2OTJS

13-deoxytedanolide bound to the large subunit of haloarcula marismortui
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
81
structure length
81
Chain Sequence
SWDVIKHPHVTEKAMNDMDFQNKLQFAVDDRASKGEVADAVEEQYDVTVEQVNTQNTMDGEKKAVVRLSEDDDAQEVASRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structures of Antibiotics Bound to the E Site Region of the 50 S Ribosomal Subunit of Haloarcula marismortui: 13-Deoxytedanolide and Girodazole.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S ribosomal RNA
total genus 19
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2007-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF00276 Ribosomal_L23 Ribosomal protein L23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2otjS00
2KG0A 2DNZA 3DXBA 3N9UC 5GMKa 2OTJS 1M1KT 2NZ4A 2MQMA 3VAKA 1WG4A 2MMYA 2O3DA 1WHWA 1BY9A 2DHGA 2MZTA 1IQTA 2J76E 2DGQA 2DH9A 1X5PA 4IO9Q 1YJNS 2XNRA 2HGLA 2MZSA 4IOCQ 2KXFA 2RRAA 4F02A 2CQBA 1KQSR 1D9AA 4EGLA 2CQDA 3OW2R 4FXWA 3CXCR 3MXHP 1VC0A 2KHCA 2N3LA 3EGNA 3FEXB 1A7GE 1K9MT 1YTYA 3CCVS 3CCQS 2OTLS 1OWXA 1L3KA 3NNAA 3CC4S 1VQ6S 2M52A 1D8ZA 1U2FA 2M9KA 2KM8B 3MI7X 3MUMP 3CCUS 3CF5Q 2VONA 3LPYA 1FJEB 3THTA 2DGTA 1DZ5A 2DB1A 2JX2A 2MQPA 3RW6A 1WI8A 4CIOA 5LJ3Y 1U1MA 2PE8A 2DGUA 3EX7B 1YIJS 1JMTA 2J8AA 1VQNS 3PIOQ 2KT5A 3R27A 3S8SA 1Q81T 2BOPA 1VQ4S 3DLLQ 2WBRA 2ZJQQ 3VALA 2MY7A 1OIAA 1U1OA 2A3JA 5GADU 3CMAS 1N88A 3CPWR 3P49B 2YTCA 5IQQA 1R8HA 2RQ4A 2X1AA 3CCSS 2DNYA 2KXHA 2AYBA 1YHQS 1KD1T 2N7CA 1VBXA 1N54B 1WG5A 2KH9A 3J7YU 2M0GB 2J0SD 3NS5A 4TLQA 1U6FA 2RS8A 3CUNA 1RKJA 2CPIA 2CQ3A 3SXLA 4U67Q 2XB2D 2DNOA 2XS5A 3FEYB 2XS7A 3LQVA 3VF0B 3CMES 2FY1A 2DNQA 2DGOA 3VAGA 4IUFA 1U1QA 2I38A 1UW4A 2DNHA 2VODA 1K73T 2LKZA 2QEXS 3CCLS 3IRWP 4F26A 2CPJA 1UAWA 5DDRC 1VQPS 1JJ4A 2GO9A 3THPA 1HL6A 1ZH5A 1PGZA 5H1SV 3CULA 5FJ4A 5IFMA 2DGXA 3MDFA 2CQHA 1DHMA 2L41A 3BO2A 4QU6A 4OZ1A 1X4CA 2KRRA 2CPYA 1RK8A 1XN9A 2LXUA 2DIUA 1Q86T 1M5VC 3Q2SC 4CQ1A 2Q79A 1HA1A 3S01A 2AD9A 1U1PA 2DK2A 4WFNQ 4LIRA 1WG1A 2BZ2A 3VAIA 1FJCA 2JRSA 2KI2A 3VAFA 5DDPC 3UD3P 4ED5A 1P1TA 4UY8T 5HL7Q 1YJWS 3HHNB 3S7RA 2KXNB 4M5DB 2MKJA 4PKDB 2N3OA 3G4SS 2KYXA 5MLCV 2DHSA 4YB1P 2CQPA 2OIHA 3SDEB 2MXYA 1VQKS 4QQBA 3BO4A 4Y00A 1S79A 2CQIA 3VAMA 2MB0B 1H2UX 2DNMA 2U2FA 1H6KX 2RVJA 4IOAQ 1NO8A 4UQTA 2CQ4A 4TU8A 2DITA 1SJFA 1VQ9S 3H2UB 1ZZNA 4CH1A 2HVZA 1SJ4P 5IM0A 3TP2A 4P6QA 2RU3A 4V19X 2CPFA 2MSSA 1NJIT 2F9DA 1N8RT 1S72S 1FO1A 1SXLA 2QA4S 2HYIB 3CTRA 1VQ7S 3UE2A 5IM0B 3BO3A 3CCMS 2CPXA 2MKSA 3B4MA 4W92B 3IWNC 3G71S 3TO8A 4Z2XA 5EN1A 1K8AT 2E5HA 2RQCA 2KM8C 2DISA 3G9CA 1M5PC 2CQ0A 3ZZYA 2V94A 2CQ2A 2MQLA 1X4AA 1Q82T 4WIIA 3G96A 1YI2S 2MQOA 1WF2A 2DGVA 2E5IA 3V4MA 4F25A 2JVOA 1FNXH 4ERDA 4QU7A 5BJRA 2YH1A 3ZZZA 2CQGA 1X4GA 2D9OA 2OJ3A 2VOOA 1WELA 3K0JA 4WF9Q 1WI6A 2RUGA 2G4BA 1YWXA 2CQCA 1QM9A 4ZKAA 3MUTP 2MZQA 2YKAA 1B7FA 2CQ1A 4PR6A 1VQOS 5CA5A 5D77A 3G8SA 2CPDA 2LMIA 5HO4A 3UCUP 3R1HA 3NNCA 3CD6S 1HD0A 3MOJB 2L9WA 3P5TL 2MY8A 1X4FA 2M88A 3G6ES 1U1NA 2DO4A 4OZ0A 1X5TA 2AYMA 1R8PA 1SJQA 3MURP 2ERRA 2CPZA 2RNEA 2HGNA 2MJNA 3MD3A 2XNQA 1YJ9S 3NNHA 2MQQA 5DM6Q 1VQ5S 1UP1A 3SDEA 3BEGB 2DNNA 2I2YA 2NLWA 2KN4A 2QFJA 1P27B 1FHTA 1CVJA 2MKKA 2M4MA 1OO0B 3US5A 2D3OR 3CCRS 4TU7A 4PRFA 2MPUA 3PIPQ 2KU7A 4RU2A 1N52B 2XSFA 1H2VZ 2RS2A 1AUDA 2M2BA 3S6EA 2M8DB 2LEBA 3J7ZT 2LA4A 1WWHA 4LJMA 2RT3A 4FXVA 2ZJPQ 3TYTA 5LJ5Y 3SMZA 5GVQA 1X4HA 2M8HA 1X5OA 1G2EA 4C4WA 1X5SA 4BS2A 3ULHA 1M5OC 1H2TZ 1QVGR 1ZZFA 3CCES 4TU9A 2LXIA 2MGZB 1M90T 5D78A 2LQ5A 1JJ2R 2F9JA 1VQ8S 2KG1A 2X1FA 1DBDA 1WEZA 1KOHA 1OPIA 1SJ3P 5LSLA 2SXLA 2DNPA 1F9FA 1KC8T 3UWTA 3MD1A 3R1LA 2X1BA 1A9NB 2MQNA 1O0PA 2DH8A 2MGZA 2DIVA 2FPHX 5DDQC 2OSQA 5LXRA 3JB9k 5CXTA 2LYVA 3VAJA 5ITHA 2MHNA 2DHXA 2MKIA 1FT8A 3CCJS 1X0FA 1DRZA 2G1DA 4YUDA 2N82B 2DO0A 2CPHA 3I55S 1FJ7A 2K8GA 1VQLS 2MJUA 3VAHA 2ZJRQ 3UCZP 3HI9A 5DETA 1WF1A 2PEHA 2JWNA 2LECA 2HGMA 2J0QD 1WHXA 2X1GA 1Q7YT 1FXLA 1VQMS 2MZRA 2M70A 5LSOA 2E5GA 1VBYA 5DM7Q 1WTBA 3RW7A 4A8XA 2XS2A 4WFAQ 1KOOA 1QVFR 2UP1A 2E44A 2B0GA 1UFWA 1W2BR 2HZCA 4CH0S 1HD1A 1WEXA 3P3DA 1M5KC 2JVRA 2LA6A 5GAGU 2EK1A 2EK6A 2F3JA 4QPTA 2U1AA 3BS9A 2FHOB 4Y0FA 2DNLA 2GHPA 1X4EA 2EVZA 2KRBA 4LMZA 2AYEA 2D9PA 1JJHA 1VC6A 2DGSA 4WKRA 2YWKA 2DHAA 1U1LA 4WCEQ 2DNKA 3CC2S 3P6YC 1X4BA 2MKCA 2OSRA 5GAEU 2MSTA 2RRBA 1NU4A 3NS6A 5CYJA 2AYGA 2K3KA 3I56S 5JVGQ 3NMRA 2KVIA 2LEAA 4WFBQ 2LCWA 2E5JA 2ADBA 3L3CA 1URNA 4YOEA 5DDOC 3CC7S 3G8TA 3UCGA 5LXYA 1WHYA 2DH7A 2MYFA 5JVHQ 2DGWA 2FC8A 3Q2TC 4W90B 2VOPA 3D2WA 1VC5A 1VBZA 2M7SA 2ADCA 1SJRA 2MKHA 1X4DA 2DNGA 2MZJA 5GAHU 1WEYA 1YITS 4C0OC 1U1RA 3B4DA 2YH0A 1WHVA 2MZ1A 1U1KA 1PO6A 2CJKA 2CPEA 2L08A 3MUVP 3EGZA 1U6BA 2G0CA 4C7QA 3U1MA 4J5OA 3U1LA 3H2VE 1WF0A 2FC9A 2KFYA 3UD4P 2DNRA
chains in the Genus database with same CATH superfamily
1SVDA 2KG0A 4GKKJ 2R3VA 2DNZA 3D1OA 4DUYJ 1S9GB 2XMJA 3F44A 2ROEA 1M1KT 2CKWA 2CVIA 2PSZA 4Z7CA 1HHTP 1IBKJ 2NZ4A 2MQMA 4FZVA 1F0XA 2LQ9A 2JSXA 2ZKTA 4J90A 4OYIA 1TKXA 1YBUA 3MM6B 4N8OA 4OZNA 5B0EA 4C0BA 3KHLA 1FJGF 2E9ZA 1SJ1A 3GONA 3PYGA 5IZHA 3ZNJ1 3TW0A 5KTQA 4N56A 1NK9A 2V2KA 2W9AA 4LSNA 4DWIA 2NPIA 2RUSA 4JV5J 4OYWA 1N6QA 4K5RA 2LDYA 2DH9A 4IO9Q 1HBNB 1Q5VA 3H25A 4JI8J 2MZSA 3O1LA 5F8HA 1HNIB 1XR5A 3MPVA 3FKBA 4ILMA 3JQMA 3SSQA 2YNIB 4EGLA 3DLKB 2UVWA 3LAMA 2O66A 4NCBA 2RIJA 4KKOA 4V1Ak 5AT1B 3OW2R 1MU2A 5L9NA 3CXCR 4ILLA 3OUYA 5K9FA 2E1AA 1UKUA 2KHCA 2HHVA 4C11B 4I2PB 1VI7A 4ZCMA 3KLGA 2JLFA 3KLVA 4J9OA 1QSLA 2ZOGA 2FZCB 1VQ6S 1D8ZA 1U2FA 4DPUA 3CF5Q 3MI7X 1KQFB 2B8QA 2VONA 2FZKB 2H9ZA 4WKYA 4Y2CA 3LPYA 1VFJA 4AL6A 5H9EJ 3PO4A 5FLXU 1B4SA 4Q45A 1C1BB 4JB8B 3Q22A 3RB0A 2KJVA 1DZ5A 2VPXB 3BGOP 2J6UA 4CO4A 1GFWB 1GQEA 4HACA 4DX6A 4O4RA 1I51B 1U1MA 3EMTA 1PAUB 4DSJA 3IGVA 4LBHA 2VC0A 3CCZA 1LW2A 4RW4A 4Q0BA 2FVCA 2J8AA 3T9NA 1RE1B 5LMUF 4CTAB 1RHMB 3PW5A 2V8GA 1IBLF 1KRPA 2C2MB 4L72B 4A8SA 2YKMB 1CC8A 2KT5A 2J9CA 1R6YA 1W26A 2QA1A 2QN6B 1TKZA 4HL9A 1WOPA 4OLOA 4PXEA 3S8SA 1Q81T 3KDOA 3DLLQ 3A12A 3KMQA 4TYBA 1U1OA 2MY7A 3BB5A 1UCNA 2IBOA 1LFPA 1HW8A 4CLTA 1WKJA 2OPRB 3CCTA 4IFVA 5F0UA 5HVFA 5IQQA 3HLUA 4DCOB 3M05A 4P10A 1IM4A 2RILA 4LR8A 3C19A 3D66A 3M8SA 2NYHA 1SC1B 4FN5A 3KMSA 1VBXA 1FJGJ 4JYAF 3QT6A 2M0GB 1LW0B 3MEDA 5DQGA 4U7CA 3W8PA 2HMIA 2FJBB 3EVOA 2HQIA 3MM7B 3MEEA 3KLIB 1OJ4A 3EDQB 4K2XA 2P9EA 1PSDA 5C42B 4WP3A 5KT7A 3KLGB 5L8RC 1JQGA 4U67Q 2DNOA 2FQQB 3HFVA 3SCKE 2DR5A 4ZP6A 2DCLA 4ZVOB 2DGOA 3ZC4A 3SBMA 2H48B 2OPPB 4BDPA 2VUGA 4U7UD 2I38A 1UW4A 2G13A 3ISNC 1K73T 4JI3J 3GR0A 3TX0A 3J81Y 1HNWJ 2NQPA 3DXSX 3GTYX 4LUBA 3CCLS 4KY3A 2Q66A 3DRSB 1UAWA 1S5ZA 5DDRC 1HBMB 3DRRA 2FIUA 2VZ9A 1NNDA 2OP5A 4NL5A 1D09B 4X4QA 2V2VA 1NB7A 4F4WA 2CA9A 2HWTA 2W7OA 3TARA 1IBCB 3C15A 4JI5F 1YSJA 1ZH5A 1L3UA 4P73A 2AWZA 3BJYA 3W64A 5F8GA 2ZH3A 1TFYA 4WU3A 5FJ4A 4B9UA 3CJ4A 3AB2B 3E01A 3KXDA 3MDFA 2B9EA 5THWA 4ZCIA 4U95A 4NLGA 3BKFA 4J9VA 4O3QA 2C28A 1NSPA 3A3OB 2CQHA 2F65A 2CFXA 4RU9A 1MMNA 2WVBA 1DURA 2XC9A 4DV6J 4P2SA 1X4CA 3RB3A 4YDXA 3OJSA 2ASLA 2BKOA 1PILA 3D54A 1SQFA 3BGRB 3CD7A 3OBIA 4JI2J 1XN9A 2VFSA 3QGPA 3TJAA 2OPPA 2DIUA 4X66J 4NLYA 5K14A 2BA9A 1Q86T 4ER8A 1HPZA 3MR6A 2IIHA 2P6TA 3BF4A 1TUGB 5E33A 8AT1B 4KPYA 2UXBF 1U1PA 1RJJA 3CDWA 4DLGA 2BZ2A 5F41A 5HSPA 2XLJA 1PAEX 2JRSA 3CJQA 2KI2A 4A47A 4WP8A 5DZ6A 3KYLA 4CYUA 4FF1A 3ISZA 2LECA 1HI1A 2AJ0A 3LANA 1YDLA 3M30A 2EFVA 4ELVA 1B7YB 5J2PA 1URRA 5IC4B 1RAJA 4DR1J 3H7HB 2PDAA 4N77A 4NA2A 2EC0A 4JP8A 1YJWS 3POTB 1FDDA 1T9WA 2XMTA 3S7RA 1HNWF 3MM9B 4DSLA 1FRJA 2KYZA 4PKDB 2N3OA 4Q8FA 3EDRB 2IMWP 4C8ZA 5KOWA 4LF8F 2YY3A 1TK8A 3SDEB 1VHFA 1JLEA 3MPUB 2ZD1B 4FS2A 2JL9A 1ZS6A 1F9EB 2EBEA 5T41A 1TK0A 3GJRB 1S1XB 4UW2A 3VVTA 3W2VA 3VAMA 1H2UX 3EICA 1H6KX 1G3OA 5ETMA 4MYUA 2ACMA 2Q6CA 4TU8A 1MU2B 3BH7B 4CLUA 4K7QA 3QJJA 2BJ7A 1RWKB 3VALA 3RBXA 3C46A 3EGWB 3OXLA 2XHWA 1QE1B 2CIMA 3T5KA 2RU3A 4ZVEA 4AD6A 1H38A 2WHOA 1HBUB 5FDLA 1CJVB 1SIZA 3GIKA 1VISA 4ZVRB 1HBOA 1NJIT 4ES2A 4J9KA 4KHRA 1FO1A 3IR5B 2XWXA 2OPSB 2VD3A 4JI6J 2QL5B 3A8IA 5EHHA 4FDFA 3ZXWA 3CCMS 1TKXB 2XMVA 4W92B 3IWNC 3G2XA 1AUSL 3DHWC 3RU0A 4ED0A 2COLA 3W2WB 1IBLJ 3ADAC 4DF4A 4RO0A 2XMKA 4ZN1A 3AD7C 1S59A 4P2MA 3CIZA 3L7PA 2DISA 4MJKA 1XERA 1RT6B 1Y00A 5CCLA 2N4CA 2CDQA 4R5PA 2V4QA 4DV7F 3TANA 3JXOA 4KB7A 4ELTA 2PI5A 4PQUB 3LP1A 2Y0BB 4DQIA 2DXDA 2CQ2A 2F40A 3ENAA 4U96A 4DX7A 2MQOA 2FJXA 1XMOJ 2IC3B 2RAQA 4N47A 1MG7A 1N34F 3TUIC 2DGVA 4LF9F 2YX7A 3MR2A 4C8NA 3DCAA 1XNQJ 1UA1A 2OHDA 4DUTA 5AE3A 2WOMB 3J7AN 3MECB 4O3RA 3SYZA 2WONA 4I0WA 4MFBA 2Y1LB 1F5CA 1FK9B 3NGTA 2BQUA 1H74A 1X4GA 1QTMA 1YJTA 2D9OA 1P8GA 2ZDOA 2OJ3A 4RL1A 4AT1B 4RZRA 2OPQB 4QR0A 3RR8A 3AJ1A 4IH7A 4GVBB 2BM1A 2ALYB 2EEYA 3NY0A 4LRFA 2NPFA 3W2VB 4FVMA 4QPXA 1WELA 1HNXJ 2AGQA 4LF6J 3K0JA 3DGPA 2R7QA 1ZAXA 1U2RA 4WF9Q 1WI6A 2RUGA 4DL4A 1PKUA 2D69A 2W4CA 2A1BA 3LOUA 2IJNA 3KJVA 3PYFA 4CWBA 3HFZB 1QM9A 1XC9A 2R8KA 1TAQA 1YRXA 2XYPB 2KHDA 1ZTTA 4FVCA 3KK2A 4OJGA 4EO8A 3G8SA 5D77A 5BYQA 2CPDA 1CC7A 5J2PB 1XMQF 3CD6S 2ILZA 2GMHA 2L9WA 2WONB 4MKBA 4DL5A 1UVMA 1H0HB 1S1WA 1YBAA 2MY8A 2A10A 3IRXA 1X4FA 2CJBA 2VC1A 4GMKA 4UOCA 4DR2J 2BANA 4NMLA 3G6ES 4J9MA 1JWWA 2ZUGA 1SIWB 2ROGA 2VG6A 4J9LA 2YWWA 1NJXA 4CNZA 4F2RA 3C15B 3HVWA 1AROP 2WTFA 2NREA 1SI9A 1S12A 2AYMA 1SJQA 2QZ8A 3MURP 1UVLA 1BQNA 4FNHA 3L7UA 2MJNA 3H8YA 1JLQA 1R8AA 3VZIA 1XMQJ 2XNQA 4DBQA 3HX9A 1W2IA 3NNHA 1T0TV 2MQQA 3RRHA 1UA0A 1WDTA 1SUQA 4KV8A 4ZP7A 3RYLA 5DM6Q 3NMAA 4RNFA 1MLAA 4OQJA 2A6OA 1RT6A 5M2UA 2I2YA 1LXJA 3TAMB 1P27B 2P2CB 4OYAA 5C2GA 2ZHOA 1MMLA 2WW8A 4Y65A 2VL1A 1VIXA 2KL8A 1OO0B 3AHPA 2IVFB 4UT4A 5I42B 4RNMA 3GJTB 4OYPA 4LF7F 5D3GB 2YKOA 3AOAA 1X9WA 2NXNA 4I4BA 2WRMA 5HMXA 4PRFA 3HVTA 2R4FA 1LNQA 2RDDA 4YP3A 3PIPQ 4DCPB 2RF2B 3PTWA 3R5CA 3KUGA 2YKPA 5CCMA 1SKWA 2VFVA 3SZ2A 1IR0A 1S1TB 4F4KA 3QATA 2HHHJ 1HNZF 4QIGA 2F63A 5EWGA 1NKEA 5LL6d 4I68A 1PG5B 2VBWA 3U02A 4AQYF 2LEBA 1LWFA 2Z8QA 1IBMJ 3N01A 1FD8A 4Y2IA 2BE2A 2OGUA 3IS9B 4YFUA 5DGBA 4ZVFA 2AEJA 3N79A 2ZJPQ 2DPJA 1JLAB 3SMZA 1S9EA 3MMBA 2UUWA 5AXNA 1VR6A 3CW2C 3T6BA 4PXDA 5L9XA 2FHMA 1KNZA 1EKRA 3LWMA 3HT3A 4RW8A 3PEHA 4TY8B 2XLKA 2L3MA 4DV7J 4HHJA 1GMWD 1ZZFA 3C6UB 3T1YF 1NK0A 2LXIA 2VKRA 3DOLB 3I0RA 1RT5A 4NLXA 1SH2A 2MTLA 3H5UA 3I4PA 2V5HG 1U26A 3KLHA 2X1FA 2HNZA 1WEZA 1V5IB 2HRYA 5CZVA 3FJ2A 5B0GA 5KFYA 4ED2A 3HVTB 3CEDA 1EP4B 1IKVA 3ILOA 4MT1A 4F2SA 5C7PA 2AP6A 2GVDA 1H7WA 4YQWA 4TY9A 4USHA 2MQNA 4TLRA 2ZBPA 3MMAB 2B8PA 3R1LA 1RTDA 2DIVA 5DDQC 3PYEA 2R7UA 1FWKA 4PG4A 1TVRA 3TAMA 8RUCA 2LYVA 1TKDA 5CXTA 1KVIA 1NDKA 3JYTA 1RTJB 4LR9A 4M5LA 2ALZA 1UVJA 1A6LA 5ITHA 1UFLA 2DHXA 3QIPA 2L9NA 2DY1A 2V34A 3CJ0A 1OS5A 4OI2A 2HS3A 3OUYB 1X0FA 1LXNA 2DO0A 2JJ4D 2V8VA 2ZZTA 4USWA 4EFAC 2VHGA 5ETKA 5D0GA 4DQSA 4NXMF 2K8GA 2VU5A 1FXDA 2MJUA 3UCZP 5KFRA 3T1YJ 3CGIA 2OH2A 1DTTB 4KHPF 2CG8A 1B99A 3IR6B 3MPWA 3W5ZA 3PX6A 3MR3A 3GJQB 1R0BG 2HFUA 3LH2S 4Y3CA 1B0VA 2XMWA 4YY3F 3GZ7A 1FXLA 3M1VA 4DCJB 5LSOA 3GSIA 5F9LA 1VBYA 2C2OB 4KPCA 3H90A 3SQOP 4RNHA 1UW9A 1WTBA 2VBYA 2QMWA 3NWRA 3H40A 4LRBA 4WFAQ 1CS4B 4NWBA 1QVFR 2Y3YA 4C8LA 2E44A 2GA7A 2BQRA 2HHHF 3ZFVA 2DPIA 2ZZMA 3QWUA 4OZJA 4DPWA 2RDIA 2HZCA 1IKWA 2ACYA 4CH0S 1NMEB 4NLTA 4CLYA 4KAIA 1HD1A 1WEXA 3GMGA 4H54A 4C3KA 2E1CA 5K8PA 2FGOA 2JVRA 2EK1A 1SL2A 4RUAA 4B9TA 1IJFB 2U1AA 4KE5A 3JAMU 1GEHA 3ETOA 4GO5X 2RQKA 4OI1A 4X4UA 2CAJA 1KQKA 3AXMA 2B5JB 1EX8A 2CADA 3AQPA 1NK6A 4ECXA 3GB0A 2JLGA 1RAGB 2DGSA 2UU9J 5L39A 1Q8IA 1Z1ZA 4F4YA 4XIUA 3DDNA 2LU2A 4DR4F 3TJ9A 1UMJA 3ICLA 2L9DA 1VBKA 4QJVA 3RB6A 4K4ZA 4JI3F 1IXKA 2UXDJ 4ZA1A 3PM9A 2VH7A 3D4JA 1S1WB 4PG5A 1TQLA 4GVLA 4AL7A 1WC4A 2GQCA 2ZH6A 1E6YB 1HQUA 2W24A 1NU4A 1RQ0A 1KS2A 1PJ6A 1NAQA 2P5VA 2EG2A 3M4XA 2ZH8A 2P6SA 3UNYA 4WK3A 1OYDA 2K3KA 2MDAA 1NZ8A 3ZZRA 1RP5A 2KVIA 5JVGQ 3M6VA 1TK5A 2LEAA 5KFGA 1SC6A 2O5DA 4ZPBA 3R9LA 4NA1A 4DV2F 4J9UE 2V4RA 4OZ3A 3KTQA 3A13A 3AFGA 3OL9A 1AYEA 1S48A 1ZYQA 3Q8YA 3ZTPA 1QJHA 2BVZA 5KFQA 3RUBL 1NZAA 4DFPA 1RTZA 2JC0A 5DDOC 2GMJA 2J9EA 4CT8A 1NDPA 1TMJA 1X8DA 3IGNA 3MCSA 3G8TA 2IAJA 2QMXA 3EXYA 4XK8C 5HQ8A 2B56A 4KO0B 4NA3A 2XM3A 5JVHQ 4GRSA 1IN0A 1FESA 5D4LA 3Q2TC 1RCOB 5CABA 1L3SA 3KJNB 2RKIA 4ZPAA 2ADCA 1SJRA 2MKHA 4EZ6A 1WORA 5GAHU 1FE0A 1SB6A 4UUXA 2R7WA 1YITS 4G1QA 3B4DA 3BH6B 3H42A 2MZ1A 1WHVA 1R7IA 3NEKA 1UEVA 3BR9A 1OPZA 5D4PA 2C2ZB 2XO7A 2CJKA 3ISND 3TWZA 4IR9A 3S1TA 4N8NA 4O4GB 4OX6A 2GJFA 4OZ5A 4Y28C 2J0WA 2F8MA 3KWMA 3U1LA 3C2PA 1RHJB 4ECSA 2FC9A 2DKOB 3O5TB 4EWTA 4OI0A 2YPYA 1ACMB 2B43A 2ZD1A 1ZPWX 5JUMA 1RTIA 4I6AA 1C0TA 3SIPB 1S7HA 4W4MA 5A8WB 2AZ3A 1Y3JA 4URGA 4JBCA 4MK7A 2W9CB 1JX4A 2UXBJ 2NYIA 3I96A 3W9HA 2NUUG 3IR7B 5CYMB 2PMWA 3GP9A 1HWUA 3NCRA 1FVQA 1YGYA 3W62A 4HYKA 2FVQA 1HQ2A 2J9DE 4TQRA 4ED8A 2MMYA 2CXEA 5C2CA 4QCLA 1SC4B 1WHWA 1JXVA 5GADI 1BY9A 2QYCA 4S0MA 1NK7A 1CJVA 3D7SB 1LV5A 3PY8A 1IVZA 1KFSA 3BGUA 5E5NA 2BJEA 4YB5A 3T1AA 3QZ8A 3H2LA 3PEJA 4WFXA 2DGQA 1QLNA 1IQTA 3IAM9 3OTEA 3FQKA 1DQAA 4LF2A 2HGLA 4PG6A 2QMUB 1HPZB 2HKEA 3FFIA 5E3QA 2EFGA 4DEZA 4AQYJ 4RW9B 3G6YA 4F02A 2CQBA 1TAUA 5IT9Y 3OT9A 4OYMA 4P2FA 2PIIA 2ZH4A 2VQFF 2E66A 1RADB 3PRBA 3ZO7A 5F3ZA 1PBUA 4FXWA 3MXHP 1VC0A 4ETXA 3AT1B 3QIPB 5IQ6A 2BDPA 4K5SA 4LFAF 1A7GE 2MLYA 3SSSA 1JLGA 3AJDA 3CCQS 2OTLS 3VGVA 3JQJA 7FDRA 3CCUS 4RKUC 3IG1B 2OELA 3MEGB 3G8QA 3MMCB 3OTOF 5HP1B 3SSRA 3TAPA 2P9GA 3SV3A 2V4JB 4FNIA 4EEYA 2GO8A 2HPUA 3HM9A 3UO0A 2GQ2A 1XEZA 4RW7A 4EBDA 4OYXA 4B3OA 1TL4A 2CJAA 1WI8A 4CZCA 1RHKB 1TUWA 1IQZA 3KFWX 1AXQA 2AJFE 3DRPA 2HSEB 5KG2A 5IWAF 4CIOA 4DR2F 3M9NB 4NZ6A 1Y4ZB 1NKBA 1I6JA 3R5JB 4B9MA 3Q8RB 1JMTA 4A8KA 2XY5A 2HRTA 2RSQA 3Q89A 3SCLE 3CJKA 3PIOQ 4KV8B 3OJUA 4E0DA 4WXWA 1NH7A 2LQ8A 1X9MA 1VHIA 1VJWA 2IRUA 3R27A 4Q2MA 4X4SA 1NK5A 1KR4A 2BOPA 4H4MB 2GV1A 1N36J 4C8OA 3I0SA 1NXIA 3AB4B 4JYAJ 1PJ5A 1U45A 5D0EA 2AV5A 4ZPCA 1EQMA 1OIAA 1S6QB 3QSIA 2A3JA 2XSJB 3UVJA 1DQ9A 3OHBA 3C6TB 1RTHA 3BZQA 4DL2A 1YBTA 4KGMA 4WBFA 3RBEA 4X4OA 1R8HA 2DNYA 9ATCB 3PNIA 1QSYA 1IJEB 2B7CB 5I3UA 1YHQS 1LWCB 4I56A 2N7CA 3W65A 3T41A 3WQPA 1S1TA 2W01A 1V9OA 3DI6B 3PG9A 4B3SF 1NK8A 1GTEA 2JFDA 3J7YU 2CVEA 2W8KA 4ETZA 4TLQA 1N32J 3PKMA 4KRWA 2XY7A 1RWUA 1Q8BA 2GVZA 3HJVA 2YX4A 3M8PA 3V6DA 2CPIA 3CNQP 1HLWA 1FCAA 2CQ3A 1REVB 2V63A 2XI2A 2JHEA 2CJXB 1JLFA 1HI0P 2XS5A 4FPIA 3TEGA 2XS7A 3RJMB 2VV5A 3AD9C 1Z2ZA 2DNQA 3VAGA 1PYSB 1RTHB 1U1QA 1WDDA 6FD1A 4ZHRB 3BGFA 4WWSA 3KK1A 2VODA 2RHSB 4PYAA 4Q8EA 2FHJD 2LKZA 3HD1A 2QEXS 1VRTB 1LWEB 2CPJA 2YX1A 3M6UA 3CJ5A 1VQSA 2ZVIA 4F26A 4I6WA 5EDWA 1JJ4A 2UVVA 4NXNJ 4QYZK 2WOMA 2HURA 4M1KA 3THPA 4N5SA 2PMZD 1T03B 4WE1B 1KKHA 1S6UA 5EGYA 2V4JA 5KFTA 3JYTB 4NASA 5H1SV 3CULA 1D9DA 2Z30B 4J9SA 3IRXB 5IFMA 3DLBA 4FYXB 2ZFHA 3V6JA 5DGAA 4KC5A 5IT0A 3AJ2A 3V5RA 1RU1A 3MAHA 1EZZB 3T3FA 3EE3A 4DHVA 3LP1B 1FKOA 1S6PB 3PW0A 5KFIA 4QU6A 4OZ1A 4K4TA 1N48A 1B64A 2BJDA 5IT4A 4CM0A 3ZTQA 4U8VA 3B8HA 3C14B 3GFXA 3I5AA 2VFRA 3SQGA 3MM8B 3BDEA 4NPOA 4CNYA 1NHVA 4H4MA 3JSMB 3PO5A 2V0NA 3UR0A 4ALZA 1HNIA 3Q2SC 2VG5A 4BBYA 4CQ1A 4JV2A 1HA1A 4LSLA 1N5YA 3DHXA 2HHPA 2BE9B 2DK2A 3DN9A 1HBOB 1WG1A 4M5JA 1FJCA 4AXJA 3OVAA 2I1RA 3R5AA 2RF2A 2JLEA 4LRCA 4OV1A 4DN0A 1J5EJ 3BQ1A 3ZTRA 4F36A 3AY0A 1S6PA 1MROB 2VF3A 2HFOA 5KG5A 1JXEA 3JSBA 5KFXA 2DRDA 2UVRA 4C8KA 4M5DB 4OHXA 4M5GA 1O5JA 4FYWB 3G4SS 2IFXA 5MLCV 2HAIA 1RUSA 1TKTA 2UV8G 4YB1P 2OIHA 1T11A 1VMBA 3CJ3A 3NOGA 3RTVA 2MXYA 1U0HB 1N33J 2CUYA 4DJBA 1XTZA 4U9RA 3G6XA 1F5BA 4DF8A 2CQIA 3CSKA 4F4XA 2MB0B 2VG7B 1NO8A 3OPKA 1YK9A 4KBIA 3MR5A 2C3UA 3EGVA 3PACA 3UR3C 2DITA 2QLBB 1V5VA 4LSZB 4X65J 1SJFA 2HHXA 3FGVA 1TZ0A 2HLUA 3A8JA 4CO5A 2HVZA 3FUYA 4GKJF 1SJ4P 3NKYA 4A8WA 4DZ6A 4QBUA 3HT0A 2BE7D 3BSOA 2OI2A 3OR2B 4PWUA 4YS2A 2F9DA 1PCAA 1N6QB 4K50A 1T3OA 1PBAA 3M8PB 3OQ2A 2QA4S 1RABB 5F0WA 2Z56B 1LK5A 3K5OA 3VVUA 2XCAA 5IM0B 2RDJA 4JOUA 5K14B 3BO3A 2CPXA 5AJ3F 4M5NA 2FLNA 3RZAA 3QNWB 3VQTA 3CO0P 4Q44A 2APOA 2Q3PA 3GYNA 2VQFJ 2C2NA 4ED3A 2BR0A 4DL6A 4N41A 4BWMA 4ICLA 4NE9C 3TZXA 2JH3A 5KG0A 2KM8C 3KJQB 4GVBA 4ECQA 3RRGA 3BKTA 3QAUA 2DD8S 1AA1B 1B0TA 2EBGA 4OZLA 4P9SA 3Q23A 1PC4A 2EG1A 4H4KA 1M5PC 1PIEA 3ITHA 3N5BA 3TR5A 4A48A 5J2MB 1MWYA 2MQLA 3MFIA 3GQCA 1Q82T 1HHQA 2GHVC 2JOQA 4P75A 2QA2A 1YI2S 3BDPA 3U7JA 4CLSA 4TVAB 3IBFB 4U7UK 1WF2A 1S0OA 2E5IA 2XEXA 1F60B 3KOAA 4C9DA 1J5EF 3NLCA 4NRTA 4USKA 3V4MA 3MF5A 2ZH5A 1HHSA 2FJAB 4WE1A 2CZVC 5HAOA 4ERDA 2ZOMA 2HQCA 2XY6A 3W3SA 5F8IA 4IH6A 1PC5A 2YH1A 2NR0A 1K0TA 5BYSA 4X4TA 1T95A 3PVXA 4YB6A 3ENQA 2R7VA 1M0SA 1SH0A 2BV3A 2AEMA 3EJMA 1XWLA 2PA3A 4O3NA 4AE5A 2N7YA 1WUUA 4JI8F 4DSEA 2FJWA 5HVHA 2PI4A 3GE9A 4DR6F 2YKNA 3FNNA 3MM5B 4FF4A 4LR7A 4HI1A 3BSNA 1D8YA 5J2NB 4DUZJ 1SKSA 2KO1A 4YHHF 5B0BA 4ZIVA 3CWJA 3W9IA 5L38A 3W5XA 4DV4F 2AU0A 2E29A 2GVZB 2CQCA 1T9YA 4ZPDA 5HMWA 3HJFA 4QYRA 4JI1J 2ZUAA 4R5PB 4CLLA 5DG8A 3MUTP 4K59A 2M3DA 1VQPS 1ZETA 4NLVA 5CA5A 2LU1A 2JC1A 2E7VA 4Q0BB 3OSPA 1FWLA 3BBCA 3OR2A 3PW4A 3R1HA 1CPZA 4ZS6A 4CO0A 4ZVPB 4E2FB 1SV5B 1F2GA 4IRKA 2QFIA 3E01B 2Q43A 2OMOA 3Q8UA 1X7VA 2GS8A 2Z2ZA 3F41A 1UTAA 5I3PA 1HNZJ 2D41A 2RB7A 3Q8VA 1XNRJ 2HQ3A 2DO4A 4OZ0A 2VDIA 4DU7A 1XBWA 1G6BA 2B4VA 2QLXA 2HVEA 5A76A 2FHKA 2RNEA 2HGNA 3PJXA 3W66A 3MD3A 5F8MA 3OLBA 1DTTA 2C42A 1YJ9S 4DR1F 1GMUA 3DYAB 3W8GA 1VQ5S 1C0UA 3W61A 1S1VB 2EFOA 3VQSA 4DR5F 3GFHA 3K59A 5H9EK 1F9HA 4I6YA 2NLWA 2B3TB 4UF4A 1TVRB 2BUNA 5HJXA 4CCHA 1CVJA 1FHTA 3M8RA 2M4MA 4IOBA 5HN0A 3JAMY 3PRDA 3UDVA 4DL3A 3DKDA 1BQMA 3MHYA 4LFBF 2YNHB 2BMBA 4WK1A 3VCDA 2MPUA 2JEFA 2GJIA 5L1KA 2KU7A 4JI2F 4DG1A 3EPIA 4RU2A 1N52B 3KLHB 1LOUA 2WVFA 3WX4A 1WNEA 1FRHA 1H2VZ 2IJRA 2ASYA 3OTDA 3KLEB 1ZM3A 3AQOA 3IO1A 2YKQA 1AUDA 4QR2A 5E0OA 2QLJB 3JTNA 4NLOA 3Q8PB 2DRBA 4IQXA 4R0JA 1ZOTA 5J1EB 3EXCX 3TRGA 3IP0A 3J7ZT 2ATLA 2AJQA 1FF2A 3UDEA 4A46A 2LA4A 4C8YA 2B9WA 2IRXA 2UXCJ 4F8RA 1S1VA 4LJMA 2EKYA 3GG1A 2HQGA 1VK3A 5AXKA 5KFWA 1Y7PA 1RI7A 2F8EX 2J7UA 5LJ5Y 1XQIA 3QBCA 3MWBA 3GIIA 4NCAA 4OX9J 2MLZA 5GVQA 4ECUA 2E5LF 1LWXA 4AL5A 5E3PA 4NYPA 1X5OA 1Y0HA 4N7TA 3NGDA 4LT6A 3QJLA 1E6VB 2EC2A 1RAIB 4IDKA 3J7YI 2FJVA 3ULHA 5HI7A 1S7IA 2F8HA 4NZ0A 4LBIA 5D0HA 5GAHI 3CCES 4TU9A 4DSFA 1JLCB 1EIYB 4DV0J 1PYOB 4NLRA 5M2PA 2HS4A 3C14A 1M90T 5D78A 1XIQA 2YQ3A 3PYDA 3TA1A 1BUXA 5CAAA 3HKWA 3I5CA 2HHUA 2HHQA 1EP4A 1SJ3P 1OPIA 1KC8T 4F4AA 1F9FA 3HZEA 1QD1A 1S4EA 3PJWA 3R6GB 3UWTA 5B0CA 3SCIE 2W9CA 2GGPB 1A9NB 4QIWD 1O0PA 4ANDA 2DH8A 2WK4A 2X3DA 4HDGA 4NEYA 2MGZA 3OL6A 3KK3A 2D3ZA 2FPHX 4DV5J 3VV2B 2OSQA 4DR7F 1GXTA 3JB9k 1OMSA 5LSRA 4B3TJ 3MOZA 4PABA 4ZLNA 1QUPA 3KK1B 3HSGA 5J1PA 2HNYA 1FDAA 4IG0A 2Q6BA 3CCJS 3X1LB 3IAS9 3M2RB 4LBPA 5D4OA 3QAEA 2A2DA 5BYRA 1MMDA 5IWAJ 4OHWA 4ZPTR 1IKXA 1VQLS 3KJFB 3HI9A 4OYOA 5LM7E 3T9ZA 4AUKA 3O44A 3NP5A 1N5VA 2LXFA 2JWNA 2EFQA 2HGMA 2PEHA 3DNCA 3GILA 1WHXA 3A8EA 3BPDA 2J0QD 5ETTA 1EETB 2POKA 2C3PA 3TVZA 5A8RB 1Q7YT 2MZRA 4U8YA 2BX6A 3TI0A 1VGYA 2M70A 4EZ9A 2DHHA 3N28A 3TNVA 1LWCA 3LALA 5EUHA 2OO4A 3QQCD 4QWBA 2ROPA 1ZM9A 3RW7A 2IYGA 4ZCKA 1WTFA 3E51A 1RWOB 2V2ZA 3K57A 2FGCA 3TZZA 4EYIB 1FWPA 3IG1A 5I42A 4MAKA 4MH8A 3P96A 3HD2A 1UFWA 2UUAF 1NPPA 1FKPA 1M1GA 5KFJA 5AJ3J 4PEOA 5B7WA 2EKNA 2RD5C 5HVGA 4M5HA 4KGZB 1ELOA 3UD5A 4DPTA 1G7CB 1P6TA 3TX8A 4Q5VA 1MW7A 2EK6A 4Y0FA 1S77D 3BS9A 2FHOB 1CJKA 3VHQA 5HMZA 3RAXA 4IRDA 2HFVA 3R7SB 4F0HA 3H0PA 3QT5A 2KZMA 1JLQB 2FY8A 2QSFA 4DI6A 2ZE2A 5KFCA 1J27A 3KG4A 2R2SA 3D3CJ 3M7VA 5HROA 4LMZA 3DRPB 3ONQA 1W25A 1NKCA 4B3RJ 1VC6A 2W4DA 4MMOA 5CD4A 4WKRA 3RB4A 2CJ9A 3BKUA 3IFEA 3EZ5A 3L95X 4DR6J 2B51A 2ZWPA 5SZTA 2IC3A 4X4PA 2QV6A 4O44B 1EB0A 4PZVA 5DG7A 1X31C 2E7WA 1X4BA 2Z2LA 3A3NB 2MKCA 4ZJQA 4DX8H 3KK3B 2VBXA 1OY9A 1UEKA 2HHWA 2GZOA 1BXNA 4GC6A 2RRBA 3ZZUA 1SKRA 3V6HA 3NS6A 4G3IA 1JLGB 5ETLA 5B0DA 1N5TA 2UUCJ 3R6LB 2MQ8A 2B6AB 1DQ8A 3MMJA 4LVNP 1TL3B 4M5MA 3TVYA 2AYGA 2V2QA 3FDSA 3NMRA 1VQYA 1YLXA 5HJYA 3W2WA 1FRLA 4LF5J 5A8KB 3F56A 3PHEA 2LCWA 5B0FA 1CEZA 1BWVA 3ZZ0A 4W98A 3L3CA 2ZBQA 1AFIA 3HP6A 2RU9A 1URNA 1C1CB 3GFYA 4RLEA 2B4UA 1NB2A 4XTTA 3PCOB 3UCGA 4LF4J 3P8BB 2CNOB 4LQ9A 2C2RA 1NM2A 1XR7A 3HFKA 3K5MA 4RX6A 5CYQB 2OFGX 5KFDA 1M5HA 2B9XA 1BD6A 2J8SA 4ES1A 3PKYA 4OHYA 2HK3A 2L48A 4TN2A 3PX4A 4W90B 4B17A 2VOPA 2J7WA 2RKIB 2IDLA 2WVDA 3ZTSA 1H7XA 1XMBA 5A0YA 4A8MP 1X4DA 2E1RA 3SEOA 2W7PA 3FVYA 1WEYA 4C0OC 1KEKA 2YH0A 1PO6A 3HVRA 2MHEA 2V9KA 2QJ3A 3QMQA 3EGZA 2KFNA 3E3XA 2G0CA 4C7QA 2QL7B 3U1MA 3NBPA 3RBZA 1C1CA 3C66A 3MCMA 2ZH2A 2CJYB 1IKYA 2D7SA 2EFPA 1F2HA 1JB0C 4I2PA 3EYZA 1Q4RA 3ZZOA 3D6HB 4K8RA 5DQHA 4DS5A 3IM9A 1F3FA 2DNRA 2FVSA 2E9RX 2E9TA 4WYLA 4NYZA 3AA8A 4GC7A 2V9WA 1CJUB 3DXBA 3N9UC 5GMKa 3CDBA 4A8OA 3DYAA 4BC7A 2KFZA 4WZMA 1H98A 3M30B 1E6YA 2WAQD 3BBFA 1FE4A 3CDEA 4ANEA 4OYBA 2O01C 4YB7A 1UZHA 1ZM2A 4FS1A 2W2OP 3IWXA 4GO7X 2O3DA 3RBDA 1RT1A 1S1UA 4LF1A 2BBEA 4NI2B 4O3OA 3MTJA 1TL1B 3C16B 1FFSB 5C24B 3UN5A 1KQGB 1X5PA 2A6MA 1YJNS 2XNRA 2LDIA 2HFZA 2FHJA 3OFGA 1LWEA 2KXFA 3ENVA 5E3AA 1KTQA 1RGVA 3CJRA 4M5IA 2RRAA 2XYGB 4NEZA 2V67A 1NDLA 4KGXB 4USVA 1KQSR 3LGNA 1D9AA 4WYWA 3FK4A 3QFHA 4ZCLA 2ZHBA 1HQEB 1RAEB 4ICLB 2H54B 3EGNA 3FEXB 1YKWA 2FDNA 1K9MT 4HTIA 1IR2A 1KHVA 3FBCA 3CCVS 1YTYA 4IRCA 4JI7F 2I8EA 4X4VA 2XG8A 3BBBA 5D15A 2X51A 2XMUA 5HBMB 3CC4S 4DFJA 4GKKF 3PJ9A 2ZOFA 2PMHA 4PXCA 4DMZA 2KM8B 3MUMP 4ZK7M 3HK2A 2HWIA 3AD8C 4K0KJ 3I87A 4KYZA 1JKHA 1B0PA 1TV6B 1YZ7A 2CRLA 2E1MC 2Z4PA 2ZBIA 4WPAA 4J9RA 2DGTA 2OAUA 1FJEB 2E5LJ 2DB1A 2MQPA 2R8JA 1EETA 1IWAA 3CJSA 2UUTA 1RCXB 1XJWB 4A8YA 2MLXA 2ZNYA 1HWIA 2AIRB 3AOBA 1BC6A 2PE8A 1VS3A 2DGUA 1YIJS 4EBCA 4ELUA 4B3TF 5K8MA 2W25A 5SUHA 1Q8KA 2OMLA 4KGKA 5LT5A 3Q8SB 3KHRA 2XZWA 1SL0A 3FZ2A 3I0SB 2ZH7A 3H98A 1VQ4S 3BQ2A 2I9SA 2JEGA 2X7IA 1NSKL 3R2DJ 4XPCA 1ICEB 5H9FJ 3NGSA 2FD2A 1R0CB 3OVSA 1UJ5A 4OFZA 5GADU 3CMAS 1N88A 1UL3A 1DLOB 3CPWR 3GJSB 3KHGA 1QUVA 2JDJA 2ZC3A 2RQ4A 5DQIA 2E7XA 3CCSS 2KXHA 1VJQA 3LGMA 4MK8A 4DR3J 2AYBA 3U1NA 1RT4A 5C42A 1KD1T 3WC2A 5DS7A 1N54B 1WG5A 4CLFA 3DFEA 1NEEA 2WSFC 5I3UB 3IN5A 3HHLB 1RWWB 1JKHB 2CWXA 2GQQA 3MEGA 5IXUA 2R7XA 4QR1A 4HH0A 1PJ7A 3ET6B 3M1VB 3A1YG 4YEAA 3CUNA 1CJTB 1KWMA 3UQSA 2GHWA 4ZVUB 4IDKB 3DOLA 4BLGA 4X84A 2R7OA 2FJEB 3BV8A 3OV7A 2XB2D 3FEYB 3LQVA 2A18A 3CMES 3G9CA 1FRIA 2DT9A 4NZ7A 4CTAA 1FX4A 3F73A 4IUFA 3TA0A 3CMQA 1KBRA 1LW2B 1TL5A 2IPOB 3AA9A 2DCUB 3GR1A 1FXRA 1HWKA 2CWKA 2ZDPA 3NAIA 3SQGB 4WP9A 4CLZA 3IRWP 3W9JA 2FLPA 2R8GA 3W7BA 5L1JA 3HVAA 1UVIA 4PQUA 3DRXA 5FD1A 3M9OB 3OXGA 5A2QY 4X4NA 2B7BB 1HL6A 4NX9A 4ZIWA 2KVQE 4ZOSA 4DV1J 4X64F 3I6PA 1PGZA 3O2IA 3UNGC 4DV0F 3T5LA 1P1LA 3WC0A 2QRRA 2YNHA 3JQKA 4HACB 4KFBA 4M5DA 3M6XA 4RBTA 9RUBA 1AZSB 4ECYA 3I0RB 1BGXT 4B3OB 1GMWA 1WOSA 1DHMA 2BEFA 2L41A 4O3PA 2MKYA 4NYOA 4AXIA 3D6MB 1ZA1B 5KOXA 3D0HE 8ATCB 2HHTA 2KRRA 3FRYA 4RW8B 3B54A 3QSYB 4X64J 2VB6A 3DOMA 3MCOA 2CPYA 1VIOA 2LLZA 3CB4A 3F0NA 1RT5B 2BOAA 2F5GA 1YZ6A 2ZITA 3HSDA 5ETVA 3PHTA 4IO1A 2V8HA 3BREA 3NOCA 5M2RA 3TUJC 5KFBA 3OLAA 2GIQA 4HTJA 4KHMA 5HATA 1Q16B 4A8QA 2NXCA 4P72A 2D1CA 2Q79A 2PN6A 1OQ6A 1GK8A 4KKOB 3S01A 4DPYA 1HARA 3HSZA 4J7CA 1I5OB 2VPYB 2AX0A 5LMNF 4OJHA 4G1QB 3VTIA 3SI8A 5KT3A 4WFNQ 3Q24A 4LIRA 5D4NA 3DRYA 1X9SA 3FMWA 4DV1F 4FYVB 3BYRA 3V81B 3QLHB 3VAFA 5DDPC 4XPEA 1U6ZA 4B3SJ 4K4UA 4HR2A 4WIQA 4ED5A 5F8JA 3H5XA 5H9FK 3KLEA 4UY8T 4PUOA 4HHUA 1V3RA 1WC1A 4DX5A 3HHNB 3HSJA 2HQFA 3VWSA 1S9GA 2VBZA 3Q83A 5F8NA 5KG4A 2CNLB 2D3UA 2KXNB 4L3KA 2NZCA 2I0XA 4ENOA 2BYCA 2ZM6J 3DMJA 1EJ7L 2DEJA 1NPKA 2ERRA 1VK8A 2CQPA 4LIWA 2R7RA 1CQMA 2OFHX 2GAGC 3GSDA 5ADZA 1S9FA 5RUBA 2IMOA 4C98A 1VQKS 4JI4F 1VYAA 2WSEC 4ED4A 1C0TB 5BR8F 4L3NA 3T1HF 4ZJOA 3PRVA 2DNMA 3DLKA 2RVJA 5KFFA 1HI8A 3E8OA 4HT7A 3N4WA 2CQ4A 4UQTA 3M9MB 1S49A 4KTQA 5KT6A 1KONA 1Y5LB 2G2YA 1VQ9S 2OEKA 3H2UB 2P8IA 4LFBJ 2R2TA 4CH1A 4A8FA 4X62F 2VIHA 4PCQA 3HZGA 5HROB 4I7FB 3TP2A 4MFBB 4P6QA 5KFPA 2IA6A 4JI4J 2GX8A 4O44A 2AGOA 2FVRA 2CPFA 2CYYA 2K3IA 4WXOA 2MSSA 4ED6A 2ZEJA 1TL7B 4KIAA 3C3LA 3MAAA 1N8RT 2IM2A 1N56A 4UZCA 4R0EA 1SXLA 1S99A 2YQ1A 4E98A 3CTRA 3KK2B 2Y8WA 2BANB 3IM8A 3UE2A 1FDNA 2LQJA 4FBTA 3B4MA 1F6TA 2DEIA 5B08A 2BKNA 3DI6A 2UP1A 3TO8A 1Y3KA 4YN3B 4BC9A 4FP9A 1CJKB 1NCLA 3QZ7A 4F4ZA 5EN1A 2GMLA 1CJUA 4DFKA 4DU8A 1H3DA 3WIVA 4OYZA 1K1SA 1WD6A 4I1TA 1Z4UA 3SFUA 3T6JA 5KFHA 2QO3A 1HQUB 2OPQA 5KT4A 3GYGA 1HWLA 3VAKA 4D3GA 2XHCA 4L75A 2V94A 1S6QA 4NLDA 3UVJB 4EI2A 1EQ0A 1X4AA 2F1FA 2DRAA 4WIIA 4NRUA 2FVPA 1TU0B 1CS4A 1RHRB 1N0VC 2NCKL 4PG7A 1RAFB 3GIRA 3TZYA 4DFMA 3OXFA 2YKMA 2DR9A 3MAAB 3P5BP 2K7JA 3UN2A 2W8LA 3CJKB 1MWQA 2GJ2A 5E2QA 5F8LA 5DRKA 1N36F 4PUOB 2UUBF 4M5KA 1S10A 4OLPA 4YHHJ 1LFWA 2WSCC 1GTHA 2P9CA 4BWJA 4B02A 3T5JA 1UVNA 4USTA 1YRTA 2AQ4A 1UZDA 1KP6A 3H5YA 2KJWA 3E2EA 2LFVA 3G86A 2PA8D 1FVSA 2CQGA 3CD5A 1RWXB 3EVWA 4ECTA 2C22A 4JI0F 4ZDNA 5K8NA 3GPAA 4C97A 2VOOA 1CBKA 2ATCB 3QPIA 4EYHB 1SBRA 1V3ZA 3H4BA 4CH7A 3KLIA 3NRBA 1TR0A 5D0RA 2NXUA 3PW2A 3MM7A 2G4BA 4K4VA 1DFDA 4IYQA 1T8EA 2XCPA 2J5AA 4ZKAA 3DDKA 1L3TA 1U09A 2YKAA 2YWGA 2CQ1A 1RDRA 4PR6A 4ED7A 1VQOS 1KLNA 4FF2A 3SFGA 3QRRA 3H5SA 2LMIA 5HO4A 1Q0NA 4F3MA 3UCUP 3NNCA 2G1HA 1HD0A 1S0NA 4CO1A 4PWDB 2QIFA 5HMYA 1KFDA 1HBUA 2DXFA 3P5TL 5FDLB 3M8QA 1J5OA 4NCGA 3JSRA 2Z0GA 5C25B 1KN6A 1WJ9A 2OD4A 3IA0A 4IFVB 2M88A 2XWYA 4KH0B 3CT9A 4P7TA 5ETNA 4WTYA 3GWCA 1JLBB 3C6UA 3PZPA 2BABA 2VA3A 4FKYA 1RYSA 1EKSA 1YJVA 2BXJA 4EK2A 1I94F 5IC6B 1X5TA 5IOLA 3VGSA 3EUNA 4JI0J 4DOZA 1QTNB 1S97A 2AF6A 1RAHB 3JSYA 1OQ3A 4UOFA 3K7RA 4UOHA 2IVYA 3FRZA 5HLFB 1JK9B 5CZXA 1HFEL 1RTJA 4E8UA 1FFGB 1RT2B 5CQGA 3RG6A 2Y1IA 2HLTA 2QSWA 3IMQJ 1PYTA 3V4IB 4CP5A 3OD2A 3SDEA 3ENWA 2BE2B 2KT3A 3BEGB 3IS9A 3WBZA 3BGRA 5K8OA 2DNNA 3B78A 2H1YA 5T14A 3THVA 2C2EA 1XNRF 2V6AA 2XGPA 1YQHA 6AT1B 1SKUB 3A3PB 3US5A 3CDAA 2HNZB 3UI3A 4IH5A 1CJTA 1NDCA 4DUZF 1MN7A 5AE1A 4TU7A 1JNRB 2V50A 1BMQB 3DLEB 3J7Z5 4G1PA 1QAXA 2ZWOA 4NXMJ 1M1HA 1MROA 3W60A 1RT7A 3AOCA 4K2JA 2RS2A 5AXLA 4QW9A 1FRKA 1RLCL 3S6EA 2CNNB 3DOKA 2M8DB 4DV5F 4Y6IA 4DR7J 5A6WA 1RA6A 4DQQA 4Y2AA 2RRNA 2IM0A 2RT3A 3DRSA 4P52A 3BQ0A 1C0UB 1RHUB 4FYYB 4OJ1A 3EWGA 1OY6A 4RPFA 2BJ3A 2OLWA 4L6V3 3LTOA 3TYTA 1N4LA 1S76D 3WX8A 1X4HA 2M8HA 3HPOA 4PYDA 1U8SA 4C4WA 3D3BJ 3FQLA 3MM8A 1X5SA 3TOQA 1YJUA 1TP7A 2IBKA 4BS2A 3HHEA 1FKPB 2MEWA 1H2TZ 3HKZD 3QT7A 1JLFB 1QVGR 1M5OC 4F3OA 4JI1F 2VG6B 4CLPA 1NH8A 4ILRA 5KFAA 3LP2B 1HKAA 3DLGA 5KFEA 3MM6A 2LQ5A 1JJ2R 1VQ8S 4XO0A 4K0KF 1XK8A 4DV2J 1KOHA 4ID8A 3K8WA 5LSLA 4O3SA 1C4CA 3CE8A 2GGPA 5IV4A 4KT0C 4CT9A 2J7KA 2YWFA 3MD1A 1EHWA 2X1BA 1M5SA 2HRUA 3L4BC 1S4FA 4DL0C 3WZ0A 3KUHA 4LF7J 5KT2A 1UJ4A 3I9V9 4Y34A 5LXRA 3QLHA 1I94J 3I32A 2Y8YA 3QT8A 3M8YA 4D3HA 3RR7A 3V2UC 3LO3A 1GX5A 3DGPB 4FPRA 5HANA 5EWFA 2MHNA 2ZH1A 3VAJA 1FKAF 1R31A 2WBMA 2V69A 2G0JA 2RH3A 4P2XA 4FBUA 5KG6A 1RB0A 3D0IE 3UDLA 3I55S 1BLUA 3HXMA 2H5JB 3T1HJ 4KQZA 5I4MA 3VAHA 1X0PA 1FD2A 4WU2A 2I6WA 3D67A 5DETA 4DR3F 3KLFA 5J2QA 2IY5B 1WF1A 2K1RB 3MTKA 2HK2A 3LW5C 1REVA 1LW0A 4X62J 5C25A 3QRPA 1VQMS 3HHLC 2LQBA 3BM7A 3VR1A 3R7BB 2B4OA 4C0HA 4L76A 2HZAA 1RT7B 2YQ0A 3MEEB 2V68A 3KNGA 4K4WA 3PW7A 4A8XA 3FEZA 5HBMA 2ZH9A 4X65F 3M6WA 4B3MF 1KOOA 5B09A 2BW7A 2W7AA 4M94A 1GXUA 1UJ6A 3TQ1A 3DLJA 4IFYA 1W2BR 1NRKA 1U02A 1T02A 3FMBA 3FBFA 5F9NA 4QWDA 1Q8LA 4LRDA 3GV7B 2HBRB 1T94A 3P3DA 4MK9A 1FFWB 1KLMB 1M5KC 3QFWA 1HW9A 2LA6A 4EBEA 2ASJA 2F3JA 4Q2LA 1GXLA 2HG4A 1ITPA 1JLAA 3N0VA 4G65A 2DNLA 3RRKA 1FK9A 4ED1A 5KFOA 4MKYA 1AFJA 5DLGA 2GHPA 2XULA 3V4IA 5ETRA 1RWPB 3IC1A 4KHPJ 2GC8A 1X4EA 4USUA 2J6SA 2YWEA 4URQU 3C16A 2OPSA 2AYEA 1GAOA 1JJHA 1S6OA 2AW0A 2F4FA 3BR8A 3R5GA 4H4OB 1S1UB 3HHDA 5KFVA 4RW4B 1N33F 2DY9A 2GCFA 2DHAA 1U1LA 4LSNB 2DYAA 1H72C 1SH3A 2HAFA 2DNKA 4PAAA 3K58A 3D0GE 3P6YC 1RISA 4PWDA 2YBVA 3MMAA 3N6NA 2DJWA 2PO4A 4BHQA 4RW7B 1TUVA 5FLXY 5KG1A 3M8QB 2GVDB 5GAEU 1BQMB 2MSTA 5CYMA 2H65B 1RT4B 2XZDB 1RTIB 3R8YA 7AT1B 4ATNA 3SV4A 2E1PA 4NLPA 5A8WA 3I56S 3GV8B 2UU9F 4DPOA 2UXCF 2BJ1A 2C1EB 3PR5B 1OSCA 5KFKA 4XDDA 4IKAA 4WFBQ 3TAQA 3NBPB 3QJPA 2AT1B 2E5JA 2HNDA 5A8KA 2XZTB 3KG1A 1RU2A 3QO9B 1XNQF 1TKTB 1YRUA 1U24A 4F3QA 5LOQA 3BSAA 4DV3F 2XMMA 3L9ZA 5IT9U 1BQNB 4RWXA 4Y2KA 5LXYA 2DR6A 3OSNA 1T7PA 4ZPVR 2DH7A 1U4BA 1IM6A 2HBZB 3TUZC 4PPZA 2HHSA 2EW9A 5DJBA 1FI4A 4B9LA 1FEHA 2OD6A 3D2WA 1VC5A 1JIHA 2M7SA 1HBNA 1T9TA 3D9BA 4A4JA 2WB4A 4USJC 1U7LA 2I5JB 3IBCB 3HF5A 3M32B 4TNOA 3EZUA 4WTOB 1N5QA 5KFZA 1WC3A 1EARA 4X4RA 2A0FB 3UPFA 2NXEA 4LSLB 1N5YB 2CPEA 2L08A 1UFKA 2VG5B 1S1XA 4J91A 3MUVP 2ZE2B 3V6KA 2PEBA 4OZ2A 5CHCB 4C3MA 1HR0F 1U6BA 1YJRA 4J5OA 2KTQA 4O23A 3DM2B 3LPEA 5E3RA 3PXGa 1WF0A 1R0AB 1VCTA 2UXDF 1Q79A 1C4AA 1TL3A 3KKFA 1BWEA 3UD4P 3MM9A 3O3LA 2PFFB 2QL9B 2VFUA 2FLLA 3MGJA 3D1HA 2G0IA 1VRUB 4ES3A 2CG4A 3J81U 1RHQB 3IXQA 4JI5J 2OTJS 4QW8A 5HK4A 1OYEA 1T9UA 1RAOA 4OL8A 5C5JA 1KDNA 2UVUA 4MIAA 4EMDA 4CYUB 2XO6A 3P45B 3OTBA 3AH6A 1WG4A 1WACA 4ANCA 3LP2A 2BRLA 2C3YA 4M63A 2BW2A 3POTA 2C3MA 1NJWA 3NAHA 3I31A 4EUVA 4B9VA 2DHGA 2MZTA 5JJBA 1TL7A 3M8WA 4JV1A 2J76E 3ELHA 2I5JA 1WC0A 2YNFB 3M32A 2QA4G 4TYAA 1N5SA 3ZTOA 4CRJA 3K5LA 4B3MJ 1HYSB 1L3VA 2V8PA 4MIWA 4IOCQ 3BPSP 4ZITA 3DU6A 1K47A 2ILYA 1KVKA 2UUCF 4F04B 1Q53A 2IAJB 5DZ7A 2F4VF 1R8BA 1RXOB 3JTPA 1QDUB 4WZQA 1Y5IB 1I3OB 2CQDA 3VGUA 1G4CA 1BHNA 3HHLD 2IJFA 3OL8A 1QAJA 4ZJLA 1CG2A 3GU0A 3JS9A 3NCPA 2N3LA 3DGVA 4P7VA 2FZGB 2Y0SD 1BE4A 1ROFA 1YG0A 3M2VB 4UTGA 1OWXA 3DM2A 3EM1A 4MKAA 2WCXA 1L3KA 3M8ZA 3NNAA 1W7WA 2M52A 2M9KA 2VASA 2G9OA 3LAKA 3MEDB 1ZA2B 2J6TA 2RMLA 4KFBB 2Y1RI 4C3LA 2W9BA 3R5BA 4RUCA 3QIDA 3THTA 1RWMB 2JX2A 3RW6A 4PXBA 3IBWA 1F5AA 4H4OA 2LVWA 1IUJA 1RBOB 2ZBRA 2FYXA 1HBMA 2IM3A 3DRRB 2PT0A 4JI7J 3RAMA 5LJ3Y 2OUGA 3M2UA 1ZPVA 3D6FB 3SCJE 3EX7B 1IKXB 3VGTA 1GT8A 3KNAA 2FTRA 2XI3A 3C6TA 5CYQA 3R5DA 4J37A 2R2RA 1VQNS 4OI6A 2Y1JA 1HNVB 3M2RA 4B9SA 2VG7A 2WVEA 1ZAWA 4JUZA 1T05A 1SPBP 4GKJJ 4C48A 5BXIA 5L1IA 2WBRA 2NSBA 4RNNA 4DUYF 2W4PA 2ZJQQ 1UWBA 3Q86A 3TQEA 1RBAA 4IG3A 3JSMA 2HBQB 5GMEA 3GG0A 4NMXA 1NJYA 4TXSA 4QWAA 2YTCA 3P49B 1DTQA 3ETMA 1RTDB 4NXNF 2X1AA 3DOKB 1FTCA 4H4KC 1CULA 2YNGA 1T9VA 4NLQA 2M5YA 1AZSA 2HIYA 3OFFA 2KH9A 1SQEA 2Z57B 4OMFG 3H4DA 1LQ9A 3NL0A 1APSA 2F7VA 1JXLA 5BR8J 2HMIB 2JEIA 2J0SD 4C6AA 4I69A 3NS5A 5D8HB 1WKLA 2D74B 1U6FA 3KLFB 2RS8A 5J2QB 1RSCA 3H20A 1RKJA 3D68A 3TZWA 4KH1B 1C2PA 3DDIA 3SXLA 1IBMF 4F0KA 1K44A 1FA0A 1UEUA 1TKZB 3AXKA 4HHHA 4F7VA 1RBLA 3VF0B 1OSDA 2G2ZA 5KAKA 3U27A 4Y2MA 2FY1A 1Q95G 4ZP9A 1FEEA 5B0AA 2DNHA 2YNIA 3C8YA 3GCWP 3TVKA 1VOMA 3GCXP 2IA0A 1RT2A 3WIUA 2B9YA 3A8KA 2UUBJ 3G87A 4Z7YA 3UN3A 5J1EA 3QGGA 4YDDB 1FX2A 2GW8A 4IR1A 2GO9A 2H4YB 2RJZA 3M2UB 1R43A 2BACA 3K17A 2DR8A 1FKOB 1WSRA 1REGX 5F3TA 1Q5YA 3DLHA 4DSKA 4RJVA 3ZZPA 1NHKL 3GV5B 2HWHA 5K5MA 3CDUA 4YR2A 1T9XA 3OTCA 4DLEA 1DARA 1Q1KA 4USIA 2DGXA 3V6DB 3ET6A 1QAYA 5K20B 1LKZA 1D0EA 2H51B 3CO9A 1VLOA 1CULB 3HHLA 4UUWA 5U47A 5ETPA 5D3GA 2FJDB 3BO2A 1RZMA 1U49A 3O6QA 5MAOA 1SQGA 5I3QA 1R27B 4PPDA 5LMUJ 2X3GA 1SL1A 4DXLA 1QY7A 2K1RA 2UUAJ 5G0RB 1RA7A 3ILJA 5J1NA 4YR0A 1RK8A 2AGPA 4B3RF 1RWNB 1SUQB 2VPZB 1JJCB 1NSQA 4TY8A 3AAWB 3L09A 3ILLA 5JXSA 4DQPA 3FSXA 2YPZA 1GX6A 2XSJA 3MCNA 1FRMA 2LXUA 1D9FA 2IDEA 1FTRA 1S9EB 3FBEA 3MMBB 1M5VC 1GNKA 4L73A 1R8CA 3UFCX 1LK7A 2LP4A 2ZKUA 2AD9A 2HW3A 3L7OA 3GIJA 4FKXA 2J0XA 3HO1A 4HT5A 3T19A 2IVMA 4F0MA 4Z37A 5KG7A 4LREA 5GAGI 3VAIA 3FZBA 4RW6A 1L5UA 3NCQA 5KFLA 2C2DA 1H73A 3UD3P 2VJUA 1QAIA 1FNMA 4I7FA 5EWEA 1P1TA 2ZZNA 3W63A 4ZVSB 5HL7Q 1VRUA 4YR3A 2DTJA 4YMEA 2H4WB 1IR1A 3W1YC 2BJ9A 4R25A 2MKJA 1TV6A 2R8IA 2BJ8A 2KYXA 3D6TB 3DLGB 1V6HA 2DHSA 2AZ1A 2VJVA 3DLEA 3OR1A 1ZBTA 5E3CA 1JLCA 4JV0A 3HMJG 4LFCJ 2YWHA 3J80Y 5J2NA 2VPWB 4QQBA 1VLYA 3BO4A 4Y00A 1UWAA 1E6VA 1KTVA 1S79A 1O6XA 4P71A 4DSIA 4RBVA 2U2FA 1JNZB 2VFTA 4XDCA 4USMA 1D1UA 1HQEA 3J7A1 4IOAQ 1G1XA 3OVBA 3GYXB 2OEMA 3CCWA 3HULA 2PFDA 3MFHA 2NXJA 1ZZNA 1JLBA 1XMOF 3R3TA 2R7SA 4QIFA 4RW9A 5GAEI 5L1LA 5IM0A 1NBEB 3LGHA 2XGQA 4F67A 4NCGB 1WSVA 4KR0B 2K7KA 4V19X 4DN9A 1U0SA 2W2QP 1RACB 1Y5NB 2NS1B 4NI2A 4RW6B 4YY3J 5C24A 5DG9A 4DV4J 1C1BA 5G4DA 1R89A 4QWCA 1S72S 2W2NP 2HYIB 4OX9F 2D3O1 4K4YA 1OY8A 4FF3A 1VQ7S 1HMVA 1RLDA 4C8MA 5D6GA 4URSA 2CZ4A 2MKSA 3Q8QB 4CI0B 4QOTA 3G71S 1WOOA 5FIIA 2XBPA 3OHAA 2HS0A 4LQ3A 3OTOJ 4Z2XA 3NGUA 2HNDB 2B4PA 2FB0A 1K8AT 1HWJA 4V19J 2E5HA 2VDHA 3KJVB 4UZBA 2RQCA 4B9NA 4RUBA 3TA2A 3NWGA 1FNOA 3OL7A 4R8UB 4WFYA 3N5FA 4NLSA 4OX8A 2GFFA 1RKIA 2W1BA 2CQ0A 4KGVB 2Z58B 3ZZYA 4NLUA 3BN7A 1I1GA 5EX3A 4I64A 4ID5A 5HQMA 3G96A 3LA0A 3LP0B 5HLFA 1T05B 4ZVTB 1S0MA 3HHKA 1UPMB 3IWLA 1IBKF 3D28A 2ZBCA 2PD1A 2FLOA 2O1PA 1NUEA 2K2PA 4F25A 4DL7A 3MECA 3X3UA 1QE1A 2JVOA 5DO2A 1FNXH 4QU7A 5KG3A 4BCAA 2GAHC 5BJRA 4HKQA 3RAQA 4LFAJ 1SV5A 3BSCA 4I2QB 3ZZZA 4K4XA 1T3NA 2WZ1A 2Q1LA 2Y9HA 3QRQA 1CQNA 4ECRA 4U6PA 2ZC4A 2AJ1A 5IS2A 4M8LA 1BQXA 2GIRA 4WFZA 5KFMA 3N6MA 3CJ8A 3TJ8A 1GH8A 2AJ4A 3D5MA 3GFZA 4ECWA 4P74A 4PQAA 4ZN3A 3J81j 1NPRA 3MR7A 1K0VA 3FCHA 4OI3A 2F4VJ 2HQDA 4MTPA 4HI2A 1YWXA 2XTJP 4DPXA 4IFYB 1B3TA 2DXEA 3DOMB 1P9QC 1KSPA 4FXDA 4DQRA 2MZQA 3OFHA 4ZLLA 4LF4F 1B7FA 4UY85 3LF0A 1XR6A 4KJIA 3H59A 2IYIA 1J2VA 5L46A 3MOJB 3NGRA 4X66F 3W5YA 4Q7AA 2EI5A 4ZPWR 5A8RA 2KB2A 4CM2A 1KVJA 1DTQB 3LUYA 1HMVB 2FUG9 3PFEA 4ZVHA 3BYPA 5IV3A 2HIQA 4DZDA 4DV3J 2HBYB 1U2CA 4C2MA 1ZTWA 1U1NA 4KO0A 1VRQC 1T03A 1UWBB 5ETSA 1R8PA 5A2QU 2CPZA 1UETA 2R2UA 4DS4A 4UOGA 3BGLA 3KHHA 2BRKA 1F1BB 4ZLPA 2JFKA 3Q0AA 2DVIA 2V8DA 2Z2YB 2ZVSA 1RAAB 3B6BA 2HNYB 5KFSA 4ECVA 2JEJA 2UZAA 1UP1A 3A4TA 2QG9B 2KN4A 2QFJA 4DDFA 2MKKA 1JLEB 2NSCA 2W2MP 7FD1A 3ILIA 4QYZJ 1R0AA 1RT3A 2D3OR 1RYRA 3UW1A 3CCRS 4LF6F 4O0NA 4QIVA 2N4DA 2RHQB 1K1QA 2XSFA 2XLIA 5T7LA 3MAQA 1U25A 4LF5F 1EAYC 2M2BA 4RR5A 2EPIA 2QX0A 4J9PA 5E41A 1DAXA 5A6PA 2KDOA 1VRTA 1WC6A 1Q78A 4TKTA 2BKPA 2B5JA 2UV8A 4LF8J 1WWHA 3RGIA 4AFFA 5AE2A 3K5NA 3CIMA 1KHWA 4ECZA 1IWGA 4DR4J 4CO2A 5E7OB 3V81A 4FXVA 1V3SA 4FYDA 1S57A 2W2PP 2RE1A 2HFSA 4ITSA 2CJQA 2XQCA 2RQMA 2Z2MA 2VQEJ 1UVKA 1G2EA 2YNFA 4NLWA 1TL1A 4RUHA 1IKWB 2AHOB 5JMNA 1B70B 5G0RA 3AODA 3I5BA 3KG0A 3QYYA 2HZVA 1FERA 2MGZB 2CZ9A 2R7TA 1HIYA 1FRXA 1O51A 3DMJB 2CNKB 2GNKA 2YXLA 3QGHA 2W9BB 1YVFA 2F9JA 2BQ3A 4G6VB 2KG1A 5DLFA 1RT3B 1DBDA 2AJ2A 4CO3A 1HNXF 1N34J 4LF9J 5KFUA 2SXLA 2DNPA 3CJTA 3DC2A 2VQEF 1CLFA 1F3VA 2QC3A 3FC9A 3GIMA 2GIFA 3I82A 4QZVB 4JV5F 1MSWD 1IKVB 4HEA9 5CD4H 2OEJA 3K5PA 2ZM6F 3J80U 1R3NA 3N6LA 1Z2LA 1U48A 4MYTA 4AYBD 4NOHA 1NK4A 1S0VA 4X2BA 3I4HX 3GLJA 3PX0A 2H5EA 3DU5A 4IG3B 3P4UB 4LRAA 4MIBA 2MKIA 2KZZA 1FT8A 2JNJA 2ZNZA 1DRZA 2G1DA 4YUDA 4OJ3A 3VZHA 2N82B 3D1QA 3NS7B 2CPHA 4OHZA 3K2YA 1FJ7A 1DJ0A 4F50A 2QYGA 2CDRB 3R97A 2OKQA 3FFIB 2ZJRQ 2DR7A 4UQGA 1O8BA 3CD0A 4OHVA 3ZZTA 3R7NB 4J9QA 2X1GA 2AEFA 2HEKA 4OI4A 2WB1D 3KUEA 4HVZA 1UPPA 4PWWA 1AB8A 2E5GA 4HH1A 4DG1B 5DM7Q 2K06A 3CVKA 3MPYA 1P9YA 4CDIA 3ZNUA 1Y11A 3FBBA 2JZ5A 4EO6A 2XS2A 3I9ZA 1ULRA 2HVHA 1AW0A 3B82A 3QWPA 1X60A 1QSSA 3HDSA 3CJ2A 3PR4A 2R9LA 2QGFB 4HLBA 4CLKA 2B0GA 2YNGB 4HDHA 4JI6F 1TMMA 2IHR1 4Q43A 1CSJA 2OPRA 3UDCA 2R8HA 2ASDA 2XMAA 1ZM4A 2EWHA 5EX0A 4L74A 1Q7LB 3HCXA 3OFEA 3NGKA 4QPTA 5GAGU 2YKNB 3MM5A 1IKYB 3PDNA 1DLOA 2KT2A 4I2QA 2QTWA 2QLWA 3EZOA 3MPDA 1FDBA 3K8VA 1DY3A 4RWWA 4ZHRA 2WW4A 4EU0A 4K4SA 2H3EB 2VKZG 2KKHA 4O4GA 1LWFB 2ABYA 1HNVA 2YVSA 2A2CA 2EVZA 2KRBA 1YX2A 3JTOA 3NG8A 4KSEB 1AT1B 3TEHB 4B08A 3NXZA 2D9PA 4QWEA 1HYSA 2ZHAA 1NSAA 2WVCA 2YWKA 2O67A 1MN9A 2H5IB 4DR5J 3K89A 1NLKL 1Y10A 2G2OA 2QT7A 5A0YB 2HFNA 1NHUA 5ETQA 3PFOA 4WCEQ 2VA2A 3CC2S 3MEKA 1J5OB 1SC3B 1TFWA 4ZMMA 4PG8A 2IRYA 3QGIA 4OV6A 2OSRA 4DV6F 4O0IA 2AKWB 2J9DA 1MNEA 2EFNA 2BM0A 2C2KB 3M2VA 4R8UA 6FDRA 3EPGA 5J2MA 4LFCF 3TUPA 3FCWA 4I67A 2AMCB 5CH7B 5CYJA 1KLMA 1TTHB 3T5HA 3LP0A 4WJBA 1HR0J 4J9NA 4ID5B 4TQSA 2HVIA 3FSYA 1R6VA 2LEPA 2PGCA 3G82A 1ZAVA 3FSIA 4RNOA 4IQMA 4C11A 1SCJB 3O8WA 2ADBA 5LMNJ 4OX7A 1WC5A 3PV8A 4ZLJA 3R2CJ 1WKKA 2VICA 1U47A 3CC7S 4YOEA 2B6AA 3EVMA 4G1IA 3G6VA 5GMDA 1D3WA 1WHYA 1LEOA 4OIXA 2MYFA 2DGWA 4ZVQB 1RT1B 4XAKA 1VDHA 2FC8A 2IM1A 1GMVA 2HVDA 1VBZA 2DBBA 2NUHA 2C3OA 2QLFB 5AXMA 4M95A 3KDNA 3WDOA 2DNGA 2MZJA 5ETOA 2R42A 4CLWA 2AX1A 2PC6A 5T7LB 1MWZA 1U1RA 1YJ7A 1U1KA 3MMCA 5HP1A 4ZP8A 1RWVB 1Y9OA 1U8WA 4QIEA 4RBUA 5KT5A 4IG0B 4MKVA 1A0OB 4ZVGA 2EXUA 3FCVA 3H2VE 5HQLA 3WHIA 3OR1B 3QO9A 4LVOP 4N76A 1NJZA 5KFNA 2KFYA 3ITHB 1TELA 1U0HA 2QE5A 3G82B 1N32F 3BN4A 3MZIA 2XYHB 3LWLA 1N0UA
chains in the Genus database with same CATH topology
2KG0A 2DNZA 3D1OA 1S9GB 2XMJA 3F44A 2ROEA 1M1KT 2CKWA 2CVIA 2PSZA 1HHTP 2NZ4A 2MQMA 4FZVA 1F0XA 2LQ9A 2JSXA 2ZKTA 4OZNA 4C0BA 1TKXA 4N8OA 3MM6B 5B0EA 3KHLA 1FJGF 2E9ZA 1SJ1A 5IZHA 3TW0A 5KTQA 4N56A 1NK9A 2V2KA 2W9AA 4LSNA 4DWIA 2NPIA 1N6QA 4K5RA 2LDYA 2DH9A 4IO9Q 1HBNB 3H25A 2MZSA 3O1LA 5F8HA 1HNIB 1XR5A 3MPVA 4ILMA 3SSQA 2YNIB 4EGLA 3DLKB 2UVWA 3LAMA 2O66A 4NCBA 2RIJA 4KKOA 3OW2R 1MU2A 5L9NA 3CXCR 4ILLA 3OUYA 5K9FA 2E1AA 1UKUA 2KHCA 2HHVA 4C11B 4I2PB 1VI7A 4ZCMA 3KLGA 2JLFA 3KLVA 4J9OA 1QSLA 2ZOGA 1VQ6S 1D8ZA 1U2FA 3CF5Q 3MI7X 1KQFB 2VONA 4WKYA 2H9ZA 4Y2CA 3LPYA 1VFJA 4AL6A 5H9EJ 3PO4A 4Q45A 3RB0A 1C1BB 1DZ5A 3Q22A 2J6UA 2KJVA 2VPXB 4CO4A 1GQEA 4O4RA 1U1MA 4DSJA 3IGVA 2VC0A 3CCZA 1LW2A 4RW4A 4Q0BA 2FVCA 2J8AA 3T9NA 5LMUF 4CTAB 3PW5A 2V8GA 1IBLF 1KRPA 4L72B 4A8SA 2YKMB 1CC8A 2KT5A 2J9CA 1R6YA 4B3SF 2QA1A 4HL9A 1TKZA 4OLOA 4PXEA 3S8SA 1Q81T 3DLLQ 3KMQA 4TYBA 1U1OA 2MY7A 3BB5A 2IBOA 1LFPA 1HW8A 2OPRB 3CCTA 4IFVA 5F0UA 5IQQA 3HLUA 3M05A 1IM4A 2RILA 1VBXA 3KMSA 4FN5A 4JYAF 2M0GB 1LW0B 3MEDA 5DQGA 4U7CA 2HMIA 2FJBB 2HQIA 3MM7B 3MEEA 3KLIB 5KT7A 4K2XA 2P9EA 1PSDA 5C42B 3KLGB 5L8RC 4U67Q 2DNOA 3SCKE 2DR5A 4ZP6A 2DCLA 2DGOA 3ZC4A 4BDPA 2OPPB 2VUGA 2I38A 1UW4A 2G13A 3ISNC 1K73T 3GR0A 3J81Y 2NQPA 3DXSX 4LUBA 3CCLS 2Q66A 3DRSB 1UAWA 5DDRC 1VQPS 1HBMB 3DRRA 2FIUA 2VZ9A 1NNDA 2OP5A 4NL5A 4X4QA 1NB7A 4F4WA 2HWTA 2W7OA 3TARA 4JI5F 1YSJA 1ZH5A 1L3UA 2AWZA 3BJYA 5F8GA 2ZH3A 1TFYA 4WU3A 5FJ4A 4B9UA 3CJ4A 3AB2B 3E01A 3MDFA 5THWA 4ZCIA 4NLGA 4O3QA 2C28A 2CQHA 2CFXA 4RU9A 1MMNA 1DURA 2XC9A 4P2SA 1X4CA 3RB3A 4YDXA 3OJSA 2ASLA 1PILA 3D54A 3BGRB 3CD7A 3OBIA 1XN9A 2VFSA 3QGPA 2OPPA 2DIUA 4NLYA 5K14A 2BA9A 1Q86T 1HPZA 3MR6A 2P6TA 3BF4A 5E33A 4KPYA 2UXBF 1U1PA 1RJJA 3CDWA 4DLGA 2BZ2A 5F41A 2XLJA 2JRSA 2KI2A 4A47A 3KYLA 4FF1A 3ISZA 1HI1A 2AJ0A 3LANA 3M30A 2EFVA 4ELVA 5J2PA 1URRA 1RAJA 2PDAA 4N77A 4NA2A 2EC0A 1YJWS 3POTB 1FDDA 2XMTA 3S7RA 1HNWF 3MM9B 4DSLA 1FRJA 2KYZA 4PKDB 2N3OA 4Q8FA 2IMWP 4C8ZA 5KOWA 4LF8F 2YY3A 1TK8A 3SDEB 1VHFA 1JLEA 2ZD1B 4FS2A 2JL9A 5T41A 1TK0A 2EBEA 1S1XB 4UW2A 3W2VA 3VAMA 1H2UX 1H6KX 1G3OA 4MYUA 2Q6CA 4TU8A 1MU2B 3QJJA 3C46A 3EGWB 3OXLA 2XHWA 1QE1B 2CIMA 3T5KA 2RU3A 4ZVEA 1H38A 2WHOA 1HBUB 5FDLA 3GIKA 1SIZA 1HBOA 1NJIT 4ES2A 4J9KA 4KHRA 1FO1A 3IR5B 2XWXA 2OPSB 2VD3A 5EHHA 3CCMS 1TKXB 2XMVA 4W92B 3IWNC 3DHWC 3RU0A 4ED0A 2COLA 3W2WB 4DF4A 2XMKA 3CIZA 3L7PA 2DISA 4MJKA 1XERA 1RT6B 1Y00A 5CCLA 2N4CA 2CDQA 4R5PA 2V4QA 4DV7F 3TANA 4ELTA 4KB7A 2PI5A 3LP1A 4DQIA 2CQ2A 2F40A 2MQOA 2FJXA 2IC3B 4N47A 1N34F 4LF9F 3TUIC 2DGVA 2YX7A 3MR2A 4C8NA 3DCAA 1UA1A 5AE3A 2WOMB 3MECB 4O3RA 3SYZA 2WONA 4I0WA 4MFBA 1F5CA 1FK9B 2BQUA 1X4GA 1QTMA 1YJTA 2D9OA 1P8GA 2ZDOA 2OJ3A 4RZRA 2OPQB 4QR0A 3RR8A 3AJ1A 4IH7A 2BM1A 3W2VB 4QPXA 2NPFA 4FVMA 1WELA 2AGQA 3K0JA 3DGPA 2R7QA 1ZAXA 1U2RA 4WF9Q 1WI6A 2RUGA 4DL4A 2W4CA 2A1BA 3LOUA 2IJNA 3KJVA 1F2GA 2R8KA 1QM9A 1XC9A 1TAQA 1YRXA 2KHDA 1ZTTA 4FVCA 3KK2A 4OJGA 4EO8A 3G8SA 5D77A 5BYQA 2CPDA 1CC7A 5J2PB 1XMQF 3CD6S 2ILZA 2GMHA 2L9WA 2WONB 4MKBA 4DL5A 1UVMA 1H0HB 1S1WA 1YBAA 2MY8A 2A10A 3IRXA 1X4FA 2VC1A 2CJBA 4GMKA 4UOCA 2BANA 4NMLA 3G6ES 4J9MA 1JWWA 2ZUGA 1SIWB 2ROGA 2VG6A 4J9LA 1NJXA 4F2RA 4CNZA 3HVWA 2NREA 1AROP 2WTFA 1SI9A 1UVLA 2AYMA 1SJQA 2QZ8A 3MURP 1BQNA 4FNHA 2MJNA 3H8YA 1JLQA 1R8AA 3VZIA 2XNQA 4DBQA 3HX9A 1W2IA 3NNHA 2MQQA 3RRHA 1UA0A 4KV8A 1SUQA 4ZP7A 3RYLA 5DM6Q 3NMAA 4RNFA 4OQJA 1RT6A 5M2UA 2I2YA 1LXJA 3TAMB 1P27B 2ZHOA 1MMLA 2WW8A 4Y65A 2VL1A 1VIXA 2IVFB 1OO0B 3AHPA 5I42B 4RNMA 4LF7F 5D3GB 2YKOA 1X9WA 4I4BA 5HMXA 2WRMA 4PRFA 3HVTA 2R4FA 4YP3A 3PIPQ 2RF2B 3R5CA 1SKWA 2YKPA 5CCMA 2VFVA 1IR0A 1S1TB 4F4KA 1HNZF 4QIGA 5EWGA 1NKEA 5LL6d 4I68A 3U02A 2VBWA 4AQYF 2LEBA 1LWFA 2Z8QA 3N01A 1FD8A 4Y2IA 2BE2A 3IS9B 4YFUA 5DGBA 4ZVFA 3N79A 2ZJPQ 2DPJA 1JLAB 3SMZA 1S9EA 3MMBA 2UUWA 5AXNA 3T6BA 4PXDA 5L9XA 2FHMA 1KNZA 3LWMA 3HT3A 4RW8A 3PEHA 4TY8B 2XLKA 2L3MA 4HHJA 1ZZFA 3C6UB 3T1YF 1NK0A 2LXIA 2VKRA 3DOLB 3I0RA 1RT5A 4NLXA 1SH2A 3H5UA 3I4PA 2V5HG 1U26A 3KLHA 2X1FA 2HNZA 1WEZA 5B0GA 2HRYA 5CZVA 3FJ2A 5KFYA 4ED2A 3HVTB 3CEDA 1EP4B 1IKVA 4F2SA 2AP6A 1H7WA 4YQWA 4TY9A 4USHA 2MQNA 4TLRA 3R1LA 3MMAB 1RTDA 2DIVA 5DDQC 2R7UA 4PG4A 1TVRA 3TAMA 1TKDA 2LYVA 5CXTA 1KVIA 3JYTA 1RTJB 1UVJA 2ALZA 1A6LA 5ITHA 1UFLA 2DHXA 3QIPA 2L9NA 3CJ0A 3OUYB 1OS5A 4OI2A 2HS3A 1X0FA 1LXNA 2DO0A 2JJ4D 2V8VA 4EFAC 4NXMF 4DQSA 2K8GA 1FXDA 2MJUA 3UCZP 5KFRA 3CGIA 2OH2A 1DTTB 4KHPF 3IR6B 3MPWA 3PX6A 3MR3A 3LH2S 4Y3CA 4YY3F 1B0VA 2XMWA 1FXLA 3GZ7A 3M1VA 5F9LA 5LSOA 1VBYA 4RNHA 1WTBA 2VBYA 2QMWA 3H40A 4WFAQ 4NWBA 1QVFR 4C8LA 2E44A 2GA7A 2BQRA 2ZZMA 3ZFVA 3QWUA 4OZJA 2RDIA 1IKWA 2ACYA 2HZCA 4CH0S 4NLTA 1HD1A 4KAIA 1WEXA