2OTJV

13-deoxytedanolide bound to the large subunit of haloarcula marismortui
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
65
structure length
65
Chain Sequence
TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structures of Antibiotics Bound to the E Site Region of the 50 S Ribosomal Subunit of Haloarcula marismortui: 13-Deoxytedanolide and Girodazole.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S ribosomal RNA
total genus 23
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2007-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2otjV00
3CXCU 4WCEV 3I55V 2QA4V 1YIJV 3G71V 1YITV 1Q81W 1S72V 1N8RW 1KQSU 1VQ6V 3CMAV 3CCEV 3CCVV 3CC7V 1QVGU 1K9MW 1VQ8V 1K8AW 1YJ9V 1KC8W 1VQMV 1VQ4V 3CCUV 1YI2V 1JJ2U 2OTLV 3CMEV 1VQOV 3CC4V 1VQNV 3CCSV 1VQPV 4WF9V 1YJWV 1KD1W 1Q86W 1QVFU 1VQ9V 4WFAV 5DM6V 1VQ5V 1NJIW 3CCMV 3CCQV 1VQLV 3G6EV 1VQKV 1R73A 3OW2U 1Q82W 4WFBV 1K73W 3I56V 2D3OW 3CD6V 1W2BU 3CCJV 3CPWU 1YJNV 1VQ7V 1Q7YW 1M90W 3CCLV 2QEXV 3CC2V 1YHQV 2OTJV 1M1KW 3CCRV 3G4SV
chains in the Genus database with same CATH superfamily
2GUZB 1K5SA 1H8EG 2QWQB 1N36B 4LF9O 2Q4PA 2EIMC 4DR1O 1V55C 1FAFA 3WB0A 2GTSA 1R73A 4FM2A 5C8YA 3CEIA 4JI0B 2V4DA 3FKSG 3ZMSA 5L3BA 1FKAO 5FPRA 4LC1A 4X20B 1PPJH 4DV5O 5EC1C 3STLC 2Q7GA 2XAGA 4QJFB 1RPRA 2LW7A 4O4IA 1X4TA 4YJ3B 3SPCA 3WB2A 1SQQH 2AGAA 4UV8A 1N4CA 1YXBA 3D36C 4Q20A 3CCRV 2UXCO 2UUCB 2GTAA 1K9MW 3THOA 4LFAB 3FX7A 1XI1A 2LW1A 5L3EA 4H37A 2P67A 2JS5A 4Z1MG 1Q82W 2Y4TA 5CA1B 2QE7G 1YJNV 3HKBA 2P22C 2DN9A 3ABKB 4PA4A 2W6IG 4EFBA 4X66B 2NR5A 5EYPB 3T1CA 5LXTB 1TVKA 3CHXA 1TVKB 1XHXA 2DYRB 3E8BA 2JK5C 3S3WA 1IZ3A 2RQ6A 4NVPA 3SPGA 3K0GA 2HG5C 4WFGA 5KAFZ 5IYZB 4ZHQB 2ZD9A 4NYKA 2E5LO 1OCZC 4U3FH 4ZIBA 1IVSA 5F2VO 5C93A 4DW0A 2RN9A 1YVWA 1ZL8B 4X1IB 5LHGA 4NTWA 5IYBO 2WPDG 5KA6A 1Q8IA 3ETGA 4X66O 1K4CC 4DV7O 2VQFO 3BA9A 4JI7O 3BVOA 1K4DC 4MS2A 2WAMA 4AILC 3T1HB 3MHSC 2ETNA 2F95B 1KU9A 3E83A 4JI5B 4OPAA 4DR6B 4DRXA 4QE9A 2FB5A 4J42A 1CEZA 5IE9A 4FZ0A 1Y66A 3ZCCA 2QWPB 2EJRA 1WLEA 3VQYA 5L3GA 1N34B 4MTGA 1SRYA 2JVDA 3RGBA 1L0LH 5LYJB 1WPBA 3AK1A 4MVQA 4UCTA 1GN4A 1Q6HA 3H1LH 4FIPC 5IDJA 2ZINA 4I4TA 3NXSA 1LNQA 1M9NA 4RAIA 1WA8A 2Y69B 3P32A 5LA6B 3W7SA 1M90W 1N33B 1S5HC 1ZUQA 1J5EB 3OM3B 5FL7G 4DR2O 2VQEO 1JVMA 1M4UA 2DW4A 5K1PA 2DYSC 1S76D 1XREA 3A0HZ 3ABUA 5EBMC 2OCCB 4PA9A 1E1QG 2MK3A 1HNXB 1WNSA 1NR7A 3L70H 2PI4A 3RVZA 2WLKA 4YXWG 1KKCA 4I50A 2BTOA 3P3NA 5KUMA 4U3JA 1EZJA 5KMGB 3OMAB 4RUEA 2BOCC 3B8MA 4GKKB 2V7QG 4DRXB 4IIJB 4UUJC 4EB6B 1NH2D 1URFA 4YHHO 4I5SA 2YSUB 1VF7A 3G6BA 1Q43A 1MOFA 5IYZA 3C3SA 4R50A 2E76B 2P4VA 1G8MA 2R9AA 1PV0A 1YIJV 4XBFA 2QGNA 1MZFA 4PD4F 1AJNA 3J81N 3Q4HB 1BSMA 1SF9A 3Q4HA 1F7YA 2E3CA 1GAXA 4YJ3A 1SQBH 4GYCB 3QO5A 1IXBA 2LO1A 3CCQV 1IBKB 2UUAB 1AR1B 3CPWU 5KHGA 1PL4A 1N0NA 3ZMTA 3G80A 3SYCA 5A2QN 3WU2Z 3LNNA 1Q3EA 4MTOA 1ZAUA 1YITV 4DO2A 1Y76B 2AZ0A 4HYOA 1Y76A 4U7OA 1FXKB 1YDXA 4DV5B 1DGSA 3K5MA 1VQKV 4X89A 4RO2A 3RYHB 2YEVA 2ZE7A 4J9ZB 5IY5C 3DGEA 2DWEC 1M57C 2WLNA 1FD9A 4JAVA 2BCCH 2V1DA 4XDJA 2EIJC 3AG2B 1AI6A 1YCIA 2QKAA 2XAQA 5LA6A 3G67A 1VIBA 2Y0IA 4JAUA 1Q6IA 1HNXO 1XNQB 4DR1B 3F5WC 3L74H 1R3IC 2F43G 1FXKC 3FAVA 2YDEA 3BPZA 2WLLA 3K06A 1GM8A 3JAMN 4FLZA 1HP8A 1H2LA 3SJCC 1OJHA 1TAEA 1QR8A 4I0XA 2IW5A 1O9HA 1BL8A 3OTOO 5LP6C 2PUSA 4FLUA 4BIUA 3KCYA 1B6QA 1PKXA 2ATKC 3HKEB 4PDVA 2ZM6B 2L35A 5LL6Y 3JASA 3K5LA 1W0JG 4O4HB 4FFKA 2WSSG 2JJ1G 1GH6A 4OGQB 4EEQA 2X6BA 3C90A 5B1AB 4TV9A 2ZT9B 3SYAA 2FKXA 4B3RB 4GKKO 1Q6UA 4CZZA 4KXRA 3OUFA 1SA0A 2RJZA 3MD0A 3JD0A 4PA3A 1SQGA 4MW3A 1RSOA 1ENVA 1M56B 4HZ3A 2YICA 2OIEA 3OAAG 4I55A 1LUVA 1TGOA 4I55B 1FPOA 4CS2A 2QKSA 3ML0A 2WA3A 3TXSA 3UM7A 1FS0G 2QM8A 2Z0AA 2Q0OC 1JX9A 4FLTA 4CH3A 5CB4A 1R6NA 2B1IA 5CB4B 3H9VA 4Z1VA 4JI1O 3ZN0A 3OTFA 1MG1A 4CH4A 2LFRA 5LHHA 3VQWA 2KSDA 1NBMG 2RNBA 1FFTB 1Q90D 1FXHA 4FZ1A 4GZRB 3JASB 4RWUA 2MW2B 1K3EA 5JQGB 4JYYA 2E75B 4B3TB 5TISZ 1P4RA 3ZRWB 1US6A 3IJ4A 3N2KB 3U11A 4LF4O 3MDSA 2L6LA 4JGSA 2XAFA 2F66C 3VOUA 1KMIZ 5L3DA 1GM7A 3TETA 1JR9A 1KYOF 1VQ8V 1JMKC 1VQMV 2WLLB 1AP6A 4GX5A 5JCOC 2QM4A 5AG2A 1R3JC 1NKDA 1RSOB 3WB1A 4UCRA 4DK0A 5B66Z 1GN6A 1SETA 3HKEA 5BR8B 1K33A 2XUMA 1A32A 1QVGU 2VWJA 3OR6C 3CC4V 1YJWV 2YI8A 1SQVH 5KX5A 1VQLV 3EFFK 3RYHA 1AJPA 4X62O 2YEVB 1OHHG 3B8NA 1Q5OA 4MVOA 5H6QA 4JI1B 2EILB 1MZEA 2XOKG 4DXWA 1D2DA 1SESA 4NTYA 5D5PA 2QJ1A 3CCEV 3BRCA 1Y74B 4YJ2B 2JGDA 4B08A 1AR4A 5KA5A 4Q6GA 3ZHQA 2Q9LA 5EBWC 2D3OW 4O2BB 2CDYA 4DV3O 1J95A 2LP7A 2OCCC 3CXHF 2LGQA 3RYIB 1WB8A 4B3MB 3L71H 2KB1A 3ZHSA 3FAVB 1HW7A 3LSUA 4UXNA 4QGPA 2BTQB 3AG7A 4ZOLA 4ZOLB 3K03A 3J7AU 1U97A 1IX9A 1PL0A 1WN7A 3FB8C 4LF5O 4I0XB 1VEWA 5LGTA 1K34A 3RYFA 4BIZA 2X7RB 3ABKC 1HNWO 5KUKA 2CAZC 1BQZA 4ZI7A 4DR2B 2HLDG 4UV9A 3PN1A 4O4HA 3CS5A 3D8CA 1QQCA 2JS3A 2CUGA 3TCUA 5GTIZ 3AG4B 3FD9A 4CS3A 2EBOA 3N2KA 1TUEB 3H1HH 4WBNA 5K1XA 2AW9A 4CH6A 1I94B 4IT5A 3OUSA 3JD4A 2CTPA 2BSKB 1H2SB 1R3KC 4AQYB 4NXMB 4F6RA 1OCOB 2A0LA 4WF9V 4CC6A 3G6EV 3ABTA 4WFHA 3K5NA 2VQFB 3HKDA 1M93A 4K0KO 1QCEA 1F51A 2DJVA 4O4JA 4DW1A 4JI6B 1XL6A 3JAKA 1HR0O 4LF7O 3JATA 1QVFU 2N04A 5KX5B 1S5LZ 5LGUA 2PZSA 5CN0A 2HP8A 3T4ZA 3QTCA 2UXBB 2HVKC 4DUZO 4WFBV 1BT8A 2WLIA 2K1EA 1KP3A 1NQTA 4IYHA 2HR3A 5H6RA 4FLYA 1WPXA 1XQ8A 1ORQC 1YHQV 1COWG 1OCZB 4UB6Z 4MSWC 3W7UA 5JH7B 3AK3A 2IU3A 4O2AB 4UVCA 4DUYB 2LFSA 1I0HA 3AG2C 1U96A 1JJ2U 2LQTA 4C7UA 3WG7C 2XHBA 2Q6AA 4DR3O 4G28B 5LGNA 1VF6C 5FLXN 3ZS8C 3CRRA 2F1MA 1L0NH 5FNVA 1Q81W 3CRMA 4UCVA 4I9WA 1AILA 2YS8A 4FFBA 3L75H 4OXSA 4DR4O 2DMXA 2EILC 2RMKB 2XNDG 3LSQA 3LUTB 1D5AA 5GONB 1EZVH 3CYOA 1W59A 2P90A 5LOVA 1QNMA 2UUCO 3CP1A 2X6CA 2GSMB 5B1BC 4JI0O 3FFQA 3K9AA 4UCOA 4JASA 3K59A 1M5IA 1SZTA 1AB3A 2WLJA 5L3CA 1VQNV 2BOBC 1OZ0A 5A9GA 3UCSC 1N36O 5DEDA 5J2UB 2DOSA 2M7WA 3JD1A 1BHAA 4R8CA 3ZMZA 4JI4B 2Q73A 3HKBB 4DV1O 3ZHUA 3N27A 2E74B 3STZC 2JRIA 4H44B 3A2FA 5HFLA 1G4YB 1BZKA 2GUZA 4LF4B 1MSWD 2ZDIA 1PM9A 2PF4E 4I9QA 5J2TB 4DUYO 4IHJA 3CWBH 1VQPV 1FYJA 1GKFA 1NTZH 4GX0A 4P9OA 2PGGA 3JYCA 5LBQA 3LDDA 4FLXA 2ZDIC 4J41A 2XAHA 3CXCU 1H8HG 1VMGA 4YIPA 1B06A 3OE7G 2IJHA 1OCRB 3DC5A 2X0LA 1XMQB 4IL6Z 4KHPO 5BR8O 4P9PA 1E79G 1RM1B 2R72A 2WLIB 5JJJB 3SYOA 3K08A 1XBLA 2ADPA 4LF7B 3H1KH 3B40A 4UFZA 4QIWF 4WFFA 2WLHA 2VRZA 3ZRVA 4JTCB 1H2NA 2HHHO 2DQ0A 1EM1A 3E89A 3WFVA 1N33O 1V9PA 4I7ZB 1IXMA 4MT8A 3RBZA 5LHIA 1PNLA 4XDKA 2Q0AA 3O65A 3A8TA 4JTAB 4W4LA 1AROP 1BHBA 4R6ZA 2H94A 2QSAA 1ZSPA 3SJQC 4XDLA 1VF6A 2OT5A 4F6RB 3JCUZ 3AG3C 5LMNO 5J2TA 4X65B 3OMNB 2UU9O 1AI4A 2FL4A 2P06A 4JI3B 4FM0A 1WA8B 2VQEB 3ASOC 2RCVA 2JEXA 1DTOA 4UVBA 1N0JA 3SGIA 1G1XB 1ZLZA 3AK2A 3OEEG 3JAKB 3K5OA 5B3SB 2BE3A 3UKMA 2W0XA 2Y48A 3H01A 2ITDC 3DTUB 4JI7B 4MVUA 2OYQA 3N2GB 1AP5A 3ASNB 2GHYA 4TV8A 4K8ZA 3T4DA 3CD6V 5D5QA 3KKYA 1V55B 2GDSA 1CPYA 3E8HA 3JSNA 3TJTA 1O9GA 3IC9A 3IFXA 1V54C 2KQXA 1GN3A 4GKJB 2A3QA 5IYDO 3CCVV 1RPOA 4QNHB 5BZBA 1SQFA 4B3TO 2ZIOA 4FMTA 4JI4O 1XMOB 3ZRSA 1VQ7V 4BWAA 1WAZA 3W7XA 1P84F 2YI9A 3F5TA 5IJ9A 5IJ9B 5FNVB 2Z5UA 2PY5A 4G2KA 3OFNG 1UJWB 2EIKB 3ETQA 4WFEA 3LNMB 2JEUA 4FLVA 1AR5A 2EX3A 2PI5A 1JCHA 1K92A 1QLNA 1JFFB 2QWRB 3ZN1A 2OWOA 3ICXA 1XILA 4TSFG 1Q7YW 1SC5B 1EBOA 3RFRA 4F6EA 5EIBD 3LDCA 3RW0A 2W6JG 3RYCB 1OCCC 2IH1C 1VQ4V 4LBEC 3CCSV 2ZM6O 3SR2C 5H2FZ 5E1AC 2ZXWB 3ZHRA 2NNUA 5CA1A 5IT9N 1OCRC 4X1KB 1YSCA 1P7BA 5EYPA 3OD4A 5EZYA 3T1YB 5DECA 3QF7A 3CMAV 2OCHA 2CH7A 4W4KA 3JD2A 4FLWA 2AXTZ 4FVMA 3ZMUA 4MVSA 5C8YB 3TGUH 1THZA 1JQ0A 4DV2B 2FYUH 4P30A 1KQSU 3ZRXA 4X20A 4JI3O 5L3FA 1N34O 2NLJC 1MNGA 4LH6A 1YJ9V 4X65O 4GCZA 4X1IA 1ZL8A 4K35A 3FB6C 1Z2GA 2ZCEA 4MVRA 2A79B 2JJ2G 2HVJC 3BABA 4J9YB 2UXNA 3SPHA 3SJBC 3IGAC 3HB3B 4TQFA 1YTFB 4X88A 1QLEB 2ITCC 2ADQB 2WWWA 2UU9B 3E8GA 1BCCH 3R65A 2QDOA 5CA0A 2DYSB 5H5NA 3R66A 4IIJA 1SZXA 4LNUA 4K8XA 1FJGO 3AG1C 4B3MO 2YXYA 5B3SC 2EZOA 4A5UB 4UCSA 1K7DA 2IJKA 3B77A 4B3SB 1Y4MA 2IU0A 3K9SA 3KG2A 4LF9B 2OIGA 4O4LB 2Q67A 5LP6B 4O4LA 1YI2V 1VQOV 4DV1B 2UXDO 1VP7A 3U10A 5GTHZ 1WJZA 4OX9B 4DV4B 2YXLA 4YY3O 1CXZB 3ABLB 1MSDA 1I94O 1LUWA 1I7FA 1S3JA 1GN2A 4X64B 3G4SV 1R1BA 3U0ZA 1DLBA 5ITZB 4KUMA 2ZNJA 3B4SA 5B5EZ 3HPLC 2JGUA 3ASNC 3ABLC 4P2ZA 4JZGA 3ZMVA 3ZEDA 1NT2B 3CCLV 3E35A 2X6AA 1EN5A 4DUZB 1SS3A 2GBOA 5JVDA 5LXTA 1ZWIC 4JV5O 4NXMO 2CH7B 3E8FA 1NTKH 2K9PA 3RN4A 3UO3A 3UQ8A 5E79Z 1I5XA 1GMGA 5IYCO 1GRJA 1RM1C 5IJ0A 5FPOA 3IC7A 3QO8A 5IJ0B 5JJNB 5EC2C 4B7KA 4BW9A 4LFBO 4PDRA 4JI8B 1BQ0A 3K58A 1N8RW 3QVNA 4NXNO 3HR0A 5LMNB 4U7NA 2GV9A 2R70A 2ZKOA 4D7SA 4O4IB 3BEHA 3H1IH 4JI5O 4PA6A 3SPJA 1UFIA 1OCOC 3UO2A 2DYRC 3DXRB 3JARA 3DXRA 3JARB 3KZIZ 1Y67A 2F23A 4DV6O 1H2GA 1K97A 4H33A 4WFAV 2Q5ZA 2ZXWC 5EK0A 1MA1A 3CCJV 3A0RA 1B3QA 4FM1A 1MABG 5CA3A 2N74A 1Y6XA 5KLVH 2QWOB 5LYJA 1F4NA 4UVAA 5EBLC 4F4LA 1K8AW 5LP6A 2A9HA 5DN6G 4UCUA 3CJHA 5B1NA 2Q68A 1EN4A 2ZE5A 4LH7A 1JPXA 4JAAA 1CP9A 2P5OA 4JTDB 3D3IA 1Z5VA 2JGDB 4LCUC 4TWKA 2O57A 4J7KA 1D5NA 2XTAA 4DV3B 4LR3A 2UXBO 4ABMA 3CE2A 1GTOA 1P49A 3ZRWA 1RP3B 4MTXA 4GUNA 2N05A 1M1KW 4J11A 3RYIA 3OT7A 5B1AC 2UXDB 3OGCC 4TT3G 4RQFA 1E1RG 3GWKC 3APOA 4GLXA 4BAYA 4JYAB 3ZHTA 1KBHA 4B3RO 2FMLA 3QO7A 4LF5B 4DV4O 4H0LB 2XASA 1J5EO 5H9CA 1YF2A 1SQXH 4DV0B 1BE3H 5KHIA 4U3JB 3W7WA 4JYBA 4GT1A 5JVDB 5JCOA 3OMIB 5KMGA 2P4KA 2QM7A 2YIDA 1KP2A 1SERA 2F4VO 1BMFG 4DV2O 4IGGA 4DR5B 4LFCO 3L73H 1L8DA 3KCXA 1NTMH 3C3TA 5B1BB 2IBZH 2UXCB 1PD3A 1G6UA 5KHHA 3VQXA 4K3AA 1V54B 2HJDA 1H2MA 4J10A 2CGOA 3CRCA 4WBNB 1JOYA 4TV9B 4DV7B 4LFAO 2YUAA 3FYEB 4UB8Z 2Y4UA 1PP9H 1KB9F 2IJJA 2LGWA 1LR1A 4ICGA 1SA0B 1OV9A 3CMEV 3S3XA 1VQ5V 3EXAA 1UPGA 1L1FA 5KHJA 3UT5A 2E5LB 4DYLA 4O2BA 3T1YO 3M7MX 1F23A 2ILMA 3JD3A 4YY3B 3EHBB 1N32O 3BFRA 1IBLO 2IH3C 4E2LA 3DC6A 5JJEB 4ASUG 2WA4A 2UUAO 1NS1A 3NR7A 1NJIW 3FB7C 2A7WA 4ZBMA 3P3PA 3ZHVA 1XUQA 4HBNA 3CSXA 2B9ZA 4L87A 3RYFB 4OX9O 4LP8A 3ZX6A 4TUYA 4TUYB 4ZI7B 2A06H 5IWAB 3CJHB 1QHTA 3IAYA 3JALA 3AG3B 4EB6A 5JQGA 4KHPB 2PYLA 1EN6A 3SYQA 2UXXA 2EIJB 4WCEV 2HFEC 2ZE8A 3LSSA 4G27B 3RWRD 3A0BZ 3OEHG 1MMMA 1XHZA 3JSLA 4BIOA 1XMQO 1W0KG 4DK1A 4OPHA 1JJOA 3CC2V 4EFEA 3AG1B 4AQYO 2WLMA 3LDEA 1FXKA 2CTQA 4LF8O 1PNKA 3SDLA 1Z5WA 1XEQA 1IDSA 4BR6A 1QLEC 1KKDA 5IY5B 1AI5A 2IM9A 2JIZG 2Q8VA 2EINB 2F4VB 4JZ2A 4O2AA 1HNZB 1FXVA 4LFBB 3X2QB 1R3LC 2EIKC 2ZR2A 1HNWB 3OR7C 1Y74A 4YJ2A 1IBMO 4NR1A 2DWDC 3UT5B 2G38A 4PA7A 3FB5C 3ZIAG 4PI2A 2Q7EA 3W7TA 2HHHB 3I55V 2XAJA 5LMUO 4Z2WA 1M56C 1GK9A 1HR0B 1OCCB 2BTQA 2Q69A 4PDLA 2PYJA 4LWSB 1XDCA 4LWSA 2KKWA 4HAMA 2CGNA 1XNRO 1XOUA 4DR6O 1TUBB 3I56V 1GM9A 2HKOA 3BAAA 4X8AA 3JAWB 4H13B 5LOVB 3AG4C 1IBKO 3JAWA 4GX1A 2UUBB 4MVMA 1P7GA 5GW7A 2EJ7A 5BXZA 4L8JA 1YZBA 4YIOA 1KD1W 1Q86W 1VQ9V 5DM6V 3OGIB 2UUBO 3K79A 4B7EA 1X59A 3GVMA 1PNMA 2LJ2A 3L72H 2H3OA 4KFMA 2QTOA 5BY1A 1KECA 5BMVA 1AI7A 1H38A 3B2EE 1XNRB 1YTFD 3CC7V 3E2EA 3ETEA 1B04A 2BSKA 2YIBD 4AI8A 3ABMC 1SQPH 1QR9A 1FJGB 4N23A 4AHCA 2XT9A 2EULA 1NVPB 1F4MA 3HKDB 3HKCA 4GKJO 3P30A 1RFYA 4O4JB 1DF5A 4HNAA 3CX5F 2VS0A 3E86A 2HEPA 1S77D 4X62B 2YIBA 3TK1A 4PDMA 4PELA 3OTOB 4LF6B 4NXNB 1NH2B 5LMUB 2OTLV 3ZJZA 1EFRG 2ZIMA 2P7TC 4NKGB 1R6TA 3F7YC 3OW2U 2IJIA 3T2MA 1XNQO 1NZ6A 4LFCB 1WP8A 1M57B 4DR5O 3EVKA 2AZ2A 2AHYA 2JDIG 2YIAA 3CB2A 4D7TA 2W0FC 3K57A 5JH7A 1I08A 3BCCH 3CRQA 4LF8B 1KC8W 4CS4A 3JALB 3MAQA 4IYIA 4TOIA 3QNEA 3CCMV 2F93B 4QPKA 4PJ0Z 3ZBHA 4PHZA 3VQVA 2M6YA 2R9RB 3FYIB 3GB7C 3H1JH 1WP7A 5KHKA 2Y69C 3RVYA 2FTKA 4JV5B 2OTJV 5EIBC 4JYCA 1JA8A 5BMVB 2CTWA 1GO3F 3RT3C 4DR3B 4FFBB 4JI2B 2QWNB 4YHHB 5CBHA 1TUBA 4X1YB 2DE0X 3T1HO 4X1YA 2Q7HA 1NR1A 3PJSK 2R9IA 2D2CB 4QE7A 3F7VC 4DV6B 1S0VA 4J7ZA 3VBBA 4E4EA 3BY6A 2ZNIA 4KL1A 4B3SO 4JI6O 3M99B 1QBZA 1S5JA 1XL4A 2RDCA 3SPIA 2YC0A 4EKWA 5J2UA 3AEIA 3N2GA 4N21A 3APQA 4BW5A 3D3QA 3GWOA 3BHPA 4MTFA 5JWPA 4MW8A 2KG7A 4X9QA 3ETDA 2PTMA 1XMOO 4X1KA 1IURA 4TQDA 3K3WA 1HWYA 3SJAC 4PV1B 1NU1H 4IHJB 1T5EA 1VF5B 3I5DA 2NN4A 3HKCB 4PI0A 2Z3YA 4DR7B 4HNAB 3O9OA 3CRAA 2DQ3A 3G71V 2B5UA 1AVMA 4J80A 1ZX3A 4J7JA 1HNZO 3SYPA 4ZKIA 1FFXB 4DV0O 1FFXA 2EZPA 4K0KB 1WB7A 1BGYH 5GONA 2ZR3A 4R7CA 5CMUA 1IBMB 4KP4A 5J9PC 2C2AA 2Y0PA 1SKVA 4LF6O 4QPJA 3RYCA 4MVZA 1ROPA 1TA8A 3MHHC 4FK5C 5KAIZ 1DF4A 4D6TH 2QR4A 2ARHA 5CA0B 3DSQA 4DR7O 2ODMA 4JI8O 3JCZA 4LNUB 2CTRA 2B1GA 1K73W 5HFMA 2CK3G 4FJCC 1BS3A 1H2KA 2KG7B 3B09A 4JF3A 2ZQMA 4GX2A 1NI8A 2QA4V 5EZYB 1S72V 1VARA 2QTSA 4NTXA 4JYAO 3ABMB 4FPPA 4CC5A 4CBCA 1DK1A 5B1OA 5IWAO 3BA8A 4RQEA 4I4TB 1AJQA 1YEWA 3K0DA 1ZTEA 2EIMB 1JFFA 1I5YA 1W2BU 1KUQA 1K5QA 4X64O 4NB5A 3TXQA 1NVPD 4DR4B 2P6JA 4ZHQA 5CBGA 3D36A 1HDJA 2EINC 3WG7B 4CH5A 2ZE6A 5ITZA 1VQ6V 2AHZA 3J80N 2HJFC 3QG5A 2QKCA 2CE4A 3L9DA 3CCUV 2VWKA 3E22A 3M8AA 3X2QC 3JATB 3E22B 1IBLB 3ASOB 1QU7A 4TV8B 1R6KA 5CBFA 4I50B 4RUFA 1N32B 4JI2O 3K04A 2QEXV 2YXHA 4JPRA 2H8PC
chains in the Genus database with same CATH topology
1NBMG 5IYDO 3CCVV 1RPOA 4QNHB 1FFTB 5BZBA 1K5SA 1H8EG 1FXHA 2EIMC 1V55C 4FMTA 3AG3B 1K3EA 1R73A 3FKSG 3ZRSA 1VQ7V 1P4RA 3ZMSA 3ZRWB 3W7XA 3SYQA 2UXXA 5L3BA 4JGSA 2EIJB 4WCEV 2Z5UA 2XAFA 4LC1A 2HFEC 3LSSA 4G27B 4G2KA 3OFNG 3VOUA 5EC1C 3STLC 5L3DA 2EIKB 1UJWB 2XAGA 1GM7A 3OEHG 3TETA 4WFEA 1VQ8V 3LNMB 2JEUA 1VQMV 4QJFB 2WLLB 4GX5A 1RPRA 2PI5A 1JCHA 1K92A 1R3JC 1NKDA 3SPCA 1QLNA 1W0KG 3ZN1A 4TSFG 4UV8A 1Q7YW 1EBOA 4Q20A 3CC2V 3AG1B 3LDCA 3RW0A 3CCRV 2W6JG 1SETA 1K33A 1OCCC 1QVGU 2WLMA 2IH1C 3LDEA 1K9MW 1FXKA 1VQ4V 3OR6C 3CC4V 4LBEC 3CCSV 1PNKA 1YJWV 5L3EA 4H37A 2P67A 1VQLV 4Z1MG 1Q82W 3EFFK 5E1AC 2ZXWB 2NNUA 2QE7G 1AJPA 1QLEC 1YJNV 2YEVB 1OHHG 1KKDA 3B8NA 3ABKB 1OCRC 4MVOA 5H6QA 5IY5B 1AI5A 4PA4A 2W6IG 1YSCA 2JIZG 2EILB 1P7BA 2EINB 2XOKG 4DXWA 3T1CA 1SESA 3CMAV 3CCEV 1FXVA 2DYRB 3X2QB 1R3LC 2EIKC 2ZR2A 3E8BA 3OR7C 2JK5C 3JD2A 3SPGA 3ZMUA 5KA5A 3K0GA 4MVSA 2DWDC 5EBWC 2D3OW 1THZA 2HG5C 4WFGA 4PA7A 3FB5C 3ZIAG 1J95A 2LP7A 2OCCC 1JQ0A 3W7TA 2ZD9A 3I55V 2XAJA 1OCZC 2KB1A 4P30A 1M56C 3ZRXA 1KQSU 1GK9A 5L3FA 5C93A 2NLJC 4UXNA 1YJ9V 1OCCB 2Q69A 4PDLA 4GCZA 4HAMA 5LHGA 3FB6C 4MVRA 5IYBO 2A79B 2JJ2G 3K03A 2WPDG 2HVJC 5KA6A 3ETGA 4J9YB 3I56V 2UXNA 3SPHA 1PL0A 1K4CC 3FB8C 3IFXA 1GM9A 5LGTA 1K34A 3HB3B 3IGAC 1YTFB 4X88A 4BIZA 1QLEB 2ITCC 2X7RB 3ABKC 1K4DC 4MS2A 2WAMA 2HKOA 4X8AA 5KUKA 3MHSC 2WWWA 3AG4C 3E8GA 4GX1A 4MVMA 3R65A 5GW7A 3E83A 2HLDG 2DYSB 4UV9A 4QE9A 1KD1W 1Q86W 1VQ9V 5DM6V 1CEZA 3TCUA 3AG4B 3K79A 1Y66A 2EBOA 3ZCCA 3AG1C 1PNMA 2EJRA 1WLEA 5L3GA 1TUEB 5B3SC 2EZOA 1SRYA 4MTGA 4KFMA 1K7DA 2QTOA 2IJKA 3B77A 1KECA 1AI7A 1Y4MA 1H38A 2IU0A 4MVQA 1YTFD 3CC7V 3KG2A 3OUSA 3E2EA 4FIPC 3ETEA 2Q67A 3JD4A 5IDJA 1YI2V 1R3KC 1VQOV 3ABMC 1OCOB 2A0LA 1QR9A 4WF9V 3NXSA 1LNQA 4N23A 3G6EV 3ABTA 1M9NA 1NVPB 4RAIA 4WFHA 2Y69B 1F4MA 3P32A 3W7SA 1M90W 3P30A 1S5HC 1QCEA 1F51A 3ABLB 1S3JA 1DF5A 3OM3B 5FL7G 1JVMA 3G4SV 3E86A 2DW4A 1DLBA 1S77D 3TK1A 1XL6A 4KUMA 2DYSC 4PDMA 4PELA 1S76D 3ABUA 5EBMC 1NH2B 2OCCB 2OTLV 3ZJZA 4PA9A 1EFRG 2P7TC 3HPLC 1E1QG 2MK3A 3ASNC 3ABLC 1QVFU 5LGUA 4P2ZA 5CN0A 1NR7A 3T4ZA 2PI4A 3F7YC 3OW2U 2HVKC 2IJIA 2WLKA 3RVZA 4WFBV 3T2MA 2WLIA 2K1EA 4YXWG 1KP3A 1M57B 1NQTA 3ZMVA 2HR3A 3CCLV 2AHYA 5H6RA 3E35A 1WPXA 5KUMA 1ORQC 1YHQV 1COWG 2JDIG 1OCZB 2X6AA 4MSWC 3W7UA 2W0FC 1EZJA 1ZWIC 2IU3A 4UVCA 3OMAB 2LFSA 3AG2C 3E8FA 4RUEA 1KC8W 2BOCC 1JJ2U 3B8MA 2V7QG 1I5XA 3WG7C 1GMGA 4UUJC 3QNEA 3CCMV 2Q6AA 1NH2D 4QPKA 5IYCO 4G28B 4I5SA 2YSUB 5LGNA 1RM1C 3IC7A 2R9RB 3FYIB 3GB7C 3QO8A 1MOFA 5EC2C 2Y69C 3RVYA 4R50A 2FTKA 2OTJV 1G8MA 4PDRA 1YIJV 1Q81W 4JYCA 1N8RW 4XBFA 4I9WA 1GO3F 4U7NA 1AJNA 4OXSA 5CBHA 3BEHA 3QO5A 3CCQV 2EILC 2XNDG 3LSQA 1NR1A 3PJSK 4PA6A 3LUTB 1AR1B 3SPJA 3CPWU 1OCOC 3CYOA 3ZMTA 3SYCA 2DYRC 2R9IA 3F7VC 4QE7A 2P90A 1S0VA 4MTOA 3VBBA 3CP1A 1YITV 4DO2A 2X6CA 2GSMB 5B1BC 4HYOA 3BY6A 3K9AA 4U7OA 4JASA 1FXKB 3M99B 1QBZA 1SZTA 1XL4A 3SPIA 2WLJA 5L3CA 1VQNV 1H2GA 2BOBC 1K97A 1OZ0A 4EKWA 4H33A 4WFAV 2ZXWC 3AEIA 1VQKV 4N21A 5EK0A 4X89A 4BW5A 2M7WA 4RO2A 3JD1A 1BHAA 3GWOA 3CCJV 4MTFA 4R8CA 3ZMZA 3A0RA 2YEVA 4MW8A 1MABG 5CA3A 3ETDA 4J9ZB 3K3WA 5IY5C 3DGEA 2DWEC 1HWYA 3STZC 1F4NA 1M57C 4UVAA 5EBLC 5HFLA 1G4YB 4F4LA 1K8AW 1MSWD 2A9HA 5DN6G 2ZDIA 5B1NA 2WLNA 2Q68A 1JPXA 1VQPV 1CP9A 1GKFA 4JAVA 4JTDB 3D3IA 4GX0A 4LCUC 2V1DA 4XDJA 4P9OA 3JYCA 4TWKA 2EIJC 3AG2B 1AI6A 5LBQA 2XAQA 3LDDA 2ZDIC 2XAHA 1GTOA 2Z3YA 4JAUA 3ZRWA 3F5WC 4MTXA 1M1KW 2DQ3A 3CXCU 1H8HG 1R3IC 3G71V 2B5UA 3OE7G 2F43G 5B1AC 1FXKC 2IJHA 1OCRB 2X0LA 3OGCC 4TT3G 4RQFA 1E1RG 2WLLA 4BAYA 3SYPA 4ZKIA 3K06A 1GM8A 4P9PA 1E79G 2EZPA 3QO7A 1RM1B 2WLIB 2XASA 3SYOA 3K08A 5H9CA 2ZR3A 4R7CA 5CMUA 1QR8A 2IW5A 1BL8A 4KP4A 5J9PC 3W7WA 4JYBA 4GT1A 4QIWF 2C2AA 3OMIB 4WFFA 2WLHA 4BIUA 1B6QA 1PKXA 2ATKC 2QM7A 4PDVA 4QPJA 4MVZA 1ROPA 3MHHC 4FK5C 3ZRVA 1KP2A 1DF4A 4JTCB 1BMFG 1SERA 2DQ0A 3E89A 3WFVA 1W0JG 5B1BB 2WSSG 2JJ1G 3JCZA 1PD3A 2B1GA 1IXMA 4MT8A 3RBZA 5HFMA 5LHIA 1K73W 2X6BA 2CK3G 4FJCC 1PNLA 4XDKA 1V54B 4JTAB 1AROP 4JF3A 1JOYA 2ZQMA 4GX2A 5B1AB 2QA4V 1S72V 3SYAA 1BHBA 3FYEB 4R6ZA 2H94A 2IJJA 3ABMB 3SJQC 4CZZA 4XDLA 4FPPA 2OT5A 3OUFA 4CBCA 3CMEV 5B1OA 4RQEA 3MD0A 3AG3C 3JD0A 1AJQA 4PA3A 4MW3A 3OMNB 1AI4A 1VQ5V 3K0DA 2EIMB 1ENVA 1L1FA 1I5YA 1W2BU 1M56B 4HZ3A 1K5QA 3OAAG 3ASOC 1F23A 1NVPD 2P6JA 2JEXA 3JD3A 1DTOA 5CBGA 3D36A 4UVBA 3EHBB 2EINC 2QKSA 3WG7B 1VQ6V 2IH3C 2AHZA 4E2LA 2HJFC 3ML0A 3OEEG 5B3SB 3UKMA 2Y48A 3CCUV 4ASUG 3H01A 3UM7A 1FS0G 2ITDC 2QM8A 3X2QC 3DTUB 1JX9A 4MVUA 3ASOB 1R6NA 1NJIW 2B1IA 1R6KA 3ASNB 2GHYA 5CBFA 3T4DA 3FB7C 3CD6V 4ZBMA 3ZN0A 4RUFA 1MG1A 1V55B 1CPYA 3E8HA 2LFRA 3K04A 4L87A 2QEXV 4JPRA 4LP8A 5LHHA 1V54C 2H8PC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CXC U;  4WCE V;  3I55 V;  2QA4 V;  1YIJ V;  3G71 V;  1YIT V;  1Q81 W;  1S72 V;  1N8R W;  1KQS U;  1VQ6 V;  3CMA V;  3CCE V;  3CCV V;  3CC7 V;  1QVG U;  1K9M W;  1VQ8 V;  1K8A W;  1YJ9 V;  1KC8 W;  1VQM V;  1VQ4 V;  3CCU V;  1YI2 V;  1JJ2 U;  2OTL V;  3CME V;  1VQO V;  3CC4 V;  1VQN V;  3CCS V;  1VQP V;  4WF9 V;  1YJW V;  1KD1 W;  1Q86 W;  1QVF U;  1VQ9 V;  4WFA V;  5DM6 V;  1VQ5 V;  1NJI W;  3CCM V;  3CCQ V;  1VQL V;  3G6E V;  1VQK V;  1R73 A;  3OW2 U;  1Q82 W;  4WFB V;  1K73 W;  3I56 V;  2D3O W;  3CD6 V;  1W2B U;  3CCJ V;  3CPW U;  1YJN V;  1VQ7 V;  1Q7Y W;  1M90 W;  3CCL V;  2QEX V;  3CC2 V;  1YHQ V;  2OTJ V;  1M1K W;  3CCR V;  3G4S V; 
#chains in the Genus database with same CATH topology
 2GUZ B;  1K5S A;  1H8E G;  2QWQ B;  1N36 B;  4LF9 O;  2Q4P A;  2EIM C;  4DR1 O;  1V55 C;  1FAF A;  3WB0 A;  2GTS A;  1R73 A;  4FM2 A;  5C8Y A;  3CEI A;  4JI0 B;  2V4D A;  3FKS G;  3ZMS A;  5L3B A;  1FKA O;  5FPR A;  4LC1 A;  4X20 B;  1PPJ H;  4DV5 O;  5EC1 C;  3STL C;  2Q7G A;  2XAG A;  4QJF B;  1RPR A;  2LW7 A;  4O4I A;  1X4T A;  4YJ3 B;  3SPC A;  3WB2 A;  1SQQ H;  2AGA A;  4UV8 A;  1N4C A;  1YXB A;  3D36 C;  4Q20 A;  3CCR V;  2UXC O;  2UUC B;  2GTA A;  1K9M W;  3THO A;  4LFA B;  3FX7 A;  1XI1 A;  2LW1 A;  5L3E A;  4H37 A;  2P67 A;  2JS5 A;  4Z1M G;  1Q82 W;  2Y4T A;  5CA1 B;  2QE7 G;  1YJN V;  3HKB A;  2P22 C;  2DN9 A;  3ABK B;  4PA4 A;  2W6I G;  4EFB A;  4X66 B;  2NR5 A;  5EYP B;  3T1C A;  5LXT B;  1TVK A;  3CHX A;  1TVK B;  1XHX A;  2DYR B;  3E8B A;  2JK5 C;  3S3W A;  1IZ3 A;  2RQ6 A;  4NVP A;  3SPG A;  3K0G A;  2HG5 C;  4WFG A;  5KAF Z;  5IYZ B;  4ZHQ B;  2ZD9 A;  4NYK A;  2E5L O;  1OCZ C;  4U3F H;  4ZIB A;  1IVS A;  5F2V O;  5C93 A;  4DW0 A;  2RN9 A;  1YVW A;  1ZL8 B;  4X1I B;  5LHG A;  4NTW A;  5IYB O;  2WPD G;  5KA6 A;  1Q8I A;  3ETG A;  4X66 O;  1K4C C;  4DV7 O;  2VQF O;  3BA9 A;  4JI7 O;  3BVO A;  1K4D C;  4MS2 A;  2WAM A;  4AIL C;  3T1H B;  3MHS C;  2ETN A;  2F95 B;  1KU9 A;  3E83 A;  4JI5 B;  4OPA A;  4DR6 B;  4DRX A;  4QE9 A;  2FB5 A;  4J42 A;  1CEZ A;  5IE9 A;  4FZ0 A;  1Y66 A;  3ZCC A;  2QWP B;  2EJR A;  1WLE A;  3VQY A;  5L3G A;  1N34 B;  4MTG A;  1SRY A;  2JVD A;  3RGB A;  1L0L H;  5LYJ B;  1WPB A;  3AK1 A;  4MVQ A;  4UCT A;  1GN4 A;  1Q6H A;  3H1L H;  4FIP C;  5IDJ A;  2ZIN A;  4I4T A;  3NXS A;  1LNQ A;  1M9N A;  4RAI A;  1WA8 A;  2Y69 B;  3P32 A;  5LA6 B;  3W7S A;  1M90 W;  1N33 B;  1S5H C;  1ZUQ A;  1J5E B;  3OM3 B;  5FL7 G;  4DR2 O;  2VQE O;  1JVM A;  1M4U A;  2DW4 A;  5K1P A;  2DYS C;  1S76 D;  1XRE A;  3A0H Z;  3ABU A;  5EBM C;  2OCC B;  4PA9 A;  1E1Q G;  2MK3 A;  1HNX B;  1WNS A;  1NR7 A;  3L70 H;  2PI4 A;  3RVZ A;  2WLK A;  4YXW G;  1KKC A;  4I50 A;  2BTO A;  3P3N A;  5KUM A;  4U3J A;  1EZJ A;  5KMG B;  3OMA B;  4RUE A;  2BOC C;  3B8M A;  4GKK B;  2V7Q G;  4DRX B;  4IIJ B;  4UUJ C;  4EB6 B;  1NH2 D;  1URF A;  4YHH O;  4I5S A;  2YSU B;  1VF7 A;  3G6B A;  1Q43 A;  1MOF A;  5IYZ A;  3C3S A;  4R50 A;  2E76 B;  2P4V A;  1G8M A;  2R9A A;  1PV0 A;  1YIJ V;  4XBF A;  2QGN A;  1MZF A;  4PD4 F;  1AJN A;  3J81 N;  3Q4H B;  1BSM A;  1SF9 A;  3Q4H A;  1F7Y A;  2E3C A;  1GAX A;  4YJ3 A;  1SQB H;  4GYC B;  3QO5 A;  1IXB A;  2LO1 A;  3CCQ V;  1IBK B;  2UUA B;  1AR1 B;  3CPW U;  5KHG A;  1PL4 A;  1N0N A;  3ZMT A;  3G80 A;  3SYC A;  5A2Q N;  3WU2 Z;  3LNN A;  1Q3E A;  4MTO A;  1ZAU A;  1YIT V;  4DO2 A;  1Y76 B;  2AZ0 A;  4HYO A;  1Y76 A;  4U7O A;  1FXK B;  1YDX A;  4DV5 B;  1DGS A;  3K5M A;  1VQK V;  4X89 A;  4RO2 A;  3RYH B;  2YEV A;  2ZE7 A;  4J9Z B;  5IY5 C;  3DGE A;  2DWE C;  1M57 C;  2WLN A;  1FD9 A;  4JAV A;  2BCC H;  2V1D A;  4XDJ A;  2EIJ C;  3AG2 B;  1AI6 A;  1YCI A;  2QKA A;  2XAQ A;  5LA6 A;  3G67 A;  1VIB A;  2Y0I A;  4JAU A;  1Q6I A;  1HNX O;  1XNQ B;  4DR1 B;  3F5W C;  3L74 H;  1R3I C;  2F43 G;  1FXK C;  3FAV A;  2YDE A;  3BPZ A;  2WLL A;  3K06 A;  1GM8 A;  3JAM N;  4FLZ A;  1HP8 A;  1H2L A;  3SJC C;  1OJH A;  1TAE A;  1QR8 A;  4I0X A;  2IW5 A;  1O9H A;  1BL8 A;  3OTO O;  5LP6 C;  2PUS A;  4FLU A;  4BIU A;  3KCY A;  1B6Q A;  1PKX A;  2ATK C;  3HKE B;  4PDV A;  2ZM6 B;  2L35 A;  5LL6 Y;  3JAS A;  3K5L A;  1W0J G;  4O4H B;  4FFK A;  2WSS G;  2JJ1 G;  1GH6 A;  4OGQ B;  4EEQ A;  2X6B A;  3C90 A;  5B1A B;  4TV9 A;  2ZT9 B;  3SYA A;  2FKX A;  4B3R B;  4GKK O;  1Q6U A;  4CZZ A;  4KXR A;  3OUF A;  1SA0 A;  2RJZ A;  3MD0 A;  3JD0 A;  4PA3 A;  1SQG A;  4MW3 A;  1RSO A;  1ENV A;  1M56 B;  4HZ3 A;  2YIC A;  2OIE A;  3OAA G;  4I55 A;  1LUV A;  1TGO A;  4I55 B;  1FPO A;  4CS2 A;  2QKS A;  3ML0 A;  2WA3 A;  3TXS A;  3UM7 A;  1FS0 G;  2QM8 A;  2Z0A A;  2Q0O C;  1JX9 A;  4FLT A;  4CH3 A;  5CB4 A;  1R6N A;  2B1I A;  5CB4 B;  3H9V A;  4Z1V A;  4JI1 O;  3ZN0 A;  3OTF A;  1MG1 A;  4CH4 A;  2LFR A;  5LHH A;  3VQW A;  2KSD A;  1NBM G;  2RNB A;  1FFT B;  1Q90 D;  1FXH A;  4FZ1 A;  4GZR B;  3JAS B;  4RWU A;  2MW2 B;  1K3E A;  5JQG B;  4JYY A;  2E75 B;  4B3T B;  5TIS Z;  1P4R A;  3ZRW B;  1US6 A;  3IJ4 A;  3N2K B;  3U11 A;  4LF4 O;  3MDS A;  2L6L A;  4JGS A;  2XAF A;  2F66 C;  3VOU A;  1KMI Z;  5L3D A;  1GM7 A;  3TET A;  1JR9 A;  1KYO F;  1VQ8 V;  1JMK C;  1VQM V;  2WLL B;  1AP6 A;  4GX5 A;  5JCO C;  2QM4 A;  5AG2 A;  1R3J C;  1NKD A;  1RSO B;  3WB1 A;  4UCR A;  4DK0 A;  5B66 Z;  1GN6 A;  1SET A;  3HKE A;  5BR8 B;  1K33 A;  2XUM A;  1A32 A;  1QVG U;  2VWJ A;  3OR6 C;  3CC4 V;  1YJW V;  2YI8 A;  1SQV H;  5KX5 A;  1VQL V;  3EFF K;  3RYH A;  1AJP A;  4X62 O;  2YEV B;  1OHH G;  3B8N A;  1Q5O A;  4MVO A;  5H6Q A;  4JI1 B;  2EIL B;  1MZE A;  2XOK G;  4DXW A;  1D2D A;  1SES A;  4NTY A;  5D5P A;  2QJ1 A;  3CCE V;  3BRC A;  1Y74 B;  4YJ2 B;  2JGD A;  4B08 A;  1AR4 A;  5KA5 A;  4Q6G A;  3ZHQ A;  2Q9L A;  5EBW C;  2D3O W;  4O2B B;  2CDY A;  4DV3 O;  1J95 A;  2LP7 A;  2OCC C;  3CXH F;  2LGQ A;  3RYI B;  1WB8 A;  4B3M B;  3L71 H;  2KB1 A;  3ZHS A;  3FAV B;  1HW7 A;  3LSU A;  4UXN A;  4QGP A;  2BTQ B;  3AG7 A;  4ZOL A;  4ZOL B;  3K03 A;  3J7A U;  1U97 A;  1IX9 A;  1PL0 A;  1WN7 A;  3FB8 C;  4LF5 O;  4I0X B;  1VEW A;  5LGT A;  1K34 A;  3RYF A;  4BIZ A;  2X7R B;  3ABK C;  1HNW O;  5KUK A;  2CAZ C;  1BQZ A;  4ZI7 A;  4DR2 B;  2HLD G;  4UV9 A;  3PN1 A;  4O4H A;  3CS5 A;  3D8C A;  1QQC A;  2JS3 A;  2CUG A;  3TCU A;  5GTI Z;  3AG4 B;  3FD9 A;  4CS3 A;  2EBO A;  3N2K A;  1TUE B;  3H1H H;  4WBN A;  5K1X A;  2AW9 A;  4CH6 A;  1I94 B;  4IT5 A;  3OUS A;  3JD4 A;  2CTP A;  2BSK B;  1H2S B;  1R3K C;  4AQY B;  4NXM B;  4F6R A;  1OCO B;  2A0L A;  4WF9 V;  4CC6 A;  3G6E V;  3ABT A;  4WFH A;  3K5N A;  2VQF B;  3HKD A;  1M93 A;  4K0K O;  1QCE A;  1F51 A;  2DJV A;  4O4J A;  4DW1 A;  4JI6 B;  1XL6 A;  3JAK A;  1HR0 O;  4LF7 O;  3JAT A;  1QVF U;  2N04 A;  5KX5 B;  1S5L Z;  5LGU A;  2PZS A;  5CN0 A;  2HP8 A;  3T4Z A;  3QTC A;  2UXB B;  2HVK C;  4DUZ O;  4WFB V;  1BT8 A;  2WLI A;  2K1E A;  1KP3 A;  1NQT A;  4IYH A;  2HR3 A;  5H6R A;  4FLY A;  1WPX A;  1XQ8 A;  1ORQ C;  1YHQ V;  1COW G;  1OCZ B;  4UB6 Z;  4MSW C;  3W7U A;  5JH7 B;  3AK3 A;  2IU3 A;  4O2A B;  4UVC A;  4DUY B;  2LFS A;  1I0H A;  3AG2 C;  1U96 A;  1JJ2 U;  2LQT A;  4C7U A;  3WG7 C;  2XHB A;  2Q6A A;  4DR3 O;  4G28 B;  5LGN A;  1VF6 C;  5FLX N;  3ZS8 C;  3CRR A;  2F1M A;  1L0N H;  5FNV A;  1Q81 W;  3CRM A;  4UCV A;  4I9W A;  1AIL A;  2YS8 A;  4FFB A;  3L75 H;  4OXS A;  4DR4 O;  2DMX A;  2EIL C;  2RMK B;  2XND G;  3LSQ A;  3LUT B;  1D5A A;  5GON B;  1EZV H;  3CYO A;  1W59 A;  2P90 A;  5LOV A;  1QNM A;  2UUC O;  3CP1 A;  2X6C A;  2GSM B;  5B1B C;  4JI0 O;  3FFQ A;  3K9A A;  4UCO A;  4JAS A;  3K59 A;  1M5I A;  1SZT A;  1AB3 A;  2WLJ A;  5L3C A;  1VQN V;  2BOB C;  1OZ0 A;  5A9G A;  3UCS C;  1N36 O;  5DED A;  5J2U B;  2DOS A;  2M7W A;  3JD1 A;  1BHA A;  4R8C A;  3ZMZ A;  4JI4 B;  2Q73 A;  3HKB B;  4DV1 O;  3ZHU A;  3N27 A;  2E74 B;  3STZ C;  2JRI A;  4H44 B;  3A2F A;  5HFL A;  1G4Y B;  1BZK A;  2GUZ A;  4LF4 B;  1MSW D;  2ZDI A;  1PM9 A;  2PF4 E;  4I9Q A;  5J2T B;  4DUY O;  4IHJ A;  3CWB H;  1VQP V;  1FYJ A;  1GKF A;  1NTZ H;  4GX0 A;  4P9O A;  2PGG A;  3JYC A;  5LBQ A;  3LDD A;  4FLX A;  2ZDI C;  4J41 A;  2XAH A;  3CXC U;  1H8H G;  1VMG A;  4YIP A;  1B06 A;  3OE7 G;  2IJH A;  1OCR B;  3DC5 A;  2X0L A;  1XMQ B;  4IL6 Z;  4KHP O;  5BR8 O;  4P9P A;  1E79 G;  1RM1 B;  2R72 A;  2WLI B;  5JJJ B;  3SYO A;  3K08 A;  1XBL A;  2ADP A;  4LF7 B;  3H1K H;  3B40 A;  4UFZ A;  4QIW F;  4WFF A;  2WLH A;  2VRZ A;  3ZRV A;  4JTC B;  1H2N A;  2HHH O;  2DQ0 A;  1EM1 A;  3E89 A;  3WFV A;  1N33 O;  1V9P A;  4I7Z B;  1IXM A;  4MT8 A;  3RBZ A;  5LHI A;  1PNL A;  4XDK A;  2Q0A A;  3O65 A;  3A8T A;  4JTA B;  4W4L A;  1ARO P;  1BHB A;  4R6Z A;  2H94 A;  2QSA A;  1ZSP A;  3SJQ C;  4XDL A;  1VF6 A;  2OT5 A;  4F6R B;  3JCU Z;  3AG3 C;  5LMN O;  5J2T A;  4X65 B;  3OMN B;  2UU9 O;  1AI4 A;  2FL4 A;  2P06 A;  4JI3 B;  4FM0 A;  1WA8 B;  2VQE B;  3ASO C;  2RCV A;  2JEX A;  1DTO A;  4UVB A;  1N0J A;  3SGI A;  1G1X B;  1ZLZ A;  3AK2 A;  3OEE G;  3JAK B;  3K5O A;  5B3S B;  2BE3 A;  3UKM A;  2W0X A;  2Y48 A;  3H01 A;  2ITD C;  3DTU B;  4JI7 B;  4MVU A;  2OYQ A;  3N2G B;  1AP5 A;  3ASN B;  2GHY A;  4TV8 A;  4K8Z A;  3T4D A;  3CD6 V;  5D5Q A;  3KKY A;  1V55 B;  2GDS A;  1CPY A;  3E8H A;  3JSN A;  3TJT A;  1O9G A;  3IC9 A;  3IFX A;  1V54 C;  2KQX A;  1GN3 A;  4GKJ B;  2A3Q A;  5IYD O;  3CCV V;  1RPO A;  4QNH B;  5BZB A;  1SQF A;  4B3T O;  2ZIO A;  4FMT A;  4JI4 O;  1XMO B;  3ZRS A;  1VQ7 V;  4BWA A;  1WAZ A;  3W7X A;  1P84 F;  2YI9 A;  3F5T A;  5IJ9 A;  5IJ9 B;  5FNV B;  2Z5U A;  2PY5 A;  4G2K A;  3OFN G;  1UJW B;  2EIK B;  3ETQ A;  4WFE A;  3LNM B;  2JEU A;  4FLV A;  1AR5 A;  2EX3 A;  2PI5 A;  1JCH A;  1K92 A;  1QLN A;  1JFF B;  2QWR B;  3ZN1 A;  2OWO A;  3ICX A;  1XIL A;  4TSF G;  1Q7Y W;  1SC5 B;  1EBO A;  3RFR A;  4F6E A;  5EIB D;  3LDC A;  3RW0 A;  2W6J G;  3RYC B;  1OCC C;  2IH1 C;  1VQ4 V;  4LBE C;  3CCS V;  2ZM6 O;  3SR2 C;  5H2F Z;  5E1A C;  2ZXW B;  3ZHR A;  2NNU A;  5CA1 A;  5IT9 N;  1OCR C;  4X1K B;  1YSC A;  1P7B A;  5EYP A;  3OD4 A;  5EZY A;  3T1Y B;  5DEC A;  3QF7 A;  3CMA V;  2OCH A;  2CH7 A;  4W4K A;  3JD2 A;  4FLW A;  2AXT Z;  4FVM A;  3ZMU A;  4MVS A;  5C8Y B;  3TGU H;  1THZ A;  1JQ0 A;  4DV2 B;  2FYU H;  4P30 A;  1KQS U;  3ZRX A;  4X20 A;  4JI3 O;  5L3F A;  1N34 O;  2NLJ C;  1MNG A;  4LH6 A;  1YJ9 V;  4X65 O;  4GCZ A;  4X1I A;  1ZL8 A;  4K35 A;  3FB6 C;  1Z2G A;  2ZCE A;  4MVR A;  2A79 B;  2JJ2 G;  2HVJ C;  3BAB A;  4J9Y B;  2UXN A;  3SPH A;  3SJB C;  3IGA C;  3HB3 B;  4TQF A;  1YTF B;  4X88 A;  1QLE B;  2ITC C;  2ADQ B;  2WWW A;  2UU9 B;  3E8G A;  1BCC H;  3R65 A;  2QDO A;  5CA0 A;  2DYS B;  5H5N A;  3R66 A;  4IIJ A;  1SZX A;  4LNU A;  4K8X A;  1FJG O;  3AG1 C;  4B3M O;  2YXY A;  5B3S C;  2EZO A;  4A5U B;  4UCS A;  1K7D A;  2IJK A;  3B77 A;  4B3S B;  1Y4M A;  2IU0 A;  3K9S A;  3KG2 A;  4LF9 B;  2OIG A;  4O4L B;  2Q67 A;  5LP6 B;  4O4L A;  1YI2 V;  1VQO V;  4DV1 B;  2UXD O;  1VP7 A;  3U10 A;  5GTH Z;  1WJZ A;  4OX9 B;  4DV4 B;  2YXL A;  4YY3 O;  1CXZ B;  3ABL B;  1MSD A;  1I94 O;  1LUW A;  1I7F A;  1S3J A;  1GN2 A;  4X64 B;  3G4S V;  1R1B A;  3U0Z A;  1DLB A;  5ITZ B;  4KUM A;  2ZNJ A;  3B4S A;  5B5E Z;  3HPL C;  2JGU A;  3ASN C;  3ABL C;  4P2Z A;  4JZG A;  3ZMV A;  3ZED A;  1NT2 B;  3CCL V;  3E35 A;  2X6A A;  1EN5 A;  4DUZ B;  1SS3 A;  2GBO A;  5JVD A;  5LXT A;  1ZWI C;  4JV5 O;  4NXM O;  2CH7 B;  3E8F A;  1NTK H;  2K9P A;  3RN4 A;  3UO3 A;  3UQ8 A;  5E79 Z;  1I5X A;  1GMG A;  5IYC O;  1GRJ A;  1RM1 C;  5IJ0 A;  5FPO A;  3IC7 A;  3QO8 A;  5IJ0 B;  5JJN B;  5EC2 C;  4B7K A;  4BW9 A;  4LFB O;  4PDR A;  4JI8 B;  1BQ0 A;  3K58 A;  1N8R W;  3QVN A;  4NXN O;  3HR0 A;  5LMN B;  4U7N A;  2GV9 A;  2R70 A;  2ZKO A;  4D7S A;  4O4I B;  3BEH A;  3H1I H;  4JI5 O;  4PA6 A;  3SPJ A;  1UFI A;  1OCO C;  3UO2 A;  2DYR C;  3DXR B;  3JAR A;  3DXR A;  3JAR B;  3KZI Z;  1Y67 A;  2F23 A;  4DV6 O;  1H2G A;  1K97 A;  4H33 A;  4WFA V;  2Q5Z A;  2ZXW C;  5EK0 A;  1MA1 A;  3CCJ V;  3A0R A;  1B3Q A;  4FM1 A;  1MAB G;  5CA3 A;  2N74 A;  1Y6X A;  5KLV H;  2QWO B;  5LYJ A;  1F4N A;  4UVA A;  5EBL C;  4F4L A;  1K8A W;  5LP6 A;  2A9H A;  5DN6 G;  4UCU A;  3CJH A;  5B1N A;  2Q68 A;  1EN4 A;  2ZE5 A;  4LH7 A;  1JPX A;  4JAA A;  1CP9 A;  2P5O A;  4JTD B;  3D3I A;  1Z5V A;  2JGD B;  4LCU C;  4TWK A;  2O57 A;  4J7K A;  1D5N A;  2XTA A;  4DV3 B;  4LR3 A;  2UXB O;  4ABM A;  3CE2 A;  1GTO A;  1P49 A;  3ZRW A;  1RP3 B;  4MTX A;  4GUN A;  2N05 A;  1M1K W;  4J11 A;  3RYI A;  3OT7 A;  5B1A C;  2UXD B;  3OGC C;  4TT3 G;  4RQF A;  1E1R G;  3GWK C;  3APO A;  4GLX A;  4BAY A;  4JYA B;  3ZHT A;  1KBH A;  4B3R O;  2FML A;  3QO7 A;  4LF5 B;  4DV4 O;  4H0L B;  2XAS A;  1J5E O;  5H9C A;  1YF2 A;  1SQX H;  4DV0 B;  1BE3 H;  5KHI A;  4U3J B;  3W7W A;  4JYB A;  4GT1 A;  5JVD B;  5JCO A;  3OMI B;  5KMG A;  2P4K A;  2QM7 A;  2YID A;  1KP2 A;  1SER A;  2F4V O;  1BMF G;  4DV2 O;  4IGG A;  4DR5 B;  4LFC O;  3L73 H;  1L8D A;  3KCX A;  1NTM H;  3C3T A;  5B1B B;  2IBZ H;  2UXC B;  1PD3 A;  1G6U A;  5KHH A;  3VQX A;  4K3A A;  1V54 B;  2HJD A;  1H2M A;  4J10 A;  2CGO A;  3CRC A;  4WBN B;  1JOY A;  4TV9 B;  4DV7 B;  4LFA O;  2YUA A;  3FYE B;  4UB8 Z;  2Y4U A;  1PP9 H;  1KB9 F;  2IJJ A;  2LGW A;  1LR1 A;  4ICG A;  1SA0 B;  1OV9 A;  3CME V;  3S3X A;  1VQ5 V;  3EXA A;  1UPG A;  1L1F A;  5KHJ A;  3UT5 A;  2E5L B;  4DYL A;  4O2B A;  3T1Y O;  3M7M X;  1F23 A;  2ILM A;  3JD3 A;  4YY3 B;  3EHB B;  1N32 O;  3BFR A;  1IBL O;  2IH3 C;  4E2L A;  3DC6 A;  5JJE B;  4ASU G;  2WA4 A;  2UUA O;  1NS1 A;  3NR7 A;  1NJI W;  3FB7 C;  2A7W A;  4ZBM A;  3P3P A;  3ZHV A;  1XUQ A;  4HBN A;  3CSX A;  2B9Z A;  4L87 A;  3RYF B;  4OX9 O;  4LP8 A;  3ZX6 A;  4TUY A;  4TUY B;  4ZI7 B;  2A06 H;  5IWA B;  3CJH B;  1QHT A;  3IAY A;  3JAL A;  3AG3 B;  4EB6 A;  5JQG A;  4KHP B;  2PYL A;  1EN6 A;  3SYQ A;  2UXX A;  2EIJ B;  4WCE V;  2HFE C;  2ZE8 A;  3LSS A;  4G27 B;  3RWR D;  3A0B Z;  3OEH G;  1MMM A;  1XHZ A;  3JSL A;  4BIO A;  1XMQ O;  1W0K G;  4DK1 A;  4OPH A;  1JJO A;  3CC2 V;  4EFE A;  3AG1 B;  4AQY O;  2WLM A;  3LDE A;  1FXK A;  2CTQ A;  4LF8 O;  1PNK A;  3SDL A;  1Z5W A;  1XEQ A;  1IDS A;  4BR6 A;  1QLE C;  1KKD A;  5IY5 B;  1AI5 A;  2IM9 A;  2JIZ G;  2Q8V A;  2EIN B;  2F4V B;  4JZ2 A;  4O2A A;  1HNZ B;  1FXV A;  4LFB B;  3X2Q B;  1R3L C;  2EIK C;  2ZR2 A;  1HNW B;  3OR7 C;  1Y74 A;  4YJ2 A;  1IBM O;  4NR1 A;  2DWD C;  3UT5 B;  2G38 A;  4PA7 A;  3FB5 C;  3ZIA G;  4PI2 A;  2Q7E A;  3W7T A;  2HHH B;  3I55 V;  2XAJ A;  5LMU O;  4Z2W A;  1M56 C;  1GK9 A;  1HR0 B;  1OCC B;  2BTQ A;  2Q69 A;  4PDL A;  2PYJ A;  4LWS B;  1XDC A;  4LWS A;  2KKW A;  4HAM A;  2CGN A;  1XNR O;  1XOU A;  4DR6 O;  1TUB B;  3I56 V;  1GM9 A;  2HKO A;  3BAA A;  4X8A A;  3JAW B;  4H13 B;  5LOV B;  3AG4 C;  1IBK O;  3JAW A;  4GX1 A;  2UUB B;  4MVM A;  1P7G A;  5GW7 A;  2EJ7 A;  5BXZ A;  4L8J A;  1YZB A;  4YIO A;  1KD1 W;  1Q86 W;  1VQ9 V;  5DM6 V;  3OGI B;  2UUB O;  3K79 A;  4B7E A;  1X59 A;  3GVM A;  1PNM A;  2LJ2 A;  3L72 H;  2H3O A;  4KFM A;  2QTO A;  5BY1 A;  1KEC A;  5BMV A;  1AI7 A;  1H38 A;  3B2E E;  1XNR B;  1YTF D;  3CC7 V;  3E2E A;  3ETE A;  1B04 A;  2BSK A;  2YIB D;  4AI8 A;  3ABM C;  1SQP H;  1QR9 A;  1FJG B;  4N23 A;  4AHC A;  2XT9 A;  2EUL A;  1NVP B;  1F4M A;  3HKD B;  3HKC A;  4GKJ O;  3P30 A;  1RFY A;  4O4J B;  1DF5 A;  4HNA A;  3CX5 F;  2VS0 A;  3E86 A;  2HEP A;  1S77 D;  4X62 B;  2YIB A;  3TK1 A;  4PDM A;  4PEL A;  3OTO B;  4LF6 B;  4NXN B;  1NH2 B;  5LMU B;  2OTL V;  3ZJZ A;  1EFR G;  2ZIM A;  2P7T C;  4NKG B;  1R6T A;  3F7Y C;  3OW2 U;  2IJI A;  3T2M A;  1XNQ O;  1NZ6 A;  4LFC B;  1WP8 A;  1M57 B;  4DR5 O;  3EVK A;  2AZ2 A;  2AHY A;  2JDI G;  2YIA A;  3CB2 A;  4D7T A;  2W0F C;  3K57 A;  5JH7 A;  1I08 A;  3BCC H;  3CRQ A;  4LF8 B;  1KC8 W;  4CS4 A;  3JAL B;  3MAQ A;  4IYI A;  4TOI A;  3QNE A;  3CCM V;  2F93 B;  4QPK A;  4PJ0 Z;  3ZBH A;  4PHZ A;  3VQV A;  2M6Y A;  2R9R B;  3FYI B;  3GB7 C;  3H1J H;  1WP7 A;  5KHK A;  2Y69 C;  3RVY A;  2FTK A;  4JV5 B;  2OTJ V;  5EIB C;  4JYC A;  1JA8 A;  5BMV B;  2CTW A;  1GO3 F;  3RT3 C;  4DR3 B;  4FFB B;  4JI2 B;  2QWN B;  4YHH B;  5CBH A;  1TUB A;  4X1Y B;  2DE0 X;  3T1H O;  4X1Y A;  2Q7H A;  1NR1 A;  3PJS K;  2R9I A;  2D2C B;  4QE7 A;  3F7V C;  4DV6 B;  1S0V A;  4J7Z A;  3VBB A;  4E4E A;  3BY6 A;  2ZNI A;  4KL1 A;  4B3S O;  4JI6 O;  3M99 B;  1QBZ A;  1S5J A;  1XL4 A;  2RDC A;  3SPI A;  2YC0 A;  4EKW A;  5J2U A;  3AEI A;  3N2G A;  4N21 A;  3APQ A;  4BW5 A;  3D3Q A;  3GWO A;  3BHP A;  4MTF A;  5JWP A;  4MW8 A;  2KG7 A;  4X9Q A;  3ETD A;  2PTM A;  1XMO O;  4X1K A;  1IUR A;  4TQD A;  3K3W A;  1HWY A;  3SJA C;  4PV1 B;  1NU1 H;  4IHJ B;  1T5E A;  1VF5 B;  3I5D A;  2NN4 A;  3HKC B;  4PI0 A;  2Z3Y A;  4DR7 B;  4HNA B;  3O9O A;  3CRA A;  2DQ3 A;  3G71 V;  2B5U A;  1AVM A;  4J80 A;  1ZX3 A;  4J7J A;  1HNZ O;  3SYP A;  4ZKI A;  1FFX B;  4DV0 O;  1FFX A;  2EZP A;  4K0K B;  1WB7 A;  1BGY H;  5GON A;  2ZR3 A;  4R7C A;  5CMU A;  1IBM B;  4KP4 A;  5J9P C;  2C2A A;  2Y0P A;  1SKV A;  4LF6 O;  4QPJ A;  3RYC A;  4MVZ A;  1ROP A;  1TA8 A;  3MHH C;  4FK5 C;  5KAI Z;  1DF4 A;  4D6T H;  2QR4 A;  2ARH A;  5CA0 B;  3DSQ A;  4DR7 O;  2ODM A;  4JI8 O;  3JCZ A;  4LNU B;  2CTR A;  2B1G A;  1K73 W;  5HFM A;  2CK3 G;  4FJC C;  1BS3 A;  1H2K A;  2KG7 B;  3B09 A;  4JF3 A;  2ZQM A;  4GX2 A;  1NI8 A;  2QA4 V;  5EZY B;  1S72 V;  1VAR A;  2QTS A;  4NTX A;  4JYA O;  3ABM B;  4FPP A;  4CC5 A;  4CBC A;  1DK1 A;  5B1O A;  5IWA O;  3BA8 A;  4RQE A;  4I4T B;  1AJQ A;  1YEW A;  3K0D A;  1ZTE A;  2EIM B;  1JFF A;  1I5Y A;  1W2B U;  1KUQ A;  1K5Q A;  4X64 O;  4NB5 A;  3TXQ A;  1NVP D;  4DR4 B;  2P6J A;  4ZHQ A;  5CBG A;  3D36 A;  1HDJ A;  2EIN C;  3WG7 B;  4CH5 A;  2ZE6 A;  5ITZ A;  1VQ6 V;  2AHZ A;  3J80 N;  2HJF C;  3QG5 A;  2QKC A;  2CE4 A;  3L9D A;  3CCU V;  2VWK A;  3E22 A;  3M8A A;  3X2Q C;  3JAT B;  3E22 B;  1IBL B;  3ASO B;  1QU7 A;  4TV8 B;  1R6K A;  5CBF A;  4I50 B;  4RUF A;  1N32 B;  4JI2 O;  3K04 A;  2QEX V;  2YXH A;  4JPR A;  2H8P C; 
#chains in the Genus database with same CATH homology
 1NBM G;  5IYD O;  3CCV V;  1RPO A;  4QNH B;  1FFT B;  5BZB A;  1K5S A;  1H8E G;  1FXH A;  2EIM C;  1V55 C;  4FMT A;  3AG3 B;  1K3E A;  1R73 A;  3FKS G;  3ZRS A;  1VQ7 V;  1P4R A;  3ZMS A;  3ZRW B;  3W7X A;  3SYQ A;  2UXX A;  5L3B A;  4JGS A;  2EIJ B;  4WCE V;  2Z5U A;  2XAF A;  4LC1 A;  2HFE C;  3LSS A;  4G27 B;  4G2K A;  3OFN G;  3VOU A;  5EC1 C;  3STL C;  5L3D A;  2EIK B;  1UJW B;  2XAG A;  1GM7 A;  3OEH G;  3TET A;  4WFE A;  1VQ8 V;  3LNM B;  2JEU A;  1VQM V;  4QJF B;  2WLL B;  4GX5 A;  1RPR A;  2PI5 A;  1JCH A;  1K92 A;  1R3J C;  1NKD A;  3SPC A;  1QLN A;  1W0K G;  3ZN1 A;  4TSF G;  4UV8 A;  1Q7Y W;  1EBO A;  4Q20 A;  3CC2 V;  3AG1 B;  3LDC A;  3RW0 A;  3CCR V;  2W6J G;  1SET A;  1K33 A;  1OCC C;  1QVG U;  2WLM A;  2IH1 C;  3LDE A;  1K9M W;  1FXK A;  1VQ4 V;  3OR6 C;  3CC4 V;  4LBE C;  3CCS V;  1PNK A;  1YJW V;  5L3E A;  4H37 A;  2P67 A;  1VQL V;  4Z1M G;  1Q82 W;  3EFF K;  5E1A C;  2ZXW B;  2NNU A;  2QE7 G;  1AJP A;  1QLE C;  1YJN V;  2YEV B;  1OHH G;  1KKD A;  3B8N A;  3ABK B;  1OCR C;  4MVO A;  5H6Q A;  5IY5 B;  1AI5 A;  4PA4 A;  2W6I G;  1YSC A;  2JIZ G;  2EIL B;  1P7B A;  2EIN B;  2XOK G;  4DXW A;  3T1C A;  1SES A;  3CMA V;  3CCE V;  1FXV A;  2DYR B;  3X2Q B;  1R3L C;  2EIK C;  2ZR2 A;  3E8B A;  3OR7 C;  2JK5 C;  3JD2 A;  3SPG A;  3ZMU A;  5KA5 A;  3K0G A;  4MVS A;  2DWD C;  5EBW C;  2D3O W;  1THZ A;  2HG5 C;  4WFG A;  4PA7 A;  3FB5 C;  3ZIA G;  1J95 A;  2LP7 A;  2OCC C;  1JQ0 A;  3W7T A;  2ZD9 A;  3I55 V;  2XAJ A;  1OCZ C;  2KB1 A;  4P30 A;  1M56 C;  3ZRX A;  1KQS U;  1GK9 A;  5L3F A;  5C93 A;  2NLJ C;  4UXN A;  1YJ9 V;  1OCC B;  2Q69 A;  4PDL A;  4GCZ A;  4HAM A;  5LHG A;  3FB6 C;  4MVR A;  5IYB O;  2A79 B;  2JJ2 G;  3K03 A;  2WPD G;  2HVJ C;  5KA6 A;  3ETG A;  4J9Y B;  3I56 V;  2UXN A;  3SPH A;  1PL0 A;  1K4C C;  3FB8 C;  3IFX A;  1GM9 A;  5LGT A;  1K34 A;  3HB3 B;  3IGA C;  1YTF B;  4X88 A;  4BIZ A;  1QLE B;  2ITC C;  2X7R B;  3ABK C;  1K4D C;  4MS2 A;  2WAM A;  2HKO A;  4X8A A;  5KUK A;  3MHS C;  2WWW A;  3AG4 C;  3E8G A;  4GX1 A;  4MVM A;  3R65 A;  5GW7 A;  3E83 A;  2HLD G;  2DYS B;  4UV9 A;  4QE9 A;  1KD1 W;  1Q86 W;  1VQ9 V;  5DM6 V;  1CEZ A;  3TCU A;  3AG4 B;  3K79 A;  1Y66 A;  2EBO A;  3ZCC A;  3AG1 C;  1PNM A;  2EJR A;  1WLE A;  5L3G A;  1TUE B;  5B3S C;  2EZO A;  1SRY A;  4MTG A;  4KFM A;  1K7D A;  2QTO A;  2IJK A;  3B77 A;  1KEC A;  1AI7 A;  1Y4M A;  1H38 A;  2IU0 A;  4MVQ A;  1YTF D;  3CC7 V;  3KG2 A;  3OUS A;  3E2E A;  4FIP C;  3ETE A;  2Q67 A;  3JD4 A;  5IDJ A;  1YI2 V;  1R3K C;  1VQO V;  3ABM C;  1OCO B;  2A0L A;  1QR9 A;  4WF9 V;  3NXS A;  1LNQ A;  4N23 A;  3G6E V;  3ABT A;  1M9N A;  1NVP B;  4RAI A;  4WFH A;  2Y69 B;  1F4M A;  3P32 A;  3W7S A;  1M90 W;  3P30 A;  1S5H C;  1QCE A;  1F51 A;  3ABL B;  1S3J A;  1DF5 A;  3OM3 B;  5FL7 G;  1JVM A;  3G4S V;  3E86 A;  2DW4 A;  1DLB A;  1S77 D;  3TK1 A;  1XL6 A;  4KUM A;  2DYS C;  4PDM A;  4PEL A;  1S76 D;  3ABU A;  5EBM C;  1NH2 B;  2OCC B;  2OTL V;  3ZJZ A;  4PA9 A;  1EFR G;  2P7T C;  3HPL C;  1E1Q G;  2MK3 A;  3ASN C;  3ABL C;  1QVF U;  5LGU A;  4P2Z A;  5CN0 A;  1NR7 A;  3T4Z A;  2PI4 A;  3F7Y C;  3OW2 U;  2HVK C;  2IJI A;  2WLK A;  3RVZ A;  4WFB V;  3T2M A;  2WLI A;  2K1E A;  4YXW G;  1KP3 A;  1M57 B;  1NQT A;  3ZMV A;  2HR3 A;  3CCL V;  2AHY A;  5H6R A;  3E35 A;  1WPX A;  5KUM A;  1ORQ C;  1YHQ V;  1COW G;  2JDI G;  1OCZ B;  2X6A A;  4MSW C;  3W7U A;  2W0F C;  1EZJ A;  1ZWI C;  2IU3 A;  4UVC A;  3OMA B;  2LFS A;  3AG2 C;  3E8F A;  4RUE A;  1KC8 W;  2BOC C;  1JJ2 U;  3B8M A;  2V7Q G;  1I5X A;  3WG7 C;  1GMG A;  4UUJ C;  3QNE A;  3CCM V;  2Q6A A;  1NH2 D;  4QPK A;  5IYC O;  4G28 B;  4I5S A;  2YSU B;  5LGN A;  1RM1 C;  3IC7 A;  2R9R B;  3FYI B;  3GB7 C;  3QO8 A;  1MOF A;  5EC2 C;  2Y69 C;  3RVY A;  4R50 A;  2FTK A;  2OTJ V;  1G8M A;  4PDR A;  1YIJ V;  1Q81 W;  4JYC A;  1N8R W;  4XBF A;  4I9W A;  1GO3 F;  4U7N A;  1AJN A;  4OXS A;  5CBH A;  3BEH A;  3QO5 A;  3CCQ V;  2EIL C;  2XND G;  3LSQ A;  1NR1 A;  3PJS K;  4PA6 A;  3LUT B;  1AR1 B;  3SPJ A;  3CPW U;  1OCO C;  3CYO A;  3ZMT A;  3SYC A;  2DYR C;  2R9I A;  3F7V C;  4QE7 A;  2P90 A;  1S0V A;  4MTO A;  3VBB A;  3CP1 A;  1YIT V;  4DO2 A;  2X6C A;  2GSM B;  5B1B C;  4HYO A;  3BY6 A;  3K9A A;  4U7O A;  4JAS A;  1FXK B;  3M99 B;  1QBZ A;  1SZT A;  1XL4 A;  3SPI A;  2WLJ A;  5L3C A;  1VQN V;  1H2G A;  2BOB C;  1K97 A;  1OZ0 A;  4EKW A;  4H33 A;  4WFA V;  2ZXW C;  3AEI A;  1VQK V;  4N21 A;  5EK0 A;  4X89 A;  4BW5 A;  2M7W A;  4RO2 A;  3JD1 A;  1BHA A;  3GWO A;  3CCJ V;  4MTF A;  4R8C A;  3ZMZ A;  3A0R A;  2YEV A;  4MW8 A;  1MAB G;  5CA3 A;  3ETD A;  4J9Z B;  3K3W A;  5IY5 C;  3DGE A;  2DWE C;  1HWY A;  3STZ C;  1F4N A;  1M57 C;  4UVA A;  5EBL C;  5HFL A;  1G4Y B;  4F4L A;  1K8A W;  1MSW D;  2A9H A;  5DN6 G;  2ZDI A;  5B1N A;  2WLN A;  2Q68 A;  1JPX A;  1VQP V;  1CP9 A;  1GKF A;  4JAV A;  4JTD B;  3D3I A;  4GX0 A;  4LCU C;  2V1D A;  4XDJ A;  4P9O A;  3JYC A;  4TWK A;  2EIJ C;  3AG2 B;  1AI6 A;  5LBQ A;  2XAQ A;  3LDD A;  2ZDI C;  2XAH A;  1GTO A;  2Z3Y A;  4JAU A;  3ZRW A;  3F5W C;  4MTX A;  1M1K W;  2DQ3 A;  3CXC U;  1H8H G;  1R3I C;  3G71 V;  2B5U A;  3OE7 G;  2F43 G;  5B1A C;  1FXK C;  2IJH A;  1OCR B;  2X0L A;  3OGC C;  4TT3 G;  4RQF A;  1E1R G;  2WLL A;  4BAY A;  3SYP A;  4ZKI A;  3K06 A;  1GM8 A;  4P9P A;  1E79 G;  2EZP A;  3QO7 A;  1RM1 B;  2WLI B;  2XAS A;  3SYO A;  3K08 A;  5H9C A;  2ZR3 A;  4R7C A;  5CMU A;  1QR8 A;  2IW5 A;  1BL8 A;  4KP4 A;  5J9P C;  3W7W A;  4JYB A;  4GT1 A;  4QIW F;  2C2A A;  3OMI B;  4WFF A;  2WLH A;  4BIU A;  1B6Q A;  1PKX A;  2ATK C;  2QM7 A;  4PDV A;  4QPJ A;  4MVZ A;  1ROP A;  3MHH C;  4FK5 C;  3ZRV A;  1KP2 A;  1DF4 A;  4JTC B;  1BMF G;  1SER A;  2DQ0 A;  3E89 A;  3WFV A;  1W0J G;  5B1B B;  2WSS G;  2JJ1 G;  3JCZ A;  1PD3 A;  2B1G A;  1IXM A;  4MT8 A;  3RBZ A;  5HFM A;  5LHI A;  1K73 W;  2X6B A;  2CK3 G;  4FJC C;  1PNL A;  4XDK A;  1V54 B;  4JTA B;  1ARO P;  4JF3 A;  1JOY A;  2ZQM A;  4GX2 A;  5B1A B;  2QA4 V;  1S72 V;  3SYA A;  1BHB A;  3FYE B;  4R6Z A;  2H94 A;  2IJJ A;  3ABM B;  3SJQ C;  4CZZ A;  4XDL A;  4FPP A;  2OT5 A;  3OUF A;  4CBC A;  3CME V;  5B1O A;  4RQE A;  3MD0 A;  3AG3 C;  3JD0 A;  1AJQ A;  4PA3 A;  4MW3 A;  3OMN B;  1AI4 A;  1VQ5 V;  3K0D A;  2EIM B;  1ENV A;  1L1F A;  1I5Y A;  1W2B U;  1M56 B;  4HZ3 A;  1K5Q A;  3OAA G;  3ASO C;  1F23 A;  1NVP D;  2P6J A;  2JEX A;  3JD3 A;  1DTO A;  5CBG A;  3D36 A;  4UVB A;  3EHB B;  2EIN C;  2QKS A;  3WG7 B;  1VQ6 V;  2IH3 C;  2AHZ A;  4E2L A;  2HJF C;  3ML0 A;  3OEE G;  5B3S B;  3UKM A;  2Y48 A;  3CCU V;  4ASU G;  3H01 A;  3UM7 A;  1FS0 G;  2ITD C;  2QM8 A;  3X2Q C;  3DTU B;  1JX9 A;  4MVU A;  3ASO B;  1R6N A;  1NJI W;  2B1I A;  1R6K A;  3ASN B;  2GHY A;  5CBF A;  3T4D A;  3FB7 C;  3CD6 V;  4ZBM A;  3ZN0 A;  4RUF A;  1MG1 A;  1V55 B;  1CPY A;  3E8H A;  2LFR A;  3K04 A;  4L87 A;  2QEX V;  4JPR A;  4LP8 A;  5LHH A;  1V54 C;  2H8P C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...