2OTJV

13-deoxytedanolide bound to the large subunit of haloarcula marismortui
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
65
structure length
65
Chain Sequence
b'TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal RNA
publication title The Structures of Antibiotics Bound to the E Site Region of the 50 S Ribosomal Subunit of Haloarcula marismortui: 13-Deoxytedanolide and Girodazole.
pubmed doi rcsb
molecule tags Ribosome
total genus 23
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2007-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2otjV00
1N8RW 3OW2U 1VQLV 3CCLV 1VQ5V 2OTJV 3CXCU 1R73A 1YJNV 1S72V 3G71V 3CCVV 1VQ7V 1YJWV 1JJ2U 2D3OW 3CD6V 1VQNV 3CCSV 1W2BU 1VQ9V 1K8AW 1QVFU 3CC7V 3I56V 4WFAV 1VQ6V 3CCQV 1YIJV 1Q82W 1M90W 1VQPV 1QVGU 1VQ8V 1YI2V 3CC2V 4WCEV 1YITV 3G6EV 2QEXV 1VQMV 1KD1W 3G4SV 1K9MW 3CMEV 3CCMV 1Q7YW 3CC4V 1M1KW 2QA4V 3CCEV 3CCJV 3CMAV 1VQOV 1K73W 1NJIW 4WF9V 1VQ4V 1YHQV 3CCUV 4WFBV 3CPWU 3I55V 3CCRV 1KC8W 1Q81W 5DM6V 1YJ9V 1VQKV 1Q86W 1KQSU 2OTLV
chains in the Genus database with same CATH superfamily
3TGUH 3IFXA 3HKCA 2EZPA 4DUZO 3FX7A 1AR4A 2BOBC 2DE0X 2Y0PA 4PJ0Z 4RAIA 3ZCCA 4JI8B 1LNQA 1AJPA 3L75H 3JD2A 1P84F 1GN2A 4K8XA 1VQLV 1SZXA 1N34O 2OTJV 2KKWA 5KHKA 4H13B 3CD6V 2QTSA 4P30A 5LYJA 3A0HZ 4B7KA 3B09A 3ZMVA 3ABMC 4O2AA 3ZIAG 2P06A 2P4VA 3K58A 2O57A 2E74B 2ZE6A 2E76B 3JAMN 3FB8C 4MVUA 4DW0A 4DV6O 1RM1C 2KG7B 2N04A 4J11A 1PV0A 2YC0A 1R6TA 3ZJZA 4LF9O 5EZYA 2XAJA 4O4LB 1SQGA 1XEQA 3JARB 4QIWF 4P2ZA 3AG2B 2H8PC 4JTDB 3NR7A 1QHTA 5E1AC 3UQ8A 1P7GA 2HR3A 3ABTA 3OR7C 2WLIB 5LMNB 2B9ZA 4CS4A 1JMKC 4FJCC 3STLC 3ZRVA 1ENVA 1ZAUA 3HKDB 4GKKO 3JATA 2OTLV 1K3EA 1OCZC 4H44B 5LHIA 5LBQA 4LFCO 5LP6B 3SYQA 4MVQA 4MS2A 3SYOA 1NR1A 2CGNA 1YTFD 3K08A 3CRQA 1SKVA 2PY5A 4MTGA 1NTKH 2Q5ZA 3BABA 4Z1MG 1WPXA 3H01A 4EEQA 2R9IA 2UUBO 1FS0G 4TV9A 5LHGA 2H94A 1VF7A 2AHZA 4CC6A 4FFBB 3SPIA 1SF9A 1K9MW 1BZKA 1XNQB 3RBZA 3IC7A 4FPPA 3ZN0A 2KB1A 3KZIZ 2IU3A 2EULA 3VQWA 4X64O 1AI4A 1OCRB 4YY3B 3BA8A 3TETA 3D3QA 3QF7A 4KXRA 2X6CA 2Y0IA 5AG2A 1XMQB 1QLNA 4JI6O 1BGYH 1R3KC 3AK3A 1KKCA 1JR9A 3OW2U 2UXCO 1R73A 3PJSK 5LHHA 1JJ2U 1HR0B 3CRMA 1S0VA 5H6RA 4ZOLB 1EZJA 4LR3A 3ZS8C 4JI5B 1QVGU 4JI0B 1L8DA 1SRYA 3HR0A 4DK1A 1H2KA 4LF7O 1ZX3A 1N34B 1FYJA 1K5SA 3ABLB 1XILA 1VARA 5BMVB 1LR1A 2A3QA 3E8BA 3K04A 3JD3A 2QM7A 1G4YB 3SPGA 1AP5A 3K0DA 1GM8A 4IYIA 2JS3A 2JGUA 3AG7A 2QWQB 1Y76B 3T4DA 2Y48A 3MHHC 4N21A 3OE7G 4JI1O 1YCIA 3SYPA 1NI8A 4ZI7B 1VQ5V 5KHIA 1BQ0A 3K3WA 3G80A 3CE2A 2YEVA 2GHYA 2E75B 3AG3B 4PI2A 2CTWA 3Q4HB 5JCOA 5IJ9B 2BTQA 1WA8B 1PNKA 5IWAO 4WFHA 5B3SB 1ZSPA 4PDRA 3ASNB 3K57A 1FXKC 4JAVA 2YXYA 1N32O 4CZZA 4XDLA 4R6ZA 3RN4A 1SQFA 2K9PA 3FD9A 3H9VA 3ZHUA 4CC5A 1NTZH 4LFBO 4LFAB 1Q7YW 1IBLO 4HNAB 5J2TA 2UUBB 2PYJA 1Z2GA 1K73W 1IBMO 5EC2C 4BIOA 3APOA 3UM7A 4FLXA 3MAQA 2ZM6O 2ZR2A 2OCCC 4PHZA 2DQ0A 2D3OW 1Q6UA 3B2EE 4X88A 2XASA 1XMOB 1FXKA 3UKMA 1VMGA 3B8NA 3JASA 5BR8O 3ML0A 5IDJA 1GK9A 1R6NA 1I94O 4UVAA 4DUYO 3WU2Z 4X62O 1Y6XA 4G27B 4BAYA 3MDSA 1K4CC 3J7AU 2XAQA 2ZXWB 5D5PA 3H1JH 2EIJC 4FFKA 1SQQH 3F7YC 3ZMUA 2FMLA 2DYSC 3CCVV 4JZGA 4ZHQB 2Y69B 3DC5A 4J7JA 4O4IA 4X1YB 5JQGB 3H1IH 4TOIA 2ADPA 2Q7HA 4PDMA 1YI2V 4DV0B 2AHYA 3OGIB 3N2KA 2UXCB 3K5OA 3N2GA 3SYAA 2P7TC 1OCOC 3CCEV 4ASUG 3OMIB 1Y66A 3X2QB 2UUAO 5CBFA 3HPLC 4H33A 2QE7G 2HJFC 3K5NA 1WP8A 4DR5B 2JRIA 3JALA 2VWJA 1CPYA 5B1AC 2PGGA 3DTUB 5FNVA 1N4CA 1Q81W 5DM6V 1XHZA 1IX9A 2AZ0A 4OPHA 5H5NA 2YDEA 1EZVH 2HKOA 1I08A 1SQVH 4X89A 5J2UA 1K8AW 3C90A 1WP7A 4YJ3B 4O2BA 2LW7A 3KG2A 1WAZA 1QU7A 3CCMV 2HHHO 1U96A 1GN3A 1LUWA 3AG4B 1D5NA 1S76D 3DXRA 3OR6C 2L6LA 3MHSC 5IYCO 2ARHA 2Q9LA 4MW8A 5CA3A 2NNUA 1ZTEA 3ETEA 4NKGB 3AK1A 1JVMA 3L71H 3CCSV 3JAKA 1SZTA 4UCOA 2XHBA 1O9HA 4YXWG 1YIJV 1I5XA 2UXXA 4JI3O 2PI4A 1N32B 1NT2B 4PA4A 4UCUA 2AZ2A 4I55B 2LO1A 3OGCC 4JAUA 2WA4A 2Y4UA 5H2FZ 4LWSB 5LXTA 4FMTA 5E79Z 2WAMA 3QO7A 3BFRA 4JGSA 3D36C 2BCCH 1IBLB 1HNWB 1GH6A 4DV1O 5FL7G 4I0XB 4LF4O 4JI4O 1IBMB 1QQCA 2LFRA 1U97A 3P30A 2ZM6B 4WFFA 3W7XA 3IJ4A 5GTHZ 2AGAA 2ITDC 4FLUA 2DMXA 3CRCA 5BR8B 1SETA 2Q67A 4F6EA 2Q4PA 4UXNA 4DUYB 3UCSC 3UT5B 3K59A 5DECA 1IVSA 3WG7C 1D2DA 1JX9A 1RPRA 2JJ2G 4DV3O 1FXVA 3D36A 5LGTA 2XT9A 5KA5A 2UUCO 2R70A 4YIPA 1NJIW 4DV4O 1VQ6V 2HVKC 4KHPB 3CYOA 3AG2C 5CA1B 2WPDG 3M7MX 3E86A 4H37A 1SQXH 2UUAB 4TV8B 3U11A 3EHBB 1XI1A 1N36B 2OCHA 2IH3C 1TAEA 2UXBO 1T5EA 3F5WC 1XUQA 5LP6C 2KG7A 3ZEDA 4ZIBA 4ICGA 2UXNA 1F51A 4F6RB 1K97A 1PD3A 2GV9A 3OM3B 3OUFA 4D7TA 3JARA 4X1KA 1K92A 5FLXN 4YHHO 2A0LA 2Y4TA 1YHQV 2WLIA 5EC1C 5IYZB 2V7QG 2ZQMA 1NH2B 2YXLA 1XNRO 4PA6A 3L70H 1PNLA 4YJ2B 1NVPB 1FKAO 4B3RB 3L73H 3QO8A 2IJJA 2RDCA 4FLYA 2LP7A 3K0GA 4FZ0A 3SPHA 3W7SA 5CA0A 3CMEV 1R3LC 1AR1B 4MT8A 2RNBA 3SDLA 2DW4A 4EB6B 5L3FA 1OCRC 4NXMB 4TQDA 4NR1A 4DR1O 1VQNV 1M56B 3FAVB 2IJIA 1VQ8V 1NZ6A 4KFMA 4RQFA 4FFBA 4X66B 2LFSA 3AG1B 4B3TO 3JAWB 4QGPA 1VF5B 2WLMA 3CCUV 1K7DA 4MVZA 1G1XB 1F7YA 4U7NA 5H6QA 3SPCA 4JTAB 4LP8A 1V54B 1QLEC 2VQEB 4PV1B 3CJHB 5IY5B 3ABLC 3C3SA 1DK1A 2V4DA 4X9QA 4B08A 1KYOF 4NXNO 4DR2O 2NLJC 4FM1A 3KCYA 1K4DC 2WWWA 3CRRA 2Z3YA 1ZWIC 3OTOB 2UUCB 2ZKOA 3ZRWB 4DV4B 4WBNA 2BSKB 2ZD9A 4AHCA 2P5OA 1R3IC 3QO5A 1MSDA 2FL4A 1CP9A 2UXDB 4DR6O 1AI6A 4H0LB 4UFZA 1N33B 2DWEC 2E5LO 4O4JB 1ZUQA 2OYQA 1S5HC 4NVPA 4MW3A 4LF6B 5BXZA 3RW0A 1AI5A 2CAZC 1L0LH 4UV8A 1KD1W 1NBMG 3ASNC 4EFBA 1VQOV 1HNXO 3W7WA 3JD0A 5EBLC 3E8GA 1A32A 1L0NH 2W6IG 3THOA 5JVDB 2HEPA 1KKDA 4ZI7A 2F93B 2WLHA 3O9OA 5JH7B 3LSQA 4K0KO 1TVKA 3ZX6A 4XDJA 5LA6B 3CB2A 5TISZ 1WPBA 5IJ9A 4GKJO 1WA8A 3WB2A 3LUTB 4X8AA 2ADQB 1MNGA 4Q6GA 4I50A 5DEDA 2YIDA 4JF3A 4RUFA 3E2EA 1VP7A 3I5DA 3BEHA 2A7WA 3STZC 1XDCA 4X20B 3ABKC 1DF5A 1H8HG 1BHAA 2CUGA 4G28B 1YITV 3S3XA 1AI7A 1KBHA 1HDJA 4EFEA 3LDDA 3FFQA 2A79B 1NR7A 3ZMTA 3RYHB 4J9YB 1WB8A 2LQTA 4O4HB 1D5AA 2EIMC 5L3GA 4A5UB 1JOYA 5L3DA 1Z5WA 5CN0A 5KMGB 2XNDG 1IURA 4B3TB 4UV9A 4DO2A 4FM2A 2HLDG 2JEXA 3KKYA 4CH3A 4DR3O 4QE7A 1WB7A 4DUZB 2VRZA 2HJDA 2EZOA 3LNNA 3HKCB 3VBBA 3SYCA 3QG5A 2ITCC 3RFRA 4JYAO 4JYCA 3JCUZ 4ZHQA 1HW7A 4GX0A 4NXNB 5IYBO 3EXAA 3FKSG 5JQGA 2HFEC 3CCRV 3K06A 1E1QG 1Y74B 1COWG 1YVWA 1FAFA 4WFEA 5LYJB 2LW1A 4HAMA 3E8HA 1WNSA 4DV6B 4LBEC 4J41A 2QR4A 1M90W 2HP8A 5GW7A 4X1IA 3AG4C 4LF9B 1BE3H 2JEUA 1PM9A 2P6JA 4PELA 1PNMA 4DW1A 5EZYB 1KQSU 5KHGA 2WLKA 2KSDA 2Q8VA 2GDSA 3B77A 1FD9A 3U0ZA 2CK3G 4N23A 2F43G 1GTOA 2GTSA 2L35A 4UCTA 4MTXA 4GKKB 2YIBD 1DF4A 1S3JA 4YJ3A 4ZKIA 3SJAC 1IBKO 1B06A 1TUBB 4LFCB 2EINB 3BHPA 4K0KB 1RM1B 4B3SO 2YSUB 3LDCA 2Z0AA 2QM8A 3VOUA 1VQPV 4LNUB 3HKBA 4DV7O 3GVMA 2YI9A 4OPAA 4GUNA 4WF9V 1JA8A 1PP9H 4TV9B 2ZE8A 4TWKA 4UB6Z 4FLZA 1Q5OA 4LWSA 4WFGA 1TA8A 3CXCU 2YIBA 1OCZB 1P7BA 2X7RB 4CH4A 2BE3A 5GONA 4BW5A 1G6UA 1GO3F 2VQFO 3UO2A 3RYFB 5A2QN 3A0RA 4X64B 2FB5A 3HKEB 3HB3B 1YTFB 1WN7A 4JZ2A 1KMIZ 4CBCA 3OEEG 5KX5A 5KUMA 3E8FA 3H1KH 4DR3B 1AR5A 1EN5A 4JI6B 4E4EA 3RGBA 5B66Z 1M1KW 5C8YA 3OFNG 3CPWU 1R6KA 1MA1A 4YIOA 2ZIMA 5HFMA 2F66C 1THZA 4LF7B 2NN4A 1TUEB 1EBOA 3I56V 4FIPC 4JTCB 3WB0A 1RFYA 2ILMA 1JFFA 2VWKA 3F5TA 1IXBA 3GB7C 1E79G 2QM4A 4DYLA 3QTCA 5KAFZ 4TSFG 3L72H 3LSSA 1PL4A 1SQBH 4JI1B 1EN4A 4U3JB 2XOKG 2R72A 3ZN1A 2XAFA 3JYCA 2CTQA 2Q7EA 2QEXV 1J5EO 4FVMA 2IJKA 2QA4V 5HFLA 5IYDO 4EKWA 5CB4A 2YXHA 3BA9A 4DR7O 3JSNA 3RYCA 1IZ3A 3K03A 2F95B 3WB1A 5LOVB 1M56C 1V55B 4JYYA 3T4ZA 3AEIA 2Q7GA 4QE9A 5EBWC 2BTQB 4GX1A 1XOUA 2F23A 4NTWA 5IWAB 4YJ2A 2YI8A 4B3SB 3AG1C 5CMUA 4FLTA 5IJ0A 1CXZB 2JS5A 1AJNA 2B5UA 3EFFK 4GZRB 3SJQC 3TJTA 4FK5C 4J7ZA 1I7FA 5BZBA 2QWPB 4IIJB 2GSMB 1V9PA 2GTAA 1M5IA 3CCLV 4DV2O 4LFBB 4J80A 4LC1A 5B1OA 2QKAA 5IY5C 2RQ6A 4LF5O 4TUYA 1MABG 4DV5O 3FAVA 2ZCEA 1SA0A 4CH6A 4NTYA 1PL0A 2YS8A 3GWOA 5ITZB 4AILC 2QWNB 3OMNB 3RT3C 4UCSA 2N74A 3SJBC 3JAWA 4HZ3A 4FLVA 2P90A 3RYIA 2YIAA 1QNMA 3B4SA 2CH7B 1FXKB 4BIZA 1I94B 2JJ1G 3JASB 4X62B 1DGSA 5LL6Y 3GWKC 5GTIZ 2DOSA 3IGAC 2QDOA 1RSOB 2EX3A 2IW5A 1Z5VA 3ZRSA 2DJVA 3ETGA 2EJRA 3ZHTA 2EJ7A 3ETDA 1QCEA 2N05A 1HNZO 2P4KA 2ATKC 3VQYA 2EBOA 4B3MO 4JI8O 5JWPA 2GBOA 2QSAA 2CE4A 2OCCB 4LH7A 5J9PC 3P32A 4JPRA 2WA3A 2RN9A 3ZRWA 3OAAG 1VQMV 3AK2A 5L3CA 3SJCC 3TXSA 1N8RW 1MZFA 2EIKB 2EIJB 3CSXA 4MVSA 1AILA 1VQ9V 4O4JA 2HG5C 3JD4A 2CDYA 1BSMA 4O4LA 1N0JA 2ZDIC 2G38A 3CHXA 1H2NA 2MK3A 1NQTA 1VIBA 2UU9O 1XL6A 2IH1C 1NU1H 2PTMA 4RQEA 5C93A 5FPRA 2IBZH 5LMNO 5J2UB 5K1XA 1FJGO 4JAAA 3BVOA 3HKDA 4IT5A 4KUMA 4O2BB 5JVDA 2HHHB 1H2GA 4QNHB 3BAAA 1GM9A 4OXSA 5LP6A 5JH7A 1OV9A 3DXRB 4B7EA 1YDXA 4FZ1A 2LGWA 4GCZA 5B1AB 1MZEA 2ZDIA 4RWUA 2VS0A 4R7CA 5B1BB 1LUVA 5B1NA 4JI3B 3BRCA 1M9NA 3T1CA 1Y4MA 5IT9N 2RCVA 3G67A 2PYLA 4GLXA 3ZMZA 1S77D 1H2SB 3MD0A 1P4RA 1BT8A 4X20A 5LXTB 2ZINA 1ORQC 2V1DA 2M7WA 2OWOA 5EK0A 2WLLB 1F23A 4IYHA 3D8CA 4DV1B 4E2LA 3P3PA 4LF4B 1ROPA 4JI4B 3RYHA 5JJJB 1CEZA 5EYPB 3SPJA 1XNQO 2RJZA 3ZHRA 2AW9A 4DK0A 2IU0A 1NKDA 1M57B 3ASOB 2PF4E 3DSQA 4J42A 2MW2B 3JCZA 1J95A 1PKXA 1M93A 3LNMB 4YY3O 1SESA 2XUMA 1GAXA 5D5QA 1FFXB 1OCCB 1B6QA 1WJZA 3E83A 4BR6A 3EVKA 1OJHA 1XMQO 4DV3B 4PA7A 4Q20A 4I7ZB 1BHBA 5KHHA 1URFA 2EILB 2OIGA 1HNZB 3FB5C 4OX9O 4UVBA 2D2CB 2RMKB 4RUEA 3E89A 4ZOLA 1HR0O 4B3MB 1XQ8A 1ZL8B 2M6YA 4JI5O 4JI0O 1KC8W 4TQFA 3R66A 4L87A 4MTOA 2JK5C 2E3CA 3IC9A 1Q8IA 1Y74A 5BMVA 3ZHSA 3AG3C 2WLNA 2P22C 3CC7V 1NS1A 2UXBB 4I4TB 2FTKA 2B1GA 3WG7B 4ZBMA 5IE9A 2X6BA 3G6EV 1Q43A 2EINC 4I9WA 4UCRA 1Y76A 4D6TH 1X4TA 5B3SC 4J10A 3CMAV 3E22B 2R9AA 5KA6A 2JVDA 1QR8A 1QBZA 2LJ2A 3RWRD 2ZNIA 4DRXB 4OGQB 4I5SA 2UU9B 2HVJC 2ZR3A 4Z1VA 4X1KB 4YHHB 2PI5A 4DXWA 3APQA 1OHHG 3A8TA 1FJGB 3CC4V 3D3IA 4R8CA 3Q4HA 3VQXA 1XNRB 3PN1A 1XBLA 3OEHG 1TUBA 1PPJH 4HBNA 1IDSA 4UUJC 5CA0B 2JGDB 1MOFA 2AXTZ 3U10A 1P49A 3FYIB 3CS5A 2P67A 2ZXWC 4LNUA 1JCHA 5FPOA 5LGUA 4DR1B 1SC5B 3LSUA 1UFIA 2W6JG 3KCXA 4HNAA 1VF6C 4K8ZA 1HWYA 4LFAO 3BY6A 2WSSG 3NXSA 4W4KA 2Y69C 2CGOA 1W2BU 1RP3B 2CTPA 3SGIA 1K5QA 3FB6C 2K1EA 4IHJB 2GUZB 3X2QC 4UCVA 1AP6A 1XMOO 3RYFA 2XAGA 2QWRB 2ZT9B 3HKEA 2QGNA 1FFTB 4W4LA 4JV5O 1H38A 3BCCH 1VF6A 3RVZA 1AVMA 1JQ0A 4X1YA 3ZBHA 4DR2B 4P9OA 1G8MA 5H9CA 3W7TA 1EFRG 2Z5UA 4DV0O 4OX9B 4WBNB 2DYRB 2PZSA 4X65O 2X0LA 4O2AB 1YZBA 1EN6A 1QLEB 4DR6B 2NR5A 5L3BA 1Q6IA 2WLJA 2E5LB 4UB8Z 4QPKA 1O9GA 4DR5O 2PUSA 3K9SA 4LH6A 2DN9A 1V55C 1VQKV 1KP2A 5JCOC 3JSLA 3TXQA 3TK1A 3G71V 1AJQA 1R1BA 3T2MA 4AQYO 5JJEB 4D7SA 5CBHA 4WFAV 1BQZA 1HNXB 1NTMH 2F4VO 4U3JA 4TT3G 4UVCA 3B8MA 1YF2A 4G2KA 4C7UA 5JJNB 4BIUA 3ABMB 3T1YO 3JATB 3J80N 2FYUH 1TVKB 1Q6HA 5LOVA 4LF8O 1F4MA 3CEIA 4GKJB 3ZHQA 1SQPH 1MG1A 3H1HH 2YUAA 2QTOA 1H8EG 1IXMA 3CCJV 3R65A 4I50B 3ZHVA 2XTAA 4I55A 4IIJA 1KB9F 3E35A 2JDIG 3W7UA 4JI2O 3J81N 2KQXA 2X6AA 1AROP 1GKFA 3O65A 1US6A 2FKXA 3F7VC 1WLEA 4PA9A 4I0XA 4QPJA 1HNWO 3CXHF 1BS3A 2XAHA 4K35A 2Q0OC 4L8JA 5ITZA 1E1RG 4BWAA 2BTOA 1QR9A 4Z2WA 2CH7A 3UT5A 4CH5A 2IM9A 5LMUO 1UPGA 3K79A 1RSOA 3ABKB 4JASA 4JI7O 3UO3A 2Q73A 2QKSA 3QNEA 4MTFA 4JV5B 2ODMA 1VEWA 4WFBV 1B04A 4NYKA 2EIKC 4JYAB 1OZ0A 4U3FH 2ZNJA 4IL6Z 4K3AA 4NB5A 4PDLA 2EIMB 3S3WA 3LDEA 1JPXA 4KHPO 4FM0A 5CA1A 2OT5A 1W59A 4DR4O 1Q3EA 3DC6A 4TV8A 4X65B 1S5JA 1NH2D 3IAYA 1NVPD 5F2VO 1N36O 4FLWA 1S72V 3OUSA 4X1IB 4JYBA 4BW9A 4P9PA 4WCEV 4F6RA 4MVMA 1FPOA 2Q0AA 1BCCH 3CX5F 3VQVA 2Q68A 3C3TA 5B1BC 1L1FA 4AQYB 2Q69A 1YJ9V 3QVNA 2F4VB 1YSCA 2YEVB 1H2MA 2H3OA 2QKCA 3L9DA 5IYZA 1KUQA 3T1YB 1IBKB 3K9AA 2ETNA 3BPZA 3CCQV 4MSWC 4GYCB 1UJWB 4R50A 1XHXA 4B3RO 5KUKA 3OT7A 4LF8B 1V54C 4J9ZB 1HP8A 2DWDC 3N27A 1SS3A 4DV7B 1M57C 3ASOC 5LGNA 1VQ7V 4EB6A 3HKBB 1H2LA 2DQ3A 3OMAB 3ZRXA 1GN6A 1Q82W 5J2TB 4AI8A 3K5LA 2BOCC 4NXMO 2OIEA 5B5EZ 4JI2B 1OCCC 2LGQA 1DTOA 2CTRA 1MMMA 4RO2A 3T1HO 2QJ1A 1XL4A 2WLLA 4X66O 5GONB 1K33A 5BY1A 2VQFB 2EILC 4ABMA 1GN4A 2B1IA 4PDVA 5EYPA 4GT1A 5KHJA 5DN6G 1W0KG 3G6BA 3CJHA 4CS3A 2VQEO 3RVYA 5KX5B 5LMUB 1I5YA 3WFVA 1DLBA 3B40A 4O4IB 3FYEB 1EM1A 1FFXA 4JI7B 1YJWV 1K34A 4NTXA 2W0FC 1X59A 5CBGA 3H1LH 3N2KB 3L74H 5C8YB 3CRAA 1MSWD 3N2GB 1JJOA 1YEWA 4XBFA 2BSKA 3OTOO 2Q6AA 1SERA 4U7OA 4QJFB 3OD4A 4KP4A 4F4LA 3M8AA 3K5MA 1Y67A 1ZL8A 2QWOB 1GMGA 3CWBH 2UXDO 1Q90D 4MVOA 4DR4B 1N33O 4CS2A 1S5LZ 1JFFB 3JALB 4PI0A 5EIBD 2DYSB 3FB7C 4HYOA 2A06H 5FNVB 5EIBC 4I4TA 1XREA 4LF6O 2W0XA 2C2AA 3TCUA 1GM7A 2IJHA 1OCOB 3SR2C 4LCUC 5A9GA 1ZLZA 3E22A 4PA3A 2ZE7A 3P3NA 4GX2A 2JIZG 4I9QA 1R3JC 3A2FA 1YJNV 1J5EB 1KU9A 2ZE5A 1QVFU 2R9RB 1FXHA 4DRXA 1M4UA 1YXBA 2F1MA 5K1PA 4XDKA 3CC2V 4DR7B 3M99B 5CB4B 3RYCB 4PD4F 1VQ4V 5LA6A 3I55V 3DGEA 3JAKB 1BL8A 1I0HA 1KP3A 3ABUA 4MVRA 5IJ0B 3CP1A 2A9HA 5L3EA 2JGDA 4IGGA 3G4SV 2ZIOA 4DV2B 2YICA 1KECA 1N0NA 1RPOA 4KL1A 4LF5B 4DV5B 4TUYB 3JD1A 3OTFA 4O4HA 1SA0B 4J7KA 1AB3A 3A0BZ 3T1HB 5KAIZ 5EBMC 5KMGA 1GRJA 1B3QA 1TGOA 3ETQA 4GX5A 3RYIB 1F4NA 5KLVH 4IHJA 1W0JG 3ICXA 3ZMSA 2GUZA 2DYRC 1Q86W 1BMFG
chains in the Genus database with same CATH topology
4CBCA 4UXNA 3OEEG 1FFTB 3IFXA 5KUMA 2EZPA 3E8FA 1H38A 3WG7C 3RVZA 2BOBC 4RAIA 1JX9A 1JQ0A 1RPRA 2JJ2G 3ZCCA 1FXVA 3D36A 5LGTA 1M1KW 4P9OA 5KA5A 1G8MA 5H9CA 1NJIW 1LNQA 1AJPA 3OFNG 1EFRG 3W7TA 3CPWU 1R6KA 3JD2A 2Z5UA 1VQ6V 2HVKC 1VQLV 5HFMA 2DYRB 3CYOA 1THZA 2OTJV 2X0LA 3AG2C 2WPDG 3E86A 3CD6V 1TUEB 4H37A 1EBOA 1QLEB 3I56V 4FIPC 4JTCB 4P30A 3ZMVA 3ABMC 3ZIAG 5L3BA 3EHBB 2WLJA 3FB8C 2IH3C 4MVUA 4QPKA 3GB7C 1E79G 1RM1C 1V55C 3F5WC 1VQKV 4TSFG 1KP2A 3ZJZA 3LSSA 2XAJA 3TK1A 3G71V 2UXNA 1AJQA 1F51A 3T2MA 1K97A 1PD3A 4QIWF 2XOKG 4P2ZA 3AG2B 2H8PC 4JTDB 3OM3B 2XAFA 3JYCA 3ZN1A 3OUFA 4WFAV 5E1AC 4TT3G 4UVCA 3B8MA 2HR3A 3ABTA 3OR7C 4G2KA 2QEXV 2WLIB 1K92A 2IJKA 4BIUA 3ABMB 2QA4V 5HFLA 4FJCC 3STLC 3ZRVA 5IYDO 1ENVA 4EKWA 2A0LA 1YHQV 2WLIA 5EC1C 2V7QG 3K03A 2OTLV 1K3EA 1OCZC 2ZQMA 1NH2B 5LHIA 1M56C 1V55B 5LBQA 4PA6A 3T4ZA 1PNLA 3AEIA 4QE9A 3SYQA 5EBWC 4GX1A 1NVPB 1F4MA 4MVQA 3QO8A 2IJJA 4MS2A 3SYOA 2LP7A 1MG1A 3AG1C 5CMUA 1NR1A 3K0GA 3SPHA 3W7SA 3K08A 1YTFD 1AJNA 2B5UA 3EFFK 3SJQC 3CMEV 4FK5C 2QTOA 4MTGA 1H8EG 1IXMA 3CCJV 5BZBA 3R65A 1R3LC 2GSMB 1AR1B 4MT8A 4Z1MG 1WPXA 2DW4A 3H01A 3E35A 2R9IA 5L3FA 3CCLV 1OCRC 1FS0G 2JDIG 5LHGA 3W7UA 2H94A 1VQNV 4LC1A 5B1OA 1M56B 2X6AA 2AHZA 1AROP 1GKFA 5IY5C 2IJIA 3SPIA 1VQ8V 1MABG 3F7VC 4KFMA 1WLEA 4PA9A 4RQFA 4QPJA 1K9MW 1PL0A 2LFSA 3AG1B 3GWOA 2WLMA 3RBZA 2XAHA 3OMNB 3CCUV 1K7DA 3IC7A 4FPPA 3ZN0A 4MVZA 2KB1A 4HZ3A 2P90A 1E1RG 4U7NA 5H6QA 3SPCA 2IU3A 4JTAB 1FXKB 4LP8A 4BIZA 2JJ1G 1QR9A 1V54B 1AI4A 1QLEC 3IGAC 1OCRB 2IW5A 3TETA 3K79A 3ABKB 5IY5B 4JASA 3ZRSA 3ABLC 3ETGA 2QKSA 2X6CA 3QNEA 4MTFA 2EJRA 3ETDA 1QCEA 1QLNA 4WFBV 2EIKC 1OZ0A 1R3KC 2ATKC 4PDLA 3OW2U 2EBOA 2NLJC 1K4DC 2EIMB 1R73A 2WWWA 3PJSK 5LHHA 1JJ2U 1S0VA 5H6RA 2Z3YA 1ZWIC 3LDEA 1EZJA 2OCCB 3ZRWB 5J9PC 1JPXA 3P32A 4JPRA 2ZD9A 1QVGU 1R3IC 1SRYA 3QO5A 2OT5A 3ZRWA 3OAAG 1VQMV 5L3CA 1CP9A 1NH2D 1AI6A 1K5SA 3ABLB 2DWEC 1NVPD 3E8BA 1N8RW 2EIKB 2EIJB 3K04A 3JD3A 1S72V 1S5HC 2QM7A 3OUSA 4MW3A 1G4YB 4MVSA 3SPGA 3K0DA 1VQ9V 1GM8A 2HG5C 3RW0A 4JYBA 1AI5A 3JD4A 3T4DA 4P9PA 4UV8A 2ZDIC 4WCEV 2Y48A 4MVMA 3MHHC 4N21A 3OE7G 1KD1W 1NBMG 2MK3A 3SYPA 3ASNC 2Q68A 1NQTA 1VQOV 1XL6A 2IH1C 3W7WA 3JD0A 5EBLC 3E8GA 5B1BC 1L1FA 4RQEA 5C93A 2Q69A 2W6IG 1YJ9V 1YSCA 2YEVB 1KKDA 1VQ5V 2WLHA 3K3WA 4KUMA 2YEVA 1H2GA 4QNHB 2GHYA 3K9AA 3LSQA 3AG3B 1GM9A 4OXSA 3CCQV 4MSWC 4XDJA 1UJWB 1PNKA 4R50A 4WFHA 5KUKA 5B1AB 4GCZA 3LUTB 5B3SB 4X8AA 4PDRA 3ASNB 2ZDIA 1FXKC 4JAVA 1V54C 4CZZA 4R7CA 5B1BB 4J9ZB 4XDLA 5B1NA 2DWDC 4R6ZA 3E2EA 4JF3A 4RUFA 1M57C 3ASOC 1M9NA 3T1CA 5LGNA 1VQ7V 1Y4MA 3BEHA 2DQ3A 3STZC 3OMAB 3ZRXA 3ZMZA 3ABKC 1S77D 1DF5A 1Q82W 1H8HG 1BHAA 2BOCC 4G28B 3MD0A 1YITV 1P4RA 1AI7A 1Q7YW 1ORQC 2V1DA 2M7WA 1OCCC 3LDDA 1K73W 5EK0A 1DTOA 2A79B 1NR7A 2WLLB 4RO2A 1F23A 3ZMTA 5EC2C 4E2LA 1XL4A 4J9YB 2EIMC 1ROPA 2WLLA 3UM7A 5L3GA 1K33A 1JOYA 2ZR2A 5L3DA 2EILC 2OCCC 3SPJA 1CEZA 5CN0A 2DQ0A 2D3OW 2XNDG 4X88A 2XASA 4UV9A 2B1IA 4PDVA 2IU0A 1NKDA 1FXKA 1M57B 3ASOB 3UKMA 3B8NA 4DO2A 3ML0A 5IDJA 1GK9A 1R6NA 4GT1A 4UVAA 2HLDG 3JCZA 5DN6G 1W0KG 2JEXA 1J95A 1PKXA 4G27B 3LNMB 4QE7A 4BAYA 1K4CC 2XAQA 1SESA 2ZXWB 2EZOA 1OCCB 3RVYA 1B6QA 3E83A 1I5YA 3WFVA 1DLBA 3VBBA 2EIJC 3F7YC 3FYEB 3SYCA 2ITCC 4PA7A 3ZMUA 1YJWV 1K34A 2DYSC 4Q20A 3CCVV 2W0FC 1BHBA 2Y69B 5CBGA 2EILB 4JYCA 3FB5C 4UVBA 1MSWD 1YI2V 4GX0A 4PDMA 2AHYA 3E89A 4RUEA 5IYBO 4XBFA 3FKSG 3SYAA 2Q6AA 2P7TC 1SERA 4U7OA 1OCOC 2HFEC 4ASUG 4QJFB 3OMIB 4KP4A 1Y66A 3CCEV 3X2QB 4F4LA 3CCRV 3K06A 1KC8W 1E1QG 1COWG 4L87A 1GMGA 4MTOA 5CBFA 2JK5C 4WFEA 4MVOA 3HPLC 4H33A 2QE7G 4HAMA 2HJFC 3AG3C 3E8HA 2WLNA 3CC7V 2DYSB 3FB7C 4LBEC 2FTKA 4HYOA 2B1GA 3WG7B 1M90W 5GW7A 4ZBMA 2X6BA 3G6EV 3AG4C 2EINC 1CPYA 4I9WA 5B1AC 2JEUA 5B3SC 3DTUB 2P6JA 3CMAV 4PELA 2C2AA 3TCUA 1PNMA 1GM7A 5KA6A 2IJHA 1Q81W 1OCOB 1QBZA 1QR8A 5DM6V 1KQSU 4LCUC 4PA3A 2WLKA 4GX2A 2JIZG 3B77A 1R3JC 1YJNV 2HKOA 2CK3G 4I5SA 4N23A 2F43G 1GTOA 4X89A 2HVJC 1K8AW 2ZR3A 2R9RB 1QVFU 1FXHA 2PI5A 4DXWA 4MTXA 3KG2A 3CC2V 4XDKA 1OHHG 3M99B 1DF4A 1S3JA 3CC4V 3CCMV 3D3IA 4ZKIA 4R8CA 1VQ4V 3AG4B 2EINB 3I55V 1S76D 3OR6C 1RM1B 3OEHG 3MHSC 2YSUB 3LDCA 3DGEA 5IYCO 4MW8A 5CA3A 1BL8A 2NNUA 4UUJC 3ETEA 1KP3A 1JVMA 3ABUA 4MVRA 3CCSV 2QM8A 1SZTA 1MOFA 4YXWG 3CP1A 1YIJV 1I5XA 2A9HA 2UXXA 3VOUA 1VQPV 5L3EA 2PI4A 4PA4A 3G4SV 3FYIB 2P67A 2ZXWC 3OGCC 1JCHA 4JAUA 4WF9V 5LGUA 1KECA 2W6JG 4FMTA 1RPOA 4TWKA 1HWYA 2WAMA 3BY6A 3QO7A 2WSSG 3NXSA 4WFGA 2Y69C 4JGSA 3CXCU 1OCZB 1P7BA 3JD1A 5CBHA 2X7RB 1W2BU 5FL7G 4BW5A 5EBMC 2LFRA 1K5QA 1GO3F 3FB6C 3P30A 2K1EA 4GX5A 4WFFA 3W7XA 3X2QC 3A0RA 1F4NA 2ITDC 2XAGA 1W0JG 3HB3B 3ZMSA 1YTFB 2DYRC 1SETA 2Q67A 1Q86W 1BMFG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N8R W;  3OW2 U;  1VQL V;  3CCL V;  1VQ5 V;  2OTJ V;  3CXC U;  1R73 A;  1YJN V;  1S72 V;  3G71 V;  3CCV V;  1VQ7 V;  1YJW V;  1JJ2 U;  2D3O W;  3CD6 V;  1VQN V;  3CCS V;  1W2B U;  1VQ9 V;  1K8A W;  1QVF U;  3CC7 V;  3I56 V;  4WFA V;  1VQ6 V;  3CCQ V;  1YIJ V;  1Q82 W;  1M90 W;  1VQP V;  1QVG U;  1VQ8 V;  1YI2 V;  3CC2 V;  4WCE V;  1YIT V;  3G6E V;  2QEX V;  1VQM V;  1KD1 W;  3G4S V;  1K9M W;  3CME V;  3CCM V;  1Q7Y W;  3CC4 V;  1M1K W;  2QA4 V;  3CCE V;  3CCJ V;  3CMA V;  1VQO V;  1K73 W;  1NJI W;  4WF9 V;  1VQ4 V;  1YHQ V;  3CCU V;  4WFB V;  3CPW U;  3I55 V;  3CCR V;  1KC8 W;  1Q81 W;  5DM6 V;  1YJ9 V;  1VQK V;  1Q86 W;  1KQS U;  2OTL V; 
#chains in the Genus database with same CATH topology
 3TGU H;  3IFX A;  3HKC A;  2EZP A;  4DUZ O;  3FX7 A;  1AR4 A;  2BOB C;  2DE0 X;  2Y0P A;  4PJ0 Z;  4RAI A;  3ZCC A;  4JI8 B;  1LNQ A;  1AJP A;  3L75 H;  3JD2 A;  1P84 F;  1GN2 A;  4K8X A;  1VQL V;  1SZX A;  1N34 O;  2OTJ V;  2KKW A;  5KHK A;  4H13 B;  3CD6 V;  2QTS A;  4P30 A;  5LYJ A;  3A0H Z;  4B7K A;  3B09 A;  3ZMV A;  3ABM C;  4O2A A;  3ZIA G;  2P06 A;  2P4V A;  3K58 A;  2O57 A;  2E74 B;  2ZE6 A;  2E76 B;  3JAM N;  3FB8 C;  4MVU A;  4DW0 A;  4DV6 O;  1RM1 C;  2KG7 B;  2N04 A;  4J11 A;  1PV0 A;  2YC0 A;  1R6T A;  3ZJZ A;  4LF9 O;  5EZY A;  2XAJ A;  4O4L B;  1SQG A;  1XEQ A;  3JAR B;  4QIW F;  4P2Z A;  3AG2 B;  2H8P C;  4JTD B;  3NR7 A;  1QHT A;  5E1A C;  3UQ8 A;  1P7G A;  2HR3 A;  3ABT A;  3OR7 C;  2WLI B;  5LMN B;  2B9Z A;  4CS4 A;  1JMK C;  4FJC C;  3STL C;  3ZRV A;  1ENV A;  1ZAU A;  3HKD B;  4GKK O;  3JAT A;  2OTL V;  1K3E A;  1OCZ C;  4H44 B;  5LHI A;  5LBQ A;  4LFC O;  5LP6 B;  3SYQ A;  4MVQ A;  4MS2 A;  3SYO A;  1NR1 A;  2CGN A;  1YTF D;  3K08 A;  3CRQ A;  1SKV A;  2PY5 A;  4MTG A;  1NTK H;  2Q5Z A;  3BAB A;  4Z1M G;  1WPX A;  3H01 A;  4EEQ A;  2R9I A;  2UUB O;  1FS0 G;  4TV9 A;  5LHG A;  2H94 A;  1VF7 A;  2AHZ A;  4CC6 A;  4FFB B;  3SPI A;  1SF9 A;  1K9M W;  1BZK A;  1XNQ B;  3RBZ A;  3IC7 A;  4FPP A;  3ZN0 A;  2KB1 A;  3KZI Z;  2IU3 A;  2EUL A;  3VQW A;  4X64 O;  1AI4 A;  1OCR B;  4YY3 B;  3BA8 A;  3TET A;  3D3Q A;  3QF7 A;  4KXR A;  2X6C A;  2Y0I A;  5AG2 A;  1XMQ B;  1QLN A;  4JI6 O;  1BGY H;  1R3K C;  3AK3 A;  1KKC A;  1JR9 A;  3OW2 U;  2UXC O;  1R73 A;  3PJS K;  5LHH A;  1JJ2 U;  1HR0 B;  3CRM A;  1S0V A;  5H6R A;  4ZOL B;  1EZJ A;  4LR3 A;  3ZS8 C;  4JI5 B;  1QVG U;  4JI0 B;  1L8D A;  1SRY A;  3HR0 A;  4DK1 A;  1H2K A;  4LF7 O;  1ZX3 A;  1N34 B;  1FYJ A;  1K5S A;  3ABL B;  1XIL A;  1VAR A;  5BMV B;  1LR1 A;  2A3Q A;  3E8B A;  3K04 A;  3JD3 A;  2QM7 A;  1G4Y B;  3SPG A;  1AP5 A;  3K0D A;  1GM8 A;  4IYI A;  2JS3 A;  2JGU A;  3AG7 A;  2QWQ B;  1Y76 B;  3T4D A;  2Y48 A;  3MHH C;  4N21 A;  3OE7 G;  4JI1 O;  1YCI A;  3SYP A;  1NI8 A;  4ZI7 B;  1VQ5 V;  5KHI A;  1BQ0 A;  3K3W A;  3G80 A;  3CE2 A;  2YEV A;  2GHY A;  2E75 B;  3AG3 B;  4PI2 A;  2CTW A;  3Q4H B;  5JCO A;  5IJ9 B;  2BTQ A;  1WA8 B;  1PNK A;  5IWA O;  4WFH A;  5B3S B;  1ZSP A;  4PDR A;  3ASN B;  3K57 A;  1FXK C;  4JAV A;  2YXY A;  1N32 O;  4CZZ A;  4XDL A;  4R6Z A;  3RN4 A;  1SQF A;  2K9P A;  3FD9 A;  3H9V A;  3ZHU A;  4CC5 A;  1NTZ H;  4LFB O;  4LFA B;  1Q7Y W;  1IBL O;  4HNA B;  5J2T A;  2UUB B;  2PYJ A;  1Z2G A;  1K73 W;  1IBM O;  5EC2 C;  4BIO A;  3APO A;  3UM7 A;  4FLX A;  3MAQ A;  2ZM6 O;  2ZR2 A;  2OCC C;  4PHZ A;  2DQ0 A;  2D3O W;  1Q6U A;  3B2E E;  4X88 A;  2XAS A;  1XMO B;  1FXK A;  3UKM A;  1VMG A;  3B8N A;  3JAS A;  5BR8 O;  3ML0 A;  5IDJ A;  1GK9 A;  1R6N A;  1I94 O;  4UVA A;  4DUY O;  3WU2 Z;  4X62 O;  1Y6X A;  4G27 B;  4BAY A;  3MDS A;  1K4C C;  3J7A U;  2XAQ A;  2ZXW B;  5D5P A;  3H1J H;  2EIJ C;  4FFK A;  1SQQ H;  3F7Y C;  3ZMU A;  2FML A;  2DYS C;  3CCV V;  4JZG A;  4ZHQ B;  2Y69 B;  3DC5 A;  4J7J A;  4O4I A;  4X1Y B;  5JQG B;  3H1I H;  4TOI A;  2ADP A;  2Q7H A;  4PDM A;  1YI2 V;  4DV0 B;  2AHY A;  3OGI B;  3N2K A;  2UXC B;  3K5O A;  3N2G A;  3SYA A;  2P7T C;  1OCO C;  3CCE V;  4ASU G;  3OMI B;  1Y66 A;  3X2Q B;  2UUA O;  5CBF A;  3HPL C;  4H33 A;  2QE7 G;  2HJF C;  3K5N A;  1WP8 A;  4DR5 B;  2JRI A;  3JAL A;  2VWJ A;  1CPY A;  5B1A C;  2PGG A;  3DTU B;  5FNV A;  1N4C A;  1Q81 W;  5DM6 V;  1XHZ A;  1IX9 A;  2AZ0 A;  4OPH A;  5H5N A;  2YDE A;  1EZV H;  2HKO A;  1I08 A;  1SQV H;  4X89 A;  5J2U A;  1K8A W;  3C90 A;  1WP7 A;  4YJ3 B;  4O2B A;  2LW7 A;  3KG2 A;  1WAZ A;  1QU7 A;  3CCM V;  2HHH O;  1U96 A;  1GN3 A;  1LUW A;  3AG4 B;  1D5N A;  1S76 D;  3DXR A;  3OR6 C;  2L6L A;  3MHS C;  5IYC O;  2ARH A;  2Q9L A;  4MW8 A;  5CA3 A;  2NNU A;  1ZTE A;  3ETE A;  4NKG B;  3AK1 A;  1JVM A;  3L71 H;  3CCS V;  3JAK A;  1SZT A;  4UCO A;  2XHB A;  1O9H A;  4YXW G;  1YIJ V;  1I5X A;  2UXX A;  4JI3 O;  2PI4 A;  1N32 B;  1NT2 B;  4PA4 A;  4UCU A;  2AZ2 A;  4I55 B;  2LO1 A;  3OGC C;  4JAU A;  2WA4 A;  2Y4U A;  5H2F Z;  4LWS B;  5LXT A;  4FMT A;  5E79 Z;  2WAM A;  3QO7 A;  3BFR A;  4JGS A;  3D36 C;  2BCC H;  1IBL B;  1HNW B;  1GH6 A;  4DV1 O;  5FL7 G;  4I0X B;  4LF4 O;  4JI4 O;  1IBM B;  1QQC A;  2LFR A;  1U97 A;  3P30 A;  2ZM6 B;  4WFF A;  3W7X A;  3IJ4 A;  5GTH Z;  2AGA A;  2ITD C;  4FLU A;  2DMX A;  3CRC A;  5BR8 B;  1SET A;  2Q67 A;  4F6E A;  2Q4P A;  4UXN A;  4DUY B;  3UCS C;  3UT5 B;  3K59 A;  5DEC A;  1IVS A;  3WG7 C;  1D2D A;  1JX9 A;  1RPR A;  2JJ2 G;  4DV3 O;  1FXV A;  3D36 A;  5LGT A;  2XT9 A;  5KA5 A;  2UUC O;  2R70 A;  4YIP A;  1NJI W;  4DV4 O;  1VQ6 V;  2HVK C;  4KHP B;  3CYO A;  3AG2 C;  5CA1 B;  2WPD G;  3M7M X;  3E86 A;  4H37 A;  1SQX H;  2UUA B;  4TV8 B;  3U11 A;  3EHB B;  1XI1 A;  1N36 B;  2OCH A;  2IH3 C;  1TAE A;  2UXB O;  1T5E A;  3F5W C;  1XUQ A;  5LP6 C;  2KG7 A;  3ZED A;  4ZIB A;  4ICG A;  2UXN A;  1F51 A;  4F6R B;  1K97 A;  1PD3 A;  2GV9 A;  3OM3 B;  3OUF A;  4D7T A;  3JAR A;  4X1K A;  1K92 A;  5FLX N;  4YHH O;  2A0L A;  2Y4T A;  1YHQ V;  2WLI A;  5EC1 C;  5IYZ B;  2V7Q G;  2ZQM A;  1NH2 B;  2YXL A;  1XNR O;  4PA6 A;  3L70 H;  1PNL A;  4YJ2 B;  1NVP B;  1FKA O;  4B3R B;  3L73 H;  3QO8 A;  2IJJ A;  2RDC A;  4FLY A;  2LP7 A;  3K0G A;  4FZ0 A;  3SPH A;  3W7S A;  5CA0 A;  3CME V;  1R3L C;  1AR1 B;  4MT8 A;  2RNB A;  3SDL A;  2DW4 A;  4EB6 B;  5L3F A;  1OCR C;  4NXM B;  4TQD A;  4NR1 A;  4DR1 O;  1VQN V;  1M56 B;  3FAV B;  2IJI A;  1VQ8 V;  1NZ6 A;  4KFM A;  4RQF A;  4FFB A;  4X66 B;  2LFS A;  3AG1 B;  4B3T O;  3JAW B;  4QGP A;  1VF5 B;  2WLM A;  3CCU V;  1K7D A;  4MVZ A;  1G1X B;  1F7Y A;  4U7N A;  5H6Q A;  3SPC A;  4JTA B;  4LP8 A;  1V54 B;  1QLE C;  2VQE B;  4PV1 B;  3CJH B;  5IY5 B;  3ABL C;  3C3S A;  1DK1 A;  2V4D A;  4X9Q A;  4B08 A;  1KYO F;  4NXN O;  4DR2 O;  2NLJ C;  4FM1 A;  3KCY A;  1K4D C;  2WWW A;  3CRR A;  2Z3Y A;  1ZWI C;  3OTO B;  2UUC B;  2ZKO A;  3ZRW B;  4DV4 B;  4WBN A;  2BSK B;  2ZD9 A;  4AHC A;  2P5O A;  1R3I C;  3QO5 A;  1MSD A;  2FL4 A;  1CP9 A;  2UXD B;  4DR6 O;  1AI6 A;  4H0L B;  4UFZ A;  1N33 B;  2DWE C;  2E5L O;  4O4J B;  1ZUQ A;  2OYQ A;  1S5H C;  4NVP A;  4MW3 A;  4LF6 B;  5BXZ A;  3RW0 A;  1AI5 A;  2CAZ C;  1L0L H;  4UV8 A;  1KD1 W;  1NBM G;  3ASN C;  4EFB A;  1VQO V;  1HNX O;  3W7W A;  3JD0 A;  5EBL C;  3E8G A;  1A32 A;  1L0N H;  2W6I G;  3THO A;  5JVD B;  2HEP A;  1KKD A;  4ZI7 A;  2F93 B;  2WLH A;  3O9O A;  5JH7 B;  3LSQ A;  4K0K O;  1TVK A;  3ZX6 A;  4XDJ A;  5LA6 B;  3CB2 A;  5TIS Z;  1WPB A;  5IJ9 A;  4GKJ O;  1WA8 A;  3WB2 A;  3LUT B;  4X8A A;  2ADQ B;  1MNG A;  4Q6G A;  4I50 A;  5DED A;  2YID A;  4JF3 A;  4RUF A;  3E2E A;  1VP7 A;  3I5D A;  3BEH A;  2A7W A;  3STZ C;  1XDC A;  4X20 B;  3ABK C;  1DF5 A;  1H8H G;  1BHA A;  2CUG A;  4G28 B;  1YIT V;  3S3X A;  1AI7 A;  1KBH A;  1HDJ A;  4EFE A;  3LDD A;  3FFQ A;  2A79 B;  1NR7 A;  3ZMT A;  3RYH B;  4J9Y B;  1WB8 A;  2LQT A;  4O4H B;  1D5A A;  2EIM C;  5L3G A;  4A5U B;  1JOY A;  5L3D A;  1Z5W A;  5CN0 A;  5KMG B;  2XND G;  1IUR A;  4B3T B;  4UV9 A;  4DO2 A;  4FM2 A;  2HLD G;  2JEX A;  3KKY A;  4CH3 A;  4DR3 O;  4QE7 A;  1WB7 A;  4DUZ B;  2VRZ A;  2HJD A;  2EZO A;  3LNN A;  3HKC B;  3VBB A;  3SYC A;  3QG5 A;  2ITC C;  3RFR A;  4JYA O;  4JYC A;  3JCU Z;  4ZHQ A;  1HW7 A;  4GX0 A;  4NXN B;  5IYB O;  3EXA A;  3FKS G;  5JQG A;  2HFE C;  3CCR V;  3K06 A;  1E1Q G;  1Y74 B;  1COW G;  1YVW A;  1FAF A;  4WFE A;  5LYJ B;  2LW1 A;  4HAM A;  3E8H A;  1WNS A;  4DV6 B;  4LBE C;  4J41 A;  2QR4 A;  1M90 W;  2HP8 A;  5GW7 A;  4X1I A;  3AG4 C;  4LF9 B;  1BE3 H;  2JEU A;  1PM9 A;  2P6J A;  4PEL A;  1PNM A;  4DW1 A;  5EZY B;  1KQS U;  5KHG A;  2WLK A;  2KSD A;  2Q8V A;  2GDS A;  3B77 A;  1FD9 A;  3U0Z A;  2CK3 G;  4N23 A;  2F43 G;  1GTO A;  2GTS A;  2L35 A;  4UCT A;  4MTX A;  4GKK B;  2YIB D;  1DF4 A;  1S3J A;  4YJ3 A;  4ZKI A;  3SJA C;  1IBK O;  1B06 A;  1TUB B;  4LFC B;  2EIN B;  3BHP A;  4K0K B;  1RM1 B;  4B3S O;  2YSU B;  3LDC A;  2Z0A A;  2QM8 A;  3VOU A;  1VQP V;  4LNU B;  3HKB A;  4DV7 O;  3GVM A;  2YI9 A;  4OPA A;  4GUN A;  4WF9 V;  1JA8 A;  1PP9 H;  4TV9 B;  2ZE8 A;  4TWK A;  4UB6 Z;  4FLZ A;  1Q5O A;  4LWS A;  4WFG A;  1TA8 A;  3CXC U;  2YIB A;  1OCZ B;  1P7B A;  2X7R B;  4CH4 A;  2BE3 A;  5GON A;  4BW5 A;  1G6U A;  1GO3 F;  2VQF O;  3UO2 A;  3RYF B;  5A2Q N;  3A0R A;  4X64 B;  2FB5 A;  3HKE B;  3HB3 B;  1YTF B;  1WN7 A;  4JZ2 A;  1KMI Z;  4CBC A;  3OEE G;  5KX5 A;  5KUM A;  3E8F A;  3H1K H;  4DR3 B;  1AR5 A;  1EN5 A;  4JI6 B;  4E4E A;  3RGB A;  5B66 Z;  1M1K W;  5C8Y A;  3OFN G;  3CPW U;  1R6K A;  1MA1 A;  4YIO A;  2ZIM A;  5HFM A;  2F66 C;  1THZ A;  4LF7 B;  2NN4 A;  1TUE B;  1EBO A;  3I56 V;  4FIP C;  4JTC B;  3WB0 A;  1RFY A;  2ILM A;  1JFF A;  2VWK A;  3F5T A;  1IXB A;  3GB7 C;  1E79 G;  2QM4 A;  4DYL A;  3QTC A;  5KAF Z;  4TSF G;  3L72 H;  3LSS A;  1PL4 A;  1SQB H;  4JI1 B;  1EN4 A;  4U3J B;  2XOK G;  2R72 A;  3ZN1 A;  2XAF A;  3JYC A;  2CTQ A;  2Q7E A;  2QEX V;  1J5E O;  4FVM A;  2IJK A;  2QA4 V;  5HFL A;  5IYD O;  4EKW A;  5CB4 A;  2YXH A;  3BA9 A;  4DR7 O;  3JSN A;  3RYC A;  1IZ3 A;  3K03 A;  2F95 B;  3WB1 A;  5LOV B;  1M56 C;  1V55 B;  4JYY A;  3T4Z A;  3AEI A;  2Q7G A;  4QE9 A;  5EBW C;  2BTQ B;  4GX1 A;  1XOU A;  2F23 A;  4NTW A;  5IWA B;  4YJ2 A;  2YI8 A;  4B3S B;  3AG1 C;  5CMU A;  4FLT A;  5IJ0 A;  1CXZ B;  2JS5 A;  1AJN A;  2B5U A;  3EFF K;  4GZR B;  3SJQ C;  3TJT A;  4FK5 C;  4J7Z A;  1I7F A;  5BZB A;  2QWP B;  4IIJ B;  2GSM B;  1V9P A;  2GTA A;  1M5I A;  3CCL V;  4DV2 O;  4LFB B;  4J80 A;  4LC1 A;  5B1O A;  2QKA A;  5IY5 C;  2RQ6 A;  4LF5 O;  4TUY A;  1MAB G;  4DV5 O;  3FAV A;  2ZCE A;  1SA0 A;  4CH6 A;  4NTY A;  1PL0 A;  2YS8 A;  3GWO A;  5ITZ B;  4AIL C;  2QWN B;  3OMN B;  3RT3 C;  4UCS A;  2N74 A;  3SJB C;  3JAW A;  4HZ3 A;  4FLV A;  2P90 A;  3RYI A;  2YIA A;  1QNM A;  3B4S A;  2CH7 B;  1FXK B;  4BIZ A;  1I94 B;  2JJ1 G;  3JAS B;  4X62 B;  1DGS A;  5LL6 Y;  3GWK C;  5GTI Z;  2DOS A;  3IGA C;  2QDO A;  1RSO B;  2EX3 A;  2IW5 A;  1Z5V A;  3ZRS A;  2DJV A;  3ETG A;  2EJR A;  3ZHT A;  2EJ7 A;  3ETD A;  1QCE A;  2N05 A;  1HNZ O;  2P4K A;  2ATK C;  3VQY A;  2EBO A;  4B3M O;  4JI8 O;  5JWP A;  2GBO A;  2QSA A;  2CE4 A;  2OCC B;  4LH7 A;  5J9P C;  3P32 A;  4JPR A;  2WA3 A;  2RN9 A;  3ZRW A;  3OAA G;  1VQM V;  3AK2 A;  5L3C A;  3SJC C;  3TXS A;  1N8R W;  1MZF A;  2EIK B;  2EIJ B;  3CSX A;  4MVS A;  1AIL A;  1VQ9 V;  4O4J A;  2HG5 C;  3JD4 A;  2CDY A;  1BSM A;  4O4L A;  1N0J A;  2ZDI C;  2G38 A;  3CHX A;  1H2N A;  2MK3 A;  1NQT A;  1VIB A;  2UU9 O;  1XL6 A;  2IH1 C;  1NU1 H;  2PTM A;  4RQE A;  5C93 A;  5FPR A;  2IBZ H;  5LMN O;  5J2U B;  5K1X A;  1FJG O;  4JAA A;  3BVO A;  3HKD A;  4IT5 A;  4KUM A;  4O2B B;  5JVD A;  2HHH B;  1H2G A;  4QNH B;  3BAA A;  1GM9 A;  4OXS A;  5LP6 A;  5JH7 A;  1OV9 A;  3DXR B;  4B7E A;  1YDX A;  4FZ1 A;  2LGW A;  4GCZ A;  5B1A B;  1MZE A;  2ZDI A;  4RWU A;  2VS0 A;  4R7C A;  5B1B B;  1LUV A;  5B1N A;  4JI3 B;  3BRC A;  1M9N A;  3T1C A;  1Y4M A;  5IT9 N;  2RCV A;  3G67 A;  2PYL A;  4GLX A;  3ZMZ A;  1S77 D;  1H2S B;  3MD0 A;  1P4R A;  1BT8 A;  4X20 A;  5LXT B;  2ZIN A;  1ORQ C;  2V1D A;  2M7W A;  2OWO A;  5EK0 A;  2WLL B;  1F23 A;  4IYH A;  3D8C A;  4DV1 B;  4E2L A;  3P3P A;  4LF4 B;  1ROP A;  4JI4 B;  3RYH A;  5JJJ B;  1CEZ A;  5EYP B;  3SPJ A;  1XNQ O;  2RJZ A;  3ZHR A;  2AW9 A;  4DK0 A;  2IU0 A;  1NKD A;  1M57 B;  3ASO B;  2PF4 E;  3DSQ A;  4J42 A;  2MW2 B;  3JCZ A;  1J95 A;  1PKX A;  1M93 A;  3LNM B;  4YY3 O;  1SES A;  2XUM A;  1GAX A;  5D5Q A;  1FFX B;  1OCC B;  1B6Q A;  1WJZ A;  3E83 A;  4BR6 A;  3EVK A;  1OJH A;  1XMQ O;  4DV3 B;  4PA7 A;  4Q20 A;  4I7Z B;  1BHB A;  5KHH A;  1URF A;  2EIL B;  2OIG A;  1HNZ B;  3FB5 C;  4OX9 O;  4UVB A;  2D2C B;  2RMK B;  4RUE A;  3E89 A;  4ZOL A;  1HR0 O;  4B3M B;  1XQ8 A;  1ZL8 B;  2M6Y A;  4JI5 O;  4JI0 O;  1KC8 W;  4TQF A;  3R66 A;  4L87 A;  4MTO A;  2JK5 C;  2E3C A;  3IC9 A;  1Q8I A;  1Y74 A;  5BMV A;  3ZHS A;  3AG3 C;  2WLN A;  2P22 C;  3CC7 V;  1NS1 A;  2UXB B;  4I4T B;  2FTK A;  2B1G A;  3WG7 B;  4ZBM A;  5IE9 A;  2X6B A;  3G6E V;  1Q43 A;  2EIN C;  4I9W A;  4UCR A;  1Y76 A;  4D6T H;  1X4T A;  5B3S C;  4J10 A;  3CMA V;  3E22 B;  2R9A A;  5KA6 A;  2JVD A;  1QR8 A;  1QBZ A;  2LJ2 A;  3RWR D;  2ZNI A;  4DRX B;  4OGQ B;  4I5S A;  2UU9 B;  2HVJ C;  2ZR3 A;  4Z1V A;  4X1K B;  4YHH B;  2PI5 A;  4DXW A;  3APQ A;  1OHH G;  3A8T A;  1FJG B;  3CC4 V;  3D3I A;  4R8C A;  3Q4H A;  3VQX A;  1XNR B;  3PN1 A;  1XBL A;  3OEH G;  1TUB A;  1PPJ H;  4HBN A;  1IDS A;  4UUJ C;  5CA0 B;  2JGD B;  1MOF A;  2AXT Z;  3U10 A;  1P49 A;  3FYI B;  3CS5 A;  2P67 A;  2ZXW C;  4LNU A;  1JCH A;  5FPO A;  5LGU A;  4DR1 B;  1SC5 B;  3LSU A;  1UFI A;  2W6J G;  3KCX A;  4HNA A;  1VF6 C;  4K8Z A;  1HWY A;  4LFA O;  3BY6 A;  2WSS G;  3NXS A;  4W4K A;  2Y69 C;  2CGO A;  1W2B U;  1RP3 B;  2CTP A;  3SGI A;  1K5Q A;  3FB6 C;  2K1E A;  4IHJ B;  2GUZ B;  3X2Q C;  4UCV A;  1AP6 A;  1XMO O;  3RYF A;  2XAG A;  2QWR B;  2ZT9 B;  3HKE A;  2QGN A;  1FFT B;  4W4L A;  4JV5 O;  1H38 A;  3BCC H;  1VF6 A;  3RVZ A;  1AVM A;  1JQ0 A;  4X1Y A;  3ZBH A;  4DR2 B;  4P9O A;  1G8M A;  5H9C A;  3W7T A;  1EFR G;  2Z5U A;  4DV0 O;  4OX9 B;  4WBN B;  2DYR B;  2PZS A;  4X65 O;  2X0L A;  4O2A B;  1YZB A;  1EN6 A;  1QLE B;  4DR6 B;  2NR5 A;  5L3B A;  1Q6I A;  2WLJ A;  2E5L B;  4UB8 Z;  4QPK A;  1O9G A;  4DR5 O;  2PUS A;  3K9S A;  4LH6 A;  2DN9 A;  1V55 C;  1VQK V;  1KP2 A;  5JCO C;  3JSL A;  3TXQ A;  3TK1 A;  3G71 V;  1AJQ A;  1R1B A;  3T2M A;  4AQY O;  5JJE B;  4D7S A;  5CBH A;  4WFA V;  1BQZ A;  1HNX B;  1NTM H;  2F4V O;  4U3J A;  4TT3 G;  4UVC A;  3B8M A;  1YF2 A;  4G2K A;  4C7U A;  5JJN B;  4BIU A;  3ABM B;  3T1Y O;  3JAT B;  3J80 N;  2FYU H;  1TVK B;  1Q6H A;  5LOV A;  4LF8 O;  1F4M A;  3CEI A;  4GKJ B;  3ZHQ A;  1SQP H;  1MG1 A;  3H1H H;  2YUA A;  2QTO A;  1H8E G;  1IXM A;  3CCJ V;  3R65 A;  4I50 B;  3ZHV A;  2XTA A;  4I55 A;  4IIJ A;  1KB9 F;  3E35 A;  2JDI G;  3W7U A;  4JI2 O;  3J81 N;  2KQX A;  2X6A A;  1ARO P;  1GKF A;  3O65 A;  1US6 A;  2FKX A;  3F7V C;  1WLE A;  4PA9 A;  4I0X A;  4QPJ A;  1HNW O;  3CXH F;  1BS3 A;  2XAH A;  4K35 A;  2Q0O C;  4L8J A;  5ITZ A;  1E1R G;  4BWA A;  2BTO A;  1QR9 A;  4Z2W A;  2CH7 A;  3UT5 A;  4CH5 A;  2IM9 A;  5LMU O;  1UPG A;  3K79 A;  1RSO A;  3ABK B;  4JAS A;  4JI7 O;  3UO3 A;  2Q73 A;  2QKS A;  3QNE A;  4MTF A;  4JV5 B;  2ODM A;  1VEW A;  4WFB V;  1B04 A;  4NYK A;  2EIK C;  4JYA B;  1OZ0 A;  4U3F H;  2ZNJ A;  4IL6 Z;  4K3A A;  4NB5 A;  4PDL A;  2EIM B;  3S3W A;  3LDE A;  1JPX A;  4KHP O;  4FM0 A;  5CA1 A;  2OT5 A;  1W59 A;  4DR4 O;  1Q3E A;  3DC6 A;  4TV8 A;  4X65 B;  1S5J A;  1NH2 D;  3IAY A;  1NVP D;  5F2V O;  1N36 O;  4FLW A;  1S72 V;  3OUS A;  4X1I B;  4JYB A;  4BW9 A;  4P9P A;  4WCE V;  4F6R A;  4MVM A;  1FPO A;  2Q0A A;  1BCC H;  3CX5 F;  3VQV A;  2Q68 A;  3C3T A;  5B1B C;  1L1F A;  4AQY B;  2Q69 A;  1YJ9 V;  3QVN A;  2F4V B;  1YSC A;  2YEV B;  1H2M A;  2H3O A;  2QKC A;  3L9D A;  5IYZ A;  1KUQ A;  3T1Y B;  1IBK B;  3K9A A;  2ETN A;  3BPZ A;  3CCQ V;  4MSW C;  4GYC B;  1UJW B;  4R50 A;  1XHX A;  4B3R O;  5KUK A;  3OT7 A;  4LF8 B;  1V54 C;  4J9Z B;  1HP8 A;  2DWD C;  3N27 A;  1SS3 A;  4DV7 B;  1M57 C;  3ASO C;  5LGN A;  1VQ7 V;  4EB6 A;  3HKB B;  1H2L A;  2DQ3 A;  3OMA B;  3ZRX A;  1GN6 A;  1Q82 W;  5J2T B;  4AI8 A;  3K5L A;  2BOC C;  4NXM O;  2OIE A;  5B5E Z;  4JI2 B;  1OCC C;  2LGQ A;  1DTO A;  2CTR A;  1MMM A;  4RO2 A;  3T1H O;  2QJ1 A;  1XL4 A;  2WLL A;  4X66 O;  5GON B;  1K33 A;  5BY1 A;  2VQF B;  2EIL C;  4ABM A;  1GN4 A;  2B1I A;  4PDV A;  5EYP A;  4GT1 A;  5KHJ A;  5DN6 G;  1W0K G;  3G6B A;  3CJH A;  4CS3 A;  2VQE O;  3RVY A;  5KX5 B;  5LMU B;  1I5Y A;  3WFV A;  1DLB A;  3B40 A;  4O4I B;  3FYE B;  1EM1 A;  1FFX A;  4JI7 B;  1YJW V;  1K34 A;  4NTX A;  2W0F C;  1X59 A;  5CBG A;  3H1L H;  3N2K B;  3L74 H;  5C8Y B;  3CRA A;  1MSW D;  3N2G B;  1JJO A;  1YEW A;  4XBF A;  2BSK A;  3OTO O;  2Q6A A;  1SER A;  4U7O A;  4QJF B;  3OD4 A;  4KP4 A;  4F4L A;  3M8A A;  3K5M A;  1Y67 A;  1ZL8 A;  2QWO B;  1GMG A;  3CWB H;  2UXD O;  1Q90 D;  4MVO A;  4DR4 B;  1N33 O;  4CS2 A;  1S5L Z;  1JFF B;  3JAL B;  4PI0 A;  5EIB D;  2DYS B;  3FB7 C;  4HYO A;  2A06 H;  5FNV B;  5EIB C;  4I4T A;  1XRE A;  4LF6 O;  2W0X A;  2C2A A;  3TCU A;  1GM7 A;  2IJH A;  1OCO B;  3SR2 C;  4LCU C;  5A9G A;  1ZLZ A;  3E22 A;  4PA3 A;  2ZE7 A;  3P3N A;  4GX2 A;  2JIZ G;  4I9Q A;  1R3J C;  3A2F A;  1YJN V;  1J5E B;  1KU9 A;  2ZE5 A;  1QVF U;  2R9R B;  1FXH A;  4DRX A;  1M4U A;  1YXB A;  2F1M A;  5K1P A;  4XDK A;  3CC2 V;  4DR7 B;  3M99 B;  5CB4 B;  3RYC B;  4PD4 F;  1VQ4 V;  5LA6 A;  3I55 V;  3DGE A;  3JAK B;  1BL8 A;  1I0H A;  1KP3 A;  3ABU A;  4MVR A;  5IJ0 B;  3CP1 A;  2A9H A;  5L3E A;  2JGD A;  4IGG A;  3G4S V;  2ZIO A;  4DV2 B;  2YIC A;  1KEC A;  1N0N A;  1RPO A;  4KL1 A;  4LF5 B;  4DV5 B;  4TUY B;  3JD1 A;  3OTF A;  4O4H A;  1SA0 B;  4J7K A;  1AB3 A;  3A0B Z;  3T1H B;  5KAI Z;  5EBM C;  5KMG A;  1GRJ A;  1B3Q A;  1TGO A;  3ETQ A;  4GX5 A;  3RYI B;  1F4N A;  5KLV H;  4IHJ A;  1W0J G;  3ICX A;  3ZMS A;  2GUZ A;  2DYR C;  1Q86 W;  1BMF G; 
#chains in the Genus database with same CATH homology
 4CBC A;  4UXN A;  3OEE G;  1FFT B;  3IFX A;  5KUM A;  2EZP A;  3E8F A;  1H38 A;  3WG7 C;  3RVZ A;  2BOB C;  4RAI A;  1JX9 A;  1JQ0 A;  1RPR A;  2JJ2 G;  3ZCC A;  1FXV A;  3D36 A;  5LGT A;  1M1K W;  4P9O A;  5KA5 A;  1G8M A;  5H9C A;  1NJI W;  1LNQ A;  1AJP A;  3OFN G;  1EFR G;  3W7T A;  3CPW U;  1R6K A;  3JD2 A;  2Z5U A;  1VQ6 V;  2HVK C;  1VQL V;  5HFM A;  2DYR B;  3CYO A;  1THZ A;  2OTJ V;  2X0L A;  3AG2 C;  2WPD G;  3E86 A;  3CD6 V;  1TUE B;  4H37 A;  1EBO A;  1QLE B;  3I56 V;  4FIP C;  4JTC B;  4P30 A;  3ZMV A;  3ABM C;  3ZIA G;  5L3B A;  3EHB B;  2WLJ A;  3FB8 C;  2IH3 C;  4MVU A;  4QPK A;  3GB7 C;  1E79 G;  1RM1 C;  1V55 C;  3F5W C;  1VQK V;  4TSF G;  1KP2 A;  3ZJZ A;  3LSS A;  2XAJ A;  3TK1 A;  3G71 V;  2UXN A;  1AJQ A;  1F51 A;  3T2M A;  1K97 A;  1PD3 A;  4QIW F;  2XOK G;  4P2Z A;  3AG2 B;  2H8P C;  4JTD B;  3OM3 B;  2XAF A;  3JYC A;  3ZN1 A;  3OUF A;  4WFA V;  5E1A C;  4TT3 G;  4UVC A;  3B8M A;  2HR3 A;  3ABT A;  3OR7 C;  4G2K A;  2QEX V;  2WLI B;  1K92 A;  2IJK A;  4BIU A;  3ABM B;  2QA4 V;  5HFL A;  4FJC C;  3STL C;  3ZRV A;  5IYD O;  1ENV A;  4EKW A;  2A0L A;  1YHQ V;  2WLI A;  5EC1 C;  2V7Q G;  3K03 A;  2OTL V;  1K3E A;  1OCZ C;  2ZQM A;  1NH2 B;  5LHI A;  1M56 C;  1V55 B;  5LBQ A;  4PA6 A;  3T4Z A;  1PNL A;  3AEI A;  4QE9 A;  3SYQ A;  5EBW C;  4GX1 A;  1NVP B;  1F4M A;  4MVQ A;  3QO8 A;  2IJJ A;  4MS2 A;  3SYO A;  2LP7 A;  1MG1 A;  3AG1 C;  5CMU A;  1NR1 A;  3K0G A;  3SPH A;  3W7S A;  3K08 A;  1YTF D;  1AJN A;  2B5U A;  3EFF K;  3SJQ C;  3CME V;  4FK5 C;  2QTO A;  4MTG A;  1H8E G;  1IXM A;  3CCJ V;  5BZB A;  3R65 A;  1R3L C;  2GSM B;  1AR1 B;  4MT8 A;  4Z1M G;  1WPX A;  2DW4 A;  3H01 A;  3E35 A;  2R9I A;  5L3F A;  3CCL V;  1OCR C;  1FS0 G;  2JDI G;  5LHG A;  3W7U A;  2H94 A;  1VQN V;  4LC1 A;  5B1O A;  1M56 B;  2X6A A;  2AHZ A;  1ARO P;  1GKF A;  5IY5 C;  2IJI A;  3SPI A;  1VQ8 V;  1MAB G;  3F7V C;  4KFM A;  1WLE A;  4PA9 A;  4RQF A;  4QPJ A;  1K9M W;  1PL0 A;  2LFS A;  3AG1 B;  3GWO A;  2WLM A;  3RBZ A;  2XAH A;  3OMN B;  3CCU V;  1K7D A;  3IC7 A;  4FPP A;  3ZN0 A;  4MVZ A;  2KB1 A;  4HZ3 A;  2P90 A;  1E1R G;  4U7N A;  5H6Q A;  3SPC A;  2IU3 A;  4JTA B;  1FXK B;  4LP8 A;  4BIZ A;  2JJ1 G;  1QR9 A;  1V54 B;  1AI4 A;  1QLE C;  3IGA C;  1OCR B;  2IW5 A;  3TET A;  3K79 A;  3ABK B;  5IY5 B;  4JAS A;  3ZRS A;  3ABL C;  3ETG A;  2QKS A;  2X6C A;  3QNE A;  4MTF A;  2EJR A;  3ETD A;  1QCE A;  1QLN A;  4WFB V;  2EIK C;  1OZ0 A;  1R3K C;  2ATK C;  4PDL A;  3OW2 U;  2EBO A;  2NLJ C;  1K4D C;  2EIM B;  1R73 A;  2WWW A;  3PJS K;  5LHH A;  1JJ2 U;  1S0V A;  5H6R A;  2Z3Y A;  1ZWI C;  3LDE A;  1EZJ A;  2OCC B;  3ZRW B;  5J9P C;  1JPX A;  3P32 A;  4JPR A;  2ZD9 A;  1QVG U;  1R3I C;  1SRY A;  3QO5 A;  2OT5 A;  3ZRW A;  3OAA G;  1VQM V;  5L3C A;  1CP9 A;  1NH2 D;  1AI6 A;  1K5S A;  3ABL B;  2DWE C;  1NVP D;  3E8B A;  1N8R W;  2EIK B;  2EIJ B;  3K04 A;  3JD3 A;  1S72 V;  1S5H C;  2QM7 A;  3OUS A;  4MW3 A;  1G4Y B;  4MVS A;  3SPG A;  3K0D A;  1VQ9 V;  1GM8 A;  2HG5 C;  3RW0 A;  4JYB A;  1AI5 A;  3JD4 A;  3T4D A;  4P9P A;  4UV8 A;  2ZDI C;  4WCE V;  2Y48 A;  4MVM A;  3MHH C;  4N21 A;  3OE7 G;  1KD1 W;  1NBM G;  2MK3 A;  3SYP A;  3ASN C;  2Q68 A;  1NQT A;  1VQO V;  1XL6 A;  2IH1 C;  3W7W A;  3JD0 A;  5EBL C;  3E8G A;  5B1B C;  1L1F A;  4RQE A;  5C93 A;  2Q69 A;  2W6I G;  1YJ9 V;  1YSC A;  2YEV B;  1KKD A;  1VQ5 V;  2WLH A;  3K3W A;  4KUM A;  2YEV A;  1H2G A;  4QNH B;  2GHY A;  3K9A A;  3LSQ A;  3AG3 B;  1GM9 A;  4OXS A;  3CCQ V;  4MSW C;  4XDJ A;  1UJW B;  1PNK A;  4R50 A;  4WFH A;  5KUK A;  5B1A B;  4GCZ A;  3LUT B;  5B3S B;  4X8A A;  4PDR A;  3ASN B;  2ZDI A;  1FXK C;  4JAV A;  1V54 C;  4CZZ A;  4R7C A;  5B1B B;  4J9Z B;  4XDL A;  5B1N A;  2DWD C;  4R6Z A;  3E2E A;  4JF3 A;  4RUF A;  1M57 C;  3ASO C;  1M9N A;  3T1C A;  5LGN A;  1VQ7 V;  1Y4M A;  3BEH A;  2DQ3 A;  3STZ C;  3OMA B;  3ZRX A;  3ZMZ A;  3ABK C;  1S77 D;  1DF5 A;  1Q82 W;  1H8H G;  1BHA A;  2BOC C;  4G28 B;  3MD0 A;  1YIT V;  1P4R A;  1AI7 A;  1Q7Y W;  1ORQ C;  2V1D A;  2M7W A;  1OCC C;  3LDD A;  1K73 W;  5EK0 A;  1DTO A;  2A79 B;  1NR7 A;  2WLL B;  4RO2 A;  1F23 A;  3ZMT A;  5EC2 C;  4E2L A;  1XL4 A;  4J9Y B;  2EIM C;  1ROP A;  2WLL A;  3UM7 A;  5L3G A;  1K33 A;  1JOY A;  2ZR2 A;  5L3D A;  2EIL C;  2OCC C;  3SPJ A;  1CEZ A;  5CN0 A;  2DQ0 A;  2D3O W;  2XND G;  4X88 A;  2XAS A;  4UV9 A;  2B1I A;  4PDV A;  2IU0 A;  1NKD A;  1FXK A;  1M57 B;  3ASO B;  3UKM A;  3B8N A;  4DO2 A;  3ML0 A;  5IDJ A;  1GK9 A;  1R6N A;  4GT1 A;  4UVA A;  2HLD G;  3JCZ A;  5DN6 G;  1W0K G;  2JEX A;  1J95 A;  1PKX A;  4G27 B;  3LNM B;  4QE7 A;  4BAY A;  1K4C C;  2XAQ A;  1SES A;  2ZXW B;  2EZO A;  1OCC B;  3RVY A;  1B6Q A;  3E83 A;  1I5Y A;  3WFV A;  1DLB A;  3VBB A;  2EIJ C;  3F7Y C;  3FYE B;  3SYC A;  2ITC C;  4PA7 A;  3ZMU A;  1YJW V;  1K34 A;  2DYS C;  4Q20 A;  3CCV V;  2W0F C;  1BHB A;  2Y69 B;  5CBG A;  2EIL B;  4JYC A;  3FB5 C;  4UVB A;  1MSW D;  1YI2 V;  4GX0 A;  4PDM A;  2AHY A;  3E89 A;  4RUE A;  5IYB O;  4XBF A;  3FKS G;  3SYA A;  2Q6A A;  2P7T C;  1SER A;  4U7O A;  1OCO C;  2HFE C;  4ASU G;  4QJF B;  3OMI B;  4KP4 A;  1Y66 A;  3CCE V;  3X2Q B;  4F4L A;  3CCR V;  3K06 A;  1KC8 W;  1E1Q G;  1COW G;  4L87 A;  1GMG A;  4MTO A;  5CBF A;  2JK5 C;  4WFE A;  4MVO A;  3HPL C;  4H33 A;  2QE7 G;  4HAM A;  2HJF C;  3AG3 C;  3E8H A;  2WLN A;  3CC7 V;  2DYS B;  3FB7 C;  4LBE C;  2FTK A;  4HYO A;  2B1G A;  3WG7 B;  1M90 W;  5GW7 A;  4ZBM A;  2X6B A;  3G6E V;  3AG4 C;  2EIN C;  1CPY A;  4I9W A;  5B1A C;  2JEU A;  5B3S C;  3DTU B;  2P6J A;  3CMA V;  4PEL A;  2C2A A;  3TCU A;  1PNM A;  1GM7 A;  5KA6 A;  2IJH A;  1Q81 W;  1OCO B;  1QBZ A;  1QR8 A;  5DM6 V;  1KQS U;  4LCU C;  4PA3 A;  2WLK A;  4GX2 A;  2JIZ G;  3B77 A;  1R3J C;  1YJN V;  2HKO A;  2CK3 G;  4I5S A;  4N23 A;  2F43 G;  1GTO A;  4X89 A;  2HVJ C;  1K8A W;  2ZR3 A;  2R9R B;  1QVF U;  1FXH A;  2PI5 A;  4DXW A;  4MTX A;  3KG2 A;  3CC2 V;  4XDK A;  1OHH G;  3M99 B;  1DF4 A;  1S3J A;  3CC4 V;  3CCM V;  3D3I A;  4ZKI A;  4R8C A;  1VQ4 V;  3AG4 B;  2EIN B;  3I55 V;  1S76 D;  3OR6 C;  1RM1 B;  3OEH G;  3MHS C;  2YSU B;  3LDC A;  3DGE A;  5IYC O;  4MW8 A;  5CA3 A;  1BL8 A;  2NNU A;  4UUJ C;  3ETE A;  1KP3 A;  1JVM A;  3ABU A;  4MVR A;  3CCS V;  2QM8 A;  1SZT A;  1MOF A;  4YXW G;  3CP1 A;  1YIJ V;  1I5X A;  2A9H A;  2UXX A;  3VOU A;  1VQP V;  5L3E A;  2PI4 A;  4PA4 A;  3G4S V;  3FYI B;  2P67 A;  2ZXW C;  3OGC C;  1JCH A;  4JAU A;  4WF9 V;  5LGU A;  1KEC A;  2W6J G;  4FMT A;  1RPO A;  4TWK A;  1HWY A;  2WAM A;  3BY6 A;  3QO7 A;  2WSS G;  3NXS A;  4WFG A;  2Y69 C;  4JGS A;  3CXC U;  1OCZ B;  1P7B A;  3JD1 A;  5CBH A;  2X7R B;  1W2B U;  5FL7 G;  4BW5 A;  5EBM C;  2LFR A;  1K5Q A;  1GO3 F;  3FB6 C;  3P30 A;  2K1E A;  4GX5 A;  4WFF A;  3W7X A;  3X2Q C;  3A0R A;  1F4N A;  2ITD C;  2XAG A;  1W0J G;  3HB3 B;  3ZMS A;  1YTF B;  2DYR C;  1SET A;  2Q67 A;  1Q86 W;  1BMF G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...