2OTJS

13-deoxytedanolide bound to the large subunit of haloarcula marismortui
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
81
structure length
81
Chain Sequence
SWDVIKHPHVTEKAMNDMDFQNKLQFAVDDRASKGEVADAVEEQYDVTVEQVNTQNTMDGEKKAVVRLSEDDDAQEVASRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal RNA
publication title The Structures of Antibiotics Bound to the E Site Region of the 50 S Ribosomal Subunit of Haloarcula marismortui: 13-Deoxytedanolide and Girodazole.
pubmed doi rcsb
molecule tags Ribosome
total genus 19
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2007-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF00276 Ribosomal_L23 Ribosomal protein L23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2otjS00
1RKJA 5LSLA 5HL7Q 3G9CA 1OPIA 2MQOA 2J0SD 1H2UX 2AYMA 1NU4A 1CVJA 1VQMS 3L3CA 2DGVA 2JVRA 5IQQA 2E5GA 3DLLQ 4ERDA 1VBXA 2AD9A 5GAEU 3UCGA 5DETA 1SJQA 4BS2A 2CQ2A 2SXLA 2MKSA 3EX7B 1SJ3P 2L9WA 3CCJS 4IOAQ 4WKRA 4YB1P 1VQ8S 1WHWA 3NNHA 3NS5A 3MUVP 2CPEA 1H2TZ 4F02A 2YWKA 1P1TA 5D78A 2X1AA 3TP2A 2RS8A 2CQBA 1VBYA 2FHOB 3PIOQ 1U2FA 2RUGA 3CF5Q 4W90B 2I38A 1DRZA 3P49B 2D9PA 4W92B 2CQIA 1P27B 3S01A 3HHNB 1ZZFA 3MUTP 2DIVA 4CIOA 4M5DB 2V94A 2K8GA 1K9MT 2OTJS 4WFAQ 1XN9A 4CQ1A 3MD1A 2N82B 1D8ZA 2ERRA 1QVFR 2MQQA 3CC2S 2DNLA 3CULA 3SDEB 2M88A 3ULHA 2CPHA 3MOJB 3MDFA 1B7FA 1YHQS 3BEGB 2MHNA 2MJUA 4A8XA 2DNKA 3UE2A 5IM0A 2DNMA 2MQLA 1U1QA 3TYTA 1WELA 3VF0B 1X4GA 3UWTA 2O3DA 1SXLA 5D77A 2L41A 1Q82T 3MD3A 3J7ZT 1UFWA 3UCUP 1X4DA 2VOPA 2MY8A 2E5HA 2LXUA 3FEXB 2XS7A 3VALA 2KH9A 2RRBA 3CXCR 4IUFA 3NNCA 3G96A 2CQGA 2KM8B 2RQCA 2XS2A 2ZJPQ 1U1RA 1U1MA 1VC6A 2CQ4A 1QM9A 2DNNA 4TU9A 2LA6A 2KXFA 1U1NA 2DGUA 2L08A 2KG0A 1VQ4S 2MPUA 2N7CA 2DITA 2KHCA 2X1GA 1ZH5A 3V4MA 3D2WA 2KXHA 2CPDA 4TU8A 2G0CA 2MZQA 3VAMA 2PE8A 2MQPA 3IRWP 2MSTA 2M8DB 3S8SA 1WG4A 1W2BR 1BY9A 2DGTA 4PKDB 2G1DA 1VC5A 2E44A 2DGQA 2GHPA 3B4MA 2MMYA 2MXYA 1X4FA 3P6YC 2M52A 1FJEB 2RT3A 2LEBA 3US5A 2DO0A 5GMKa 2HVZA 2GO9A 2DHSA 1X5PA 2MGZA 1N52B 1O0PA 3ZZZA 2QEXS 5IFMA 5DDPC 2VONA 1JJ2R 2JWNA 2RNEA 2CQPA 3THPA 1UP1A 1KOHA 2MQNA 4QPTA 3PIPQ 1WEZA 3R1HA 4WFNQ 1UW4A 1OWXA 1WHYA 1VQ7S 1OIAA 1H6KX 3CTRA 2MKKA 3K0JA 2K3KA 2X1FA 2LCWA 1N8RT 3S6EA 2DNQA 1X4EA 3UCZP 5FJ4A 1YTYA 3NS6A 2FPHX 2MKCA 2DHXA 3CMES 2WBRA 1WI8A 2LMIA 2MKJA 2LECA 2J0QD 5CA5A 2A3JA 2YH0A 3VAGA 3CPWR 3NNAA 3H2VE 1RK8A 4IOCQ 2DB1A 2NLWA 1VQNS 2DH8A 1WTBA 4LIRA 2DK2A 5GVQA 4Y00A 5HO4A 3CCVS 2QFJA 1YJWS 1KQSR 5ITHA 2CJKA 2LKZA 4WFBQ 3U1MA 1S79A 5DM6Q 2X1BA 1D9AA 2KN4A 1JMTA 3BO2A 2ZJRQ 2CPYA 2KG1A 4UQTA 4ED5A 2KVIA 5DDRC 5JVGQ 5IM0B 3H2UB 4IO9Q 5CYJA 2RS2A 2MYFA 1VQ6S 4PR6A 3MXHP 3P5TL 1NJIT 4C7QA 2BZ2A 1L3KA 2MZ1A 1X4AA 1X4CA 2M4MA 2EVZA 2J8AA 1X5TA 1DBDA 1Q86T 1FO1A 1FHTA 1VQPS 1U1LA 1F9FA 3S7RA 1M1KT 4LJMA 3Q2TC 1JJHA 2MKIA 2CQ3A 3CCSS 1VC0A 3VAJA 2KRRA 1KD1T 3Q2SC 1JJ4A 2MSSA 1X5SA 4V19X 2M8HA 2DISA 3CCMS 3CCLS 4TU7A 2XSFA 2MZJA 2AYBA 1VQ5S 1K73T 2JX2A 2QA4S 2MY7A 3G6ES 3SDEA 2U2FA 4C0OC 3CMAS 2ZJQQ 2F9JA 1FJCA 2Q79A 2M2BA 2CPZA 2KT5A 3G71S 2CQDA 2RVJA 3BO4A 1KC8T 1SJRA 1U1PA 2EK1A 2MGZB 4PRFA 2CQ0A 2CPXA 1WI6A 2XNRA 2JRSA 2MQMA 2LEAA 4OZ0A 2ADCA 2DH9A 3CD6S 3CCUS 3RW7A 3BO3A 2CPIA 3DXBA 2B0GA 3LQVA 3U1LA 1HD1A 1WHVA 5DDOC 2DNOA 3CCES 1YIJS 2F9DA 2F3JA 2BOPA 1NO8A 1X4HA 1WF1A 2HYIB 2KRBA 2G4BA 2DNZA 2VOOA 3I56S 1WF0A 2LA4A 1WF2A 1WG1A 1WEYA 1M5PC 1WEXA 3TO8A 2DH7A 5CXTA 4CH1A 2DNRA 5EN1A 2CQCA 4RU2A 4WF9Q 1YJ9S 3G4SS 5GAHU 4J5OA 1FT8A 5LXRA 3UD4P 1U6FA 2LXIA 3P3DA 2DIUA 2YTCA 4U67Q 1M5KC 2CPFA 1URNA 2U1AA 1U1KA 2CQHA 1DHMA 5BJRA 2RRAA 2E5JA 4CH0S 2UP1A 1VQKS 1IQTA 2AYEA 2LQ5A 2ADBA 2M70A 4P6QA 2M9KA 3OW2R 3VAFA 1X0FA 1S72S 3JB9k 2NZ4A 3VAKA 2N3LA 4EGLA 3VAIA 2OSQA 1FJ7A 4WCEQ 3MI7X 4Y0FA 3EGNA 1A9NB 1VQ9S 2CQ1A 2DHAA 2M7SA 2D3OR 4YUDA 5MLCV 1YI2S 5LJ3Y 1AUDA 3HI9A 1X5OA 4ZKAA 2KXNB 2YH1A 1SJ4P 2DNHA 3ZZYA 1U1OA 2RU3A 4UY8T 1HA1A 3G8TA 2MKHA 3G8SA 2DNPA 2KU7A 1VQOS 2FC9A 2KI2A 2JVOA 5LJ5Y 3MURP 2EK6A 2MZSA 2I2YA 2MJNA 2MZRA 2DNYA 3N9UC 1N88A 2DGXA 5GAGU 1M90T 2J76E 2XNQA 3R27A 1YITS 3SXLA 1G2EA 3CCQS 3I55S 4QU6A 2DGOA 5H1SV 1Q7YT 2VODA 1PO6A 4OZ1A 2M0GB 2LYVA 1A7GE 1DZ5A 1FNXH 2D9OA 2OTLS 2DGWA 1K8AT 3J7YU 5JVHQ 2DO4A 4FXWA 1UAWA 2E5IA 3FEYB 5DDQC 1KOOA 1M5OC 1HL6A 1OO0B 4Z2XA 2MB0B 4QQBA 2XB2D 1M5VC 2KFYA 3THTA 3IWNC 2KYXA 3SMZA 2HGNA 1U6BA 3CUNA 3B4DA 1Q81T 1N54B 5LXYA 2XS5A 2FC8A 3VAHA 3CCRS 2KM8C 1QVGR 2HGMA 1WWHA 2OSRA 4QU7A 5DM7Q 2FY1A 2HGLA 1YWXA 3CC4S 1WHXA 3LPYA 4F26A 3UD3P 5LSOA 3R1LA 4F25A 2DHGA 1ZZNA 1X4BA 4YOEA 3BS9A 1VQLS 2PEHA 4LMZA 1WG5A 1R8HA 2CPJA 2OJ3A 2OIHA 5GADU 2RQ4A 4FXVA 1SJFA 1R8PA 2HZCA 4C4WA 1H2VZ 1PGZA 2YKAA 2AYGA 3MUMP 1YJNS 2DGSA 3NMRA 4TLQA 1VBZA 3CC7S 1FXLA 3EGZA 4WIIA 2MZTA 2N3OA 2DNGA 1HD0A 3RW6A
chains in the Genus database with same CATH superfamily
1IUJA 1X9WA 4QIGA 2A6MA 1VQMS 2IBOA 4OYWA 3EPGA 3FSXA 3BF4A 4ERDA 2A10A 4EBDA 4U8VA 5L1LA 2NXCA 5T41A 2IRYA 4RW6B 3DGPA 3CEDA 3PY8A 4LQ3A 2C3UA 3OSNA 2WSEC 3CVKA 2D69A 3RB4A 3NMAA 3P8BB 2DCUB 4Z37A 2B4OA 2FIUA 1CJVA 4WFAQ 5A0YA 2G0IA 2IJRA 3I0RA 1QVFR 1HNVA 4NL5A 3SDEB 1TVRB 2M88A 3MM7A 2I6WA 3DM2B 4CWBA 2DNKA 3D67A 2MQLA 5B0DA 2OH2A 3TAMA 2FVPA 4HHHA 1ITPA 4TY9A 4BDPA 1RTJB 3R2DJ 3RUBL 2DNNA 2R9LA 3HFZB 2BOAA 3LAKA 4PZVA 4DR2J 4M95A 1PC5A 4Q45A 3Q89A 3QGGA 3NGSA 3OHAA 3A13A 2KTQA 2GO9A 1UVIA 4GKKJ 3SCLE 2PSZA 4LSLB 2K3IA 3M2UB 1WHYA 1UA1A 3DRPB 1RWXB 3GU0A 3ZTPA 3NEKA 3UCZP 1HR0J 1YTYA 1S0VA 2ZFHA 2JHEA 2WZ1A 2DVIA 3VVUA 4I68A 3GLJA 1RK8A 3QATA 4XDCA 2JJ4D 4A46A 1N5SA 4JI0F 2R4FA 4DV5F 4KKOB 3QFWA 5HN0A 4W4MA 1GXLA 2FGOA 1UWBA 2KVIA 7FDRA 3CJKB 3TANA 2WHOA 1FXRA 4QYRA 5FLXU 2ZWPA 2H5IB 1CJUB 2FJEB 1S99A 1B0VA 1DBDA 4GVLA 1DLOB 1RAEB 1G4CA 4EU0A 1S0OA 4PG4A 2HVEA 3W65A 4DR7F 3W2VB 3CJRA 1U0HA 2HG4A 4Z7YA 5KOXA 3FEZA 3R6LB 1KFDA 5IC6B 2WVFA 1Q5YA 2P5VA 2ZOMA 1FJCA 4NWBA 2R8GA 4IG3A 1OY8A 4ZVPB 3MR6A 3M8PA 2OAUA 5B0CA 1ELOA 3CD6S 5ETQA 4NYZA 3SBMA 5FLXY 3HVAA 4CI0B 1TKDA 1PYOB 2VBYA 4A8MP 3DLBA 2LU2A 4F4XA 3H90A 2BJEA 1LWCA 5J2NB 5GAHU 2LXIA 5HMWA 3KMQA 3W5XA 1IQTA 2QMWA 4IDKA 3PR4A 1KNZA 3VAKA 1RTHA 3PFEA 4EGLA 1WDDA 3BKTA 1CJVB 5A0YB 5K20B 1F3FA 1HNVB 4EYIB 1XR6A 2DHAA 4NMLA 2UUCF 3ZTSA 5MLCV 5A8WA 3FJ2A 4FN5A 3OXGA 3A8JA 3G8TA 4CLFA 3G8SA 1WC4A 2I2YA 2FDNA 1HPZA 2FHMA 1O5JA 3SEOA 1FJGF 4B02A 2RDIA 2V9WA 1DY3A 3VV2B 3ZC4A 1CQMA 2YX4A 2BE2B 3KUGA 2IFXA 2HAFA 4LR8A 1MSWD 1B4SA 1B0TA 1T9WA 1X7VA 4O3PA 1NEEA 1L3UA 3KDNA 3SFUA 3IWXA 4QQBA 1YBAA 2QLXA 2WK4A 1DQAA 3QSIA 4NPOA 4Y2AA 2BE7D 1C1BA 4PWWA 2CJYB 2WRMA 5KG0A 3M1VB 2OSRA 5DM7Q 2ASDA 3T5HA 1S7HA 3MM5A 4NYOA 2W7PA 2BDPA 2OIHA 4AUKA 1R8PA 4CO3A 4WZMA 1VBZA 1NPPA 5BYQA 2DNGA 1KD1T 3G9CA 1FA0A 1KLMA 4DV7F 3NL0A 1HW8A 4FBTA 5AE2A 4DV3F 1G6BA 4LF7F 3M4XA 3M8YA 4AFFA 3IFEA 4RW8A 2VG5A 1N5TA 5D4PA 4G65A 1HNWJ 5D78A 2CQBA 2X51A 3LP0A 2AGPA 4R8UB 5L38A 4LFCJ 1NXIA 1CC8A 1WOSA 5KFDA 1N33F 1IKXA 1PCAA 3ZZTA 3NS7B 3CULA 2O1PA 3IR6B 1RWOB 5KFWA 4X4OA 1Y9OA 4IG3B 3MEDB 5IM0A 2QX0A 4LF4J 5C42A 1K1SA 1Q82T 4NA3A 4U6PA 1NKCA 4K4VA 5ETNA 2KH9A 3PHTA 3NNCA 2CQGA 3BV8A 2UV8A 4H4KA 1U6ZA 2YNHA 4CDIA 5KFHA 3NCPA 1BWEA 5G0RA 4DQIA 1QM9A 2KXFA 1U1NA 3J7Z5 3PYGA 4NASA 4DPXA 3I5CA 1VS3A 2IRXA 2F5GA 1VOMA 4O4GA 4TLRA 2MQPA 1NK8A 3KXDA 4KB7A 3KJNB 1T9VA 3P6YC 1TKZB 2YQ0A 2RT3A 4IDKB 5T14A 1TTHB 3LOUA 1X60A 3G82B 4RWXA 1EQMA 4B3MF 3R1HA 1TL1A 2MDAA 2LCWA 2NPIA 3R5BA 2QLBB 2OFHX 1FNOA 3ELHA 4URGA 2D7SA 4AYBD 2N4DA 3VAGA 1IKVA 3N6MA 2HURA 2HKEA 3KJFB 2Y1RI 3DOKA 3Q83A 1UJ6A 4QW9A 2K7JA 2Y1LB 3ILOA 2WB4A 4JV5F 2MZ1A 2HHHF 3CJ0A 3KK1B 3TEHB 3FSYA 2E1CA 1NSAA 1U1LA 2V2VA 3RB3A 1S6UA 3NGRA 3IWLA 1JLBB 1S1UA 4LJMA 2Y3YA 3MCSA 2XYHB 1AXQA 2DR8A 5I3PA 2M8HA 1LOUA 2B56A 1RA6A 3GR1A 1VQ5S 1J2VA 2FLNA 4E0DA 3WZ0A 4A48A 4HI2A 2QG9B 3RAMA 5K8MA 5HMYA 1RDRA 3TW0A 4ZIWA 3UR0A 2Q66A 2CQDA 3H2LA 3E3XA 5FIIA 1YQHA 3F73A 1KDNA 4LSZB 1SH0A 4X64F 1B99A 2ADCA 2GVDA 2VASA 1NCLA 5DDOC 1GQEA 2HBQB 2HYIB 1HWUA 5HROB 1H74A 3C2PA 4OYIA 4N8OA 1N48A 2NXNA 4CLYA 4PUOB 3NGKA 1NK7A 3TO8A 5CXTA 2X7IA 3P3DA 2W4PA 5KFAA 3LP0B 1APSA 3IC1A 2W24A 1OY6A 3F44A 3DDIA 3NBPB 1YRXA 4HI1A 5EHHA 4OI0A 2ALYB 5JUMA 2VG7A 3GTYX 3ONQA 2MTLA 2XY7A 2VDIA 2VQEF 1E6VB 2XLJA 1IVZA 1RCOB 1YSJA 2YKNA 5B09A 1XR7A 4JI2J 5HATA 2ZM6J 2FC9A 1XMQF 3BGUA 2P9GA 1JLGB 3WC0A 3QZ7A 4ZPAA 5GAGU 5G0RB 4Q0BA 1UVKA 5KOWA 3KNGA 1FNXH 3H25A 4OQJA 2VDHA 2WW8A 2YPYA 3J7YU 4O4GB 2VKZG 3TX8A 2HS3A 1RE1B 4PYDA 2Z2MA 3H20A 1AZSB 3EVWA 5THWA 1AYEA 5LXYA 4PPZA 3DRYA 2IAJB 1NJZA 5D0HA 4GC6A 4DV2F 3BYPA 3CC4S 1S10A 2POKA 5LSOA 3R3TA 2ACMA 4URQU 4TNOA 3BM7A 2LFVA 4WFXA 3TNVA 4QBUA 2NZCA 3G6VA 3LP1B 3SZ2A 1HBMA 2EC0A 4LFBF 5IWAF 3NMRA 1VYAA 3DYAB 4WIIA 3ZZOA 2MKSA 1HD0A 2DXDA 1S1XB 5L8RC 4M63A 4G1QA 3E51A 4TVAB 2DR5A 1HBOA 4GVBA 4KHRA 3CJ3A 5E7OB 3CCJS 4YB1P 1VQ8S 2QO3A 1WDTA 2JOQA 3PDNA 1TL7A 2X1AA 4JI8F 4FPIA 5J2MA 4ZCIA 4MIAA 3C6UA 4IYQA 3M9NB 4HHJA 3IMQJ 2M5YA 2V8GA 3DU5A 1UEUA 1PKUA 4XPCA 1YJ7A 2HNZB 4RBUA 3B6BA 2IMOA 2CG4A 2DNMA 4HACA 3JQKA 2BQUA 3UCUP 5G4DA 1NSQA 2MY8A 2Z30B 3GV8B 4IUFA 1XNQJ 1VC6A 2CQ4A 2L9NA 4DV6F 2XBPA 2QA1A 2ZITA 4LF1A 5K8NA 3LGMA 2LXFA 3PZPA 3S8SA 1U4BA 3IG1B 1WG4A 4RW9B 3BREA 4CP5A 1FJEB 2R8IA 2LEBA 1VFJA 4G1PA 5GMKa 2Q3PA 4H4OB 1BD6A 3GYGA 1NK5A 2BMBA 1D0EA 3N6LA 4GKJJ 2RNEA 4F0KA 5E5NA 4NXNJ 2ZC3A 3ENWA 2V8VA 3C16B 4LFAJ 1BMQB 2BBEA 2ZH1A 1BUXA 1SV5B 3VGVA 5IC4B 4K5SA 3NGTA 4X4NA 2VA3A 4Y65A 3NNAA 3H2VE 1VQNS 5D3GA 5A6PA 5JMNA 2G9OA 5ITHA 1Y5IB 4NZ0A 2IYIA 2KN4A 2QN6B 2R7WA 3AJ1A 2MYFA 1N34F 3MXHP 1R0CB 3IS9B 2AX1A 3D68A 1R0BG 2EVZA 3H5XA 5F9LA 3AOCA 1VI7A 1LV5A 1RAAB 1I1GA 1RTDB 1FRLA 4BHQA 2WB1D 3B8HA 4IRDA 5T7LB 4C0OC 1CPZA 2Q79A 3ADAC 2YY3A 5K9FA 4OHYA 3IR5B 1FRKA 1NHUA 2KL8A 1K47A 1MWZA 3BGFA 1FKPA 2ZVIA 1HW9A 2JC1A 3LQVA 1OYEA 2NR0A 2XQCA 5HJXA 2BOPA 2B51A 3BSNA 2WOMB 5SUHA 4RUAA 4GVBB 3OXLA 1WG1A 1M5PC 4OZ3A 3EXYA 4ZPTR 2PIIA 4ZP6A 2MKYA 4P2MA 4GRSA 1U6FA 3PRBA 4YS2A 1CEZA 1IBKJ 5KG5A 5FD1A 4DUTA 1TAUA 2O67A 2C22A 2CJBA 3D28A 1H72C 3KJVA 3IN5A 2C3PA 1HQEA 4WPAA 2WONB 3OVSA 2JVOA 1S6PA 4ZS6A 2EK6A 4DSEA 2DYAA 1NK4A 1FRHA 5A76A 2Y0SD 4HT5A 2ZZTA 2W7OA 3OL7A 5C24B 4YDDB 4QWCA 5K8OA 1RWVB 2UXCF 4DV7J 3ISNC 2DO4A 1QTNB 3HHLC 2YX7A 5AXMA 3ETOA 3FZBA 4U9RA 1XTZA 2E5IA 3EUNA 3JTOA 4G6VB 2XY6A 1V3SA 3R5DA 4Z2XA 2UXDJ 5CZVA 4F8RA 1FRMA 1HBUB 3NRBA 2BKNA 3OFGA 1Q8KA 5D8HB 3Q8RB 4KGXB 1N56A 3CB4A 4F26A 3GG0A 3ETMA 2YVSA 3AQPA 2KJVA 2CPJA 2Q6BA 2P9EA 2CVEA 2J6SA 2LDIA 3MUMP 1IR1A 4TLQA 3EGZA 1YRUA 5D3GB 4ECTA 1H2UX 4FNHA 1NU4A 4MKYA 1QUVA 3L3CA 4EEYA 3PW7A 1IJEB 4BS2A 4OZLA 3EVMA 2QRRA 3EICA 4OYPA 5K14B 4Y2CA 4CLTA 2YKQA 2FHOB 2HFZA 1U2FA 3W3SA 3M32B 1RWNB 1ZM2A 4L3KA 3UVJB 2ZZMA 3S01A 1FERA 2NCKL 3P96A 4CRJA 4CIOA 3R5JB 3S1TA 1RWWB 2M3DA 2CKWA 4HTIA 2ROPA 1VDHA 3MOJB 1RWPB 2MJUA 3B78A 2G2OA 4V19J 1U1QA 2AJQA 3DMJA 1N5QA 1LWEA 1IXKA 2PEBA 1FKPB 2D3O1 4B3MJ 2ZH8A 1YJRA 3AT1B 2VHGA 2VKRA 5IT0A 3W5YA 3G2XA 5IT9Y 1RU1A 4ES1A 3WIUA 4FYYB 1SH3A 2KG0A 2PMZD 3HM9A 1T95A 4KHPF 1S7IA 3V4MA 1FF2A 4XTTA 1H0HB 1CJTA 1T9TA 1NH8A 4ZVTB 4PKDB 2G1DA 4DLEA 1M0SA 1URRA 1R0AB 4KYZA 2LDYA 5D6GA 4ELTA 1YX2A 1FCAA 1AFJA 1N52B 4NLXA 4C11B 1O0PA 2VBXA 3MPVA 5F8JA 3THPA 3LALA 1MWYA 1WEZA 2BQ3A 4J91A 1ZS6A 5KFEA 3CTRA 2K3KA 4PABA 1TP7A 2V9KA 2OPRA 4OX6A 2GAHC 1S6PB 2UZAA 3R6GB 4OL8A 2C2ZB 3ZTOA 2AW0A 4D3HA 3W2WB 1KHWA 5J1PA 3QIPB 2OKQA 1CS4B 5KFJA 2QFJA 3VGUA 1ICEB 4ZITA 3LTOA 2ZJRQ 1RTIB 3CIZA 2ALZA 4ED5A 5DDRC 3D1OA 3UO0A 4DUZJ 2W9BA 1NJIT 2DRDA 2DRBA 3NAIA 1GTHA 1FX4A 2FJVA 2GCFA 5ETMA 3I6PA 2NYIA 4HTJA 4S0MA 2FVRA 4CLZA 3CJ2A 2BW7A 2XZDB 4ANEA 2ZEJA 4K4YA 5I3UA 3CCLS 2X3GA 1K73T 4ED8A 2JX2A 2JEIA 5HSPA 1EQ0A 1HFEL 3EZUA 3Q22A 3DLJA 1VRUB 2M2BA 5L9XA 5F3TA 2V2KA 1I94J 4KGVB 5IQ6A 2FZKB 3FFIB 1QLNA 2JRSA 2XYGB 2ZBQA 3BO3A 3U1LA 4JI7J 1WHVA 2B7BB 2DNOA 4OZJA 3A4TA 3UR3C 1NO8A 1RYRA 2OPSB 1SBRA 1MLAA 1WF0A 1LWFA 3M8QA 3QJPA 3KK3B 4MJKA 4ES2A 3A12A 4J5OA 1FEEA 3UD4P 3PJ9A 4QYZK 3U27A 4L75A 1Y11A 1DHMA 3JQJA 3LAMA 2QL5B 3CT9A 4Q2MA 4UT4A 2XYPB 4IKAA 5A8RA 5B7WA 1S6QA 1S97A 2AGQA 5E2QA 2E29A 2VPYB 3GIRA 3LF0A 4KFBA 2NXJA 2BXJA 3QT7A 2VD3A 4J9VA 1LWEB 1MU2B 3KHRA 5F8GA 2OPPB 4WTYA 1TL5A 4ZN3A 3G6XA 2E1RA 3CCQS 2HNDA 2VIHA 3MEGA 5E3CA 4CNZA 1QAIA 2FD2A 4C8ZA 3IRXA 5HMXA 3EJMA 4FXWA 3DXSX 4DFPA 1WTFA 1KOOA 4XAKA 1SUQA 4DBQA 4DPTA 1JLFB 2OD4A 3T5JA 2BANB 3DOMA 4ILMA 2VB6A 3QJJA 3OPKA 3W1YC 2V50A 2J9EA 1UETA 3PNIA 5KFPA 4YHHJ 2ZC4A 1G7CB 4A8SA 1S48A 3BQ1A 2ZHAA 3UI3A 1N32F 1SJFA 3DRRA 2XMWA 1LW2B 2PMHA 1EETB 3MMCB 1TU0B 4ED4A 2W01A 4NZ7A 2HMIA 3T9ZA 1F5AA 1S9FA 3C6TA 2HBRB 1RBLA 5AE3A 4R5PB 3EX7B 1HI1A 4WKRA 3H5YA 3M8ZA 3UDVA 1U8SA 4X4QA 2EFQA 4O44B 4J7CA 4X66J 1Q7LB 4I6WA 2RUSA 3LP2B 2BKOA 4F0MA 2G13A 3D6MB 4G1IA 5I3UB 2YPZA 5HJYA 3BPSP 3OFHA 2P9CA 2O66A 4Y2KA 4UY85 4CO1A 4EO8A 7FD1A 2DNLA 3DLEB 4FS1A 4I69A 2EC2A 3EGVA 2E9RX 5KT4A 1KWMA 2V69A 4LIWA 3UWTA 1SXLA 3LGHA 3MD3A 3DRSA 5CABA 3AODA 4RW7B 2WBMA 4K2XA 1VRTA 3JSBA 3H4DA 3IBCB 5KFOA 1S1VA 1GXUA 1LWFB 4P2XA 3O44A 1Q8IA 3CIMA 3HFVA 2C2KB 4NI2B 3MPUB 1KRPA 1X8DA 3W7BA 2MSTA 4QWDA 2C42A 1BC6A 5KFTA 4KAIA 4DWIA 4KGKA 3KLEB 2M52A 2ZUAA 4B3SF 4P52A 3US5A 3AA9A 3BN7A 4KPYA 1SPBP 3W9HA 3CDAA 2Y1JA 4RW4A 3C19A 2AU0A 4HVZA 2ZWOA 1CLFA 4HHUA 5KFYA 4WE1A 1UW4A 3K57A 2OMLA 2XMUA 3K0JA 4LF8J 2MLYA 2DNQA 2E66A 2N4CA 1RI7A 4LF5F 5DG8A 4F4YA 2NLWA 2A6OA 1Q4RA 2DK2A 5GVQA 5HO4A 4DV4F 2LKZA 4WFBQ 1S79A 3BR8A 1JXVA 1CQNA 5IZHA 4K4TA 4FYXB 5KFBA 2FVSA 4C7QA 2Q6CA 5CYQB 1EAYC 1SUQB 5AJ3F 4J9LA 1UTAA 4NXMF 1M1HA 4RPFA 1FO1A 2E5LF 2XCAA 2VPZB 1REGX 3GFYA 3N28A 4M5JA 3UW1A 4IOBA 2W9CA 3G6ES 1RZMA 3F41A 2DXFA 3J80U 2V4JA 4O23A 2QGFB 4KO0A 1ZTTA 3DRRB 4K2JA 3MMAB 3NAHA 3FMWA 4ED7A 2B0GA 2JFDA 2QT7A 2B9EA 1ZTWA 2RAQA 1MN7A 1FK9B 3MCMA 3C6TB 4DX6A 1YJTA 4DV0F 1XNRF 2FLOA 2R3VA 2H54B 3TR5A 4F04B 3V81B 1TMJA 1UPMB 3G4SS 4ED2A 2LQJA 2C1EB 3V4IA 2I1RA 3RZAA 4WWSA 2U1AA 1XWLA 2DTJA 4OFZA 2UXCJ 3J80Y 3I96A 2F8MA 2WSFC 1TFYA 2HNYA 4WCEQ 5GMEA 4Y0FA 2ATLA 1R8BA 1A9NB 1S1TA 4USMA 3ZNJ1 2UU9J 4I0WA 2L3MA 3OSPA 3O1LA 3M2VA 3FKBA 4FF2A 2FVQA 4ZVUB 2AKWB 4WP9A 5LSRA 1KVIA 1IKWB 3R5GA 4DR3F 2Z2YB 2MJNA 2XO7A 3R9LA 1RT1A 2DGOA 1ZOTA 3AFGA 4OZ1A 5DZ7A 7AT1B 1HWKA 1RT2A 1OSCA 4MKAA 2R8HA 1HYSB 3BBBA 4MFBB 1FD2A 2AEFA 3KLHB 3T6BA 1SL1A 3MM8A 1ULRA 5FDLA 1JLQA 2OPQA 4NLSA 4PQAA 2KYXA 3D54A 4B08A 4NE9C 5CCLA 4YFUA 4QIWD 2I5JA 4P9SA 3TA2A 1FRIA 4H4MB 2DHGA 3FGVA 4OZNA 3BS9A 3NOGA 3HZGA 1Q53A 4RNHA 1PGZA 4LRBA 1Y5LB 3CC7S 3GJSB 1SQEA 2UUTA 2DR7A 1Q8LA 2QV6A 5KT3A 2B6AA 4RO0A 1KVJA 4RUBA 2JEGA 3ILJA 4XIUA 5GAEU 1RP5A 1OYDA 4OV6A 3I0SA 5F8MA 3PYEA 4NA2A 2FLLA 1P1TA 4KH0B 4ICLA 4DR2F 3TUIC 2VZ9A 4DFKA 3QYYA 3PEHA 4ZN1A 3DU6A 2O5DA 3IGNA 4WIQA 3AOBA 2V6AA 2JLEA 4ECWA 4PXBA 2OTJS 5J2PB 1EP4A 3NLCA 2DEIA 4GKKF 5CCMA 2W2OP 3DI6A 2XMKA 2CPHA 4ZK7M 3A8EA 3NGDA 2V4JB 2HRUA 5D0RA 3W8PA 1TL3A 1ROFA 1X4GA 2Z2ZA 4QIEA 5D77A 1JNRB 1C0UB 1UZHA 4AT1B 4J9PA 3BZQA 3QGHA 1HR0F 2R7VA 4GO7X 3M05A 4L72B 2V34A 3V5RA 2EFVA 3OUYB 1QY7A 3Q8UA 2RKIB 3HD2A 5J1EB 2MPUA 3AQOA 3T9NA 2HIQA 4JV1A 2BACA 3QRPA 3V4IB 2IJNA 2JZ5A 1HMVA 1RXOB 1X4FA 1SIWB 2FJWA 4EBCA 2HVZA 2DHSA 2DEJA 4QOTA 2AX0A 1XEZA 5D0GA 2VONA 3CDBA 4X4RA 1RQ0A 2QL9B 2R42A 2XHWA 4OI1A 1KLNA 5KT6A 1IR2A 1MWQA 3C66A 2XEXA 3M2VB 1VQ7S 1N0VC 4ZJOA 4LF6J 4NCGB 3ET6B 3PEJA 1BQMA 2RD5C 4JBCA 2QE5A 1KS2A 5HMZA 4ELVA 4EZ9A 4ECVA 1YZ7A 4LRAA 3AAWB 1KQSR 3TZZA 4OYBA 2AGOA 1UJ4A 3DLKB 2BM1A 3MM6A 4PEOA 1U25A 1RHKB 3BYRA 3ITHB 5C2GA 4DL6A 3OR1A 1S9EA 2LP4A 4NLWA 5KFLA 1OPZA 5FDLB 3CD7A 4NLGA 2K7KA 2OPQB 4JI1J 2PDAA 1NDKA 1IWGA 1XK8A 4ECZA 4QR0A 2HRTA 1UVJA 2ZZNA 2I5JB 2J7UA 4IG0B 3KG0A 2F9JA 4ZVHA 3I5AA 4JI5J 3GIKA 1Y0HA 2RVJA 2Z2LA 5DLGA 3R97A 4RJVA 2HFNA 1U1PA 4EZ6A 3CJ8A 3M8RA 3G87A 4P7VA 2F63A 2VFSA 4WXOA 2ZDOA 3HXMA 2B6AB 4OHXA 2F9DA 1NM2A 4BC9A 2XULA 4CM0A 1T9YA 3K5MA 1UL3A 3AH6A 2L9DA 2YX1A 3I56S 2NYHA 2CWKA 4P2SA 5F8IA 5BYSA 6AT1B 5EN1A 4MIBA 4CT8A 3ZZUA 4CYUA 3MWBA 1C0TA 1RUSA 5ETVA 2V8PA 3IM9A 4CH0S 2RDJA 3GP9A 2UP1A 3QLHA 4GMKA 1QTMA 4C8KA 3ZTRA 1W26A 2V8DA 2HVIA 3DI6B 4DR6J 4LT6A 1YBTA 1DTQB 4OYZA 1AUDA 3OD2A 3KHGA 5F3ZA 1U1OA 4P2FA 2CUYA 4LRFA 2V4RA 1T05A 4Q8EA 1LWXA 2RHSB 3MAAB 4XK8C 3C14A 4FYVB 4K4WA 4UOFA 1HI0P 5LMNF 1HWJA 3I55S 1K0VA 1VBKA 2C2MB 3J81j 2QL7B 3D3BJ 3U02A 5KFXA 4FXDA 2EPIA 5DDQC 4KV8A 3MEKA 2V2ZA 1M5VC 1SC4B 3D6FB 2OGUA 2HHUA 4WK1A 2W1BA 4DF4A 2W2NP 1YZ6A 2FC8A 4USHA 4KHMA 2UVRA 4USWA 3O3LA 3MM9A 1RT3B 3FMBA 2P2CB 4LFCF 2FLPA 3WIVA 4ZJQA 3B54A 4YOEA 6FD1A 3FZ2A 1VQLS 1SKRA 4BC7A 4N7TA 2BV3A 1NSPA 4FXVA 4OX7A 5LOQA 2V5HG 3QZ8A 1J5EJ 1L3VA 1WC0A 2N3OA 4DQQA 4ZP9A 3DOLB 3AD9C 2V68A 2J0SD 4LF4F 2GS8A 4JV0A 4CLSA 2CXEA 1NDPA 2HW3A 1RBAA 4C0BA 2OELA 4DSLA 1OJ4A 4P72A 3UCGA 3RR7A 4YQWA 1T3OA 1DTTA 1WHWA 3GG1A 1H2TZ 3OR1B 4AD6A 3A8KA 4BCAA 2D74B 4W92B 2AZ3A 4EK2A 2I8EA 3PTWA 3ZNUA 2RF2A 3G86A 1EHWA 5A8KA 2MQQA 3RB0A 1HLWA 4KR0B 1NK6A 3HHLB 3RR8A 5DO2A 1U49A 4K5RA 1VJWA 2RHQB 3GV5B 4B3OB 3A1YG 3VF0B 2FQQB 2D3ZA 1NMEB 4C8LA 1GMUA 1F2HA 2XS7A 3GONA 4WU2A 2B9YA 4F4KA 1LFWA 1U0SA 3IO1A 2YWEA 2BVZA 4ZDNA 3ZZPA 3CJQA 2COLA 2MZQA 1Q79A 3J81U 1LKZA 4YDXA 3UD5A 4NLYA 1ZPVA 2NSCA 1GMWD 3ISND 4KTQA 2D1CA 1S1WA 2EEYA 1U02A 2HHTA 1GFWB 2E7VA 2HHQA 1KP6A 1HHQA 5H9EK 2YNGA 4I2QA 2D41A 1HHSA 2R7UA 3NOCA 2EFPA 4Y00A 2KYZA 3MECA 3BQ0A 3U1MA 1JNZB 4U8YA 5A6WA 3E01A 1T11A 4IFVA 2CPYA 2OMOA 4EUVA 3W64A 1VMBA 2QZ8A 2HK3A 3BDEA 3H0PA 1R6VA 2M4MA 1FKOA 3UN2A 3IAM9 2J8AA 3H59A 1Q86T 1TK5A 4NRUA 1VQPS 4DV0J 5AXLA 4OJ3A 2PD1A 4USIA 4A8OA 1GK8A 2VU5A 4WP3A 2ABYA 2B5JA 2YWGA 1JJ4A 3MM9B 2MZJA 4WP8A 2XC9A 1JLCA 1R43A 2ZJQQ 1RAJA 2Y1IA 1VRQC 2ZDPA 1AW0A 4UF4A 4OHWA 4HH1A 4RUHA 3RBDA 3KK2B 4FP9A 2WW4A 1JKHA 3WX4A 2LQ9A 1H73A 4PAAA 4LQ9A 3KUEA 5KFNA 3KLGB 4NZ6A 1MW7A 3R5AA 3CCUS 4JI2F 3QAEA 3D3CJ 2ZM6F 2JFKA 1YIJS 2VH7A 2QYGA 4HKQA 2G2ZA 3RRHA 4KGMA 3MAQA 3UPFA 4A8FA 1WF2A 4KQZA 4DFMA 1RA7A 2DH7A 1IBLJ 3AJ2A 1Y00A 2YNIA 1UJ5A 5HVFA 6FDRA 4MAKA 2M9KA 1X0FA 2CA9A 2XLKA 1BWVA 3QT5A 2B43A 4IFYB 3JYTB 1LXNA 2D3OR 5DG7A 4FZVA 2A1BA 1MMNA 2KXNB 2RU3A 4UY8T 4RL1A 3N6NA 3M30B 5H9FJ 2CG8A 1N88A 1M90T 4QR2A 3Q24A 2DT9A 4C6AA 3RAQA 2YNFB 4KBIA 1YDLA 1A6LA 4WFYA 3C46A 2OI2A 1XR5A 4OI4A 4DQSA 4ECXA 2XMTA 4I2PA 3SMZA 1RAIB 2H5JB 4DQPA 1IBMJ 1QVGR 5CD4A 3B82A 4DPOA 4C3MA 2J9DE 1FDAA 1F2GA 2OJ3A 3QRRA 3OL9A 3CCWA 1NKBA 1X9SA 3LO3A 2IC3A 5KFFA 1RT5A 5I42A 2MZTA 1RKJA 5LSLA 2HIYA 3OTCA 2YKMA 5HBMA 3MECB 3ZXWA 5DG9A 4NCBA 3E01B 3MMBA 2GJFA 2XY5A 1RT7B 3TZYA 2CQ2A 3PVXA 4FS2A 3HCXA 1XNQF 2V67A 1UKUA 3NNHA 5EUHA 1S12A 2B8PA 3POTB 3AB4B 2HHVA 3P5BP 4ZCLA 4KRWA 4TY8A 4USVA 2CQIA 1P27B 2MLZA 3T5LA 1PIEA 1HNIA 2B5JB 2HS4A 4N77A 3UDLA 4DG1A 2DIVA 2YWFA 1D8ZA 4I7FA 4FF4A 1OS5A 3NCRA 4OX9F 2UVWA 3ULHA 2HQCA 1YLXA 4GKJF 2J6UA 4O3NA 4NXNF 2B4PA 4A8XA 2KT3A 4CTAA 4I56A 4LFAF 2H4WB 4RU9A 4ER8A 2C3OA 4MMOA 2HPUA 4EWTA 4K4ZA 1VQ4S 4LF2A 3CDWA 3V6KA 1I51B 5D15A 4J9MA 2GO8A 3D2WA 5CH7B 3PJXA 3PR5B 4TU8A 4P75A 5KAKA 2YNIB 1W2BR 1BY9A 1WORA 4CZCA 3GMGA 5GAHI 1B3TA 4ZVSB 1X5PA 4F50A 2ASJA 2Z0GA 3H4BA 4X62J 2GMJA 3P45B 3A3NB 3BKFA 1UA0A 2IY5B 4C8YA 5KG1A 4OMFG 1OIAA 1H6KX 2X1FA 3DGPB 1N8RT 3HD1A 1IN0A 3NS6A 3GR0A 3L7PA 2HQFA 2B3TB 2Q1LA 2F8EX 3SCKE 2LMIA 5JXSA 1WC5A 2J0QD 4FF3A 3KWMA 4E2FB 2RIJA 1NJYA 3SYZA 1WTBA 4DUYJ 3I0RB 1FRXA 3I31A 1KTQA 1FX2A 3FUYA 3MM7B 4DR1J 4N47A 4NA1A 2RS2A 3BSCA 2AMCB 3HHEA 3HSDA 3TAMB 1JK9B 4ILLA 4O0NA 3MTKA 3JAMY 2F8HA 2BRKA 4NLUA 3I32A 2FJXA 1OSDA 1H3DA 4PWUA 3Q2TC 1JJHA 1SC3B 2KKHA 1YRTA 1X5SA 1IBKF 1SKWA 1YVFA 4F0HA 3CDEA 2U2FA 3CMAS 1SQFA 4KE5A 4FVCA 1I6JA 1MMLA 3Q8YA 1P9YA 2IC3B 4DU7A 1DFDA 3RU0A 2JEJA 2FHJD 4DEZA 2LEAA 3PKYA 1VQSA 3GCXP 5HBMB 3KJQB 4ZIVA 2GAGC 3IA0A 3MMBB 2EKNA 2VBWA 4QIFA 4DR5J 4YR3A 3H5UA 2WAQD 4X4UA 1NZAA 4B3RJ 9ATCB 3SQGA 5LMNJ 4CH1A 2UVUA 1YJ9S 3HMJG 2R2SA 1RT6A 1U1KA 3GFXA 2AZ1A 3HVTA 5CHCB 3M6UA 2NPFA 3N79A 3U7JA 3QAUA 2H48B 2PFDA 1HARA 1NZ8A 2UXDF 1UWBB 4I7FB 3EGNA 2W2QP 2AHOB 3GIMA 1R3NA 4DX5A 5C7PA 3EYZA 2JC0A 4K4SA 5LJ3Y 2GGPA 2KZZA 4CTAB 4P10A 2BA9A 1ZETA 3NXZA 3GYXB 1T7PA 2DNPA 4GC7A 1ZM4A 4C2MA 3DCAA 1EB0A 3IGVA 4NYPA 2OO4A 2EBGA 1E6YA 1UW9A 2MZRA 1U0HB 4YB7A 4IRCA 5E33A 3R27A 5HLFA 5DQIA 1Q7YT 3OL8A 2ILYA 2DGWA 3M8PB 4DX7A 3RB6A 3GPAA 4UOCA 5F8HA 5DQHA 4KSEB 1Z2LA 4A8YA 4ED0A 3HF5A 5C2CA 1F0XA 3HVRA 3IWNC 1RT4A 2ZH2A 3D6HB 2XS5A 1NUEA 2KM8C 4WYWA 1ZAVA 1BXNA 4M5IA 4FYDA 2NUHA 2OP5A 1LWCB 4FKYA 3FQLA 2BM0A 4YB6A 1X4BA 2GIRA 2R7TA 1S4FA 1SJ1A 1TQLA 1YKWA 3KMSA 4MTPA 2HWIA 1JXEA 5M2PA 1D1UA 1WNEA 1LNQA 3VZHA 1V6HA 1RTHB 5CAAA 3OLAA 3VZIA 4AXJA 4CM2A 3BSOA 5EDWA 1JLAA 3T1HJ 5A8WB 3Q8SB 2PA8D 3DLLQ 1WC6A 3ZO7A 4CCHA 4IH5A 4LR7A 1KSPA 4LF9J 3MUVP 4DR4F 3KLIA 1FE4A 2DRAA 4F02A 3SV3A 1HPZB 2DD8S 5L1KA 4MT1A 4OYXA 3W62A 4TXSA 4ZA1A 1PILA 1REVA 2HRYA 5EWGA 1ZZFA 3HLUA 3DLHA 2RILA 2C2EA 3X1LB 1N5YA 2N82B 1EARA 5LM7E 2W2PP 1B7FA 2RRNA 2KVQE 1GXTA 4YN3B 4DDFA 2O3DA 4R0JA 1NRKA 5H9FK 2ZH7A 2IYGA 4MK9A 2E5HA 1F3VA 1C1BB 2WVBA 4OYMA 2G0JA 1TELA 4X84A 1GMVA 1U1MA 2ACYA 4B9VA 3MM5B 1MROA 4QCLA 4HL9A 4DXLA 1HNXF 4DUZF 1ZYQA 1KLMB 3HVTB 1NKEA 3SV4A 3TAPA 5KFGA 2DO0A 4N41A 2IPOB 4JI3J 2MGZA 4YMEA 2J7WA 1JJ2R 4ZCMA 3EZ5A 2AT1B 2JLFA 1NSKL 1TKXA 3I4HX 5HVGA 4RW8B 1X31C 2VG5B 2BUNA 3MCNA 3FNNA 4Q2LA 5KT2A 4H54A 3DN9A 1NJXA 2YXLA 1TV6A 1E6YB 2B4VA 1I94F 3FRYA 4JUZA 4IOCQ 1XBWA 3TX0A 1IKXB 3BGRA 2GQQA 4PXEA 1MN9A 4Y2IA 3TRGA 9RUBA 5F0UA 4EBEA 4MK7A 3NKYA 3BJYA 4JI7F 5IM0B 4ILRA 3TQ1A 2YKPA 2XHCA 5C42B 1WJ9A 2IDLA 2HZVA 3HPOA 1H7XA 1X5TA 2C2OB 2DR9A 2J6TA 1FHTA 2YNHB 2P8IA 3V6DA 1VK8A 5AT1B 5IV4A 1P6TA 2GVZA 3KNAA 3VAJA 1PAEX 3ILIA 2VC1A 2DISA 3T41A 3RBEA 2PA3A 3TWZA 2ZE2A 2CPZA 1BLUA 1YK9A 2W7AA 4RBTA 4RNOA 2XWYA 3ZZRA 2PN6A 2K1RA 1HQUA 4MYTA 3DXBA 3Q8QB 3CCES 1TL1B 4DSFA 3WDOA 1KQFB 5KG4A 4CT9A 5BR8J 4FVMA 4DV1J 3KLFA 2W25A 1IKVB 4HH0A 1UCNA 5HK4A 3DOKB 3ISZA 1T02A 3HKZD 3DNCA 1CG2A 4MIWA 3VAIA 8RUCA 1T9XA 3D6TB 2UUBF 3T1AA 2R7OA 4MH8A 8ATCB 4LRDA 2YH1A 5HI7A 3J7A1 5HVHA 1S1UB 3KG1A 4YHHF 3MURP 2ILZA 4PG5A 4ANCA 2DGXA 2XM3A 3VGTA 3D0HE 4AE5A 2M0GB 3PX6A 4UUWA 5KFQA 3NWRA 2IM0A 3I4PA 4ZP8A 5JVHQ 3BPDA 3JS9A 2VBZA 1TVRA 2GVDB 2XG8A 3DM2A 3TVYA 2UUAJ 2OUGA 1LK5A 2HQDA 3TAQA 2APOA 5D0EA 1S4EA 4X66F 1RABB 4UZBA 4ZPVR 1WKJA 2HGLA 1RTJA 1TKTA 3A8IA 1WG5A 4R25A 3TQEA 4QYZJ 2WVCA 4LR9A 1FRJA 4C4WA 2G1HA 1H2VZ 3PM9A 2AYGA 3OTOJ 3N5BA 4OX9J 1FXLA 5B08A 1V3RA 2UXBJ 4DS5A 3OFEA 3QJLA 1QD1A 3W8GA 2VG7B 2R8JA 2HLUA 1BE4A 5AE1A 2DGVA 3RRKA 4DJBA 3X3UA 3WX8A 1VBXA 4YR2A 2YKNB 4LSLA 5DETA 1P8GA 1SJ3P 4MK8A 2L9WA 3PRDA 2I0XA 3FBEA 5L39A 3THVA 3DRPA 2EW9A 2XMVA 1NHKL 4LSNA 2IIHA 1DURA 2RUGA 3CF5Q 3V6DB 1KHVA 3OR2A 1Q0NA 4RNMA 1TAQA 3J7AN 3CJTA 1IWAA 4Q0BB 1RISA 2DY9A 4CQ1A 2GJ2A 1Z1ZA 3CC2S 1QDUB 4CO0A 1GX5A 4KKOA 1YG0A 2W9AA 4HLBA 2BJ3A 1RWMB 5D4OA 3HP6A 4DL2A 2QA4G 3M8WA 3CJKA 4CO5A 4LF8F 2KFZA 1NH7A 2O01C 4ANDA 2VOPA 3W9JA 3FEXB 1CJUA 1EKRA 4DL4A 1DLOA 1NHVA 1HQ2A 1IQZA 3K8VA 3MEEA 3IM8A 1J27A 3W2VA 4F3OA 1C1CA 1QSYA 4ZLJA 3K5OA 4EO6A 2A0FB 3OLBA 4J9NA 4A8QA 1HBMB 2PE8A 4OZ2A 2P6TA 1IM6A 5GADI 2E44A 2HFUA 3B4MA 3BB5A 4DI6A 4G1QB 1FE0A 5IFMA 1DARA 3MR2A 1HBOB 2EG2A 5RUBA 3RRGA 2C3MA 2ZD1A 1TL7B 3K58A 1RHJB 4NLDA 3VVTA 2CRLA 5J2MB 2VA2A 3C6UB 2CJAA 1RAGB 2EXUA 4DLGA 3WBZA 5J2NA 4USJC 4CLPA 2DB1A 2FUG9 3TVZA 5E3RA 2CJKA 3NGUA 1HWIA 5DM6Q 2WSCC 3PRVA 3G8QA 1R7IA 3QSYB 5KFZA 4HACB 4IH7A 2FHJA 1U8WA 4UTGA 2HEKA 1X4AA 1X4CA 2PFFB 4YR0A 2CNKB 3OJUA 3QIDA 3S7RA 1M1KT 1N36J 3R2CJ 1HBNA 3OQ2A 3Q2SC 1TKTB 4IH6A 1VJQA 1NK9A 1F5BA 2HWHA 2BE2A 2UU9F 3V2UC 4UUXA 1WI6A 5ETLA 2AF6A 2HFSA 4WKYA 3RW7A 2CVIA 2CPIA 1FVSA 1Q95G 1FXDA 1AA1B 1JIHA 4BLGA 2VG6A 2F40A 3TI0A 2LU1A 2J9CA 2YWHA 1UZDA 2BR0A 1NK0A 2LA4A 1WEYA 3M1VA 2F4FA 3PX0A 5HANA 4RU2A 3GSDA 4LSNB 1FT8A 4KJIA 4FBUA 4U7CA 4OHVA 1YJVA 4Y3CA 4CLUA 4U67Q 3LA0A 3CW2C 2RDDA 1URNA 2CQHA 3PCOB 4QWAA 2RRAA 3OR2B 1VQKS 2QIFA 2DR6A 4P6QA 3MHYA 3IP0A 3RTVA 3K8WA 3D0IE 3GJTB 4RLEA 2PO4A 4PQUA 3MI7X 2V4QA 5ETKA 1VQ9S 2GHWA 4JOUA 1TL4A 2YQ3A 1RACB 5IT9U 3PO5A 3GFHA 1T9UA 2BQRA 1HNZJ 3MTJA 3VQTA 2PI5A 2HQ3A 2G2YA 1JB0C 1G2EA 3MEEB 2HHXA 4R8UA 4KT0C 3BBCA 2ASLA 3NWGA 1C1CB 4N56A 2IJFA 1SL0A 2GMHA 3U1NA 2JL9A 4CO4A 2KHDA 1SI9A 3MEDA 3KFWX 1NAQA 2CFXA 2GMLA 3G6YA 4DR4J 3GFZA 2AJFE 4ECRA 2HGMA 4WTOB 1WWHA 2ZD1B 3PXGa 2C2DA 2FY1A 2Z8QA 4EYHB 1WHXA 3WQPA 4Q7AA 3O6QA 1AROP 4NCAA 5EX0A 2IM2A 1R8AA 4LMZA 5ETTA 3HSGA 1WSVA 2HZCA 3TJAA 3UFCX 2OFGX 4AXIA 2JH3A 2D3UA 1VGYA 2AYMA 1TKZA 2ZHOA 1VIOA 3F0NA 2XMJA 3KJVB 5LT5A 3TARA 4AL7A 3RGIA 3G82A 1HQEB 5D4NA 1GAOA 4IR9A 4AQYJ 4DCPB 3NS5A 3MR5A 3M7VA 3TP2A 4ZPCA 2VQFJ 2Z57B 4MYUA 2KO1A 4L6V3 3PYFA 4C8NA 1EKSA 3UN3A 1HNXJ 1HBNB 3HHNB 4XO0A 3T6JA 2HWTA 1O6XA 3VTIA 3TZWA 2R7QA 3CWJA 1OY9A 5KT7A 3C8YA 3Q8VA 1SH2A 2VV5A 1S49A 3Q23A 4ZOSA 1TZ0A 1UMJA 3KHLA 2L41A 4LF6F 1TMMA 3KK1A 1X4DA 2LXUA 3ZZ0A 1N5VA 3CXCR 4RNNA 2B8QA 2ZUGA 2XS2A 1S5ZA 5ETSA 4ZPWR 2VG6B 1JLBA 3HFKA 3JTNA 2C2NA 2DGUA 4HDHA 2L08A 3CO9A 5KFKA 1EX8A 3VHQA 1AUSL 1ZH5A 1ZA2B 5IS2A 2R7XA 3PJWA 1XERA 3VAMA 1NDCA 2EKYA 3BH6B 3JTPA 2AEMA 2DGQA 2L48A 2GA7A 2GHVC 3JQMA 3M9OB 1IBCB 2YQ1A 1UVLA 2QEXS 5DDPC 3F56A 2JWNA 4PQUB 4CH7A 4JI1F 3O5TB 1KOHA 3PIPQ 4KC5A 4B17A 2MKKA 5HROA 2VUGA 4NOHA 5L46A 1X4EA 4PUOA 4J9UE 2AJ2A 4DPYA 1UVMA 2FYXA 4OJGA 4QIVA 2LECA 3W60A 2J0XA 4I1TA 4JI5F 1P9QC 3CPWR 2AJ4A 5F8LA 5KFCA 2HLTA 2CJ9A 3NBPA 2J8SA 1TUVA 4W98A 3MR7A 1FNMA 4DFJA 3DMJB 1G1XA 4L3NA 3CJ4A 4Q5VA 3M8SA 1E6VA 3KTQA 4DN0A 2VC0A 3L7UA 4N8NA 3OVBA 1V5VA 3GWCA 4ETXA 3D7SB 3NG8A 3UNYA 4DF8A 3T1YJ 2DPJA 3EGWB 5M2RA 2WVEA 1JLGA 4QWBA 5DRKA 4M5DA 2AYBA 2QYCA 2MY7A 1CJTB 3DDNA 5SZTA 4U95A 1OQ3A 2KT5A 1M5SA 4WZQA 1IM4A 4DR6F 4XPEA 1A0OB 2UUBJ 3I87A 2EK1A 1SKUB 3N5FA 2B9WA 4JI6F 2KJWA 4OJ1A 1B0PA 2MQMA 1T3NA 1HWLA 1W7WA 4LUBA 3TEGA 1LW0A 4FF1A 3SIPB 3IAS9 1AZSA 4OI3A 2EFGA 1QE1A 1Q5VA 5B0EA 3CD0A 3TUZC 2IAJA 2OPRB 2MLXA 2MQ8A 3Q8PB 1N0UA 3DRXA 2CQCA 1O51A 2JNJA 1LFPA 1C4AA 2I9SA 2YTCA 1ZM9A 1VLOA 3BSAA 5BXIA 3BQ2A 2DJWA 4WBFA 4MKVA 1OMSA 3LP1A 1T94A 1PAUB 3DYAA 2PT0A 2F4VJ 3OT9A 5F0WA 2W9BB 5I4MA 1WACA 1S1XA 2M7SA 4CO2A 5B0GA 2F65A 4NLPA 3E8OA 1FKAF 1GTEA 3HI9A 4Y28C 4ZKAA 2V2QA 3KYLA 4OLOA 4NRTA 2MKHA 2OD6A 4DL3A 1Y7PA 3E2EA 4A4JA 1S0MA 3QGIA 5M2UA 1JWWA 4B9LA 1J5EF 5CZXA 3C15A 2EWHA 3K17A 3EMTA 1FDDA 3QGPA 2HNZA 2QMXA 3M2RA 4C0HA 5HQ8A 2QLFB 5AXNA 2HSEB 4X65J 5DS7A 3D1HA 1H38A 4QR1A 1XC9A 4HYKA 3CUNA 4NLRA 1SB6A 4M5GA 4ZP7A 3AY0A 3M8QB 3HK2A 1NPRA 2W4DA 1YWXA 3R1LA 5EWEA 4F25A 1HKAA 2HFVA 4DSIA 3EXCX 4DU8A 2PEHA 3FRZA 2KB2A 2IA6A 5A8RB 2W8KA 1FTCA 1S6QB 4DZ6A 1R8CA 5C25A 3IG1A 2R2UA 4RW9A 1DJ0A 2IDEA 2LVWA 4H4OA 1GEHA 4WJBA 4KFBB 2E5GA 1N4LA 1Q1KA 1T03A 1WSRA 1XMBA 4IOAQ 2HS0A 2CADA 3FDSA 2VF3A 2HHWA 3C16A 1S76D 2QMUB 2ZKTA 4C48A 4K0KJ 1SV5A 1NJWA 3HDSA 3EE3A 1DRZA 2HNDB 3MEGB 4P7TA 4DL7A 3CO0P 2EBEA 2KT2A 1Y4ZB 4M5DB 2V94A 1D09B 3GILA 5ETOA 1K9MT 4NMXA 3IRXB 3NY0A 4X4PA 4K8RA 1TUWA 1YHQS 3O8WA 1JX4A 3CJSA 3DOMB 1Y10A 3IS9A 1LW0B 5J1NA 2KM8B 3H42A 3T3FA 1M5HA 1QE1B 2LA6A 5HAOA 1RTDA 2A2CA 2V8HA 4DSJA 1QJHA 2DITA 3KG4A 2X1GA 3PV8A 2CZVC 1I5OB 2CYYA 4DPUA 4WYLA 2G0CA 2VJUA 5T7LA 1LQ9A 3EVOA 2M8DB 2DGTA 4OIXA 1S9GA 2ROEA 2HMIB 1OQ6A 5HQLA 3KHHA 2MHEA 2OEMA 5EWFA 4FKXA 4U7UD 3OTEA 1RKIA 1WD6A 2WOMA 3M6XA 5F9NA 2MEWA 2R8KA 4X4TA 4F2RA 4G3IA 1YGYA 5KFMA 4DN9A 1V5IB 3D5MA 1R27B 4C3KA 2HFOA 1YJUA 2YH0A 4DX8H 5KG2A 4LIRA 3N4WA 4USUA 3DKDA 1TUGB 3JSRA 3C15B 2X1BA 1NDLA 5LL6d 4I67A 1PJ7A 2ZVSA 1CSJA 2N7YA 3FCWA 1NPKA 3QWPA 3M2RB 2BYCA 3UQSA 3LANA 3NP5A 3DRSB 1S77D 1JQGA 1VRTB 1IBLF 2WONA 2VPXB 4PXCA 1SC1B 4O3OA 1S1VB 2MKIA 3GV7B 2YWWA 3L4BC 2XSFA 4E8UA 4QJVA 3I82A 1S0NA 2AP6A 2ZOFA 2A2DA 3W61A 2Z4PA 5C24A 4USTA 1U48A 4U7UK 3QMQA 2CQ0A 2CPXA 1B64A 2J9DA 4JI0J 1XJWB 4DV5J 5C25B 2IA0A 4RW4B 4AL6A 4DCJB 3K89A 1MNEA 4WE1B 4NLQA 3CDUA 1WF1A 1HBUA 3TJ8A 1T03B 3AJDA 3MOZA 4HR2A 4C9DA 4UOGA 4DS4A 2AWZA 1FEHA 3T5KA 2H51B 5GAEI 2DIUA 5H9EJ 2CPFA 4DR7J 2E5JA 2IVMA 5LMUF 3NCQA 1SKSA 1QAYA 3R5CA 3OW2R 2QLJB 2H65B 4YUDA 2Y9HA 1IBMF 3KLVA 1YI2S 1SQGA 2K2PA 2IRUA 3RJMB 2NREA 3R7NB 4J9KA 4ES3A 3H7HB 3UDCA 1VQOS 4K4UA 2BX6A 2KI2A 5K14A 4M1KA 5HP1A 3N9UC 4HDGA 1UWAA 2ZOGA 4RWWA 4KGZB 3AHPA 3M32A 2W9CB 3UVJA 4QU6A 1MG7A 1PO6A 3CGIA 2LEPA 4KO0B 2D9OA 2HBYB 2A18A 3PW0A 5KT5A 2ZH6A 1M5OC 1HL6A 3M9MB 2CJQA 1S9GB 2KFYA 4P73A 4J9QA 2ZKUA 4OLPA 3B4DA 2UUCJ 1KEKA 1WC1A 4B3TF 2BEFA 2GFFA 2CZ9A 3LPYA 2E1PA 4ZLNA 4A8KA 2C2RA 2JEFA 5GADU 1WOPA 3W5ZA 1FJGJ 4ZVGA 2FHKA 3CE8A 1QSSA 4A8WA 5HL7Q 2HNYB 2QA2A 1R0AA 1S1TB 3AD8C 4C11A 1F60B 2ZBRA 2JLGA 3C3LA 3H8YA 2CAJA 1UEKA 5DLFA 3AB2B 4O3QA 2YWKA 4DCOB 4ZVRB 1QAJA 1L5UA 3PKMA 3O2IA 1RT1B 2H4YB 1WKKA 4X2BA 2ZH3A 3FBCA 5B0BA 4Y34A 1Q16B 2K8GA 1RBOB 3W2WA 1RT2B 3QIPA 3MD1A 1CS4A 5DGAA 4X62F 2ROGA 3BEGB 1RTIA 3HULA 3UE2A 4L74A 3MM8B 4WFZA 2LQBA 1JLQB 4F67A 4DZDA 1UFWA 2H1YA 1UFLA 4DV3J 1SC6A 4ZJLA 4LF7J 4ID5A 3VCDA 2RRBA 1S59A 4ED1A 1F6TA 4EI2A 4TU9A 3SFGA 2HAIA 3OV7A 2DXEA 1B70B 4DUYF 4FDFA 2ZH9A 1FFWB 2KHCA 1SL2A 2Q43A 4FNIA 5GMDA 3OL6A 1VRUA 3IRWP 4DR1F 1H7WA 4RKUC 2OLWA 2MXYA 4ZVFA 3GSIA 1N33J 3FFIA 5E3QA 4OYAA 4M5KA 1P1LA 2QJ3A 4ENOA 1UP1A 3I0SB 1RYSA 1RHUB 4O3RA 2OPSA 3GIJA 4J9OA 4ICLB 3TOQA 1RLDA 1EIYB 5ETRA 2ZBCA 3K5PA 2CZ4A 2DHXA 3CMES 5JJBA 3KK3A 5KTQA 5HP1B 2LQ8A 2NXUA 3CCZA 3QWUA 5CA5A 4YY3F 4JYAF 4DL5A 5E3AA 2B7CB 1EP4B 4YB5A 2IBKA 4UOHA 3JXOA 3RBZA 3QQCD 1D9AA 1JMTA 3BO2A 1G3OA 4JI6J 2KG1A 4IO9Q 3I5BA 5KFRA 1TL3B 2H5EA 1FDNA 1U45A 1VQ6S 4PR6A 4RBVA 2H9ZA 3SSQA 3P5TL 1L3KA 4DR5F 3WC2A 2GC8A 2FZCB 1U09A 1NNDA 2VFUA 4B3RF 1VISA 3PW2A 2NSBA 1MU2A 1KN6A 4Q43A 4MKBA 2OPPA 1IJFB 3JSYA 4V19X 4TU7A 2BABA 2VL1A 4U96A 4B9TA 1EZZB 4M94A 4Q8FA 1RGVA 4ITSA 1HMVB 1KC8T 1SJRA 2AV5A 2GNKA 2J5AA 2XNRA 5IT4A 2DH9A 2B9XA 1VK3A 1JLFA 2F3JA 4JV5J 2IM3A 2BANA 2KRBA 2HHHJ 1BQMB 2VOOA 3GYNA 4CLWA 2DNRA 1RHMB 4WK3A 1RB0A 4JB8B 2GIQA 5BJRA 3FQKA 3BH7B 1XMOF 1S72S 3UDEA 1LW2A 2GQCA 3MM6B 2PMWA 2OSQA 1EETA 2GW8A 3MMCA 2JDJA 2UVVA 2HBZB 4C97A 1W25A 3MFHA 1S9EB 4X64J 1SJ4P 3K5LA 4R5PA 4ALZA 1ZM3A 4F36A 3SQOP 4BBYA 4O44A 2R2TA 2MZSA 4ID5B 2XMMA 2DNYA 4F3QA 4RX6A 1J5OA 3TA1A 5IXUA 1SIZA 3LP2A 5H1SV 2XZTB 3PW4A 2Z56B 5CD4H 4ZVQB 1K8AT 3T1HF 3KUHA 3DLEA 1X9MA 3CNQP 4QWEA 1OO0B 4F4AA 1FVQA 3W66A 3FSIA 2HHPA 1FI4A 2XB2D 2FGCA 4LF9F 3THTA 5IOLA 3T19A 3LPEA 4ED3A 2DPIA 2VQEJ 4RW7A 3VAHA 3GIIA 2Y8YA 4J9SA 3BN4A 1FWPA 1VHFA 1FD8A 5K5MA 3SCJE 2QTWA 2ZBPA 3AXKA 5KFSA 4CYUB 1Q78A 1VCTA 1C0TB 1XMQJ 1RTZA 4NI2A 3HKWA 3VWSA 3BGLA 3QLHB 1GX6A 5DGBA 2DGSA 4PG6A 2ZH5A 3BR9A 1OPIA 3HHLD 3KLEA 4I4BA 4TYAA 3OBIA 2HVHA 2WTFA 2JVRA 3RBXA 2IHR1 4NLOA 4P71A 2AD9A 4DSKA 4OZ5A 1T05B 2DKOB 4ID8A 4DL0C 3C14B 1FDBA 2NQPA 2CPEA 3FC9A 2DHHA 1QSLA 4ECSA 5CYMA 1VBYA 1FFSB 4UQGA 3P49B 2RMLA 2GJIA 4DV2J 1PC4A 3KDOA 1NLKL 2R2RA 4C98A 1GT8A 4JI3F 4CNYA 4KV8B 3MDFA 4LFBJ 5IWAJ 3BGOP 3HZEA 2BRLA 3MAHA 5CYQA 3J7ZT 2PC6A 5HQMA 4IO1A 3EDQB 3G96A 3BDPA 2ZJPQ 5KG7A 4GO5X 1PG5B 3QBCA 2GIFA 1S6OA 1V9OA 4ATNA 4JI8J 4LBHA 1Y3KA 2CPDA 3PG9A 5J2QA 2Z58B 2HVDA 2ZNYA 3DDKA 1RCXB 1VC5A 1NB7A 2GHPA 4OI6A 1TK0A 2H3EB 3MMAA 2HK2A 3ZZZA 2XI3A 3D0GE 1ZAXA 1F5CA 1DTTB 3M6VA 3GJQB 4N76A 4DOZA 3GCWP 1FTRA 1FK9A 1LXJA 2ZNZA 3S6EA 2AIRB 2Y8WA 4PG8A 1WI8A 2MKJA 3V81A 4BWMA 2A3JA 2RF2B 2GQ2A 5E0OA 1J5OB 2RU9A 5A8KB 2FY8A 4DV6J 2YKOA 3FVYA 1Q8BA 3ENQA 4NEZA 4N5SA 5E3PA 1IKYA 1VIXA 5JVGQ 3V6HA 3AD7C 4V1Ak 1VHIA 4M5NA 1HI8A 3L9ZA 2RJZA 2XTJP 1KTVA 1U24A 1TK8A 1PYSB 5BR8F 3W63A 4ZCKA 3HT3A 4DV1F 3DHXA 1HHTP 1IKWA 1CBKA 1KBRA 2KRRA 2FB0A 4L73A 4KIAA 3QPIA 1ACMB 5LMUJ 3PHEA 1FWKA 1LEOA 1F9HA 3G71S 1H98A 3BO4A 3CSKA 4ECUA 1U2RA 3FBBA 4FYWB 3D66A 1HIYA 1GH8A 2CDRB 4PRFA 1HYSA 3OTDA 4OZ0A 1RWKB 4MFBA 4KY3A 3KLHA 1Y3JA 1S1WB 1SCJB 2RQMA 2CJXB 1N34J 2EI5A 2AEJA 5L1JA 1X4HA 1WC3A 2G4BA 1WUUA 4QZVB 4F4ZA 3HJFA 1FFGB 2YNGB 2PI4A 2EFOA 2VJVA 4I2QB 5CYMB 4H4MA 2HQIA 2V0NA 2GZOA 1U47A 2LQ5A 2ADBA 4LVNP 2NZ4A 1F1BB 4IFVB 2BJ1A 1RU2A 2N3LA 2BE9B 2C3YA 1FJ7A 2UUAF 3RYLA 5B0AA 1D3WA 2CQ1A 4NLVA 3V6JA 1FKOB 3MPDA 2CDQA 2QFIA 2DNHA 3VGSA 4B3TJ 1KFSA 1HA1A 2X3DA 1RAOA 4OYOA 4WU3A 4Z7CA 1YITS 3SXLA 4CLLA 3OTOF 4JI4F 1JLCB 4USKA 2UXBF 2LYVA 2BW2A 1A7GE 4NLTA 5J2PA 2OTLS 5J2QB 1JKHB 2UV8G 3DFEA 1D9DA 3KOAA 3DGVA 2MB0B 2VICA 1Y5NB 4ZLPA 1TR0A 2HZAA 2HGNA 1VQYA 1C0UA 1IR0A 3MCOA 1DQ9A 1PJ5A 1K44A 3ZTQA 1CULA 4QU7A 4I64A 1KQGB 3OUYA 1ZZNA 1CC7A 4J90A 2RKIA 5J1EA 5DJBA 3FCHA 2RQ4A 4K50A 3HSZA 2CWXA 3SSRA 1RADB 3DLGA 3JAMU 2MQOA 3ENVA 4M5MA 1ZA1B 1WKLA 1CVJA 3BKUA 2XLIA 3EWGA 1JJCB 3QT6A 5IQQA 4ZHRA 1BHNA 4LRCA 2DY1A 1IKYB 4I6AA 1JLEA 4OV1A 2VPWB 1SJQA 3Q86A 1M1GA 4PWDA 5B0FA 3PFOA 1U7LA 3GE9A 1CJKA 1RWUA 3PYDA 4NCGA 3ET6A 3PIOQ 3R7SB 2I38A 2DBBA 1RHRB 2KFNA 4P74A 1K1QA 1XN9A 2ERRA 1BQXA 4HT7A 4O0IA 3PW5A 3DLKA 5I3QA 1XQIA 2MHNA 3TYTA 1WELA 4I2PB 1UEVA 4EMDA 3ITHA 3VALA 2ZH4A 1PSDA 1RJJA 3CD5A 3HSJA 3LWMA 2QSFA 2N7CA 4JYAJ 4YY3J 2Y0BB 2WCXA 4OX8A 1PBAA 3JSMA 1RT5B 4IG0A 2EFNA 5U47A 4ZLLA 5I42B 3AXMA 1U2CA 3DHWC 2YKMB 2F7VA 5D4LA 4Q44A 3LW5C 3HO1A 4JP8A 3H5SA 2RSQA 3K59A 2P6SA 3UN5A 1EJ7L 4PCQA 3R7BB 4M5HA 4LBPA 4QPTA 1N36F 3VQSA 2W2MP 4WFNQ 4RZRA 1OWXA 1SVDA 2RE1A 3IBWA 3WHIA 5L1IA 4LVOP 4TY8B 2FPHX 2WBRA 2CNLB 1HNIB 5F8NA 2UUWA 4TKTA 4DG1B 2BJDA 2EG1A 1YJWS 4YEAA 3SI8A 2IMWP 4PPDA 2FVCA 2NS1B 2F1FA 4RNFA 4KHPJ 5CQGA 2XSJA 1U26A 3CMQA 3H2UB 5CYJA 1PBUA 4NX9A 2QLWA 2RQKA 3TJ9A 2BZ2A 1I3OB 2E9TA 1DTQA 2V63A 4DHVA 2HQGA 4OHZA 3QT8A 1PYTA 4ZPDA 5EGYA 3EZOA 1F9FA 1JXLA 3BBFA 3MAAA 4H4KC 1VC0A 1BQNA 3CCMS 3TVKA 1CULB 3MF5A 1PJ6A 3K2YA 4PYAA 2IVFB 2DCLA 4X4SA 4LREA 3HT0A 4TN2A 1XMOJ 2GX8A 3OJSA 2R7SA 3L09A 4I6YA 2RB7A 4X4VA 2FTRA 3DLGB 2PGCA 2ASYA 1HD1A 1FWLA 3HJVA 4JV2A 4ZHRB 4PG7A 2R7RA 5DZ6A 1HNZF 3LWLA 1JLEB 5K8PA 2DNZA 3TZXA 5A2QU 1RT3A 4PWDB 1WEXA 4A47A 3I9ZA 4WF9Q 3ENAA 1CJKB 5LXRA 4UW2A 5KG6A 1Z2ZA 1M5KC 2FZGB 3RAXA 2AYEA 1D9FA 2M70A 2OEJA 3DC2A 4F4WA 4URSA 3DOLA 4FPRA 3HVWA 4M5LA 1DQ8A 3HX9A 2FJDB 3OHBA 5DQGA 2AJ0A 3MFIA 3ZZYA 3CCTA 4DPWA 3GJRB 3N0VA 4QPXA 5A2QY 3CJ5A 5ETPA 2XGQA 4AL5A 2J76E 2XNQA 2VODA 2RH3A 3TUJC 4B9UA 1DZ5A 3IBFB 3JSMB 1TFWA 4J37A 1UAWA 3MGJA 1N6QA 1GMWA 1K0TA 3HHLA 4B3OA 3MZIA 4AQYF 2E1MC 2J0WA 1T8EA 1VR6A 1Q81T 2VQFF 3MPWA 2ATCB 3SQGB 2W8LA 3AOAA 3A3OB 1RT6B 2E7WA 3IR7B 1R8HA 2XZWA 2XWXA 2YKAA 4ED6A 3RW6A 3QO9A 1GNKA 3K5NA 4F7VA 3OVAA 3R8YA 2XSJB 4ECYA 4HEA9 2GGPB 1LK7A 4KH1B 4B9NA 1T0TV 4XDDA 2SXLA 3TUPA 3FCVA 2RS8A 3QRQA 3LGNA 4W90B 4L76A 4R0EA 2D9PA 5HLFB 4B9MA 4TYBA 3UNGC 1BQNB 4ELUA 3MUTP 5GAGI 2BKPA 3RG6A 3FK4A 2E1AA 4B9SA 1N32J 2XMAA 4TQSA 4QW8A 3J7YI 8AT1B 2VFTA 1MMDA 1QAXA 3GB0A 1R6YA 1RT4B 1L3TA 1F9EB 1FESA 1UVNA 2RQCA 3HHDA 2AQ4A 3W9IA 3L95X 1U1RA 1HNWF 3KKFA 1DAXA 3SCIE 1QUPA 1NBEB 3HHKA 5IV3A 4M8LA 2IM1A 2KXHA 1RHQB 1XIQA 4K59A 4O3SA 4F2SA 2AJ1A 1UPPA 2ZBIA 2JSXA 2MMYA 3KK2A 4OI2A 1JLAB 4YP3A 5KG3A 4IRKA 1O8BA 3KLGA 2CQPA 2IVYA 2MQNA 3T1YF 5AXKA 3KLIB 3A3PB 1C4CA 3ICLA 2BJ9A 5FJ4A 5L9NA 2CNOB 3AA8A 3GQCA 2MKCA 5EX3A 1REVB 4KPCA 1KONA 3ILLA 1KVKA 1N5YB 2DH8A 3MPYA 3CCVS 5C5JA 4ZVEA 3SSSA 4LBIA 2CIMA 1R89A 3D1QA 4K4XA 4UQTA 4BWJA 3IXQA 4IFYA 3JYTA 4NEYA 1N6QB 4B3SJ 5MAOA 4F3MA 4TQRA 1X0PA 2OEKA 4RW6A 3TA0A 3FBFA 1KQKA 1KKHA 3H98A 3OFFA 1C2PA 1R31A 2CQ3A 3EPIA 3M30A 3CCSS 1MROB 4ZMMA 2MSSA 4DMZA 2WVDA 5KFIA 1D8YA 2GV1A 3ZFVA 4C3LA 2J7KA 2QA4S 2VFRA 5ADZA 4J9RA 1ZAWA 4O4RA 4IQXA 3SDEA 4ZPBA 2F4VF 3VR1A 4LF5J 1RSCA 2YNFA 4ECQA 3P4UB 4DV4J 1RLCL 2MGZB 3OXFA 2C28A 3K7RA 3H40A 2QC3A 3QFHA 3L7OA 3QO9B 4E98A 2W4CA 3MMJA 4ZVOB 1TKXB 3LH2S 1RAFB 2ZHBA 4C8OA 1ZPWX 5AJ3J 4NXMJ 3I9V9 4C8MA 2E5LJ 2CNNB 2QSWA 4K7QA 1TV6B 4JI4J 4D3GA 4OJHA 3OTBA 2XGPA 3BGRB 1RAHB 1NB2A 3MR3A 2KDOA 3VAFA 3JB9k 1WOOA 2NXEA 4X65F 1VLYA 3PX4A 2LLZA 3GZ7A 2BJ8A 3M2UA 4UZCA 3J81Y 3Q0AA 1X5OA 1RT7A 1Z4UA 1KR4A 3PO4A 4EFAC 2YBVA 3LUYA 2E7XA 2KU7A 5LJ5Y 3D9BA 2XO6A 2GVZB 3POTA 1YBUA 3QNWB 2VFVA 1XNRJ 1W2IA 1ZBTA 2ZE2B 3M6WA 2HHSA 4Y2MA 3N01A 2FJBB 5BYRA 4WXWA 4RR5A 3FEYB 2K1RB 1HQUB 1AB8A 4ETZA 3D4JA 2OHDA 2XCPA 2FJAB 5KFVA 5E41A 1AFIA 2K06A 1U6BA 5KFUA 4DQRA 1N54B 3PACA 4K0KF 3CCRS 2BJ7A 1S57A 2B4UA 3UD3P 3KLFB 3EM1A 5F41A 1AT1B 2KZMA 4PXDA 4IR1A 4Y6IA 2NUUG 4CLKA 4DR3J 1L3SA 1V3ZA 2E9ZA 4IQMA 4RUCA 2XI2A 1YJNS 1UFKA 1B7YB 3EDRB 1BGXT
chains in the Genus database with same CATH topology
1EETB 4AXJA 3MMCB 1IUJA 5HL7Q 2HNYB 1X9WA 2QA2A 1R0AA 3BSOA 5EDWA 4QIGA 1S1TB 4NZ7A 1VQMS 2IBOA 2HMIA 1JLAA 3T9ZA 1F5AA 5A8WB 2PA8D 4C11A 3Q8SB 3EPGA 3DLLQ 1F60B 1S9FA 3FSXA 2JLGA 3C3LA 3BF4A 3H8YA 3C6TA 4ERDA 4CCHA 4IH5A 2A10A 5AE3A 4R5PB 3EX7B 4EBDA 5L1LA 1HI1A 4WKRA 5DLFA 1KSPA 3H5YA 1U8SA 3AB2B 4X4QA 3MUVP 4DR4F 3KLIA 2EFQA 5T41A 1FE4A 2DRAA 2IRYA 4O3QA 4O44B 4F02A 2YWKA 4RW6B 3DGPA 3CEDA 1QAJA 1L5UA 3SV3A 3PY8A 1HPZB 2DD8S 5L1KA 1Q7LB 3PKMA 3O2IA 4LQ3A 2C3UA 4TXSA 1RT1B 3OSNA 4I6WA 2WSEC 3CVKA 3LP2B 1PILA 1REVA 2HRYA 4ZA1A 3RB4A 3NMAA 5EWGA 4X2BA 2ZH3A 2G13A 5B0BA 4G1IA 5I3UB 2DCUB 4Y34A 1ZZFA 1Q16B 3OFHA 4Z37A 3HLUA 3DLHA 2P9CA 2B4OA 2FIUA 2K8GA 3W2WA 2RILA 2C2EA 1RT2B 3X1LB 4WFAQ 2O66A 3QIPA 5A0YA 1N5YA 3MD1A 4Y2KA 2N82B 3I0RA 4UY85 4CO1A 4EO8A 1QVFR 7FD1A 5DGAA 1HNVA 2DNLA 3DLEB 4NL5A 4FS1A 3SDEB 1TVRB 2M88A 4X62F 1B7FA 2ROGA 2RRNA 3BEGB 1RTIA 4I69A 3MM7A 2E9RX 3DM2B 5KT4A 1GXTA 2DNKA 3UE2A 2MQLA 3MM8B 4DDFA 4LIWA 4WFZA 3UWTA 2LQBA 2O3DA 5B0DA 1JLQB 2OH2A 1SXLA 4R0JA 1NRKA 3TAMA 2FVPA 4F67A 2ZH7A 3MD3A 3DRSA 1UFWA 4RW7B 2IYGA 2WBMA 1UFLA 2E5HA 4MK9A 1C1BB 1SC6A 4ID5A 3VCDA 4K2XA 2RRBA 4TY9A 1VRTA 3JSBA 4ED1A 3H4DA 4BDPA 4X84A 1RTJB 5KFOA 1U1MA 2ACYA 2DNNA 4TU9A 2R9LA 4B9VA 1S1VA 3SFGA 1GXUA 2HAIA 3OV7A 3MM5B 1LWFB 1MROA 4QCLA 3O44A 1Q8IA 4DUYF 2ZH9A 3LAKA 3CIMA 2KHCA 1TFWA 1SL2A 2Q43A 4HL9A 4M95A 4FNIA 1HNXF 3OL6A 1KRPA 1PC5A 1X8DA 1VRUA 3W7BA 2MSTA 4QWDA 2C42A 1H7WA 4Q45A 3IRWP 4DUZF 4DR1F 1BC6A 5KFTA 1KLMB 3HVTB 2OLWA 4KGKA 4KAIA 4RKUC 3SV4A 2MXYA 3KLEB 1ZYQA 3TAPA 1NKEA 4ZVFA 3QGGA 5KFGA 2M52A 3OHAA 4B3SF 2KTQA 3US5A 2DO0A 3AA9A 3BN7A 2GO9A 4N41A 1UVIA 3SCLE 3FFIA 5E3QA 4YMEA 2J7WA 2MGZA 2PSZA 4KPYA 1JJ2R 4ZCMA 3CDAA 1P1LA 4LSLB 3EZ5A 4RW4A 2Y1JA 1UP1A 2JLFA 3I0SB 2K3IA 2AU0A 1RYSA 1TKXA 4HVZA 3I4HX 1CLFA 5KFYA 4O3RA 4WE1A 1UW4A 3M2UB 1WHYA 4RW8B 2VG5B 1UA1A 2BUNA 3K57A 3DRPB 2OPSA 2OMLA 3FNNA 2XMUA 3GIJA 3K0JA 4J9OA 4Q2LA 5KT2A 4H54A 4ICLB 3TOQA 2DNQA 3UCZP 1YTYA 3DN9A 1S0VA 2ZBCA 2ZFHA 3K5PA 2JHEA 2CZ4A 2DHXA 1NJXA 5JJBA 3KK3A 2DVIA 2E66A 5KTQA 3CMES 2N4CA 1TV6A 4I68A 1E6YB 1RI7A 5HP1B 4LF5F 2NXUA 5CA5A 2B4VA 3CCZA 3QWUA 4YY3F 5DG8A 4DL5A 5E3AA 1I94F 2B7CB 4F4YA 3FRYA 1RK8A 4JUZA 4IOCQ 2NLWA 1EP4B 4YB5A 1XBWA 4XDCA 2IBKA 1Q4RA 2DK2A 2JJ4D 5GVQA 5HO4A 4DV4F 1IKXB 3BGRA 2GQQA 1N5SA 4PXEA 2LKZA 4Y2IA 4A46A 4WFBQ 3TRGA 1S79A 3BR8A 4JI0F 1CQNA 2R4FA 4DV5F 4KKOB 1D9AA 1JMTA 3BO2A 5HN0A 5F0UA 1G3OA 5IZHA 4EBEA 4MK7A 1GXLA 4K4TA 2FGOA 3NKYA 2KG1A 1UWBA 3BJYA 2KVIA 4JI7F 5IM0B 4ILRA 4IO9Q 3TQ1A 3I5BA 5KFRA 1TL3B 7FDRA 2YKPA 2H5EA 1FDNA 5KFBA 1U45A 4PR6A 1VQ6S 4RBVA 2H9ZA 3SSQA 3P5TL 3CJKB 5C42B 2FVSA 4C7QA 1L3KA 2Q6CA 3TANA 2WHOA 5CYQB 1FXRA 3HPOA 2GC8A 4DR5F 3WC2A 4QYRA 1U09A 1SUQB 1NNDA 2VFUA 4B3RF 1H7XA 1X5TA 2FJEB 5AJ3F 4J9LA 1S99A 4NXMF 1B0VA 1DBDA 2DR9A 1FO1A 2J6TA 3PW2A 1FHTA 1DLOB 2E5LF 2YNHB 3V6DA 4EU0A 1VK8A 2NSBA 1S0OA 2XCAA 4PG4A 1MU2A 2VPZB 1KN6A 3GFYA 4Q43A 1P6TA 3N28A 4MKBA 4DR7F 2OPPA 3UW1A 3W2VB 3VAJA 3KNAA 1IJFB 3JSYA 2VC1A 4V19X 2DISA 4TU7A 2BABA 2HG4A 2VL1A 4IOBA 3RBEA 5KOXA 2W9CA 4B9TA 3G6ES 3FEZA 1KFDA 3F41A 2PA3A 4M94A 2P5VA 2ZE2A 2ZOMA 4Q8FA 1FJCA 1RGVA 4NWBA 2V4JA 4O23A 2CPZA 2R8GA 1BLUA 4KO0A 4IG3A 4ITSA 1HMVB 1ZTTA 3MR6A 1KC8T 3M8PA 1SJRA 3DRRB 2OAUA 2AV5A 2W7AA 3MMAB 2GNKA 5B0CA 1ELOA 4RBTA 2J5AA 4RNOA 2XNRA 2XWYA 3ZZRA 2PN6A 2K1RA 1HQUA 3NAHA 4MYTA 5IT4A 2DH9A 3CD6S 3FMWA 2B9XA 3DXBA 2B0GA 4ED7A 1VK3A 3Q8QB 2JFDA 2QT7A 3CCES 1JLFA 4NYZA 2F3JA 1ZTWA 1TL1B 2IM3A 2BANA 5FLXY 4DSFA 1FK9B 3HVAA 2KRBA 3C6TB 4CI0B 3WDOA 1KQFB 1TKDA 2VBYA 1YJTA 1BQMB 4A8MP 3DLBA 2VOOA 2LU2A 5KG4A 4DV0F 1XNRF 3GYNA 4CT9A 2FLOA 4F4XA 3TR5A 4FVMA 2DNRA 2BJEA 1LWCA 3V81B 3G4SS 5J2NB 5GAHU 4WK3A 3KLFA 2W25A 2LXIA 5HMWA 4ED2A 2LQJA 2GIQA 3V4IA 1IKVB 2I1RA 3RZAA 2U1AA 4HH0A 3KMQA 1XWLA 5BJRA 2DTJA 3DOKB 3FQKA 3ISZA 1T02A 3HKZD 1XMOF 1IQTA 3DNCA 2QMWA 4IDKA 1CG2A 4OFZA 3PR4A 1S72S 3J80Y 1KNZA 4MIWA 1LW2A 3VAKA 1RTHA 2GQCA 3PFEA 4EGLA 3MM6B 3VAIA 2OSQA 3I96A 2F8MA 2WSFC 1EETA 2GW8A 3MMCA 5A0YB 1TFYA 2HNYA 2JDJA 2UUBF 3T1AA 4WCEQ 2ATLA 4Y0FA 2R7OA 4MH8A 1R8BA 1HNVB 4EYIB 1A9NB 1S1TA 1XR6A 2UVVA 2DHAA 4I0WA 2L3MA 4NMLA 3O1LA 3OSPA 2UUCF 5MLCV 4C97A 1W25A 3M2VA 5A8WA 3FJ2A 4FF2A 3MFHA 4FN5A 3OXGA 1S9EB 2YH1A 2FVQA 1SJ4P 3K5LA 5HI7A 4R5PA 4ALZA 3G8TA 1ZM3A 3J7A1 3G8SA 1S1UB 3KG1A 5LSRA 1KVIA 4BBYA 4YHHF 3MURP 2ILZA 1IKWB 4O44A 2R2TA 4PG5A 4DR3F 2MZSA 4ID5B 2I2YA 2MJNA 2XMMA 2DNYA 2FDNA 2DGXA 1HPZA 2XO7A 2FHMA 1O5JA 4F3QA 4RX6A 1J5OA 3SEOA 3TA1A 1FJGF 5IXUA 1RT1A 4B02A 2DGOA 2RDIA 1SIZA 3D0HE 3LP2A 5H1SV 1ZOTA 2V9WA 4AE5A 3ZC4A 1CQMA 2YX4A 2BE2B 2M0GB 4OZ1A 3PX6A 4UUWA 5KFQA 3PW4A 1HWKA 2IFXA