLA 3KQ4B 5ISLA 3RNSA 4N8MA 3UJQA 2DUPA 3ETPA 4QT6A 3VBOA 1GWLA 1UW8A 2NYYA 5IHRA 3VHRA 3I59B 4I3GA 1OKQA 5JR7B 4CDWC 1VAMA 3PIGA 2XVGA 3NL1A 2J7MA 1BK0A 2ZAAA 4OHVA 5FYBA 3IN9A 3N9OA 4GALA 3B02A 3PJQA 4XTMA 4JKLA 4DB5A 4COWA 4KBBA 1F5FA 1KDMA 1KRIA 4AEDB 1ND3C 3RSJA 3KM5A 2WFF1 2A5ZA 1S0DA 4FT8A 4QXBA 1D2QA 3ZXJA 2WZR2 5FZ4A 4ZZ8A 5C3PA 3IKWA 2YV8A 5JDBA 4AL9A 1WCDJ 2PELA 2JWPA 1MPXA 4UOJA 1MQTA 4WM8A 5EHDA 1XNAA 2QQIA 1PO13 1AR63 1W8UA 4QX1A 2QNKA 1RUG3 2W3JA 3LF7A 2LALA 4GD4A 4XUNA 1UIJA 1K3IA 4D94A 5C9AC 4XUTA 2JG8C 1W6MA 4DO0A 3JZVA 5KBFA 5CFCA 1IQAA 1WW6A 5F6KA 4A6SA 4AQ2A 2Q1ZB 3K2OA 4QM9A 3OG2A 2KXLA 2WIIB 1KS4A 1WCSA 4GAZA 3MLJA 2GU9A 4QX7A 3BTAA 5JIAA 4D3WA 5C8CA 2RHPA 3ZKUA 5JOXA 4Y5Z0 5FZBA 4HANA 2TNFA 2X5IA 4XCAA 1LGCA 1TNRA 1KFUL 4A4AA 1J83A 4HN0A 2K0GA 5FZHA 4E2GA 1DQ0A 3NWKA 3C7OA 4XE9A 1RJ7A 3TN91 3VZOA 5CBLA 3L2HA 1CAWB 2PMWB 5A1FA 1C28A 5FZGA 1FXZA 5L73A 1HRI2 1VBC2 4CDQA 5F1RA 4Q1RA 3U14A 3WP3A 1OA2A 1POQA 5FQ0A 2HWC2 1AR71 1IG3A 1ZZ8A 1GV9A 1C1LA 5IJRA 1JXNA 4JCKA 3FWEA 3DPRA 4OFGA 1PGW2 5FY8A 1BHGA 4AGVA 1HIXA 4CEYA 2BU9A 1K5MB 1LRHA 5FOJB 2MNGA 2VM9A 3PVBB 3WF3A 3K4ZA 1J3QA 2XKPA 4CEWA 4CCCA 3LDBA 3N9PA 4CU6A 2V73A 3ELNA 2BNMA 1UY1A 4JGYA 5FZFA 1W0NA 3IDBB 2EIDA 5FYZA 1PO22 4QGLA 1V6KA 1ZNPA 5BPXA 4XUOA 5FYVA 5BNOA 4PJYA 1OVPA 1SMVA 1WW5A 1R091 3ZXFA 2YY1A 3VD5A 3N7KA 3JB8A 4MGIE 3S5QA 1DZTA 1NXMA 3QD6A 4Y1ZA 1RL3A 3PUIA 2XH6A 5EJ1B 4FPOB 3AKSA 2WFF3 1CAXB 4HONA 2WNEA 4AHWA 1WUVA 2EVXA 2W9XA 1V6OA 2VXRA 3D5OA 3T2TA 2HWF3 1UOJA 1SG3A 2IFRA 4A3ZA 2B39A 5HPOA 2GSYA 2R072 2ZTNA 3ZFFA 1KFXL 3URFA 1H9PA 4B1MA 3W9AA 3S7IA 1U0AA 1ZA4A 5FP8A 3ECQA 1LHUA 1AX0A 4Y24A 1B35C 3LFIA 1JYCA 3AMMA 3G7DA 1EUTA 2YYOA 1ZBA2 1JTZX 5C4WA 4BMBA 1SLLA 2XONA 3MIBA 3VBSA 3SC7X 1SCRA 4CPBD 1O5UA 1H9WA 2VW1A 4JTNA 4Q4X2 4IV3B 2Q5TA 2VZ1A 2D3PA 4ORFA 2OT7A 2YUEA 3AJZA 1MACA 4R9CA 2DCJA 3VB9A 1O91A 1QU0A 2OX0A 3AVRA 2QUOA 3VGIA 1NCRB 4X8PA 3HQUA 3I3EA 1NKGA 2VW2A 3ZXAC 2HWD2 4IL7A 1TMF1 4AYUA 1GP5A 1NXD1 4MVTA 2PHUA 4NRMA 2ZBJA 3ZYHA 3ZFEA 2WQ4A 3AKPA 4GWJA 4LKSA 4TSVA 5FXWA 3K46A 3A22A 2J1EA 1Q56A 5FLIA 5LA2A 1O5LA 2XXZA 3ACGA 4B8EA 4BQYA 1UN1A 3OGSA 3SEPA 3IPVA 4DOUA 2YFZA 2JD4A 2WS92 4AW7A 3W20A 4NRQA 5E6HA 2JIGA 2A70A 3K51A 4XCBA 1AR73 4X6RB 4WZCA 3WT3A 4DNYA 3FMGA 2AUYA 2GNDA 2XJPA 2CAUA 1UY4A 4Q5OA 3BOWA 4MV2A 4BA6A 5BNPA 3LIGA 5AFEA 3I2FA 2PAEA 4CDXC 4D7SA 1ND2C 4IESA 2E51A 2ZKLA 3CLPA 1LCLA 5A3TA 2P17A 3WR0A 1XYOA 4QQ2A 1VBA1 4N43B 3AK0A 3H3LA 4CDUC 1L7LA 1R093 2JECA 2BP6A 3AYDA 3UNPA 2CAVA 1V70A 2JE8A 1HRV2 2JG9B 4CCJA 3I2HA 1CZTA 1HB2A 1DGWX 1Y9MA 4HPKB 2ZHLA 4HSLA 4CYDA 4AVCA 3NJVA 3I2DA 2VQAA 4W65A 3ZSKA 1LR5A 3FN9A 1EAH1 4FFIA 1BK1A 2FDFA 3ACLA 2JB4A 3RVHA 4N7UA 2WL1A 3NV2A 1LB2A 2HJIA 1HW5A 2I2SA 4QQOA 5KWRA 3N36A 3HN1A 4LBOA 2BFUS 2CDOA 4N53B 4D8MA 2CSGA 5C33A 3WDXA 4WM7B 4BDVB 4W6XA 1DP0A 5I0RA 4YW1A 5FYSA 1WKYA 4AHYA 4YM0A 2E6VA 2RV9A 3MV01 2MEV2 3MIHA 1TEIA 2ZX3A 3HQXA 2B8MA 1PZ7A 1JYVA 1K45A 4QHZA 2PQQA 3GCWA 2VW0A 2WKKA 2VZSA 3AXEA 1E5SA 1GNYA 1MVEA 1PNGA 4IEQA 3SKJE 4P9XA 1BVVA 3DKQA 1DYPA 3U0ZA 4R8HA 4Y4YA 1F8VA 1ULGA 2WZEA 3LEGA 2Z5WA 3NJXA 4XUQA 5FZMA 3VBRA 2IXJA 2VMIA 1TME2 4FPKA 4XF1A 5EWSA 2W0XA 2D3SA 1W39A 3WQ1A 4DY3A 1OC1A 4OUEA 3N7MA 2BOIA 1ZVFA 1DIWA 1YUDA 4XZPA 1QJU2 4EV0A 1H4HA 1I3HA 1NCQC 4L2NA 3CEWA 1Y4WA 4H7LA 1WLDA 4V2VA 1RUOA 5DAPA 4D6SA 4YSFA 1WCUA 4JRLA 4M4PA 2R062 4W4ZA 2BGPA 1G9CA 5BXXA 3BPZA 5EV7A 1BXHA 1S0CA 1XU2A 4Q0VA 5HV0A 1L3JA 3DYPA 4Y33A 1QY4A 2VCCA 3KV5A 1EP0A 5KC5A 2Y38A 4META 4MOAA 3OGRA 4P9WA 1CAUA 1JYTA 2IC1A 1KGYA 2ZJCA 2ZKNA 4YW6A 2F4PA 4WVMA 4HSJA 5GLZA 3AC0A 1DLLA 1LOCA 1QIQA 2A7AA 2D97A 3CBNA 3KF5A 2BEOA 2B7YA 4DXZA 5AFBA 2B45X 4XTPA 1YFXA 2Y6LA 1QH6A 1O8SA 2KR2A 3C3VA 1VBB1 4GH4C 4HN1A 4LO4B 3WNMA 4BK5A 1DYOA 1RVF3 1H2LA 5J1XA 4FP3A 3ZIWA 3Q8FA 2AGSA 5LEKA 4AR2A 1CAVA 3W21A 4J25A 4V1PA 4YWAA 1RITA 3WDWA 4AWDA 5BY5A 1TMF2 4KGGA 3P3NA 3I49A 2WQ8A 3BIWE 4QX5A 1UU5A 3CJIB 1JH5A 1UD1A 4BLJA 4CXWA 2Y60A 3PUSA 3ASIA 1AUYA 1D4M1 1YQ2A 5EYYA 2Z4FA 2VVDA 3VZLA 4C91A 4LLFA 1NY72 2D98A 2VXJA 3AMQA 2ET7A 3D0SA 4LUMA 4RGKA 3OPWA 4NWVA 4YYOA 3MPBA 1NZIA 4DUXA 2XJQA 2WNUB 4IEOA 3LPFA 4D6QA 1TZOA 1U5ZA 3S30A 1S2BA 4A45A 1LNSA 1LOEA 3LIHA 5GZEA 5EJ3A 5FP7A 5JXJA 4GJZA 3KB5A 1PNFA 3SEEA 4CA9A 1JW6A 3WHUA 4XBLA 4XFIA 2IXCA 4AEJA 2J1UA 4EROA 4LR4A 4QQLA 3E5QA 4JZRA 1YNAA 1W2NA 4AQ6A 1HJGA 5DG1A 4LITA 1MS3A 5CADA 3IDAA 2CWMA 2CWSA 2G19A 3VD9A 3FHQA 5H9QA 1AXYA 3T2PA 2HWB1 2ES3A 4XBNA 1OVSA 1MS0A 2JDUA 1Z7S2 2RS53 3L2YA 5K0UB 4DINB 4B7KA 5A7NA 3PVOA 1SQ4A 1SLCA 2BV4A 1Q8OA 4PBOA 4FTSA 5A6XA 1R082 2CGOA 2DCKA 1DF0A 1RMU3 1W2TA 4XIKA 1YI7A 1QDOA 5A33A 1H4GA 1H6XA 4SLIA 3B9IA 2WLQA 4YM3A 2GNMA 5A7PA 1YYNA 4OZXA 2BJSA 3KZ4C 4YLZA 5LY2A 1EAH2 4EWAA 2ZX0A 5HXVA 5J09A 3SCHA 3MUY1 1RHI2 1NT0A 2A73B 4JRAA 3WY6A 4RGAA 1RXFA 2Y64A 4UW4A 1V00A 3AL6A 3DV8A 1C4RA 2PHRA 3I2KA 3V64A 1JYNA 5I0UA 3RZLA 5ERLA 1KDKA 2BGOA 2FMYA 2QQWA 5DQ0A 4YGBA 1VBB3 1A8DA 1UNBA 1AR81 3I3DA 4CXYA 5FZ9A 1AL0G 3U10A 3C7HA 1UX6A 2TBVA 3T2OA 5FZ0A 4GA9A 3ZDSA 3PL0A 4P9JA 2WR9A 1N1YA 3MV11 4HLTA 1XE0A 4MXVA 5IWFA 4A3XA 4YG6A 2JDNA 4Y1VA 5T5LA 3S5AA 2PLV1 4OQ8A 3WUDA 4AGGA 1D2SA 4NHYA 5DAXA 4BQ5A 1BLZA 3VV1A 3WG1A 3NAPA 1ASJ3 3POFA 3VBUB 1NA1C 2VCMA 1MS1A 1WMDA 3ZYFA 3ZN6B 3FLPA 1NX9A 1F4HA 4Q4Y2 1CAWA 1RUJ2 3M3OA 3SNMA 2XQRA 4ES8A 2ZACA 1XYNA 3H7YA 3M4FA 1SFPA 4XURA 4BE3A 4MGKE 4F7ZA 2ZMLA 4IEWA 1XB9A 2YFUA 5JLVA 4YZ4A 1RUD2 3D6EA 1RJ8A 4RFRB 2BRTA 2VH9A 2E53A 2RR13 4NIAA 2OQ7A 3O1UA 3LOBA 1OLMA 1RUH1 5IAXA 4XQWA 4UAPA 3WF1A 5LA1A 2Y6HA 4AI1A 4CDWB 5IVBA 2R7EB 3UJOA 1NLSA 2VE1A 5HCFA 1JZ5A 1CIWA 3RYRA 4A2UA 3ENRA 2G9ZA 3JQWA 4UF0B 3VDDB 1AYM2 3U11A 1GANA 3LDRA 4LHLA 4YW4A 1NYWA 5ACA2 4QPIB 1ND3B 4GMP0 4FPCA 4KBZA 2D6MA 3FLTA 2LM3A 4R52A 4BQ2A 4MSVA 4RQPA 1WLWA 1CAXA 1STMA 5K8SA 1DQ5A 5JMOA 4CSWA 1SBDA 4G4FA 4BH9A 4AEKA 4AQSA 4D6RA 1IGOA 2G9GA 4QKBA 3RMXA 4E27A 5FYIA 1YFYA 2D40A 2GC1A 2DUQA 2NM1A 1D4M2 5DDJ1 4QX2A 4AFDA 4EN8B 5C9AB 5C71A 2YPJA 1AR83 3AZYA 1X8EA 3HEIA 4LO5B 3M3QA 5FY7A 3ZR6A 4AQTA 2A6WA 1UYXA 4AVTA 4BHPA 4YW2A 3PU8A 4I0BA 2WO7A 2JE9A 1W6QB 4IV3A 4NO4A 3NNJA 2W68A 4D7TA 2I45A 5BNNA 5GZFA 3TYJA 5LK5A 1YFWA 4QPGC 3V0BB 4IE5A 4BIOA 3NO8A 2PHTA 1G7YA 4DY5A 3BIEA 1H8TB 3I8TA 5A6YA 1NCRA 1QOTA 4TN7A 2IVIB 3KT4A 4LQRA 1UYYA 3KWVA 1PHMA 4AGRA 5LEJA 3HBZA 3AKRA 2HWB2 5CEHA 3ZR5A
chains in the Genus database with same CATH topology
3N9OA 5FYHA 2YBSA 3PUAA 5FZIA 4E4HA 4CUGA 5FYYA 2Q8CA 5A80A 5IVYA 4HOOA 3PU3A 3PUQA 5FZ9A 4V2VA 2OT7A 4GJYA 5FJKA 4D6SA 3AVRA 3PDQA 2OX0A 4QXBA 5FXXA 5FZ4A 5FZ0A 5KR7A 5IVJA 5FY4A 5F5AA 2OQ6A 4Y33A 3N9LA 5FY1A 5IWFA 2Q8EA 2P5BA 3KV5A 4V2WA 4QXCA 5FXWA 2PXJA 5LW9A 4Y4RA 2XXZA 5LY1A 2YBPA 2YU2A 5F2SA 4GD4A 5FPBA 5FPUA 5E6HA 4DO0A 4BISA 5LWBA 4URAA 4XDOA 3NJYA 3K2OA 4XDPA 5FZ1A 5FZCA 5FY5A 5A7WB 2XMLA 4AI9A 5FZ3A 4GAZA 3N9NA 4DIQA 4QX7A 5A7SA 2YPDA 2WWUA 5A3WA 3PTRB 5A7WA 4AAPA 2XDVA 2OQ7A 3N9MA 5FZBA 3LD8A 4IGPA 5F32A 5FWEA 5FZEA 5F3EA 5FPLA 3U4SA 5FZ6A 5A3TA 5FXZA 5F5CA 3KV6A 5FZHA 3PUSA 5IVBA 5A7QA 3K3NA 5FUPA 5FYCA 5FZKA 5FP9A 5A1FA 5A7OA 5FZGA 4UF0B 4Y3OA 5F5IA 5FP4A 2XUEA 5FY9A 5FYMA 3ZLIA 3ZPOA 3PURA 3OPWA 4LIVA 3UYJA 4IGQA 3KVBA 3N9QA 4CCJA 4D6QA 5F39A 4EYUA 4UF0A 5FZ7A 5FY8A 5ANQA 5FJHA 4EZ4A 3K3OA 5FP7A 5IW0A 4GJZA 4BXFA 5F3CA 4CCNA 4CSWA 3RVHA 4CCLA 5FZDA 3LDBA 5F2WA 3N9PA 5A1LA 4LITA 3KV9A 4D6RA 5FBJA 5FZFA 5FYUA 4EZHA 5K4LA 2YBKA 5FYIA 5FYZA 4BU2A 5F3GA 4QWNA 5FZLA 5FYVA 5FP3A 5FV3A 4CCMA 5A7NA 5FPAA 2WWJA 2OS2A 5IVFA 4CCOA 5IVCA 4NUBA 5IVEA 5FYSA 5FWJA 5A3PA 3AVSA 5FY7A 4QXHA 4C8DA 3U78A 4QU1A 3PU8A 2Q8DA 4HONA 5F3IA 3AL5A 3KVAA 5FXVA 4CCKA 5A3NA 2W2IA 5FZ8A 2VD7A 4LIUA 1VRBA 4QX8A 5A7PA 5F37A 5LY2A 5FZOB 5FPVA 5ISLA 2GP5A 2YU1A 5FUNA 4TN7A 5FP8A 3OPTA 4LXLA 4ASKA 3DXTA 5IVVA 3DXUA 5FZMA 5FYTA 4IGOA 5FZAA 3KV4A 5FZOA 5FYBA 3AL6A 2GP3A 5CEHA 5FY0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3N9O A;  5FYH A;  2YBS A;  3PUA A;  5FZI A;  4E4H A;  4CUG A;  5FYY A;  2Q8C A;  5A80 A;  5IVY A;  4HOO A;  3PU3 A;  3PUQ A;  5FZ9 A;  4V2V A;  2OT7 A;  4GJY A;  5FJK A;  4D6S A;  3AVR A;  3PDQ A;  2OX0 A;  4QXB A;  5FXX A;  5FZ4 A;  5FZ0 A;  5KR7 A;  5IVJ A;  5FY4 A;  5F5A A;  2OQ6 A;  4Y33 A;  3N9L A;  5FY1 A;  5IWF A;  2Q8E A;  2P5B A;  3KV5 A;  4V2W A;  4QXC A;  5FXW A;  2PXJ A;  5LW9 A;  4Y4R A;  2XXZ A;  5LY1 A;  2YBP A;  2YU2 A;  5F2S A;  4GD4 A;  5FPB A;  5FPU A;  5E6H A;  4DO0 A;  4BIS A;  5LWB A;  4URA A;  4XDO A;  3NJY A;  3K2O A;  4XDP A;  5FZ1 A;  5FZC A;  5FY5 A;  5A7W B;  2XML A;  4AI9 A;  5FZ3 A;  4GAZ A;  3N9N A;  4DIQ A;  4QX7 A;  5A7S A;  2YPD A;  2WWU A;  5A3W A;  3PTR B;  5A7W A;  4AAP A;  2XDV A;  2OQ7 A;  3N9M A;  5FZB A;  3LD8 A;  4IGP A;  5F32 A;  5FWE A;  5FZE A;  5F3E A;  5FPL A;  3U4S A;  5FZ6 A;  5A3T A;  5FXZ A;  5F5C A;  3KV6 A;  5FZH A;  3PUS A;  5IVB A;  5A7Q A;  3K3N A;  5FUP A;  5FYC A;  5FZK A;  5FP9 A;  5A1F A;  5A7O A;  5FZG A;  4UF0 B;  4Y3O A;  5F5I A;  5FP4 A;  2XUE A;  5FY9 A;  5FYM A;  3ZLI A;  3ZPO A;  3PUR A;  3OPW A;  4LIV A;  3UYJ A;  4IGQ A;  3KVB A;  3N9Q A;  4CCJ A;  4D6Q A;  5F39 A;  4EYU A;  4UF0 A;  5FZ7 A;  5FY8 A;  5ANQ A;  5FJH A;  4EZ4 A;  3K3O A;  5FP7 A;  5IW0 A;  4GJZ A;  4BXF A;  5F3C A;  4CCN A;  4CSW A;  3RVH A;  4CCL A;  5FZD A;  3LDB A;  5F2W A;  3N9P A;  5A1L A;  4LIT A;  3KV9 A;  4D6R A;  5FBJ A;  5FZF A;  5FYU A;  4EZH A;  5K4L A;  2YBK A;  5FYI A;  5FYZ A;  4BU2 A;  5F3G A;  4QWN A;  5FZL A;  5FYV A;  5FP3 A;  5FV3 A;  4CCM A;  5A7N A;  5FPA A;  2WWJ A;  2OS2 A;  5IVF A;  4CCO A;  5IVC A;  4NUB A;  5IVE A;  5FYS A;  5FWJ A;  5A3P A;  3AVS A;  5FY7 A;  4QXH A;  4C8D A;  3U78 A;  4QU1 A;  3PU8 A;  2Q8D A;  4HON A;  5F3I A;  3AL5 A;  3KVA A;  5FXV A;  4CCK A;  5A3N A;  2W2I A;  5FZ8 A;  2VD7 A;  4LIU A;  1VRB A;  4QX8 A;  5A7P A;  5F37 A;  5LY2 A;  5FZO B;  5FPV A;  5ISL A;  2GP5 A;  2YU1 A;  5FUN A;  4TN7 A;  5FP8 A;  3OPT A;  4LXL A;  4ASK A;  3DXT A;  5IVV A;  3DXU A;  5FZM A;  5FYT A;  4IGO A;  5FZA A;  3KV4 A;  5FZO A;  5FYB A;  3AL6 A;  2GP3 A;  5CEH A;  5FY0 A; 
#chains in the Genus database with same CATH topology
 3E6D A;  2PHL A;  3LGR A;  2RJK A;  2ERF A;  5J37 A;  1DBN A;  3IMN A;  1W8H A;  4B7E A;  1QWR A;  4JC1 A;  4XXA A;  4Z2A A;  1YCI A;  2UWB A;  4FBF A;  1GKB A;  4XW3 A;  3LDK A;  4GJY A;  2VZT A;  2IXL A;  2PTM A;  4QXK A;  4AEM A;  5FXX A;  2HLE A;  4COZ A;  4BQW A;  1WW4 A;  2RG4 A;  4AF9 A;  4N7I A;  4ITC A;  1GNH A;  2P5B A;  2EA7 A;  4QM8 A;  2RMU 3;  1ENX A;  1PIV 2;  4LBJ A;  1AYN 1;  4XYX A;  2E33 A;  3AZW A;  1G86 A;  1VBE 3;  1W8T A;  1EPZ A;  5ABJ C;  2QE3 A;  4I30 A;  5GZC A;  5CA6 A;  4QDR A;  3L9J T;  5JXG A;  2IVJ A;  1JHN A;  4HBN A;  5FPX A;  4LBQ A;  2XVL A;  4ZKT B;  4XET A;  1JZ2 A;  2VVF A;  4Q29 A;  3H50 A;  4N43 A;  4Q4V 2;  5LWB A;  3HIF A;  3VBF C;  5I0T A;  2DDU A;  3IM0 A;  1AHS A;  1GZT A;  4LO6 B;  2QQV A;  1S55 A;  4FPH A;  2ZGR A;  4L9B A;  5HI0 A;  5JSO A;  3VBO C;  5A7S A;  4GQ7 A;  2XGX A;  4K6B A;  4XIO A;  4HK9 A;  1RGS A;  2Q1F A;  4KNC A;  5FK8 A;  3CZU A;  1A78 A;  3LOI A;  4BQ1 A;  2ARC A;  4CP9 B;  3B00 A;  2BWC A;  4R9B A;  1UKR A;  2A75 A;  3SIS A;  1B35 B;  3Q8B A;  1AJO A;  1CWP A;  2A6X A;  4LO7 A;  2VO5 A;  3OUJ A;  3CO2 A;  1HRI 1;  1VBC 1;  1S0E A;  5IK7 A;  2OXB A;  3WG4 A;  2J1A A;  4SBV A;  1H1M A;  3HD8 B;  1RUI 2;  3KSC A;  2HWC 1;  4OI1 A;  3DL3 A;  1FPN 1;  1G9F A;  3KVB A;  2QBX A;  3LFM A;  1I5Z A;  1PGW 1;  4XPV A;  3PTY A;  4MXW A;  5FJH A;  3OEB A;  1MQT C;  4WM8 C;  4Q0U A;  3BU7 A;  1RTV A;  4NMI A;  4RHV 1;  1NG0 A;  2DVB A;  5D8A A;  1IHM A;  1JOB A;  1UKG A;  4A7Y A;  4CUB A;  1LHO A;  4MAD A;  4XC9 A;  3AX4 A;  3WVJ A;  2PFW A;  3MLL A;  1OSG A;  3CNA A;  2RJL A;  3OY8 B;  2JDZ A;  4M3C F;  1PO2 1;  5FOB B;  1JN2 P;  1PK6 B;  4QWN A;  3SH5 A;  1PM4 A;  4OZO A;  3IMM A;  4Y22 A;  5CFC C;  5CAZ A;  5JVV A;  3FHI B;  3UV9 A;  3WD5 A;  2VGD A;  2VME A;  5IVF A;  1IPJ A;  3RZK A;  1UPI A;  5A3P A;  5C8C C;  1LEM A;  4URT A;  1FT9 A;  2O14 A;  4XJ9 A;  1OUR A;  3JQX A;  1W90 A;  4GMP 1;  2WZR 3;  1CX1 A;  2ZGT A;  4DRR A;  2D3R A;  2X5I C;  1G9A A;  5G05 L;  5EZW A;  1MVQ A;  2VOK A;  2XLF A;  4BM8 A;  4PF5 A;  5EJZ B;  2X05 A;  1CZV A;  2EAK A;  2R07 1;  4LMF A;  4L0P A;  2VTF A;  4Z1V A;  4XJZ A;  4FOV A;  3VZM A;  1WD3 A;  3UKT A;  4AZZ A;  4CDQ C;  4O7X A;  5KHK A;  1AL2 1;  4PIX A;  4DUV A;  2WA3 A;  4ZXK A;  1ZBA 1;  2WIN B;  5A70 A;  5FZO A;  4CDU B;  4QPW A;  3UET A;  5ANN A;  1BEV 1;  5IT6 A;  3DPR C;  2H6C A;  2E7T A;  4FPY A;  5DDJ 2;  4AI8 A;  4J1W A;  4LTA A;  1ZBE 2;  4Q4X 1;  2ZGN A;  4CEY C;  4YFW A;  4XQ4 A;  4CU7 A;  1GQG A;  5JAX A;  4P9L A;  5J98 B;  3ZXD A;  1V6L A;  3LA2 A;  2NPI A;  1OOP B;  1Q3E A;  4GWN A;  5FLH A;  4CEW C;  2ZGS A;  4QPY A;  3VBH B;  2AEY A;  3IIA A;  5KR7 A;  4JGY C;  5IVJ A;  2HWD 1;  4FFF A;  1OXC A;  2CGN A;  3DUI A;  4KWK A;  5BNO C;  2VBB A;  4Y1U A;  3J7H A;  1FOD 2;  4ZPI A;  3O1S A;  3BTY A;  4NJ4 A;  4I0A A;  5HBA A;  1HXS 3;  1OMI A;  3LEI A;  1PVC 2;  4FP2 A;  5JI9 A;  4IE0 A;  1ULF A;  3JBG 3;  3THD A;  3UKN A;  1HRI 3;  3CJI A;  3VKO A;  2DCY A;  2WS9 1;  1XXN A;  5A1A A;  5C70 A;  4WBB A;  1W6O B;  3RGB A;  3SMH A;  3MIC A;  3X29 B;  1FMD 3;  1IS3 A;  5A7W B;  1JZ6 A;  3WIN E;  2VCA A;  3MYX A;  3ZFF C;  4DIQ A;  2D44 A;  4XQD A;  2RM2 3;  4N90 A;  1SAC A;  2OKX A;  3A0K A;  2VAU A;  2YPD A;  4AOC A;  4FOY A;  1NZC A;  5C4W C;  4LBM A;  1SHW B;  4XVH A;  4TTG A;  2J1T A;  3HWJ A;  1JS9 A;  3INA A;  4JVA A;  5FPL A;  4OQ9 A;  5IK4 A;  2ZCW A;  3VBS C;  3KV6 A;  4NPL A;  1AYN 2;  4C0H A;  1UIK A;  3ZKY A;  3PME A;  4M3C A;  2Z2S B;  5AC9 2;  1QJY 2;  1G8W A;  2HWE 2;  5FUP A;  3SCG A;  3WSO A;  5LAS A;  4Q0P A;  2UYA A;  3OJB A;  2ILM A;  3JU9 A;  1HRV 1;  1EY2 A;  1ONA A;  2LUW A;  2VUL A;  2VVE A;  2B46 X;  4COV A;  2WYS A;  3B69 A;  3KF3 A;  4UFK A;  4EYU A;  5FZ7 A;  4YZ1 A;  2ID4 A;  4YVS A;  3SXW A;  3ZFE C;  3K3O A;  4Z07 A;  2WO2 A;  1SLI A;  2R49 A;  1KEX A;  2Y26 A;  5IYY A;  1DDL A;  4PQ9 A;  5IK8 A;  4XAB A;  2R07 3;  3WF0 A;  2ZX2 A;  4CCL A;  2C5D A;  1RUC 1;  3O5S A;  4IEV A;  3NNF A;  1UX7 A;  1Y43 B;  3BAL A;  2R0H A;  4BQX A;  4E2Q A;  3RRD A;  3UT0 A;  2JEM A;  4QAW A;  5F6L B;  4BU2 A;  1S0B A;  5FV3 A;  2GAU A;  5KXC A;  4E4D X;  3ZXL A;  3H7J A;  5CVR A;  3U07 A;  5FK7 A;  2EIG A;  5FWJ A;  2E63 A;  1VP6 A;  1XNC A;  2MEV 1;  4GH4 B;  5HCB A;  4LBQ D;  1VRH 3;  5BNP C;  5GLT A;  1FPN 2;  3SHR A;  2P3K A;  4K8R B;  5GJ6 A;  4YVW A;  1UYP A;  1QDC A;  1YXW A;  2HWD 3;  3RMY A;  3MIG A;  3POS A;  3UL2 A;  4A41 A;  5DMY A;  2P34 A;  2QZ3 A;  4RHV 2;  3NKG A;  1ODM A;  4M01 A;  5GLU A;  1JYX A;  1OD5 A;  3T2Q A;  3RDI A;  4Q4W 1;  3HR9 A;  4UBG A;  1JU4 A;  4Y5S A;  3ZM8 A;  4ATE A;  1UZZ A;  2Z42 A;  4B29 A;  3EQE A;  2B9V A;  4IGO A;  5L9B A;  1TME 1;  2F17 A;  2ZGL A;  3VUO A;  3J8F 1;  1H6Y A;  5FY0 A;  2CNA A;  5I8Y A;  3H8U A;  3NRU A;  1X7N A;  1IPS A;  4GWM A;  2OA2 A;  1QJU 1;  5CFD B;  2FZ2 A;  2VZR A;  3UGH A;  1RC6 A;  4CP2 A;  3AZV A;  5EXO A;  3AFK A;  4PDW A;  5C3S A;  4HT1 T;  4LEJ A;  5HCH A;  1ZRC A;  2B5H A;  4CVU A;  3N7J A;  1I5P A;  2BOJ A;  3KD4 A;  1GZW A;  2R06 1;  5JOW A;  3RG0 A;  1W6N B;  1F4A A;  2ORZ A;  2ZEW A;  1A6C A;  2PAM A;  1QF3 A;  2XJS A;  1N3Q A;  1ULP A;  2OQ6 A;  3IDC B;  3GZT B;  4Y20 B;  4YGE A;  3ES4 A;  2VUD A;  3ZSM A;  4XDQ A;  4DRV A;  5A3L A;  2IXI A;  4BIF A;  1DU3 D;  2X8K A;  1AL2 2;  3OBT A;  5I0S A;  4PHZ A;  4GXL A;  2ZAB A;  1RUG 2;  2ZGQ A;  2VOV A;  4WVZ A;  2GN3 A;  2ZZJ A;  5FCC A;  1BEV 2;  5H9P A;  5L9V A;  1YFU A;  2YRO A;  2XR4 A;  4FVV A;  4OUL A;  3JXS A;  5GLV A;  1JOP A;  3FBM A;  4LHN A;  5A3U A;  3NJY A;  1GOG A;  3VDD A;  2AC1 A;  3IBM A;  4ZS3 A;  2EXI A;  5FY5 A;  4AI9 A;  1GP4 A;  2GNB A;  2WQZ C;  4LO8 A;  1CJP A;  1MZE A;  1BQP A;  1RUE 2;  2D6K A;  3OYW B;  1NQD A;  2LRP A;  3NNL A;  4MGY E;  3GHN A;  1LES A;  4QPI A;  1S0I A;  5FKB A;  1XE8 A;  3VBR C;  3PTR B;  2BQP A;  4CUA A;  2NZ9 A;  3E6C C;  1APN A;  4WVV A;  4P5Y A;  4XHB A;  3I97 A;  3KCC A;  4HFS A;  4MO3 M;  5FZE A;  3BVC A;  3RQ0 A;  2P6C A;  3TNQ A;  5A32 A;  2H0V A;  3TN9 3;  3I2G A;  3R4S A;  2VCB A;  1US2 A;  3B93 A;  3VN4 A;  1NY7 1;  5FY9 A;  2ZEY A;  1VB2 A;  4Y26 A;  2OPK A;  3LPG A;  1D0H A;  1ST8 A;  4XZU G;  5E89 A;  1GMM A;  3T4V A;  1VE0 A;  1YQ8 A;  2WNV A;  4QKF A;  2K46 A;  5EPA A;  5F8P A;  3V0B A;  3RZM A;  4E4Z A;  2WN3 A;  1LKN A;  3AYA A;  4MLO A;  4KWL A;  5GM0 A;  3WQ7 A;  3VKL A;  2YMZ A;  4JHT A;  2EAL A;  1YC6 1;  4YZ2 A;  3ACI A;  1EV1 1;  1SDD B;  3JCI A;  4BQ4 A;  3BOP A;  2Q8O A;  4CCN A;  2CY6 A;  4P9I A;  2P6H A;  4JQR A;  5T5P A;  3JD7 1;  2HEW F;  1LOA A;  4WVW A;  3RI9 A;  2VZ3 A;  2NLR A;  3TEZ A;  3U1X A;  2A6Z A;  3MDP A;  1K12 A;  1H8T A;  3Q8C A;  4M0N A;  5M0T A;  4FPJ A;  5KHH A;  1Z7S 1;  5H9R A;  2V09 A;  4LOT A;  5C5T A;  5DN2 A;  3ILN A;  4EWE A;  4I3P A;  1EYB A;  2ZEX A;  1ULE A;  3N4M A;  1NA1 B;  3HBK A;  1WMF A;  1R08 1;  4PI2 A;  1HQL A;  4IEU A;  4X8N A;  1G9B A;  4ZS2 A;  1NAE A;  4IER A;  4K3U A;  4Y5T A;  2R06 3;  2QCS B;  1FX5 A;  5E16 A;  5CIS A;  1E5I A;  3C7G A;  5IFP A;  1TQ5 A;  5FZ8 A;  2VMC A;  2VD7 A;  3DN7 A;  4XF0 A;  2FDH A;  4M4R A;  3OB8 A;  1WME A;  1RHI 1;  2V72 A;  2YC0 A;  3O14 A;  4ZY9 A;  1RUC 2;  1OLQ A;  3OPT A;  3OGV A;  4F83 A;  4BXS V;  2C9K A;  2UY8 A;  4LOR A;  3CL1 A;  2XOM A;  4ASL A;  5CKQ A;  5IVY A;  4MYE A;  1DGR N;  3IZO A;  4Z92 B;  3ETQ A;  4AFC A;  2YB7 A;  1M4W A;  3NJZ A;  4LE4 A;  1F31 A;  2PA7 A;  5FYY A;  2QJV A;  3D0J A;  2PYT A;  3WW3 A;  1JUI A;  4Z8B A;  3PUQ A;  1W8W A;  4KWJ A;  2R04 1;  5FMO S;  4BK4 A;  3HT2 A;  1C8M 1;  4IE4 A;  2VMF A;  2CL2 A;  3FFZ A;  5FFO C;  4LJH A;  3K77 A;  3BTX A;  4CZS A;  1TMF 3;  2R0F A;  1JOJ A;  3N9L A;  3LKJ A;  1RYY A;  3H1W A;  2OZJ A;  3A23 A;  3WZ1 A;  2E9Q A;  1OI6 A;  2BNN A;  4FOW A;  2J1R A;  4Q4W 2;  2E26 A;  5C8W A;  2VOX A;  4CU9 A;  5LY1 A;  3ZPY A;  3MFC A;  1REE A;  4LLO A;  4XFF A;  4UFL A;  3T3Y A;  4CP9 A;  5JSP A;  3HNB M;  5LA0 A;  4RS5 B;  5DAQ A;  2F6B A;  2DF7 A;  2QZ2 A;  5KXB A;  2Y33 A;  4NHK A;  3RPQ A;  3J8F 2;  4CCD A;  2OUH A;  1J3R A;  2ORX A;  4KG0 A;  4NHX A;  1UL9 A;  3N7L A;  2WAB A;  3EMR A;  2FHR A;  4KH9 A;  1O3R A;  4FPG A;  4Q4Y 1;  1RUJ 1;  4DMI A;  3AP6 A;  1WBL A;  2IUW A;  2LW8 A;  4NIG A;  1BYH A;  5FZ3 A;  2BDR A;  1DZR A;  2KD7 A;  2PAK A;  1U12 A;  3O7O A;  1X9T A;  2VOW A;  3ZVX A;  3B5L B;  1RUD 1;  2I07 B;  4R9D A;  2Z79 A;  3U37 A;  3ZFG A;  4IV1 A;  4AK3 A;  2XVK A;  5F5Q A;  4AAP A;  4F8A A;  1X33 A;  1O3T A;  5KXE A;  3GYD A;  4TYS A;  1MEC 1;  5EIY B;  3WUC A;  4TZD A;  1B09 A;  1ZRD A;  1VBA 3;  4OMC A;  1D4V B;  2WDB A;  4AVV A;  1UO9 A;  2FMD A;  3GM8 A;  5T3N A;  2V4A A;  5A7O A;  3U75 A;  3ZPO A;  2JX9 A;  1CD3 G;  4DFS A;  1PK6 A;  1AYM 1;  3GZE A;  3M1H A;  2E7A A;  4D0Q A;  1QJE A;  5ACA 1;  3IWZ A;  3HVD A;  2DCZ A;  1F15 A;  2XJT A;  5JXH A;  1QNY A;  4EZ4 A;  2FDI A;  1SBE A;  2VU9 A;  3WEZ A;  1GFF 2;  3H3Z A;  4NID A;  3GZU C;  1W3V A;  1EAH 3;  1FI2 A;  1F2N A;  3AZX A;  3T0D A;  1RHI 3;  3DYO A;  4C0B A;  4IQP A;  2Q4S A;  2R1D A;  3EXU A;  2N7G A;  3NAP C;  4GB3 1;  5FBJ A;  5ABJ B;  5FYU A;  4LBK A;  5J3U A;  5I8S A;  4C90 A;  3B94 A;  1E57 A;  2UY9 A;  1Z0H A;  1UMZ A;  5FBZ A;  2DTY A;  3POJ A;  1XE7 A;  2BNO A;  2WWJ A;  4JDN A;  5I8T A;  1UZV A;  2EF6 A;  2GMP A;  2FZ1 A;  4CCO A;  3U4X A;  4NUB A;  4RR3 A;  4W50 A;  5LBF A;  4IND A;  3AKT A;  3PLQ A;  4DXT A;  1NE6 A;  4QXH A;  3VBF B;  3U78 A;  3I54 A;  5FO7 B;  5L7O A;  4EWD A;  1BBT 2;  3SKV A;  3KVA A;  5FXV A;  4AFM A;  1QMJ A;  1IS4 A;  1UQX A;  1ZX5 A;  3VBO B;  3WW1 A;  4FQ4 A;  1N1V A;  1W8F A;  1OOP A;  1EV1 2;  3Q8E A;  3TNP B;  1AR9 1;  5F37 A;  5FPV A;  3VBH A;  4MGT A;  5E1R A;  3AP4 A;  3FX3 A;  4RN5 A;  5IAV A;  4ASK A;  2XLG A;  2D7F A;  3DXT A;  3JD7 2;  2W46 A;  4QX3 A;  1G9D A;  2ZA9 A;  3AKQ A;  2HYK A;  1GNZ A;  1QNW A;  2IXH A;  2P37 A;  2WA4 A;  3Q8A A;  4N9I A;  2ARB A;  4RD7 A;  5SV8 A;  1DQ1 A;  1ZZ9 A;  1RUJ 3;  3I59 A;  4CUG A;  2BWA A;  3WNP A;  1SCS A;  2QQO A;  2W1Q A;  4RQP C;  3KLS A;  1LU1 A;  1A34 A;  1RB8 G;  4PLM A;  1XND A;  1O3S A;  1JBC A;  3MUZ 1;  4NOT A;  1HJF A;  1MQT B;  4J1X A;  5JXI A;  1JZ7 A;  1W28 A;  2XHK A;  1LGN A;  3QBQ A;  2JB8 A;  1RUD 3;  5FY4 A;  1XQN A;  3VKM A;  5F5A A;  1IQD C;  4KQ7 A;  5LBC A;  1AX2 A;  4HL0 A;  4P00 B;  4XAC A;  2Q8E A;  4AED A;  1W2O A;  3IB3 A;  4MGQ A;  3TAY A;  4DQA A;  1PIV 1;  5CNA A;  2ARA A;  4ARX A;  1JZ8 A;  2ETE A;  5FMC A;  4OYU A;  4ATF A;  2ARE A;  3KGL A;  3VHN A;  1DLC A;  1SLB A;  1W6M B;  3CQO A;  4NPR A;  4HET A;  5CFC B;  1W03 A;  3E6B A;  4PT6 A;  4XBQ A;  2GMM A;  3HN3 A;  4K7J A;  1CN1 A;  1QJX 1;  4W6W A;  4UBH A;  4Q4V 1;  4IV3 C;  2XLA A;  4ZHN A;  3GJA A;  5BNN C;  2DU1 A;  1GIC A;  2RDQ A;  5FDB A;  3GJB A;  3RZZ A;  2IWG B;  2FDJ A;  1RVF 2;  3A21 A;  4JGZ B;  4CUC A;  5JPN B;  1NCR C;  1OF4 A;  2R04 2;  4GUL A;  2ADD A;  1C8M 2;  4M00 A;  1N1S A;  2XDV A;  3RZG A;  5F32 A;  5DUX A;  1URX A;  1POV 1;  4Y1Y A;  5DZF A;  1JI6 A;  3KS7 A;  4IUG A;  1QXR A;  5F5C A;  5FRE A;  4AHX A;  4X6Q B;  2DVF A;  2WO3 A;  5FQ0 B;  4AI0 A;  5J96 B;  1OPO A;  1D4M 3;  1X82 A;  2W95 A;  5FYC A;  1ZRI A;  5LBB A;  1R1A 1;  1CVN A;  3DPR B;  2HBT A;  5FYM A;  1K42 A;  1RUI 1;  1DHK B;  4QDQ A;  3VZN A;  1PMI A;  2VNR A;  2W94 A;  1DZQ A;  1S0J A;  5LA9 A;  4ZZ5 A;  4FSJ A;  1ODN A;  2X53 S;  3FUO A;  3JB4 C;  4OHW A;  3FJS A;  1PX4 A;  3R0R A;  2V5Y A;  4BPZ A;  2VQU A;  5JPM B;  3POW A;  4NWW A;  5LRS A;  3CJX A;  1QQP 2;  4JGY B;  4GIQ A;  1GZ9 A;  1JHJ A;  5CKN A;  2QQK A;  1DQ2 A;  1TE1 B;  3ZN4 A;  1MZ6 A;  2J22 A;  4P08 A;  4YGC A;  1K5M A;  4UW6 A;  3KT7 A;  1H2M A;  1VLN A;  1CES A;  1RIR A;  2RDR A;  2QQP A;  1OA4 A;  5K4L A;  4NE9 A;  4N43 C;  1MEC 2;  2HWB 3;  3AMP A;  5FKC A;  1IKP A;  5FP3 A;  2RS5 2;  4Q2F A;  1S1A A;  2XBO 2;  2OS2 A;  4JX0 A;  3H8O A;  3RWK X;  3T4H B;  2Q0A A;  3ILR A;  4BOW A;  1IZ3 A;  1JYI A;  2O0O A;  2Q30 A;  1RMU 2;  3H42 B;  5KHG A;  2Q8D A;  5CFD A;  3ZFF B;  1LEC A;  4CCK A;  2MPF A;  2R1B A;  2UUR A;  1ENS A;  4QX8 A;  4LKE A;  2JDP A;  3KT1 A;  4NHM A;  1GUI A;  4TLF A;  5C4W B;  1PIV 3;  2XJV A;  1C5H A;  1SLT A;  3D82 A;  5LZ6 A;  3OCP A;  4DUW A;  3I2O A;  1QJF A;  2B42 B;  3K4D A;  4E2S A;  1BJQ A;  3PVN A;  4GB3 2;  3ZXE A;  4MH0 E;  4R4Z A;  5FLJ A;  2VR4 A;  4XUP A;  3I3M A;  3HAG A;  1IS6 A;  2RDN A;  5APA A;  2RS3 1;  5FMB A;  2UU8 A;  1TNF A;  3HMY A;  4XIL A;  3VKF C;  3S7E A;  3WNX A;  3UKV A;  1ZBE 1;  5FZI A;  2JG8 B;  3LB9 A;  1HB3 A;  2Q8C A;  4FTB A;  3O12 A;  3PU3 A;  1Q5O A;  5D8A C;  1XNB A;  4BME A;  2OW4 A;  5FJK A;  1NOV A;  1X36 A;  3E1F 1;  3GBF A;  1NE4 A;  1SLA A;  3P3P A;  2JIC A;  2P3J A;  2VZV A;  3VL8 A;  4JAA A;  1FOD 1;  1HQN A;  1PMH X;  1MR5 A;  2C26 A;  1AR9 2;  3IPV B;  4LNV A;  1UXZ A;  4JDO A;  4S2D A;  4V2W A;  3ZSL A;  5C3O A;  5JWP A;  2LRO A;  2EXH A;  1J59 A;  4A44 A;  1PVC 1;  4BCU A;  4XXP A;  1VIW B;  2PLV 3;  4RGG A;  4XJA A;  3WNK A;  2PHW A;  4PCR A;  4TWT A;  1UOG A;  4XEZ A;  1Y9G A;  3MF6 A;  5DAW A;  2Q1M A;  2WLP A;  3M8L A;  1W6P B;  2J1V A;  1E5R A;  2CGP A;  2HBU A;  2Y34 A;  1ZA7 A;  3AYC A;  3HJR A;  1FAT A;  3T09 A;  5C6C A;  2GC3 A;  4S2F A;  4LT5 A;  2D5F A;  2X29 A;  4AHZ A;  3R6S A;  1V9U 1;  2CU5 A;  1OKO A;  2UWC A;  5GLW A;  1HN1 A;  1K5J A;  1VB4 A;  1ZYB A;  1GQH A;  3FZ3 A;  2HEY F;  1I6X A;  4COU A;  1RUH 3;  4PQQ A;  3ST7 A;  5IK5 A;  4MX3 A;  5FXZ A;  3WLU A;  3B9C A;  1N1T A;  1P8J A;  5AC9 1;  1QJY 1;  2W87 A;  1W9W A;  2HWE 1;  3QH6 A;  3BI3 A;  3ZYR A;  1QOS A;  1S0G A;  3MW4 A;  4O9E A;  4XHX A;  1AX1 A;  4Y3O A;  2AAC A;  3EBR A;  2DV9 A;  1CON A;  1LED A;  1YHF A;  1QJX 2;  5B2G B;  3I4I A;  1DFQ A;  1UF2 C;  1DG6 A;  1W0P A;  5FTT C;  2AYH A;  2DUO A;  1WZX A;  1OPM A;  3ZYI B;  3O1O A;  3DYM A;  3HOB A;  5E88 A;  2V5D A;  2JG9 A;  4FAG A;  2JDK A;  1TVG A;  5F3C A;  5CB7 A;  1PGS A;  2BYV E;  2FCU A;  4HPK A;  3ZXK A;  5L36 A;  3NV3 A;  2PN5 A;  1YIP A;  2P3I A;  2WWS A;  3CJI C;  4KU7 A;  3RJR A;  4HVQ A;  2JD9 A;  3ILF A;  4LK7 A;  3WOG A;  4R4X A;  4IE6 A;  4PIY A;  5LRR A;  1GLH A;  5C3Q A;  5C3R A;  1COV 1;  2QVS B;  3OOX A;  4PLO A;  2F4L A;  4XMA A;  3WQ0 A;  5I91 A;  2PHD A;  4CU8 A;  5DDJ 3;  3PIJ A;  1UOB A;  4NRO A;  1W8N A;  3AFG A;  1R1A 2;  3MLK A;  4L92 A;  4Q1P A;  4OI2 A;  1KJR A;  1YO8 A;  3AVS A;  1RUF 1;  4N53 A;  5B4N A;  2QQN A;  2OVU A;  4UWD A;  2BER A;  2D5H A;  4WM7 A;  3H8R A;  5DXD A;  3IDE A;  3VZJ A;  2GME A;  4UFJ A;  4Q27 A;  4ZU5 A;  3N35 A;  3VBR B;  3M3E A;  3J7N A;  3QLQ A;  1RIN A;  2Y8K A;  4Q0S A;  2GP5 A;  4FI9 A;  1J1T A;  4AI2 A;  3TBD A;  3LA7 A;  1GZC A;  2V4V A;  2QTW B;  1PVC 3;  2D6P A;  2E7Q A;  4D7Y A;  1BZW A;  1H1A A;  2GH8 A;  2XJU A;  3K4A A;  1OH4 A;  4AVS A;  1WW7 A;  2EIC A;  4LA3 A;  4ET7 A;  1V6J A;  4QQH A;  4K21 A;  2W5F A;  5CU1 A;  3PUA A;  4YVS C;  3BN6 A;  1ACC A;  3PJY A;  3MZH A;  1WCQ A;  3ATG A;  4OUS A;  4RS5 A;  2YDE A;  3ZOI A;  3ACH A;  1DQ4 A;  1L7Q A;  3EJK A;  3C7E A;  4L97 A;  1O8P A;  1J84 A;  3PDQ A;  4YPJ A;  3DCQ A;  5HXM A;  3LSE A;  1WWY A;  1UPS A;  2ZS6 B;  5LK7 B;  4EN0 A;  5FY1 A;  2Y6F A;  1WGP A;  3H0O A;  4LBN A;  3MFA A;  2QQU A;  4WVM B;  4CDX B;  3WXP A;  1ND2 B;  2RMU 2;  4KU8 A;  3P6B A;  1AYN 3;  3AP7 A;  1H30 A;  2KM2 A;  5AC9 3;  1QJY 3;  1AR6 1;  4U2A A;  2FQP A;  4XJW A;  2AH2 A;  1W9S A;  2LS6 A;  2NQY A;  2YBP A;  3DGT A;  3H1M A;  4RA0 A;  1RUG 1;  1H2N A;  2VBD A;  5F2S A;  4EN7 B;  5JIU A;  4EQV A;  3ZSE A;  2RS3 2;  3CZJ A;  4L8Q A;  3A7Q A;  1S4C A;  1X8M A;  3NNM A;  4YVW C;  1ZZB A;  3M3I A;  4OUM A;  1HV0 A;  2NP0 A;  1H1I A;  1CAV B;  3K75 B;  1T6G C;  3PMS A;  4XDP A;  3A0N A;  5FPZ A;  2XML A;  4QDS A;  2WO1 A;  2W47 A;  4XFC A;  1RUE 1;  2J1S A;  3THT A;  4WZF A;  1PGL 2;  1GQP A;  1W99 A;  1JYW A;  1MS8 A;  2JXA A;  3J7L A;  1UOF A;  4EE2 A;  2YGM A;  3QOP A;  4IGP A;  5FWE A;  4FXK B;  1EUU A;  3R4U A;  2ZGK A;  4HMZ A;  1RED A;  1XOY A;  5FMD A;  4UW5 A;  5A7Q A;  4H2A A;  4PDW C;  3VD4 A;  1PMJ X;  3LA3 A;  1VBC 3;  5F5I A;  5FP4 A;  4NN0 A;  2XUE A;  3C8X A;  4XF3 A;  1BCX A;  4B1L A;  4AFB A;  1SFN A;  4QKN A;  2P4E A;  1D0G A;  3RYP A;  2HWC 3;  2VNG A;  4HK8 A;  4IGQ A;  3VDB A;  1FPN 3;  1DGR A;  4C1W A;  5KXD A;  3B7M A;  5DUU A;  5DZG A;  2CTV A;  4N9H A;  3V0A B;  2R16 A;  2WNU A;  1XYP A;  1V9U 2;  4RHV 3;  2KA3 A;  3J4U H;  4GWI A;  2C9A A;  2DFB A;  1XC6 A;  2UYB A;  5DG2 A;  1YEW A;  4CE8 A;  1PZ8 A;  2D6N A;  2RDS A;  3KQR A;  1CQ9 A;  5IUQ A;  2DTW A;  1JU3 A;  1PO2 3;  1LUL A;  1YQ5 A;  5FZL A;  1VMF A;  4UYB A;  3NKT A;  3O1M A;  4NR1 A;  3O0V A;  3VDD C;  3S6P A;  2WN2 A;  4E8C A;  2VBP A;  1KS5 A;  5A33 B;  4OHY A;  4LE3 A;  5IVC A;  3KHC A;  2VUA A;  2WJS A;  4A7Z A;  3D8C A;  1D7P M;  2MHF A;  4YRD A;  4QPI C;  5K0U A;  1NCQ B;  1QGL A;  3A4U A;  1W2U A;  4JV4 A;  4GMP 3;  5F3I A;  4RYD A;  4AXO A;  1WLT A;  1PX3 A;  2FCV A;  1O59 A;  4H7M A;  4JTO A;  1FV3 A;  4ZU7 A;  1VRB A;  2VL4 A;  1UMI A;  2HWF 1;  4QGN A;  1ZZC A;  5FO8 B;  1N3P A;  1LHV A;  1MS9 A;  5BYN A;  4FQZ A;  4LUK A;  1W8O A;  3HPN A;  4LXL A;  2A71 A;  3BKZ A;  1ZZ7 A;  1AL2 3;  1Y3T A;  2C1F A;  2OII A;  4XOG A;  1LHW A;  1ZBA 3;  2WNV C;  2ZOE B;  1W04 A;  2W52 A;  1COV 2;  3P1I A;  3TEW A;  4QMA A;  2XL9 A;  1BEV 3;  3ACF A;  2YBS A;  4FFG A;  1YLL A;  1LU2 A;  2G9F A;  3J7M A;  5HCA A;  4Q4X 3;  1ULC A;  1WMX A;  2RS1 2;  2DYC A;  4KG8 A;  2WT1 A;  5A80 A;  2EXK A;  1WD4 A;  3VL9 A;  3RI8 A;  5JZG B;  1RUF 2;  4QKD A;  3CHX A;  5E8A A;  4YG3 A;  1RUE 3;  1ENQ A;  1L7R A;  1IS5 A;  4FAH A;  1VBD 2;  3LZZ A;  3VDA A;  2VMD A;  1VAK A;  1HQW A;  1W0O A;  1QEX A;  2X09 A;  1FNZ A;  1H8T C;  3KMH A;  1YWK A;  3MW2 A;  4JGZ A;  5FAX A;  3VD7 A;  4E9K A;  2GC2 A;  2E32 A;  2ADE A;  2RE9 A;  5CIR A;  2PXJ A;  3ES1 A;  3NAP B;  3WP6 A;  5LW9 A;  4OHX A;  1T6B X;  1HXS 2;  2VQ0 A;  3O1P A;  1Q8P A;  4I02 A;  4DS0 A;  3H9A A;  3OF1 A;  4HZF A;  3O0X A;  4IE7 A;  1WLC A;  3JBG 2;  4PIZ A;  4BJ0 A;  3ITQ A;  1MS4 A;  3T1L A;  3LEK A;  5A3M A;  2BZD A;  2WS9 3;  3QAC A;  4I0W B;  1O4T A;  4EN9 B;  1LOF A;  5DZE A;  2VEC A;  1H0B A;  4K8F A;  4YW3 A;  4URA A;  2H6B A;  1FMD 2;  4IW3 A;  4UW3 A;  1LOB A;  3G6J B;  1U5X A;  1NLQ A;  2P1B A;  1J1L A;  2VOT A;  1LOG A;  3B01 A;  3SCF A;  3VBU A;  1CX4 A;  3AJY A;  3ZIX A;  3ZN6 A;  4CXX A;  3C2U A;  2XKO A;  2ARX A;  2SBA A;  2RM2 2;  3LCP A;  4ARY A;  5GKA C;  2BPA 2;  4AI3 A;  3OD0 A;  5DAV A;  4YM2 A;  3HT1 A;  3ZDV A;  1YI9 A;  1IPK A;  4UFH A;  2HKX A;  5J48 A;  1W2A X;  1PO1 2;  5D1I A;  1O6U A;  1AR6 2;  2NMO A;  3MGU A;  3Q9O A;  3RS6 A;  2BVV A;  5I93 A;  4NIH A;  4CDW A;  4LIV A;  3OTF A;  4UFM A;  1HRV 3;  3OBA A;  1IG0 A;  4RQP B;  1V6M A;  1OFN A;  5GAL A;  3UGF A;  4B4R A;  4UF0 A;  1ZRE A;  5JOZ A;  4HXC A;  5CKM A;  2B4K A;  3RWN A;  1XNK A;  3IAQ A;  3H8X A;  1UCX A;  2GNT A;  1ND3 A;  3SH4 A;  3CMG A;  1HN0 A;  2QDR A;  1ZRR A;  1RUC 3;  3NST A;  4MHR A;  2JKB A;  2P3Y A;  3T1M A;  3E5U A;  5J7M A;  2Z69 A;  4L99 A;  1JZ4 A;  4COY A;  3GAL A;  3WG3 A;  2RVA A;  3M2M A;  1Z78 A;  1BKZ A;  4W6Y A;  1W06 A;  5F3G A;  4C1X A;  2WFP A;  1UZW A;  4DZG A;  5BNQ A;  1FNY A;  1OLM E;  1HDK A;  4BWO A;  1SPP B;  2DBI A;  1VMJ A;  4FFH A;  2FDG A;  2K2S A;  4FPL A;  3TEX A;  2GN7 A;  5BNN B;  1S2K A;  4C8D A;  2MEV 3;  5C7G A;  3OD4 A;  3M70 A;  1XJA A;  1VRH 2;  2WAO A;  4IV1 C;  1BBT 1;  4ZU4 A;  2K9Z A;  3ZFG C;  5C9A A;  2JG8 A;  4J6G A;  4KMQ A;  1W9F A;  2BVB A;  2ZEZ A;  4O9G A;  3ME2 A;  3WHT A;  1GSL A;  3BUC A;  1MZ5 A;  4BYY A;  1W6Q A;  1W9Y A;  3WNN A;  3AP5 A;  4MUV A;  4Q4W 3;  1OT5 A;  4XF9 A;  1LEN A;  1OH3 A;  1XNT A;  1PK6 C;  4PI0 A;  5D21 A;  1SZB A;  5JI7 A;  1Q8V A;  4MHU A;  1TME 3;  3WDV A;  3AYE A;  2ZX1 A;  3TWI A;  5EFU A;  3O0W A;  3J8F 3;  1OQ1 A;  3ALQ A;  4TLG A;  3MHZ A;  3N3H A;  2XWB B;  3WP4 A;  1QJU 3;  1QJZ A;  2XB6 C;  2Y6G A;  4P9G A;  4HOO A;  5KHJ A;  4O65 A;  1W6P A;  3VZK A;  4RL7 A;  4ASM B;  2WFF 2;  5H9S A;  4K1Y A;  3W59 A;  2VC9 A;  4LHK A;  3RZH A;  2BGC A;  2IZW A;  2Y6K A;  1LTE A;  1W05 A;  2ET1 A;  3V65 A;  2BUK A;  1GR3 A;  3AXD A;  2HWF 2;  3USU B;  1AF9 A;  2C0Z A;  4BLI A;  2EAA A;  4LBQ B;  3FUQ A;  4DXS A;  1CPN A;  4U36 A;  2AEN A;  2IXK A;  5C5U A;  3OUI A;  4RR3 C;  1XSR A;  2VNO A;  5GZG A;  4FO9 A;  3ZYG A;  5L7O C;  3LWC A;  3AB0 A;  2QKD A;  1JOD A;  2HYX A;  1W8Z A;  2YG0 A;  4MGZ E;  4YZ3 A;  5EQU A;  3WW4 A;  4Z82 A;  3ZO0 B;  2ZGO A;  1LAJ A;  1OOP C;  1XPW A;  5FZC A;  1RVF 1;  1OUX A;  4W8J A;  2BBA A;  4G3Y C;  1NUK A;  3VBH C;  1XSQ A;  2G4I A;  1HB1 A;  2DUR A;  2WZP P;  3WDU A;  5K7P A;  2PHF A;  3I3B A;  2DBN A;  3ZMO A;  4IEX A;  1PM7 A;  2A6Y A;  1YJL A;  2VTX J;  5SV5 A;  5JR2 A;  2YC4 A;  3FC0 A;  2PQS A;  1CGP A;  4LHS A;  3U4S A;  2B9U A;  1DCS A;  2ZHN A;  3LE0 A;  1POV 0;  3BB6 A;  2ZXQ A;  4XMI A;  2BTV C;  3T30 A;  1AXZ A;  4FPE A;  4HKW A;  3TN9 2;  1REF A;  2VUC A;  3K3N A;  4IEZ A;  2XWJ B;  3VHP A;  4D69 A;  4YW7 A;  3FHA A;  4P9Y A;  1UY0 A;  2A3W A;  4FXG B;  2ZZQ A;  4FCA A;  4MXW B;  3RFR A;  1I9R A;  1B35 A;  5BUV A;  2RJ2 A;  1ULD A;  5FUI A;  3O1V A;  1AR7 2;  2W39 A;  5D8A B;  3V56 A;  1BBT 3;  4HKO A;  4AG4 A;  2CHH A;  2XUM A;  4AED C;  3GGL A;  3GDB A;  4BQ3 A;  3UGG A;  5T5J A;  2WZ8 A;  4YFZ A;  3WV6 A;  1QQP 1;  2C6S A;  2VPV A;  4YNI A;  3WQB A;  2XJR A;  2FDK A;  1EV1 3;  1Q8Q A;  1O4Z A;  2JDM A;  2A3X A;  4QPG B;  5G04 L;  1UY2 A;  4Y22 B;  4O61 A;  5FZD A;  1U5Y A;  1J3P A;  3JD7 3;  2TUN A;  3UES A;  1RXG A;  4XAE A;  4Q8K A;  2RS5 1;  1Z7S 3;  4LKD A;  2JE7 A;  4ISQ A;  5A6Z A;  2XBO 1;  5FPA A;  3ROU A;  5DUW A;  1R09 2;  2VG9 A;  3OY8 A;  5IVE A;  2QQL A;  1OA3 A;  1R08 3;  3WCR A;  2GC0 A;  1IOA A;  1UAI A;  1RMU 1;  3H1Y A;  4FOQ A;  5D2A A;  3GF6 A;  4FPF A;  3GBW A;  2BFU L;  1QKQ A;  2A1X A;  2JKX A;  2W2I A;  1VMH A;  4YAR A;  1F9K A;  5GZD A;  4LIU A;  4QGM A;  5L19 A;  2EIB A;  5FZO B;  1IKQ A;  4MZU A;  3S0M A;  3SQO A;  4FTE A;  5FMO L;  3FE5 A;  4CRQ A;  5IVV A;  3DXU A;  3LSD A;  3KGZ A;  3DF0 A;  1H2K A;  3KV4 A;  4XFB A;  4CDX A;  1ND2 A;  5T5O A;  3TEY A;  3EHK A;  1KQR A;  1CR7 A;  4WV8 A;  3I3Q A;  5CG9 A;  3GXU A;  5I0D A;  4NRP A;  3BTZ A;  5T54 A;  3GNE A;  1YQC A;  5JSR A;  4OVE A;  3B3Q E;  3OSD A;  4NHL A;  2VNV A;  4CDU A;  4NPM A;  4R9A A;  3R4D B;  1C8N A;  2BBV A;  1SDW A;  4K20 A;  4QB1 A;  1UU6 A;  2R04 3;  3CKH A;  1QXP A;  4K9S A;  2O8O A;  1FYU A;  2DVA A;  3NV4 A;  1C8M 3;  1K5M C;  1O7F A;  4B4Q A;  1U5I A;  2JIJ A;  3VHO A;  2DFC A;  1C3H A;  4KGQ A;  3O1R A;  4YM1 A;  1NQJ A;  4LA2 A;  3EB7 A;  3E5X A;  3K48 A;  5EYX A;  1HX6 A;  2ZHK A;  3I2J A;  3MBW A;  4Y1X A;  4BB3 A;  4Y4R A;  4EJR A;  1C5I A;  4Q26 A;  5FPB A;  2C24 A;  3ZXG A;  1ASJ 1;  5CFD C;  5FPU A;  2UWA A;  3SLI A;  1CJD A;  1WA6 X;  1GBG A;  3GBG A;  2W1W A;  1UZY A;  2WYF A;  1ENR A;  4GKX A;  4HVR A;  4Q4Y 3;  4XDO A;  4LPL A;  5FZ1 A;  5LAT A;  2YHJ A;  1WA4 A;  3APB A;  3MPP G;  3WDY A;  1HB4 A;  1W6O A;  1E5H A;  1QQP 3;  1WCK A;  2JJ6 A;  4WM8 B;  4A42 A;  2WSV A;  2JDH A;  5F9T A;  2P2K A;  2WWU A;  3PUH A;  4M3C B;  5A7W A;  1C57 A;  1GWK A;  3POE A;  2RR1 1;  3N9M A;  3NQH A;  3LD8 A;  3ZSJ A;  3WF4 A;  1GOF A;  1Q8S A;  3W5N A;  3V0A A;  1FAY A;  2ZX4 A;  5JZG C;  1MEC 3;  3ORJ A;  3DKW A;  3NMB A;  1VBA 2;  1X50 A;  3P5B A;  1S0F A;  1R1Z A;  5TSW A;  3I7D A;  2XBO 3;  5FZK A;  4DEV A;  3MIF A;  4YVS B;  1H8V A;  3PUR A;  1AYM 3;  4LKF A;  3UYJ A;  5ACA 3;  2D93 A;  4I01 A;  1ZZ6 A;  1T2X A;  2AR6 A;  3N9Q A;  1PVX A;  5C8C B;  2G1M A;  3WX5 A;  2VZP A;  3SH3 A;  5IW0 A;  2WSU A;  2X5I B;  2ATF A;  1AVB A;  1NCQ A;  4LBL A;  5JUV A;  5EP9 A;  1GYK A;  4DEQ A;  3NVC A;  2WBK A;  2R6Q A;  5F2W A;  3KV9 A;  1MZF A;  2GAL A;  4GB3 3;  4AVA A;  1R64 A;  2OYZ A;  4CDQ B;  1ULO A;  4EZH A;  4JKK A;  2YBK A;  4OHZ A;  3BYW A;  1OLR A;  3POB A;  4CCM A;  3MEP A;  3T0A A;  2VTX A;  3POI A;  2IFW A;  1ALY A;  4YVW B;  2HH9 A;  1VAL A;  4CEY B;  3III A;  4M3C E;  4UFI A;  3GZA A;  2CDP A;  3FFQ A;  2HEV F;  2XL7 A;  2GH2 A;  4S2G A;  3ZYJ B;  5KHI A;  4H55 A;  3BU0 A;  3JUU A;  1SEF A;  2YGL A;  3AL5 A;  3LQC A;  4CEW B;  4DPN A;  5JZG A;  4OI4 A;  4QX0 A;  4GH4 A;  4Q0Q A;  2NN8 A;  4B3N A;  1AR9 3;  2A3Y A;  3ABZ A;  1VJ2 A;  4YW5 A;  5BNO B;  3DEC A;  4OCT A;  2XPJ A;  5JOY A;  5FUN A;  1CZS A;  1UWW A;  3AM2 A;  3R05 A;  2JEN A;  2OZ6 A;  1JMU B;  4BZ4 A;  5FZA A;  3PHM A;  4PDW B;  3AMH A;  2L9L A;  3HQR A;  1HV1 A;  2VZQ A;  4JDM A;  5CG8 A;  2VMH A;  1GZW B;  2W08 A;  3VLB B;  2OPW A;  3POG A;  4E4H A;  4PBP A;  1YQ6 A;  3GHM A;  4AAX A;  2JG9 C;  2ZHM A;  1OF3 A;  4S2H A;  4QHO A;  2C4X A;  1ZM1 A;  2PHX A;  4YG0 A;  1OQD A;  2SLI A;  1XBF A;  5FIX A;  3KHB A;  2WAA A;  2ZMK A;  3OGJ A;  1AXK A;  3BPS A;  4ES9 A;  4NII A;  2R30 A;  1SFY A;  1UZ0 A;  2VUJ A;  3CIH A;  4Z2W A;  4LUL A;  4QXC A;  2RMU 1;  1KD7 A;  4KWU A;  1LOD A;  1W6N A;  3D3A A;  3ZN5 A;  1GP6 A;  1DQ6 A;  1VBE 1;  3VBS B;  4B4P A;  3H3U A;  4XJ8 A;  2DU0 A;  1CPM A;  1GWM A;  2EIE A;  2YU2 A;  4N53 C;  4Y20 A;  1YRZ A;  4UT5 A;  1QJX 3;  4WM7 C;  1VPH A;  4Q4V 3;  3WCS A;  1W9T A;  4IET A;  3AP9 A;  3AZZ A;  4UI9 L;  1OQE A;  3MIE A;  1N3O A;  1GOH A;  1VBB 2;  3CU7 A;  4NVP A;  2VY0 A;  1J58 A;  4YZ5 A;  2XHN A;  3IAP A;  4M0H A;  2H0B A;  3THP A;  1DGL A;  3ZFE B;  1PGL 1;  3LAG A;  3M3C A;  5A32 B;  4RFT 0;  3F95 A;  4QD2 A;  3W58 A;  5A3W A;  3WNO A;  4OI0 A;  3MF9 A;  2VMG A;  2DWR A;  3OYW A;  4OMD A;  1POV 3;  2W1U A;  3W5M A;  4G9S B;  5A3O A;  1M06 G;  5J36 A;  1JUH A;  3WG2 A;  2WNV B;  4RS5 C;  1PZ9 A;  2ZMN A;  1R1A 3;  1LJ7 A;  1HLC A;  4QQP A;  3ZLI A;  1KIT A;  1UYZ A;  2D43 A;  1RUI 3;  1ASJ 2;  2DVD A;  4KL1 A;  4E8D A;  3RZJ A;  4IEY A;  1RUN A;  5FR3 A;  3MW3 A;  3M7A A;  5T52 A;  5F39 A;  1Y7B A;  1SPP A;  5BNP B;  3S57 A;  2FBE A;  4UXA A;  2YXS A;  1V0A A;  2GZW A;  3OEA A;  1BMV 1;  4BXF A;  1DGW A;  4XFH A;  4K40 A;  5LCW L;  3EYP A;  1MS5 A;  1QHD A;  1QH7 A;  4Q8L A;  2RR1 2;  5AVA A;  5A1L A;  1QOO A;  3OPZ A;  4CP1 A;  2WNO A;  3BCW A;  4HVO A;  3KCX A;  4JKM A;  3KCY A;  3O1T A;  5T55 A;  4YGD A;  3I2I A;  2TEP A;  4HG6 B;  4XFG A;  4L11 A;  4I2O A;  1WBF A;  3PVE A;  4ONU A;  2GDF A;  3USS A;  1UU4 A;  4P02 B;  3WF2 A;  1HKD A;  4QU1 A;  4XFA A;  3ON7 A;  1A8M A;  3SIT A;  4EN6 B;  1NA1 A;  1V6I A;  2WZR 1;  3ZYB A;  2AZ5 A;  1LGB A;  1OHF A;  2AEZ A;  3CDZ B;  2OUJ A;  3T08 A;  2ZGU A;  1BVP 1;  3NV1 A;  4LOS A;  3LEM A;  1AJK A;  2D6L X;  2YU1 A;  4CP0 A;  4AE2 A;  4CTE A;  2FD8 A;  1EPW A;  4K1Z A;  5FYT A;  5LB6 A;  2DVG A;  2ZGM A;  3OBR A;  1C1F A;  1Q43 A;  3USU A;  1CIY A;  3ZYP A;  2QQM A;  2RS3 3;  2GP3 A;  3CF6 E;  4GKY A;  2FCT A;  3MID A;  3UK9 A;  3HNM A;  5FYH A;  4A7K A;  4F3J A;  1S2E A;  1JZ3 A;  4MGS A;  2Y0O A;  3DEM A;  1ZBE 3;  5DPN A;  2RS1 1;  3EO6 A;  4H14 A;  3T0B A;  3VKN A;  1X9P A;  1V6N A;  4HKL A;  3VD3 A;  5IFT A;  3AMN A;  2WNU C;  3J9S A;  4NAO A;  1AR8 2;  1OBN A;  3NNG A;  3WW2 A;  1O3Q A;  4P5H A;  5A6Q A;  1ZRF A;  3C7F A;  5CYY A;  1VBD 1;  2EXJ A;  1SBF A;  4ZON A;  4PF1 A;  2QFE A;  4CCE A;  5HV4 A;  3TB0 A;  2R32 A;  4AFA A;  5K9Y A;  2JDA A;  3BOD A;  1UMH A;  3OGG A;  1F5J A;  1FOD 3;  1YIF A;  1QXJ A;  2WC2 A;  4IXL A;  4QB2 A;  2YC2 A;  1HXS 1;  1NLR A;  4E4S A;  2PLV 2;  2VQT A;  3BGA A;  3JBG 1;  3PNA A;  1UXX X;  2BW8 A;  2YZ4 A;  4RSU A;  3RYK A;  5BV6 A;  5JCT A;  5K0U C;  1G6N A;  3IT8 A;  2ZGP A;  4QU2 A;  4XJU A;  2O8Q A;  5LBE A;  4BIS A;  2JDY A;  3RJ2 X;  2E31 A;  1FMD 1;  1LHN A;  1VAV A;  1VR3 A;  4TXW A;  3J26 N;  3ZFG B;  4IV1 B;  4OLL A;  5F7U A;  3N9N A;  3MO4 A;  3THC A;  1V9U 3;  2ENR A;  2RM2 1;  2VZO A;  4JQT A;  5DAB A;  1CAU B;  3HNY M;  5FRA A;  5CZK A;  4NAM A;  4KI5 M;  4ISR A;  1RUH 2;  5JMC A;  5F3E A;  2QDN A;  2I74 A;  5FZ6 A;  1DYK A;  1N47 A;  2Y6J A;  2X10 A;  4QPG A;  4H3W A;  4A6O A;  4CPB A;  2CV6 A;  1I1E A;  1PO1 1;  1VBE 2;  1F35 A;  2HWE 3;  3QH7 A;  4QHB A;  1KXG A;  3ZX7 A;  1FV2 A;  5FP9 A;  1A3K A;  2W91 A;  3FL7 A;  3WDT A;  4DXR A;  3WP5 A;  5KC6 A;  4LK6 A;  3TOJ A;  1AZD A;  1GU3 A;  1TG7 A;  4PLN A;  4JGZ C;  5ANQ A;  5DUV A;  2ZPX A;  3D4K A;  1O4Y A;  3GCX A;  2LTN A;  1OFS A;  1XRU A;  3ZMN A;  2D6O X;  1OD3 A;  2VZU A;  1LOF C;  2WT0 A;  3TRS B;  1US3 A;  4RR3 B;  2A6V A;  1COV 3;  3FBY A;  2CYF A;  3OUH A;  4IDZ A;  4JHZ A;  5IAT A;  2WT2 A;  2Y0I A;  1UY3 A;  1OUS A;  5FO9 B;  2VJX A;  2QQJ A;  3F2Z A;  2W92 A;  4GZ9 A;  5AVP A;  5L7O B;  1XU1 A;  2WRA A;  1Y9Q A;  2J42 A;  2RS1 3;  3VBU C;  3POY A;  5ABJ A;  4I09 A;  3OBZ A;  1W3X A;  4XF4 A;  3NW4 A;  5B4X A;  1RUF 3;  1VRH 1;  2W1S A;  5T50 A;  4XAA A;  1VBD 3;  2XQX A;  2NMN A;  3FLR A;  3QCW A;  4IEP A;  5L9R A;  2XG3 A;  1YJK A;  2WUH A;  3VDC A;  5A3N A;  3MI8 A;  3E97 A;  3WNL A;  4P14 A;  4QB6 A;  2O1Q A;  3VBF A;  4AVB A;  2ZAH A;  4MG2 A;  2DCT A;  1BMV 2;  4ZXE A;  1KJL A;  3KQ4 B;  5ISL A;  3RNS A;  4N8M A;  3UJQ A;  2DUP A;  3ETP A;  4QT6 A;  3VBO A;  1GWL A;  1UW8 A;  2NYY A;  5IHR A;  3VHR A;  3I59 B;  4I3G A;  1OKQ A;  5JR7 B;  4CDW C;  1VAM A;  3PIG A;  2XVG A;  3NL1 A;  2J7M A;  1BK0 A;  2ZAA A;  4OHV A;  5FYB A;  3IN9 A;  3N9O A;  4GAL A;  3B02 A;  3PJQ A;  4XTM A;  4JKL A;  4DB5 A;  4COW A;  4KBB A;  1F5F A;  1KDM A;  1KRI A;  4AED B;  1ND3 C;  3RSJ A;  3KM5 A;  2WFF 1;  2A5Z A;  1S0D A;  4FT8 A;  4QXB A;  1D2Q A;  3ZXJ A;  2WZR 2;  5FZ4 A;  4ZZ8 A;  5C3P A;  3IKW A;  2YV8 A;  5JDB A;  4AL9 A;  1WCD J;  2PEL A;  2JWP A;  1MPX A;  4UOJ A;  1MQT A;  4WM8 A;  5EHD A;  1XNA A;  2QQI A;  1PO1 3;  1AR6 3;  1W8U A;  4QX1 A;  2QNK A;  1RUG 3;  2W3J A;  3LF7 A;  2LAL A;  4GD4 A;  4XUN A;  1UIJ A;  1K3I A;  4D94 A;  5C9A C;  4XUT A;  2JG8 C;  1W6M A;  4DO0 A;  3JZV A;  5KBF A;  5CFC A;  1IQA A;  1WW6 A;  5F6K A;  4A6S A;  4AQ2 A;  2Q1Z B;  3K2O A;  4QM9 A;  3OG2 A;  2KXL A;  2WII B;  1KS4 A;  1WCS A;  4GAZ A;  3MLJ A;  2GU9 A;  4QX7 A;  3BTA A;  5JIA A;  4D3W A;  5C8C A;  2RHP A;  3ZKU A;  5JOX A;  4Y5Z 0;  5FZB A;  4HAN A;  2TNF A;  2X5I A;  4XCA A;  1LGC A;  1TNR A;  1KFU L;  4A4A A;  1J83 A;  4HN0 A;  2K0G A;  5FZH A;  4E2G A;  1DQ0 A;  3NWK A;  3C7O A;  4XE9 A;  1RJ7 A;  3TN9 1;  3VZO A;  5CBL A;  3L2H A;  1CAW B;  2PMW B;  5A1F A;  1C28 A;  5FZG A;  1FXZ A;  5L73 A;  1HRI 2;  1VBC 2;  4CDQ A;  5F1R A;  4Q1R A;  3U14 A;  3WP3 A;  1OA2 A;  1POQ A;  5FQ0 A;  2HWC 2;  1AR7 1;  1IG3 A;  1ZZ8 A;  1GV9 A;  1C1L A;  5IJR A;  1JXN A;  4JCK A;  3FWE A;  3DPR A;  4OFG A;  1PGW 2;  5FY8 A;  1BHG A;  4AGV A;  1HIX A;  4CEY A;  2BU9 A;  1K5M B;  1LRH A;  5FOJ B;  2MNG A;  2VM9 A;  3PVB B;  3WF3 A;  3K4Z A;  1J3Q A;  2XKP A;  4CEW A;  4CCC A;  3LDB A;  3N9P A;  4CU6 A;  2V73 A;  3ELN A;  2BNM A;  1UY1 A;  4JGY A;  5FZF A;  1W0N A;  3IDB B;  2EID A;  5FYZ A;  1PO2 2;  4QGL A;  1V6K A;  1ZNP A;  5BPX A;  4XUO A;  5FYV A;  5BNO A;  4PJY A;  1OVP A;  1SMV A;  1WW5 A;  1R09 1;  3ZXF A;  2YY1 A;  3VD5 A;  3N7K A;  3JB8 A;  4MGI E;  3S5Q A;  1DZT A;  1NXM A;  3QD6 A;  4Y1Z A;  1RL3 A;  3PUI A;  2XH6 A;  5EJ1 B;  4FPO B;  3AKS A;  2WFF 3;  1CAX B;  4HON A;  2WNE A;  4AHW A;  1WUV A;  2EVX A;  2W9X A;  1V6O A;  2VXR A;  3D5O A;  3T2T A;  2HWF 3;  1UOJ A;  1SG3 A;  2IFR A;  4A3Z A;  2B39 A;  5HPO A;  2GSY A;  2R07 2;  2ZTN A;  3ZFF A;  1KFX L;  3URF A;  1H9P A;  4B1M A;  3W9A A;  3S7I A;  1U0A A;  1ZA4 A;  5FP8 A;  3ECQ A;  1LHU A;  1AX0 A;  4Y24 A;  1B35 C;  3LFI A;  1JYC A;  3AMM A;  3G7D A;  1EUT A;  2YYO A;  1ZBA 2;  1JTZ X;  5C4W A;  4BMB A;  1SLL A;  2XON A;  3MIB A;  3VBS A;  3SC7 X;  1SCR A;  4CPB D;  1O5U A;  1H9W A;  2VW1 A;  4JTN A;  4Q4X 2;  4IV3 B;  2Q5T A;  2VZ1 A;  2D3P A;  4ORF A;  2OT7 A;  2YUE A;  3AJZ A;  1MAC A;  4R9C A;  2DCJ A;  3VB9 A;  1O91 A;  1QU0 A;  2OX0 A;  3AVR A;  2QUO A;  3VGI A;  1NCR B;  4X8P A;  3HQU A;  3I3E A;  1NKG A;  2VW2 A;  3ZXA C;  2HWD 2;  4IL7 A;  1TMF 1;  4AYU A;  1GP5 A;  1NXD 1;  4MVT A;  2PHU A;  4NRM A;  2ZBJ A;  3ZYH A;  3ZFE A;  2WQ4 A;  3AKP A;  4GWJ A;  4LKS A;  4TSV A;  5FXW A;  3K46 A;  3A22 A;  2J1E A;  1Q56 A;  5FLI A;  5LA2 A;  1O5L A;  2XXZ A;  3ACG A;  4B8E A;  4BQY A;  1UN1 A;  3OGS A;  3SEP A;  3IPV A;  4DOU A;  2YFZ A;  2JD4 A;  2WS9 2;  4AW7 A;  3W20 A;  4NRQ A;  5E6H A;  2JIG A;  2A70 A;  3K51 A;  4XCB A;  1AR7 3;  4X6R B;  4WZC A;  3WT3 A;  4DNY A;  3FMG A;  2AUY A;  2GND A;  2XJP A;  2CAU A;  1UY4 A;  4Q5O A;  3BOW A;  4MV2 A;  4BA6 A;  5BNP A;  3LIG A;  5AFE A;  3I2F A;  2PAE A;  4CDX C;  4D7S A;  1ND2 C;  4IES A;  2E51 A;  2ZKL A;  3CLP A;  1LCL A;  5A3T A;  2P17 A;  3WR0 A;  1XYO A;  4QQ2 A;  1VBA 1;  4N43 B;  3AK0 A;  3H3L A;  4CDU C;  1L7L A;  1R09 3;  2JEC A;  2BP6 A;  3AYD A;  3UNP A;  2CAV A;  1V70 A;  2JE8 A;  1HRV 2;  2JG9 B;  4CCJ A;  3I2H A;  1CZT A;  1HB2 A;  1DGW X;  1Y9M A;  4HPK B;  2ZHL A;  4HSL A;  4CYD A;  4AVC A;  3NJV A;  3I2D A;  2VQA A;  4W65 A;  3ZSK A;  1LR5 A;  3FN9 A;  1EAH 1;  4FFI A;  1BK1 A;  2FDF A;  3ACL A;  2JB4 A;  3RVH A;  4N7U A;  2WL1 A;  3NV2 A;  1LB2 A;  2HJI A;  1HW5 A;  2I2S A;  4QQO A;  5KWR A;  3N36 A;  3HN1 A;  4LBO A;  2BFU S;  2CDO A;  4N53 B;  4D8M A;  2CSG A;  5C33 A;  3WDX A;  4WM7 B;  4BDV B;  4W6X A;  1DP0 A;  5I0R A;  4YW1 A;  5FYS A;  1WKY A;  4AHY A;  4YM0 A;  2E6V A;  2RV9 A;  3MV0 1;  2MEV 2;  3MIH A;  1TEI A;  2ZX3 A;  3HQX A;  2B8M A;  1PZ7 A;  1JYV A;  1K45 A;  4QHZ A;  2PQQ A;  3GCW A;  2VW0 A;  2WKK A;  2VZS A;  3AXE A;  1E5S A;  1GNY A;  1MVE A;  1PNG A;  4IEQ A;  3SKJ E;  4P9X A;  1BVV A;  3DKQ A;  1DYP A;  3U0Z A;  4R8H A;  4Y4Y A;  1F8V A;  1ULG A;  2WZE A;  3LEG A;  2Z5W A;  3NJX A;  4XUQ A;  5FZM A;  3VBR A;  2IXJ A;  2VMI A;  1TME 2;  4FPK A;  4XF1 A;  5EWS A;  2W0X A;  2D3S A;  1W39 A;  3WQ1 A;  4DY3 A;  1OC1 A;  4OUE A;  3N7M A;  2BOI A;  1ZVF A;  1DIW A;  1YUD A;  4XZP A;  1QJU 2;  4EV0 A;  1H4H A;  1I3H A;  1NCQ C;  4L2N A;  3CEW A;  1Y4W A;  4H7L A;  1WLD A;  4V2V A;  1RUO A;  5DAP A;  4D6S A;  4YSF A;  1WCU A;  4JRL A;  4M4P A;  2R06 2;  4W4Z A;  2BGP A;  1G9C A;  5BXX A;  3BPZ A;  5EV7 A;  1BXH A;  1S0C A;  1XU2 A;  4Q0V A;  5HV0 A;  1L3J A;  3DYP A;  4Y33 A;  1QY4 A;  2VCC A;  3KV5 A;  1EP0 A;  5KC5 A;  2Y38 A;  4MET A;  4MOA A;  3OGR A;  4P9W A;  1CAU A;  1JYT A;  2IC1 A;  1KGY A;  2ZJC A;  2ZKN A;  4YW6 A;  2F4P A;  4WVM A;  4HSJ A;  5GLZ A;  3AC0 A;  1DLL A;  1LOC A;  1QIQ A;  2A7A A;  2D97 A;  3CBN A;  3KF5 A;  2BEO A;  2B7Y A;  4DXZ A;  5AFB A;  2B45 X;  4XTP A;  1YFX A;  2Y6L A;  1QH6 A;  1O8S A;  2KR2 A;  3C3V A;  1VBB 1;  4GH4 C;  4HN1 A;  4LO4 B;  3WNM A;  4BK5 A;  1DYO A;  1RVF 3;  1H2L A;  5J1X A;  4FP3 A;  3ZIW A;  3Q8F A;  2AGS A;  5LEK A;  4AR2 A;  1CAV A;  3W21 A;  4J25 A;  4V1P A;  4YWA A;  1RIT A;  3WDW A;  4AWD A;  5BY5 A;  1TMF 2;  4KGG A;  3P3N A;  3I49 A;  2WQ8 A;  3BIW E;  4QX5 A;  1UU5 A;  3CJI B;  1JH5 A;  1UD1 A;  4BLJ A;  4CXW A;  2Y60 A;  3PUS A;  3ASI A;  1AUY A;  1D4M 1;  1YQ2 A;  5EYY A;  2Z4F A;  2VVD A;  3VZL A;  4C91 A;  4LLF A;  1NY7 2;  2D98 A;  2VXJ A;  3AMQ A;  2ET7 A;  3D0S A;  4LUM A;  4RGK A;  3OPW A;  4NWV A;  4YYO A;  3MPB A;  1NZI A;  4DUX A;  2XJQ A;  2WNU B;  4IEO A;  3LPF A;  4D6Q A;  1TZO A;  1U5Z A;  3S30 A;  1S2B A;  4A45 A;  1LNS A;  1LOE A;  3LIH A;  5GZE A;  5EJ3 A;  5FP7 A;  5JXJ A;  4GJZ A;  3KB5 A;  1PNF A;  3SEE A;  4CA9 A;  1JW6 A;  3WHU A;  4XBL A;  4XFI A;  2IXC A;  4AEJ A;  2J1U A;  4ERO A;  4LR4 A;  4QQL A;  3E5Q A;  4JZR A;  1YNA A;  1W2N A;  4AQ6 A;  1HJG A;  5DG1 A;  4LIT A;  1MS3 A;  5CAD A;  3IDA A;  2CWM A;  2CWS A;  2G19 A;  3VD9 A;  3FHQ A;  5H9Q A;  1AXY A;  3T2P A;  2HWB 1;  2ES3 A;  4XBN A;  1OVS A;  1MS0 A;  2JDU A;  1Z7S 2;  2RS5 3;  3L2Y A;  5K0U B;  4DIN B;  4B7K A;  5A7N A;  3PVO A;  1SQ4 A;  1SLC A;  2BV4 A;  1Q8O A;  4PBO A;  4FTS A;  5A6X A;  1R08 2;  2CGO A;  2DCK A;  1DF0 A;  1RMU 3;  1W2T A;  4XIK A;  1YI7 A;  1QDO A;  5A33 A;  1H4G A;  1H6X A;  4SLI A;  3B9I A;  2WLQ A;  4YM3 A;  2GNM A;  5A7P A;  1YYN A;  4OZX A;  2BJS A;  3KZ4 C;  4YLZ A;  5LY2 A;  1EAH 2;  4EWA A;  2ZX0 A;  5HXV A;  5J09 A;  3SCH A;  3MUY 1;  1RHI 2;  1NT0 A;  2A73 B;  4JRA A;  3WY6 A;  4RGA A;  1RXF A;  2Y64 A;  4UW4 A;  1V00 A;  3AL6 A;  3DV8 A;  1C4R A;  2PHR A;  3I2K A;  3V64 A;  1JYN A;  5I0U A;  3RZL A;  5ERL A;  1KDK A;  2BGO A;  2FMY A;  2QQW A;  5DQ0 A;  4YGB A;  1VBB 3;  1A8D A;  1UNB A;  1AR8 1;  3I3D A;  4CXY A;  5FZ9 A;  1AL0 G;  3U10 A;  3C7H A;  1UX6 A;  2TBV A;  3T2O A;  5FZ0 A;  4GA9 A;  3ZDS A;  3PL0 A;  4P9J A;  2WR9 A;  1N1Y A;  3MV1 1;  4HLT A;  1XE0 A;  4MXV A;  5IWF A;  4A3X A;  4YG6 A;  2JDN A;  4Y1V A;  5T5L A;  3S5A A;  2PLV 1;  4OQ8 A;  3WUD A;  4AGG A;  1D2S A;  4NHY A;  5DAX A;  4BQ5 A;  1BLZ A;  3VV1 A;  3WG1 A;  3NAP A;  1ASJ 3;  3POF A;  3VBU B;  1NA1 C;  2VCM A;  1MS1 A;  1WMD A;  3ZYF A;  3ZN6 B;  3FLP A;  1NX9 A;  1F4H A;  4Q4Y 2;  1CAW A;  1RUJ 2;  3M3O A;  3SNM A;  2XQR A;  4ES8 A;  2ZAC A;  1XYN A;  3H7Y A;  3M4F A;  1SFP A;  4XUR A;  4BE3 A;  4MGK E;  4F7Z A;  2ZML A;  4IEW A;  1XB9 A;  2YFU A;  5JLV A;  4YZ4 A;  1RUD 2;  3D6E A;  1RJ8 A;  4RFR B;  2BRT A;  2VH9 A;  2E53 A;  2RR1 3;  4NIA A;  2OQ7 A;  3O1U A;  3LOB A;  1OLM A;  1RUH 1;  5IAX A;  4XQW A;  4UAP A;  3WF1 A;  5LA1 A;  2Y6H A;  4AI1 A;  4CDW B;  5IVB A;  2R7E B;  3UJO A;  1NLS A;  2VE1 A;  5HCF A;  1JZ5 A;  1CIW A;  3RYR A;  4A2U A;  3ENR A;  2G9Z A;  3JQW A;  4UF0 B;  3VDD B;  1AYM 2;  3U11 A;  1GAN A;  3LDR A;  4LHL A;  4YW4 A;  1NYW A;  5ACA 2;  4QPI B;  1ND3 B;  4GMP 0;  4FPC A;  4KBZ A;  2D6M A;  3FLT A;  2LM3 A;  4R52 A;  4BQ2 A;  4MSV A;  4RQP A;  1WLW A;  1CAX A;  1STM A;  5K8S A;  1DQ5 A;  5JMO A;  4CSW A;  1SBD A;  4G4F A;  4BH9 A;  4AEK A;  4AQS A;  4D6R A;  1IGO A;  2G9G A;  4QKB A;  3RMX A;  4E27 A;  5FYI A;  1YFY A;  2D40 A;  2GC1 A;  2DUQ A;  2NM1 A;  1D4M 2;  5DDJ 1;  4QX2 A;  4AFD A;  4EN8 B;  5C9A B;  5C71 A;  2YPJ A;  1AR8 3;  3AZY A;  1X8E A;  3HEI A;  4LO5 B;  3M3Q A;  5FY7 A;  3ZR6 A;  4AQT A;  2A6W A;  1UYX A;  4AVT A;  4BHP A;  4YW2 A;  3PU8 A;  4I0B A;  2WO7 A;  2JE9 A;  1W6Q B;  4IV3 A;  4NO4 A;  3NNJ A;  2W68 A;  4D7T A;  2I45 A;  5BNN A;  5GZF A;  3TYJ A;  5LK5 A;  1YFW A;  4QPG C;  3V0B B;  4IE5 A;  4BIO A;  3NO8 A;  2PHT A;  1G7Y A;  4DY5 A;  3BIE A;  1H8T B;  3I8T A;  5A6Y A;  1NCR A;  1QOT A;  4TN7 A;  2IVI B;  3KT4 A;  4LQR A;  1UYY A;  3KWV A;  1PHM A;  4AGR A;  5LEJ A;  3HBZ A;  3AKR A;  2HWB 2;  5CEH A;  3ZR5 A; 
#chains in the Genus database with same CATH homology
 3N9O A;  5FYH A;  2YBS A;  3PUA A;  5FZI A;  4E4H A;  4CUG A;  5FYY A;  2Q8C A;  5A80 A;  5IVY A;  4HOO A;  3PU3 A;  3PUQ A;  5FZ9 A;  4V2V A;  2OT7 A;  4GJY A;  5FJK A;  4D6S A;  3AVR A;  3PDQ A;  2OX0 A;  4QXB A;  5FXX A;  5FZ4 A;  5FZ0 A;  5KR7 A;  5IVJ A;  5FY4 A;  5F5A A;  2OQ6 A;  4Y33 A;  3N9L A;  5FY1 A;  5IWF A;  2Q8E A;  2P5B A;  3KV5 A;  4V2W A;  4QXC A;  5FXW A;  2PXJ A;  5LW9 A;  4Y4R A;  2XXZ A;  5LY1 A;  2YBP A;  2YU2 A;  5F2S A;  4GD4 A;  5FPB A;  5FPU A;  5E6H A;  4DO0 A;  4BIS A;  5LWB A;  4URA A;  4XDO A;  3NJY A;  3K2O A;  4XDP A;  5FZ1 A;  5FZC A;  5FY5 A;  5A7W B;  2XML A;  4AI9 A;  5FZ3 A;  4GAZ A;  3N9N A;  4DIQ A;  4QX7 A;  5A7S A;  2YPD A;  2WWU A;  5A3W A;  3PTR B;  5A7W A;  4AAP A;  2XDV A;  2OQ7 A;  3N9M A;  5FZB A;  3LD8 A;  4IGP A;  5F32 A;  5FWE A;  5FZE A;  5F3E A;  5FPL A;  3U4S A;  5FZ6 A;  5A3T A;  5FXZ A;  5F5C A;  3KV6 A;  5FZH A;  3PUS A;  5IVB A;  5A7Q A;  3K3N A;  5FUP A;  5FYC A;  5FZK A;  5FP9 A;  5A1F A;  5A7O A;  5FZG A;  4UF0 B;  4Y3O A;  5F5I A;  5FP4 A;  2XUE A;  5FY9 A;  5FYM A;  3ZLI A;  3ZPO A;  3PUR A;  3OPW A;  4LIV A;  3UYJ A;  4IGQ A;  3KVB A;  3N9Q A;  4CCJ A;  4D6Q A;  5F39 A;  4EYU A;  4UF0 A;  5FZ7 A;  5FY8 A;  5ANQ A;  5FJH A;  4EZ4 A;  3K3O A;  5FP7 A;  5IW0 A;  4GJZ A;  4BXF A;  5F3C A;  4CCN A;  4CSW A;  3RVH A;  4CCL A;  5FZD A;  3LDB A;  5F2W A;  3N9P A;  5A1L A;  4LIT A;  3KV9 A;  4D6R A;  5FBJ A;  5FZF A;  5FYU A;  4EZH A;  5K4L A;  2YBK A;  5FYI A;  5FYZ A;  4BU2 A;  5F3G A;  4QWN A;  5FZL A;  5FYV A;  5FP3 A;  5FV3 A;  4CCM A;  5A7N A;  5FPA A;  2WWJ A;  2OS2 A;  5IVF A;  4CCO A;  5IVC A;  4NUB A;  5IVE A;  5FYS A;  5FWJ A;  5A3P A;  3AVS A;  5FY7 A;  4QXH A;  4C8D A;  3U78 A;  4QU1 A;  3PU8 A;  2Q8D A;  4HON A;  5F3I A;  3AL5 A;  3KVA A;  5FXV A;  4CCK A;  5A3N A;  2W2I A;  5FZ8 A;  2VD7 A;  4LIU A;  1VRB A;  4QX8 A;  5A7P A;  5F37 A;  5LY2 A;  5FZO B;  5FPV A;  5ISL A;  2GP5 A;  2YU1 A;  5FUN A;  4TN7 A;  5FP8 A;  3OPT A;  4LXL A;  4ASK A;  3DXT A;  5IVV A;  3DXU A;  5FZM A;  5FYT A;  4IGO A;  5FZA A;  3KV4 A;  5FZO A;  5FYB A;  3AL6 A;  2GP3 A;  5CEH A;  5FY0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...