2OTJE

13-deoxytedanolide bound to the large subunit of haloarcula marismortui
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
172
structure length
172
Chain Sequence
PRVELEIPEDVDAEQDHLDITVEGDNGSVTRRLWYPDIDVSVDGDTVVIESDEDNAKTMSTIGTFQSHIENMFHGVTEGWEYGMEVFYSHFPMQVNVEGDEVVIENFLGEKAPRRTTIHGDTDVEIDGEELTVSGPDIEAVGQTAADIEQLTRINDKDVRVFQDGVYITRKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal RNA
publication title The Structures of Antibiotics Bound to the E Site Region of the 50 S Ribosomal Subunit of Haloarcula marismortui: 13-Deoxytedanolide and Girodazole.
pubmed doi rcsb
molecule tags Ribosome
total genus 39
structure length 172
sequence length 172
ec nomenclature
pdb deposition date 2007-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00347 Ribosomal_L6 Ribosomal protein L6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.930.12 Alpha Beta Alpha-Beta Complex Outer Surface Protein A; domain 3 Ribosomal protein L6, alpha-beta domain 2otjE02
3.90.930.12 Alpha Beta Alpha-Beta Complex Outer Surface Protein A; domain 3 Ribosomal protein L6, alpha-beta domain 2otjE01
3CC4E 1VQNE 3CCSE 3I55E 1M90G 1VQPE 1N8RG 2OTJE 1VQME 3CCLE 4WFAE 1K73G 1Q7YG 5H1SI 1K8AG 3CCQE 2CQLA 5DM7E 4WFBE 3CCJE 1S72E 5JVGE 1RL6A 3CXCE 1Q81G 1VQ6E 1VQ7E 2QEXE 3G4SE 1JJ2E 3CCVE 1YHQE 3CCEE 1QVFE 3CCME 3DLLE 4U67E 4WFNE 1YITE 3CPWE 3G6EE 1YIJE 2QA4E 1VQKE 3G71E 1YJWE 3CCUE 3CD6E 1KQSE 3CMEE 1VQ9E 3PIOE 2ZJQE 5GAGG 3PIPE 2OTLE 5HL7E 5MLCH 2ZJRE 4IO9E 1VQOE 5JVHE 3CMAE 1NJIG 3I56E 4WCEE 1VQ8E 1K9MG 5GAEG 5AN9B 1YJNE 3J7ZG 4IOCE 1Q86G 1VQ4E 1YI2E 3CF5E 1QVGE 1VQ5E 5GAHG 4UY8G 3CC2E 1VQLE 3CCRE 1KD1G 5GADG 1YJ9E 1W2BE 3OW2E 5DM6E 1Q82G 3CC7E 4IOAE 2ZJPE 4WF9E 1M1KG 1KC8G
chains in the Genus database with same CATH superfamily
3CC4E 3IG9A 1VQNE 3CCSE 3I55E 1M90G 1VQPE 1N8RG 5B10O 1VQME 2OTJE 3CCLE 2OY1O 4WFAE 1K73G 1Q7YG 5H1SI 1K8AG 3CCQE 2CQLA 5DM7E 4WFBE 3CCJE 5B2AO 3AUMO 1S72E 3IGEA 5JVGE 1RJLC 1RL6A 3CXCE 1Q81G 2OL8O 1VQ6E 1VQ7E 2QEXE 2AF5A 3G4SE 1FJ1E 1JJ2E 3CCVE 1YHQE 3CCEE 1QVFE 5B11O 3CCME 3DLLE 4U67E 4WFNE 3CKGA 1YITE 3CPWE 3G6EE 1YIJE 2QA4E 2OL6O 1VQKE 3G71E 1YJWE 2G8CO 3CCUE 3CD6E 2FKJA 1KQSE 3CMEE 1VQ9E 3PIOE 2ZJQE 5GAGG 3PIPE 2HKDA 2OTLE 5HL7E 5MLCH 2ZJRE 4IO9E 1VQOE 2FKGA 5JVHE 3CMAE 1NJIG 3I56E 4WCEE 3CKFA 1VQ8E 1K9MG 5GAEG 5AN9B 1YJNE 2I5ZO 3J7ZG 4IOCE 2PI3O 1Q86G 1VQ4E 2OL7A 5B3MO 1YI2E 2OY5O 3CF5E 1QVGE 1VQ5E 2OY8A 1P4PA 5GAHG 4UY8G 3CC2E 2OYBO 1VQLE 3CCRE 2OY7A 1KD1G 2I5VO 5GADG 1YJ9E 1W2BE 3OW2E 5DM6E 1OSPO 1Q82G 3CC7E 4IOAE 2ZJPE 4WF9E 3EC5A 1M1KG 1KC8G
chains in the Genus database with same CATH topology
3CC4E 1VQNE 3CCSE 3I55E 1M90G 1VQPE 1N8RG 2OTJE 1VQME 3CCLE 4WFAE 1K73G 1Q7YG 5H1SI 1K8AG 3CCQE 2CQLA 5DM7E 4WFBE 3CCJE 1S72E 5JVGE 1RL6A 3CXCE 1Q81G 1VQ6E 1VQ7E 2QEXE 3G4SE 1JJ2E 3CCVE 1YHQE 3CCEE 1QVFE 3CCME 3DLLE 4U67E 4WFNE 1YITE 3CPWE 3G6EE 1YIJE 2QA4E 1VQKE 3G71E 1YJWE 3CCUE 3CD6E 1KQSE 3CMEE 1VQ9E 3PIOE 2ZJQE 5GAGG 3PIPE 2OTLE 5HL7E 5MLCH 2ZJRE 4IO9E 1VQOE 5JVHE 3CMAE 1NJIG 3I56E 4WCEE 1VQ8E 1K9MG 5GAEG 5AN9B 1YJNE 3J7ZG 4IOCE 1Q86G 1VQ4E 1YI2E 3CF5E 1QVGE 1VQ5E 5GAHG 4UY8G 3CC2E 1VQLE 3CCRE 1KD1G 5GADG 1YJ9E 1W2BE 3OW2E 5DM6E 1Q82G 3CC7E 4IOAE 2ZJPE 4WF9E 1M1KG 1KC8G
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CC4 E;  1VQN E;  3CCS E;  3I55 E;  1M90 G;  1VQP E;  1N8R G;  2OTJ E;  1VQM E;  3CCL E;  4WFA E;  1K73 G;  1Q7Y G;  5H1S I;  1K8A G;  3CCQ E;  2CQL A;  5DM7 E;  4WFB E;  3CCJ E;  1S72 E;  5JVG E;  1RL6 A;  3CXC E;  1Q81 G;  1VQ6 E;  1VQ7 E;  2QEX E;  3G4S E;  1JJ2 E;  3CCV E;  1YHQ E;  3CCE E;  1QVF E;  3CCM E;  3DLL E;  4U67 E;  4WFN E;  1YIT E;  3CPW E;  3G6E E;  1YIJ E;  2QA4 E;  1VQK E;  3G71 E;  1YJW E;  3CCU E;  3CD6 E;  1KQS E;  3CME E;  1VQ9 E;  3PIO E;  2ZJQ E;  5GAG G;  3PIP E;  2OTL E;  5HL7 E;  5MLC H;  2ZJR E;  4IO9 E;  1VQO E;  5JVH E;  3CMA E;  1NJI G;  3I56 E;  4WCE E;  1VQ8 E;  1K9M G;  5GAE G;  5AN9 B;  1YJN E;  3J7Z G;  4IOC E;  1Q86 G;  1VQ4 E;  1YI2 E;  3CF5 E;  1QVG E;  1VQ5 E;  5GAH G;  4UY8 G;  3CC2 E;  1VQL E;  3CCR E;  1KD1 G;  5GAD G;  1YJ9 E;  1W2B E;  3OW2 E;  5DM6 E;  1Q82 G;  3CC7 E;  4IOA E;  2ZJP E;  4WF9 E;  1M1K G;  1KC8 G; 
#chains in the Genus database with same CATH topology
 3CC4 E;  3IG9 A;  1VQN E;  3CCS E;  3I55 E;  1M90 G;  1VQP E;  1N8R G;  5B10 O;  1VQM E;  2OTJ E;  3CCL E;  2OY1 O;  4WFA E;  1K73 G;  1Q7Y G;  5H1S I;  1K8A G;  3CCQ E;  2CQL A;  5DM7 E;  4WFB E;  3CCJ E;  5B2A O;  3AUM O;  1S72 E;  3IGE A;  5JVG E;  1RJL C;  1RL6 A;  3CXC E;  1Q81 G;  2OL8 O;  1VQ6 E;  1VQ7 E;  2QEX E;  2AF5 A;  3G4S E;  1FJ1 E;  1JJ2 E;  3CCV E;  1YHQ E;  3CCE E;  1QVF E;  5B11 O;  3CCM E;  3DLL E;  4U67 E;  4WFN E;  3CKG A;  1YIT E;  3CPW E;  3G6E E;  1YIJ E;  2QA4 E;  2OL6 O;  1VQK E;  3G71 E;  1YJW E;  2G8C O;  3CCU E;  3CD6 E;  2FKJ A;  1KQS E;  3CME E;  1VQ9 E;  3PIO E;  2ZJQ E;  5GAG G;  3PIP E;  2HKD A;  2OTL E;  5HL7 E;  5MLC H;  2ZJR E;  4IO9 E;  1VQO E;  2FKG A;  5JVH E;  3CMA E;  1NJI G;  3I56 E;  4WCE E;  3CKF A;  1VQ8 E;  1K9M G;  5GAE G;  5AN9 B;  1YJN E;  2I5Z O;  3J7Z G;  4IOC E;  2PI3 O;  1Q86 G;  1VQ4 E;  2OL7 A;  5B3M O;  1YI2 E;  2OY5 O;  3CF5 E;  1QVG E;  1VQ5 E;  2OY8 A;  1P4P A;  5GAH G;  4UY8 G;  3CC2 E;  2OYB O;  1VQL E;  3CCR E;  2OY7 A;  1KD1 G;  2I5V O;  5GAD G;  1YJ9 E;  1W2B E;  3OW2 E;  5DM6 E;  1OSP O;  1Q82 G;  3CC7 E;  4IOA E;  2ZJP E;  4WF9 E;  3EC5 A;  1M1K G;  1KC8 G; 
#chains in the Genus database with same CATH homology
 3CC4 E;  1VQN E;  3CCS E;  3I55 E;  1M90 G;  1VQP E;  1N8R G;  2OTJ E;  1VQM E;  3CCL E;  4WFA E;  1K73 G;  1Q7Y G;  5H1S I;  1K8A G;  3CCQ E;  2CQL A;  5DM7 E;  4WFB E;  3CCJ E;  1S72 E;  5JVG E;  1RL6 A;  3CXC E;  1Q81 G;  1VQ6 E;  1VQ7 E;  2QEX E;  3G4S E;  1JJ2 E;  3CCV E;  1YHQ E;  3CCE E;  1QVF E;  3CCM E;  3DLL E;  4U67 E;  4WFN E;  1YIT E;  3CPW E;  3G6E E;  1YIJ E;  2QA4 E;  1VQK E;  3G71 E;  1YJW E;  3CCU E;  3CD6 E;  1KQS E;  3CME E;  1VQ9 E;  3PIO E;  2ZJQ E;  5GAG G;  3PIP E;  2OTL E;  5HL7 E;  5MLC H;  2ZJR E;  4IO9 E;  1VQO E;  5JVH E;  3CMA E;  1NJI G;  3I56 E;  4WCE E;  1VQ8 E;  1K9M G;  5GAE G;  5AN9 B;  1YJN E;  3J7Z G;  4IOC E;  1Q86 G;  1VQ4 E;  1YI2 E;  3CF5 E;  1QVG E;  1VQ5 E;  5GAH G;  4UY8 G;  3CC2 E;  1VQL E;  3CCR E;  1KD1 G;  5GAD G;  1YJ9 E;  1W2B E;  3OW2 E;  5DM6 E;  1Q82 G;  3CC7 E;  4IOA E;  2ZJP E;  4WF9 E;  1M1K G;  1KC8 G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...