2OTJL

13-deoxytedanolide bound to the large subunit of haloarcula marismortui
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
150
structure length
145
Chain Sequence
b'TSKKKRQRGSRTHGGGSHKNRRGAGHRGGRGDAGRDKHEFHNHEPLGKSGFKRPQKVQEEAATIDVREIDENVTLLAADDVAEFRVDVRDVVEEADDADYVKVLGAGQVRHELTLIADDFSEGAREKVEGAGGSVELTDLGEERQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal RNA
publication title The Structures of Antibiotics Bound to the E Site Region of the 50 S Ribosomal Subunit of Haloarcula marismortui: 13-Deoxytedanolide and Girodazole.
pubmed doi rcsb
molecule tags Ribosome
total genus 30
structure length 145
sequence length 150
ec nomenclature
pdb deposition date 2007-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00828 Ribosomal_L27A Ribosomal proteins 50S-L15, 50S-L18e, 60S-L27A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.100.10.10 Alpha Beta Ribosomal Protein L15; Chain: K; domain 2 Ribosomal Protein L15; Chain: K; domain 2 Ribosomal Protein L15; Chain: K; domain 2 2otjL02
4.10.990.10 Few Secondary Structures Irregular Molecule: Ribosomal Protein L15; Chain: K; domain 1 Molecule: Ribosomal Protein L15; Chain: K; domain 1 2otjL01
1NJIM 3CC4O 3CMEL 3I56O 1VQMO 1VQLL 3CCSO 1KC8P 3OW2K 1M90P 1QVFK 1JJ2K 1YIJO 1VQ4O 1YJ9O 3CCUO 1S72O 1Q7YM 3CMAO 1YJNL 1YJWO 2QEXL 1VQPO 3CC7L 3CCLO 1Q81P 1Q82M 3I55L 3G6EO 3CC4L 1YI2O 1Q86P 3I56L 3CCMO 1KD1P 1K8AM 1VQ6O 1VQ5L 3CCSL 3CCQL 1N8RM 2OTLO 2OTJO 1YIJL 3CCJO 1YJ9L 1VQ4L 1S72L 3CMAL 1YJWL 1KC8M 1YHQO 3CXCN 3CCLL 1M1KM 1M90M 1W2BN 1VQNO 1VQOL 1VQ9O 1VQKO 3G6EL 3CCEO 1YITO 1K73P 1KQSK 3CCVO 3CC2O 3CCML 1VQ7O 1VQ6L 3CD6O 1K9MP 3G71O 2OTLL 3G4SO 2QA4O 1Q86M 1KQSN 1VQML 3CCJL 3CXCK 1W2BK 1YHQL 1VQNL 3CCUL 1VQPL 1VQ9L 3CCEL 1YITL 3CCRO 1VQ8O 3CC2L 1VQ7L 3CD6L 1QVGN 1YI2L 3G71L 1Q81M 1K73M 1NJIP 2QA4L 1N8RP 2OTJL 1K9MM 3CPWN 1VQ5O 1KD1M 3CCQO 3CMEO 1M1KP 3CCRL 1Q7YP 1VQ8L 1VQLO 1QVGK 1Q82P 1VQKL 3OW2N 3CCVL 1QVFN 1YJNO 1JJ2N 1VQOO 2QEXO 3CC7O 1K8AP 3CPWK 3G4SL 3I55O
chains in the Genus database with same CATH superfamily
1NJIM 3CC4O 3CMEL 3I56O 1VQMO 1VQLL 3CCSO 1KC8P 3OW2K 1M90P 1QVFK 1JJ2K 1YIJO 1VQ4O 1YJ9O 3CCUO 1S72O 1Q7YM 3CMAO 1YJNL 1YJWO 2QEXL 1VQPO 3CC7L 3CCLO 1Q81P 1Q82M 3I55L 3G6EO 3CC4L 1YI2O 1Q86P 3I56L 3CCMO 1KD1P 1K8AM 1VQ6O 1VQ5L 3CCSL 3CCQL 1N8RM 3NKDA 4P6IC 2OTLO 2OTJO 1YIJL 3CCJO 5DQZA 1YJ9L 1VQ4L 1S72L 3CMAL 1YJWL 1KC8M 1YHQO 3CXCN 3CCLL 1M1KM 1M90M 1W2BN 1VQNO 4QDLA 1VQOL 1VQ9O 1VQKO 3G6EL 3CCEO 1YITO 1K73P 1KQSK 3CCVO 3CC2O 3CCML 1VQ7O 1VQ6L 3CD6O 4XTKA 1K9MP 3G71O 4WJ0A 2OTLL 3G4SO 2QA4O 1Q86M 1KQSN 1VQML 2YZSA 3CCJL 3CXCK 1W2BK 4N06A 1YHQL 5FCLA 1VQNL 3CCUL 5DS6A 5DQTA 5DS5A 1VQPL 1VQ9L 3CCEL 1YITL 3CCRO 5DLJA 1VQ8O 3CC2L 4W8KA 1VQ7L 3CD6L 1QVGN 1YI2L 3G71L 1Q81M 1K73M 1NJIP 2QA4L 1N8RP 5DS4A 2OTJL 1K9MM 3CPWN 1VQ5O 1KD1M 3CCQO 3CMEO 1M1KP 3CCRL 1Q7YP 1VQ8L 1VQLO 1QVGK 1Q82P 1VQKL 3OW2N 3CCVL 1QVFN 1YJNO 3GODA 1JJ2N 1VQOO 2QEXO 3CC7O 1K8AP 3CPWK 3G4SL 3I55O
chains in the Genus database with same CATH topology
1NJIM 3CC4O 3CMEL 3I56O 1VQMO 1VQLL 3CCSO 1KC8P 3OW2K 1M90P 1QVFK 1JJ2K 1YIJO 1VQ4O 1YJ9O 3CCUO 1S72O 1Q7YM 3CMAO 1YJNL 1YJWO 2QEXL 1VQPO 3CC7L 3CCLO 1Q81P 1Q82M 3I55L 3G6EO 3CC4L 1YI2O 1Q86P 3I56L 3CCMO 1KD1P 1K8AM 1VQ6O 1VQ5L 3CCSL 3CCQL 1N8RM 3NKDA 4P6IC 2OTLO 2OTJO 1YIJL 3CCJO 5DQZA 1YJ9L 1VQ4L 1S72L 3CMAL 1YJWL 1KC8M 1YHQO 3CXCN 3CCLL 1M1KM 1M90M 1W2BN 1VQNO 4QDLA 1VQOL 1VQ9O 1VQKO 3G6EL 3CCEO 1YITO 1K73P 1KQSK 3CCVO 3CC2O 3CCML 1VQ7O 1VQ6L 3CD6O 4XTKA 1K9MP 3G71O 4WJ0A 2OTLL 3G4SO 2QA4O 1Q86M 1KQSN 1VQML 2YZSA 3CCJL 3CXCK 1W2BK 4N06A 1YHQL 5FCLA 1VQNL 3CCUL 5DS6A 5DQTA 5DS5A 1VQPL 1VQ9L 3CCEL 1YITL 3CCRO 5DLJA 1VQ8O 3CC2L 4W8KA 1VQ7L 3CD6L 1QVGN 1YI2L 3G71L 1Q81M 1K73M 1NJIP 2QA4L 1N8RP 5DS4A 2OTJL 1K9MM 3CPWN 1VQ5O 1KD1M 3CCQO 3CMEO 1M1KP 3CCRL 1Q7YP 1VQ8L 1VQLO 1QVGK 1Q82P 1VQKL 3OW2N 3CCVL 1QVFN 1YJNO 3GODA 1JJ2N 1VQOO 2QEXO 3CC7O 1K8AP 3CPWK 3G4SL 3I55O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NJI M;  3CC4 O;  3CME L;  3I56 O;  1VQM O;  1VQL L;  3CCS O;  1KC8 P;  3OW2 K;  1M90 P;  1QVF K;  1JJ2 K;  1YIJ O;  1VQ4 O;  1YJ9 O;  3CCU O;  1S72 O;  1Q7Y M;  3CMA O;  1YJN L;  1YJW O;  2QEX L;  1VQP O;  3CC7 L;  3CCL O;  1Q81 P;  1Q82 M;  3I55 L;  3G6E O;  3CC4 L;  1YI2 O;  1Q86 P;  3I56 L;  3CCM O;  1KD1 P;  1K8A M;  1VQ6 O;  1VQ5 L;  3CCS L;  3CCQ L;  1N8R M;  2OTL O;  2OTJ O;  1YIJ L;  3CCJ O;  1YJ9 L;  1VQ4 L;  1S72 L;  3CMA L;  1YJW L;  1KC8 M;  1YHQ O;  3CXC N;  3CCL L;  1M1K M;  1M90 M;  1W2B N;  1VQN O;  1VQO L;  1VQ9 O;  1VQK O;  3G6E L;  3CCE O;  1YIT O;  1K73 P;  1KQS K;  3CCV O;  3CC2 O;  3CCM L;  1VQ7 O;  1VQ6 L;  3CD6 O;  1K9M P;  3G71 O;  2OTL L;  3G4S O;  2QA4 O;  1Q86 M;  1KQS N;  1VQM L;  3CCJ L;  3CXC K;  1W2B K;  1YHQ L;  1VQN L;  3CCU L;  1VQP L;  1VQ9 L;  3CCE L;  1YIT L;  3CCR O;  1VQ8 O;  3CC2 L;  1VQ7 L;  3CD6 L;  1QVG N;  1YI2 L;  3G71 L;  1Q81 M;  1K73 M;  1NJI P;  2QA4 L;  1N8R P;  2OTJ L;  1K9M M;  3CPW N;  1VQ5 O;  1KD1 M;  3CCQ O;  3CME O;  1M1K P;  3CCR L;  1Q7Y P;  1VQ8 L;  1VQL O;  1QVG K;  1Q82 P;  1VQK L;  3OW2 N;  3CCV L;  1QVF N;  1YJN O;  1JJ2 N;  1VQO O;  2QEX O;  3CC7 O;  1K8A P;  3CPW K;  3G4S L;  3I55 O; 
#chains in the Genus database with same CATH topology
 1NJI M;  3CC4 O;  3CME L;  3I56 O;  1VQM O;  1VQL L;  3CCS O;  1KC8 P;  3OW2 K;  1M90 P;  1QVF K;  1JJ2 K;  1YIJ O;  1VQ4 O;  1YJ9 O;  3CCU O;  1S72 O;  1Q7Y M;  3CMA O;  1YJN L;  1YJW O;  2QEX L;  1VQP O;  3CC7 L;  3CCL O;  1Q81 P;  1Q82 M;  3I55 L;  3G6E O;  3CC4 L;  1YI2 O;  1Q86 P;  3I56 L;  3CCM O;  1KD1 P;  1K8A M;  1VQ6 O;  1VQ5 L;  3CCS L;  3CCQ L;  1N8R M;  3NKD A;  4P6I C;  2OTL O;  2OTJ O;  1YIJ L;  3CCJ O;  5DQZ A;  1YJ9 L;  1VQ4 L;  1S72 L;  3CMA L;  1YJW L;  1KC8 M;  1YHQ O;  3CXC N;  3CCL L;  1M1K M;  1M90 M;  1W2B N;  1VQN O;  4QDL A;  1VQO L;  1VQ9 O;  1VQK O;  3G6E L;  3CCE O;  1YIT O;  1K73 P;  1KQS K;  3CCV O;  3CC2 O;  3CCM L;  1VQ7 O;  1VQ6 L;  3CD6 O;  4XTK A;  1K9M P;  3G71 O;  4WJ0 A;  2OTL L;  3G4S O;  2QA4 O;  1Q86 M;  1KQS N;  1VQM L;  2YZS A;  3CCJ L;  3CXC K;  1W2B K;  4N06 A;  1YHQ L;  5FCL A;  1VQN L;  3CCU L;  5DS6 A;  5DQT A;  5DS5 A;  1VQP L;  1VQ9 L;  3CCE L;  1YIT L;  3CCR O;  5DLJ A;  1VQ8 O;  3CC2 L;  4W8K A;  1VQ7 L;  3CD6 L;  1QVG N;  1YI2 L;  3G71 L;  1Q81 M;  1K73 M;  1NJI P;  2QA4 L;  1N8R P;  5DS4 A;  2OTJ L;  1K9M M;  3CPW N;  1VQ5 O;  1KD1 M;  3CCQ O;  3CME O;  1M1K P;  3CCR L;  1Q7Y P;  1VQ8 L;  1VQL O;  1QVG K;  1Q82 P;  1VQK L;  3OW2 N;  3CCV L;  1QVF N;  1YJN O;  3GOD A;  1JJ2 N;  1VQO O;  2QEX O;  3CC7 O;  1K8A P;  3CPW K;  3G4S L;  3I55 O; 
#chains in the Genus database with same CATH homology
 1NJI M;  3CC4 O;  3CME L;  3I56 O;  1VQM O;  1VQL L;  3CCS O;  1KC8 P;  3OW2 K;  1M90 P;  1QVF K;  1JJ2 K;  1YIJ O;  1VQ4 O;  1YJ9 O;  3CCU O;  1S72 O;  1Q7Y M;  3CMA O;  1YJN L;  1YJW O;  2QEX L;  1VQP O;  3CC7 L;  3CCL O;  1Q81 P;  1Q82 M;  3I55 L;  3G6E O;  3CC4 L;  1YI2 O;  1Q86 P;  3I56 L;  3CCM O;  1KD1 P;  1K8A M;  1VQ6 O;  1VQ5 L;  3CCS L;  3CCQ L;  1N8R M;  3NKD A;  4P6I C;  2OTL O;  2OTJ O;  1YIJ L;  3CCJ O;  5DQZ A;  1YJ9 L;  1VQ4 L;  1S72 L;  3CMA L;  1YJW L;  1KC8 M;  1YHQ O;  3CXC N;  3CCL L;  1M1K M;  1M90 M;  1W2B N;  1VQN O;  4QDL A;  1VQO L;  1VQ9 O;  1VQK O;  3G6E L;  3CCE O;  1YIT O;  1K73 P;  1KQS K;  3CCV O;  3CC2 O;  3CCM L;  1VQ7 O;  1VQ6 L;  3CD6 O;  4XTK A;  1K9M P;  3G71 O;  4WJ0 A;  2OTL L;  3G4S O;  2QA4 O;  1Q86 M;  1KQS N;  1VQM L;  2YZS A;  3CCJ L;  3CXC K;  1W2B K;  4N06 A;  1YHQ L;  5FCL A;  1VQN L;  3CCU L;  5DS6 A;  5DQT A;  5DS5 A;  1VQP L;  1VQ9 L;  3CCE L;  1YIT L;  3CCR O;  5DLJ A;  1VQ8 O;  3CC2 L;  4W8K A;  1VQ7 L;  3CD6 L;  1QVG N;  1YI2 L;  3G71 L;  1Q81 M;  1K73 M;  1NJI P;  2QA4 L;  1N8R P;  5DS4 A;  2OTJ L;  1K9M M;  3CPW N;  1VQ5 O;  1KD1 M;  3CCQ O;  3CME O;  1M1K P;  3CCR L;  1Q7Y P;  1VQ8 L;  1VQL O;  1QVG K;  1Q82 P;  1VQK L;  3OW2 N;  3CCV L;  1QVF N;  1YJN O;  3GOD A;  1JJ2 N;  1VQO O;  2QEX O;  3CC7 O;  1K8A P;  3CPW K;  3G4S L;  3I55 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...