2OTJO

13-deoxytedanolide bound to the large subunit of haloarcula marismortui
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
115
structure length
115
Chain Sequence
b'SKTNPRLSSLIADLKSAARSSGGAVWGDVAERLEKPRRTHAEVNLGRIERYAQEDETVVVPGKVLGSGVLQKDVTVAAVDFSGTAETKIDQVGEAVSLEQAIENNPEGSHVRVIR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal RNA
publication title The Structures of Antibiotics Bound to the E Site Region of the 50 S Ribosomal Subunit of Haloarcula marismortui: 13-Deoxytedanolide and Girodazole.
pubmed doi rcsb
molecule tags Ribosome
total genus 32
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2007-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00828 Ribosomal_L27A Ribosomal proteins 50S-L15, 50S-L18e, 60S-L27A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.100.10.10 Alpha Beta Ribosomal Protein L15; Chain: K; domain 2 Ribosomal Protein L15; Chain: K; domain 2 Ribosomal Protein L15; Chain: K; domain 2 2otjO00
3CCUO 3I56O 3CXCN 3CCML 3CMEO 1K73M 1N8RM 1YJWO 1VQOL 1VQ6L 1VQMO 1VQLL 1VQ7L 1VQPO 1YHQL 3G6EO 1VQ9L 3G71L 3CC4O 1VQ8L 1JJ2K 1YI2O 3CC2L 1S72O 1JJ2N 3CCRO 1YITL 3CCUL 1VQ8O 3CMEL 1Q82M 1YJWL 3CXCK 1K9MM 1VQ5L 1VQML 1KD1M 1VQPL 1YJNL 3G6EL 3CCSO 3CC4L 1YI2L 1KQSK 1VQ5O 1YIJO 2OTJO 1Q86M 1S72L 1YJNO 3CCRL 1M90M 1KQSN 1QVFK 1M1KP 1QVFN 1Q7YM 1KC8M 1Q82P 1K8AM 3CD6O 1VQKO 1KD1P 3CCJO 3CCSL 1K73P 1N8RP 3G4SO 1YIJL 2OTJL 3CCEO 1QVGN 3CCLO 3CCQO 3I55O 3CD6L 1Q7YP 2OTLO 1KC8P 2QEXO 1W2BN 1VQ4L 1VQKL 3CMAL 3CC7L 2QA4O 3CCJL 1NJIM 3OW2N 1K9MP 3G4SL 1VQ4O 3CMAO 1Q81M 3CPWK 3CC7O 3CCEL 3CCVO 1VQNO 1YJ9O 3CPWN 3CCLL 3CCQL 3I55L 1QVGK 2OTLL 3CCMO 1Q86P 2QEXL 1M90P 1VQOO 1VQ6O 2QA4L 1VQLO 1VQ7O 1W2BK 1M1KM 1NJIP 1K8AP 1YHQO 1VQ9O 3G71O 3I56L 3OW2K 3CCVL 1VQNL 1Q81P 1YJ9L 3CC2O 1YITO
chains in the Genus database with same CATH superfamily
3CCUO 3I56O 3CXCN 3CCML 3CMEO 1K73M 1N8RM 1YJWO 5DS6A 1VQOL 1VQ6L 1VQMO 1VQLL 1VQ7L 1VQPO 1YHQL 3G6EO 3GODA 1VQ9L 3G71L 3CC4O 1VQ8L 1JJ2K 1YI2O 3CC2L 1S72O 1JJ2N 3CCRO 1YITL 3CCUL 1VQ8O 3CMEL 1Q82M 5DS4A 1YJWL 3CXCK 1K9MM 1VQ5L 1VQML 1KD1M 1VQPL 1YJNL 3G6EL 5DQZA 3CCSO 3CC4L 1YI2L 1KQSK 1VQ5O 5FCLA 1YIJO 2OTJO 1Q86M 1S72L 1YJNO 3CCRL 1M90M 1KQSN 1QVFK 1M1KP 1QVFN 1Q7YM 5DLJA 1KC8M 1Q82P 1K8AM 3CD6O 1VQKO 1KD1P 4WJ0A 3CCJO 3CCSL 1K73P 1N8RP 3G4SO 1YIJL 2OTJL 4W8KA 3CCEO 1QVGN 4QDLA 3CCLO 3CCQO 3I55O 4XTKA 3CD6L 1Q7YP 2OTLO 1KC8P 2QEXO 2YZSA 1W2BN 1VQ4L 5DQTA 1VQKL 3CMAL 3CC7L 2QA4O 3CCJL 1NJIM 3OW2N 1K9MP 3G4SL 1VQ4O 3CMAO 1Q81M 3CPWK 3CC7O 3CCEL 3CCVO 1VQNO 1YJ9O 4N06A 3CPWN 3CCLL 3CCQL 3I55L 1QVGK 4P6IC 2OTLL 3CCMO 1Q86P 2QEXL 1M90P 3NKDA 1VQOO 1VQ6O 2QA4L 1VQLO 1VQ7O 1W2BK 1M1KM 1NJIP 1K8AP 1YHQO 1VQ9O 3G71O 3I56L 3OW2K 3CCVL 1VQNL 5DS5A 1Q81P 1YJ9L 3CC2O 1YITO
chains in the Genus database with same CATH topology
3CCUO 3I56O 3CXCN 3CCML 3CMEO 1K73M 1N8RM 1YJWO 5DS6A 1VQOL 1VQ6L 1VQMO 1VQLL 1VQ7L 1VQPO 1YHQL 3G6EO 3GODA 1VQ9L 3G71L 3CC4O 1VQ8L 1JJ2K 1YI2O 3CC2L 1S72O 1JJ2N 3CCRO 1YITL 3CCUL 1VQ8O 3CMEL 1Q82M 5DS4A 1YJWL 3CXCK 1K9MM 1VQ5L 1VQML 1KD1M 1VQPL 1YJNL 3G6EL 5DQZA 3CCSO 3CC4L 1YI2L 1KQSK 1VQ5O 5FCLA 1YIJO 2OTJO 1Q86M 1S72L 1YJNO 3CCRL 1M90M 1KQSN 1QVFK 1M1KP 1QVFN 1Q7YM 5DLJA 1KC8M 1Q82P 1K8AM 3CD6O 1VQKO 1KD1P 4WJ0A 3CCJO 3CCSL 1K73P 1N8RP 3G4SO 1YIJL 2OTJL 4W8KA 3CCEO 1QVGN 4QDLA 3CCLO 3CCQO 3I55O 4XTKA 3CD6L 1Q7YP 2OTLO 1KC8P 2QEXO 2YZSA 1W2BN 1VQ4L 5DQTA 1VQKL 3CMAL 3CC7L 2QA4O 3CCJL 1NJIM 3OW2N 1K9MP 3G4SL 1VQ4O 3CMAO 1Q81M 3CPWK 3CC7O 3CCEL 3CCVO 1VQNO 1YJ9O 4N06A 3CPWN 3CCLL 3CCQL 3I55L 1QVGK 4P6IC 2OTLL 3CCMO 1Q86P 2QEXL 1M90P 3NKDA 1VQOO 1VQ6O 2QA4L 1VQLO 1VQ7O 1W2BK 1M1KM 1NJIP 1K8AP 1YHQO 1VQ9O 3G71O 3I56L 3OW2K 3CCVL 1VQNL 5DS5A 1Q81P 1YJ9L 3CC2O 1YITO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCU O;  3I56 O;  3CXC N;  3CCM L;  3CME O;  1K73 M;  1N8R M;  1YJW O;  1VQO L;  1VQ6 L;  1VQM O;  1VQL L;  1VQ7 L;  1VQP O;  1YHQ L;  3G6E O;  1VQ9 L;  3G71 L;  3CC4 O;  1VQ8 L;  1JJ2 K;  1YI2 O;  3CC2 L;  1S72 O;  1JJ2 N;  3CCR O;  1YIT L;  3CCU L;  1VQ8 O;  3CME L;  1Q82 M;  1YJW L;  3CXC K;  1K9M M;  1VQ5 L;  1VQM L;  1KD1 M;  1VQP L;  1YJN L;  3G6E L;  3CCS O;  3CC4 L;  1YI2 L;  1KQS K;  1VQ5 O;  1YIJ O;  2OTJ O;  1Q86 M;  1S72 L;  1YJN O;  3CCR L;  1M90 M;  1KQS N;  1QVF K;  1M1K P;  1QVF N;  1Q7Y M;  1KC8 M;  1Q82 P;  1K8A M;  3CD6 O;  1VQK O;  1KD1 P;  3CCJ O;  3CCS L;  1K73 P;  1N8R P;  3G4S O;  1YIJ L;  2OTJ L;  3CCE O;  1QVG N;  3CCL O;  3CCQ O;  3I55 O;  3CD6 L;  1Q7Y P;  2OTL O;  1KC8 P;  2QEX O;  1W2B N;  1VQ4 L;  1VQK L;  3CMA L;  3CC7 L;  2QA4 O;  3CCJ L;  1NJI M;  3OW2 N;  1K9M P;  3G4S L;  1VQ4 O;  3CMA O;  1Q81 M;  3CPW K;  3CC7 O;  3CCE L;  3CCV O;  1VQN O;  1YJ9 O;  3CPW N;  3CCL L;  3CCQ L;  3I55 L;  1QVG K;  2OTL L;  3CCM O;  1Q86 P;  2QEX L;  1M90 P;  1VQO O;  1VQ6 O;  2QA4 L;  1VQL O;  1VQ7 O;  1W2B K;  1M1K M;  1NJI P;  1K8A P;  1YHQ O;  1VQ9 O;  3G71 O;  3I56 L;  3OW2 K;  3CCV L;  1VQN L;  1Q81 P;  1YJ9 L;  3CC2 O;  1YIT O; 
#chains in the Genus database with same CATH topology
 3CCU O;  3I56 O;  3CXC N;  3CCM L;  3CME O;  1K73 M;  1N8R M;  1YJW O;  5DS6 A;  1VQO L;  1VQ6 L;  1VQM O;  1VQL L;  1VQ7 L;  1VQP O;  1YHQ L;  3G6E O;  3GOD A;  1VQ9 L;  3G71 L;  3CC4 O;  1VQ8 L;  1JJ2 K;  1YI2 O;  3CC2 L;  1S72 O;  1JJ2 N;  3CCR O;  1YIT L;  3CCU L;  1VQ8 O;  3CME L;  1Q82 M;  5DS4 A;  1YJW L;  3CXC K;  1K9M M;  1VQ5 L;  1VQM L;  1KD1 M;  1VQP L;  1YJN L;  3G6E L;  5DQZ A;  3CCS O;  3CC4 L;  1YI2 L;  1KQS K;  1VQ5 O;  5FCL A;  1YIJ O;  2OTJ O;  1Q86 M;  1S72 L;  1YJN O;  3CCR L;  1M90 M;  1KQS N;  1QVF K;  1M1K P;  1QVF N;  1Q7Y M;  5DLJ A;  1KC8 M;  1Q82 P;  1K8A M;  3CD6 O;  1VQK O;  1KD1 P;  4WJ0 A;  3CCJ O;  3CCS L;  1K73 P;  1N8R P;  3G4S O;  1YIJ L;  2OTJ L;  4W8K A;  3CCE O;  1QVG N;  4QDL A;  3CCL O;  3CCQ O;  3I55 O;  4XTK A;  3CD6 L;  1Q7Y P;  2OTL O;  1KC8 P;  2QEX O;  2YZS A;  1W2B N;  1VQ4 L;  5DQT A;  1VQK L;  3CMA L;  3CC7 L;  2QA4 O;  3CCJ L;  1NJI M;  3OW2 N;  1K9M P;  3G4S L;  1VQ4 O;  3CMA O;  1Q81 M;  3CPW K;  3CC7 O;  3CCE L;  3CCV O;  1VQN O;  1YJ9 O;  4N06 A;  3CPW N;  3CCL L;  3CCQ L;  3I55 L;  1QVG K;  4P6I C;  2OTL L;  3CCM O;  1Q86 P;  2QEX L;  1M90 P;  3NKD A;  1VQO O;  1VQ6 O;  2QA4 L;  1VQL O;  1VQ7 O;  1W2B K;  1M1K M;  1NJI P;  1K8A P;  1YHQ O;  1VQ9 O;  3G71 O;  3I56 L;  3OW2 K;  3CCV L;  1VQN L;  5DS5 A;  1Q81 P;  1YJ9 L;  3CC2 O;  1YIT O; 
#chains in the Genus database with same CATH homology
 3CCU O;  3I56 O;  3CXC N;  3CCM L;  3CME O;  1K73 M;  1N8R M;  1YJW O;  5DS6 A;  1VQO L;  1VQ6 L;  1VQM O;  1VQL L;  1VQ7 L;  1VQP O;  1YHQ L;  3G6E O;  3GOD A;  1VQ9 L;  3G71 L;  3CC4 O;  1VQ8 L;  1JJ2 K;  1YI2 O;  3CC2 L;  1S72 O;  1JJ2 N;  3CCR O;  1YIT L;  3CCU L;  1VQ8 O;  3CME L;  1Q82 M;  5DS4 A;  1YJW L;  3CXC K;  1K9M M;  1VQ5 L;  1VQM L;  1KD1 M;  1VQP L;  1YJN L;  3G6E L;  5DQZ A;  3CCS O;  3CC4 L;  1YI2 L;  1KQS K;  1VQ5 O;  5FCL A;  1YIJ O;  2OTJ O;  1Q86 M;  1S72 L;  1YJN O;  3CCR L;  1M90 M;  1KQS N;  1QVF K;  1M1K P;  1QVF N;  1Q7Y M;  5DLJ A;  1KC8 M;  1Q82 P;  1K8A M;  3CD6 O;  1VQK O;  1KD1 P;  4WJ0 A;  3CCJ O;  3CCS L;  1K73 P;  1N8R P;  3G4S O;  1YIJ L;  2OTJ L;  4W8K A;  3CCE O;  1QVG N;  4QDL A;  3CCL O;  3CCQ O;  3I55 O;  4XTK A;  3CD6 L;  1Q7Y P;  2OTL O;  1KC8 P;  2QEX O;  2YZS A;  1W2B N;  1VQ4 L;  5DQT A;  1VQK L;  3CMA L;  3CC7 L;  2QA4 O;  3CCJ L;  1NJI M;  3OW2 N;  1K9M P;  3G4S L;  1VQ4 O;  3CMA O;  1Q81 M;  3CPW K;  3CC7 O;  3CCE L;  3CCV O;  1VQN O;  1YJ9 O;  4N06 A;  3CPW N;  3CCL L;  3CCQ L;  3I55 L;  1QVG K;  4P6I C;  2OTL L;  3CCM O;  1Q86 P;  2QEX L;  1M90 P;  3NKD A;  1VQO O;  1VQ6 O;  2QA4 L;  1VQL O;  1VQ7 O;  1W2B K;  1M1K M;  1NJI P;  1K8A P;  1YHQ O;  1VQ9 O;  3G71 O;  3I56 L;  3OW2 K;  3CCV L;  1VQN L;  5DS5 A;  1Q81 P;  1YJ9 L;  3CC2 O;  1YIT O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...