2OTKE

Structure of alzheimer ab peptide in complex with an engineered binding protein
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
43
structure length
43
Chain Sequence
GEIVYLPNLNPDQLCAFIHSLHDDPSQSANLLAEAKKLNDAQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Stabilization of a beta-hairpin in monomeric Alzheimer's amyloid-beta peptide inhibits amyloid formation.
pubmed doi rcsb
source organism Engineered binding protein
molecule tags De novo protein, peptide binding protein
molecule keywords Amyloid beta A4 protein
total genus 16
structure length 43
sequence length 43
chains with identical sequence F
ec nomenclature
pdb deposition date 2007-02-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 2otkE00
2LXBA 1LP1B 1LP1A 4MN4C 1H0TB 4ASVA 1JMBA 1EDKA 2M5AB 3FXDA 1EDLA 4HKZH 3MZWB 1OVUA 4GOFA 5DJUB 1MFTA 3FXEA 1OVVA 2R44A 4K35A 1FC2C 1EDJA 2M0BA 4NPDA 2KIKA 4JBZA 3S1KA 1NVOA 4BXLA 2OTKE 5CBNA 2LXCB 2K3RA 4HB1A 2QRXA 2JWDA 5K5GB 5EFWB 1U7MA 1X0TA 2P58A 1BDDA 2ZAEB 1DEEG 4GODA 3RGUA 4GOEA 2WMMA 1H0TA 1JM0A 2KS1B 2M5AA 2LR2A 1SS1A 1EDIA 1Q2NA 1LT1A 2B89A 1ZXGA 4HJGH 4WWIA 1BDCA 1EC5A 4ZNCA 1S3JA 2KZIA 1U7JA 5CBOA 4EYYQ 3MHVA 4IOIH 2B87A 2Q1KA 2B88A 4NPEA 4NPFX 4K3AA 3QWOC 4ASWA 2QVAA 2KI7B 3PH0A 1Y47A 2B87B 5C39A 2I8DA 4CPGA 4KJMA 1OVRA 2KUBA 2KZJA 3ZDMA 1ZW0A 2HR3A 2SPZA 2UWJE 4ZMDA 2RKLA 5DJTB
chains in the Genus database with same CATH superfamily
1N73B 3CWBJ 2JDIH 1M7LA 2IBZI 3C8VA 3H1JG 1L0LE 4RO0A 3CX5I 3GHGA 4ZNCA 3HD7C 4HYTB 3TF5A 5AW5B 5KLVK 3LW5H 2AEJA 2OYOA 1NU1D 1S5LE 2JEEA 2M5AB 3AEEC 4C46A 2BCCJ 4WB4A 1Q7YQ 1KB9I 2ZYGA 5CJ0A 2RMZA 5KAIH 1JUNA 1YTZI 3O6QA 3A7OA 1JCDA 3B8EB 2OTJP 2YIUB 2ZXXA 1R5LA 3OW2O 2CPSA 1BGYD 3V4WA 4GOFA 3N4XA 5E79E 1M1JA 1URQD 2FYNB 5DJUB 3S9OA 1JY3N 1P84D 3RBXA 3HE4A 3AECC 1L0LJ 3GW6A 2WZ7A 2ZFCA 2ZT9D 4I6MC 1BCCD 1RF0C 1SQBD 4WBAA 5AVVB 1QVGO 1KC8Q 3CXHI 3IAOA 4JQ0D 3HD7D 4K35A 3L70J 3HUSC 4PD4D 3W68A 4C7NB 2JWAA 1AJYA 1EDJA 3CCLP 1Z56A 4N3YB 4OVNF 1NU1G 1EZVG 3BCCG 4NPDA 1YJNP 1GU4A 1NH4A 3CC4P 1FZCB 2KYVA 1VQKP 2ZXEB 2YIUC 4BRYA 1LTTC 2O01N 3B5ND 3JCUE 1SQBE 3PLNA 1SQVD 1GL2D 1SQPK 4I2LC 2ZVOB 1SFCB 2OTKE 2PRRA 5AVZB 3H1LJ 2LXCB 3GG2A 4OGQB 4GT1A 2W6AA 1P84I 4H44B 2HODA 2IZ1A 2K3RA 2XNXA 3G71P 3H32B 1M8OB 5KAIE 2JWDA 1HGZA 1BGYJ 2R5DA 1NJIQ 2WPVB 5EFWB 2LKMA 3H1HE 3VMZA 2PAJA 1YITP 1T2KC 1ZMEC 4L73A 2AEMA 3L71D 3CD6P 3GLMA 1Y9BA 2FFDA 1EZVD 3BCCD 2NPSB 4IFMA 4ASVA 1K04A 3W67A 4RJTA 1KQFB 1LNQA 3RL0D 5CCHD 3CLQA 1S4XA 1RE4A 4I1LA 2QA4P 4D6TE 2P7JA 3Q5PA 1K73Q 2RH0A 4U7JA 1NGMB 1SQVG 1VL2A 4JYCA 1T2KD 3L70G 3T97A 3I55P 2NPSC 3RGUA 2KNCA 1KILB 4GOEA 2IFMA 1AVYA 1JM0A 1JMMA 2KS1B 1BGYE 3IR9A 1FDOA 1OW6A 2BCCE 5APWA 5AW1B 2E75D 2YMYA 1WRGA 3PTZA 3M0DC 2HG5D 1CZQA 3HTKB 1KB9H 3CL3D 1Q2NA 2Z5IA 3FWLA 2H89C 2Q7CA 3V2QA 3SWFA 4H0LB 3G9RA 4HJGH 5TISE 1JNMA 2OYHA 1XTGB 1M1JB 3B5NC 2E5TA 4WWIA 1FBMA 3HTKA 5APYA 2Z4EA 1NTMG 3II6A 1NTZG 2H8PD 2BCCG 2W83C 2D2CD 2KZIA 2H43A 5AW4B 4LC1A 3V5BA 3L73J 1L4AA 2FYUG 2KNCB 3NXSA 3S4RA 2V7QH 2AEFA 1W5CE 2QJYB 2O3JA 4IOIH 5BVZA 5H2FH 1VPCA 1HJBA 3SWYA 1KYOE 2QM7A 1A02F 3SWKA 1TU3F 1D7MA 4PJ0H 3U1CA 3GHGB 1LT9C 2WQYC 3QWOC 1J1DC 1FDMA 3FGAD 2KI7B 2OQQA 1Y47A 1QX8A 3E1IA 1KB9E 5C39A 1KN7A 3BATA 1BE3G 2E76B 3AEFC 3F89A 3M9HA 1VQ5P 1URQC 1QVFO 1OVRA 2KUBA 2FBWC 2KZJA 1M1KQ 4EOTA 1R5SA 3O6QB 3JCUH 2N1TC 3L37A 2SPZA 5KAFH 1RE3A 1FJKA 2I1JA 2J5UA 2UWJE 1JY2P 2OYIA 1AA0A 4ZMDA 1VQPP 3A2AA 3VOPA 1NO4A 3TGUJ 4XA4A 1KQSO 1HJ0A 5AW8B 2LXBA 4PD4H 3OA7A 1YBKA 5KLIC 1ZOYC 3GF3A 1JEKA 1JCCA 3L71E 1L0NJ 4AUWA 2NRGA 1J1EC 2KOGA 5AVSB 1IFMA 2KS1A 1Q82Q 1EDLA 1GW3A 4LLHA 3L74J 1PL5A 5CJ4A 2P2UA 1RQUA 3EFFK 4IL6E 4N78D 3RK3C 4H13B 1KV4A 1N73C 1QL1A 1YQ3C 1S9KD 2M8RA 2PFXA 2N1TD 1NTMK 2YKPA 3AEGC 1NOHA 1VQ7P 1JB0J 1ZP0C 1BSNA 3RK2C 3WMM0 3WUTA 1FJPA 3FXEA 4DZOA 3ABVC 3AE3C 3VTPC 2R44A 3RK2B 3NFQA 2A06G 1NAYA 1SFCD 3A0BE 4PD4I 3MUDA 1S5LH 1FZCA 3L35A 5CCGD 1OXZA 4AYCA 3CX5E 2ZJSE 2WSEJ 2V7QJ 4H44D 3TDKA 2M0BA 1DIPA 1YTZT 3EQ2A 2R32A 3E1RA 2QJPB 1L2PA 2KIKA 2W6JH 2XDJA 4JBZA 3S1KA 3TGUD 1L0NE 3TSIA 4D6TJ 3SFDC 4H13C 3KDPB 4JYBA 5KKZC 3CCRP 1GU5A 2NZ2A 3U1AA 5KJ7A 1IK7A 1L0ND 3CI9A 3WUVA 2HLOA 2E42A 1YYCA 2HYNA 2GM4A 1AQ5A 1NTME 4BXLA 3CC7P 4HH2A 1N73A 1PPJE 1SQPE 1H88A 3D71A 1GW4A 2CK3H 3RL0B 1L0LG 2C9LY 1RF1C 1Q81Q 1NU1E 4OH8B 3HRNA 1VQMP 3BRTB 2KSJA 3MP7B 3VMYA 3L70D 3Q5SA 1YI2P 4C7NA 2E75C 3L74G 3VYIA 4GIFA 2QRXA 2A06D 5K5GB 1RF1A 2JP3A 5AVXB 1KTMA 5AW6B 1KYOH 2R3CA 2QE7H 5CMZA 3AE9C 1VQNP 2WSSH 1IC2A 3CCQP 3VMAA 3R2PA 3V4QA 3TGUG 5KJ7C 1RE3C 2N1TA 1CI6A 1LTBC 1N7SD 1BDDA 3V2NA 1J1DB 1W2BO 1VQOP 1USDA 1FU1A 1URQA 1AQTA 5B5EE 1DH3A 2WWWA 4GODA 2O1KA 2VRSA 4OWFA 1J2JB 4D6TD 1MFZA 2WMMA 3V2RA 2QJYC 1FZCC 1QEXA 3MUDC 3LIEA 1LT9A 2QIWA 3HE5A 4DOJA 4IFDK 1WMKA 2L91A 3RBZA 2ZVNB 1K9MQ 1G1JA 1EDIA 1NTKE 3Q2YA 4TT3H 1LT1A 2IFNA 4YPCA 4ZKUA 1SQXJ 1R8EA 2B89A 1KQLA 5KLVE 2GA1A 1JY2O 1NTMD 3K5BA 3I56P 1KILE 1PGJA 1NTZK 1BE3D 3CXHD 2WSEH 1PFIA 3M06A 1FOSF 1BCCE 1BGYG 1NYHA 4YXDC 2FYNC 4R4MA 1BE3E 2OYHC 2GUVA 5APXA 2A45H 2FY8A 3CX5H 3P8MC 3CCMP 1PP9J 2OYIB 5H2FE 2B87A 4EDFA 1MZ9A 2AXTE 3AE2C 3Q3DA 2B88A 1NTKD 1HUCA 4NPEA 1EXJA 4DCKA 2KLUA 2QEXP 3P8CE 3V2PA 5KLVD 3H1KE 2IBZE 1SLQA 1IO4A 3PH0A 4A7PA 1WT6A 1J1EB 2B87B 2QM8A 2ZT9C 2A45G 2HPCA 2WSCH 2OYIC 1HBWA 1RH5B 2ITAA 3BVHA 2FYUE 1P84H 3L4FA 1T8ZA 3KHUA 3ITKA 4GKGA 4QMAA 1RE4C 1GK4A 1H89A 4GDOA 3L73E 2HR3A 2Y0DA 3E7KA 4H13D 4XE5B 2OTLP 1G2CA 4JPZB 2O01H 1GL2B 2Q5UA 2KLVA 1S9KE 3G3ZA 1KD1Q 3L73D 2RKLA 3LW5J 5DJTB 3CMAP 1NHLA 2L5GB 4OGQD 1YQ4C 1AV1A 1NTMJ 2IBZD 1VQ4P 4M3LA 1PP9G 1LP1A 2HODB 1VF5C 4EIJA 1HVVA 1SQQJ 5GTHE 1KYOI 1SQXG 2CPBA 5M1BA 1IJDB 3AEDC 3PJSK 3H1IE 3RK2D 1L4AC 3MGNA 1E5WA 1LTIC 4IL6X 4DT0A 2KB7P 1HTLC 1ZN5A 1ZRTD 2A06E 2JKVA 1RHZB 1S5LX 2QJKB 3AEAC 4WVZA 4HKZH 2YXQB 3WU2E 1X79B 4W7ZA 1VQ8P 1OVUA 3B5NA 5E79H 5KLVJ 1PP9E 3QH9A 3L75J 2Y9YA 3RK3D 2MKVA 3TK1A 2Z5HA 2W90A 1U57A 3OJAB 1BSHA 1L4AD 2XV5A 3CXHE 3C9IA 1LTJB 1HH0A 1OW8A 3M0DA 3C1LA 1RY3A 3H1ID 1VF5D 3H1LE 2AXTH 2JJLA 3L72G 3HUSA 1FOSE 1VQ9P 4PV1D 4WY4D 2NPSA 2M3EA 1RF0A 3L74D 3IFMA 3CX5D 5B66H 1KFNA 2ZYAA 1M57D 1EQ7A 1OZHA 2Y0CA 4H0LD 1SQXK 1M56D 5TISH 1H8AA 2FFDC 3H1LG 1NVOA 4UB8E 4I7ZC 3KQGA 2MJZA 2FKWB 2XZRA 5CBNA 4YXWH 3H1KD 1LTSC 2YKOA 4RESB 2IYOA 1Q90D 3OAKA 1DD4A 1MUUA 3H1JD 5L8RJ 2O01J 4D6TG 3G4SP 3HD7A 3H1IG 4O9BA 3IN6A 2AXCA 5B5EH 2FXPA 3Q5RA 1NKNA 4U3FD 1X9VA 1IFNA 5AVUB 2FYZA 1FZGA 1PPJG 1SQPG 2FXMA 1GZLA 3AE7C 3AE8C 1OMIA 3H1IJ 2P58A 1YHQP 3A3YB 1UIIA 1LTAC 1FZFA 1IFJA 5APVA 2ZAEB 1DEEG 2WPRA 3A0BH 1YJ9P 4YTPC 3CWBG 1N2DC 3T97B 2O1JA 2FYUK 1IK9A 1MKMA 1SQQE 1H0TA 3JSVC 3HD7B 2HFED 5AW2B 5CCGA 3RL0g 1EZVE 3BCCE 3VN0A 2YNYA 4KHXA 2N9YB 3M91A 1LWUA 2QSIA 3WU2H 3CCJP 1M1JC 2K1AA 2C0XA 2KSEA 2WVRA 4U3FG 1SVFA 4DJGA 3A5TA 1SQVE 3FWNA 4BRYB 1RF1B 2WTYA 3H1JJ 3H1HJ 2W6BA 1BDCA 1CI6B 1VDFA 1S1CX 2FYUJ 2M3BA 2R5BA 4N6JA 5GTHH 3NTNA 3B5NB 5KJ7D 3CCSP 5CHXA 1G1IA 1JY3P 5CCHA 2YO3A 1U7JA 1Q86Q 4PD4E 4R4LA 1JTHB 4EYYQ 3USSA 2WSFJ 1NTKG 5KKZB 1DX7A 3CWBD 1JOCA 2Q1KA 2Y0EA 3KYQA 2KP8A 3L74E 3L73G 3GHGC 3HE5B 4L74A 2PP6A 5AVRB 3JC22 5KLVG 1YJWP 1NTZJ 1NU1J 1M90Q 4TLFA 2KK7A 2QVAA 5AW7B 5BU8B 2FFDB 3KZIH 2B9BA 2I8DA 2WPSA 1IFIA 4UB6H 1SQXD 4CPGA 4ZKPA 1GD2E 1GL2C 1HF9A 3L71G 4Z1MH 1UIXA 3NMDA 4LGDE 1L0NG 3ZDMA 1BE3J 5APSA 1N7SA 2WSFH 4IL6H 1PGPA 1FZBA 3L70E 2K9JB 1CSBA 2IBZG 1PGOA 1NKZB 1L0LD 3HE4B 3M9BA 3O8ZA 1PP9D 1BCCJ 2OARA 4H44C 3B71A 1SFCA 3L36A 4Y28J 1SP4A 1LTGC 1LP1B 4Y99B 1LTJC 1NTKJ 1PIXA 5APUA 3RK3B 4WY4A 2E75B 3AE6C 1JO5A 2YMKA 4MN4C 1EXIA 4B86A 1USEA 2J59M 1ZRTE 1EDKA 1JMBA 1QLED 5APTA 1DD3A 3A0HH 3FXDA 2Q3IA 3PP5A 3D6ZA 4OGQC 1NU1K 1X22A 3H1HG 4W7YA 1ZLLA 2E74B 3AE4C 3CXHH 3TYYA 5GTIE 1NTZE 2V4HA 1DEBA 3MIWA 1N86A 3VP9A 3MZWB 1GTWA 2ZYDA 1LGHB 1QL2A 1CW5A 1E79H 1OX3A 2YO2A 1NTZD 2BASA 1HWTC 1SQVJ 3P32A 1A02J 3LIDA 1NTKK 5AW9B 3R4YA 3H1LD 3UIAA 5B66E 3P8CD 1MFTA 2Q9IA 2QG4A 1GDTA 1Y8AA 1OVVA 5KLIB 3L72D 4C7RA 2C9NY 1K05A 1OFCX 1KQGB 2E5YA 3H1KG 1SQBG 1FC2C 1KFMA 1SQBK 1N7LA 2IZ0A 2W27A 3H32A 1SQQD 1EZVI 4IFFA 5AW0B 3Q1MA 1LT9B 1W2EA 2IPPA 1N8RQ 2H7HA 1X8YA 3L71J 2YXRB 2E76D 4I7ZB 3P7KA 3TNUA 3BCCJ 1PV3A 2E74C 1URQB 5APQA 3H25A 4U3FE 1LJ2A 3F5HA 5TJHA 2BEQD 1PPJD 1SQPD 3EFGA 1KILA 2G3AA 2WITA 2ZT9B 3U59A 2GUSA 3L75D 1BCCG 2XU6A 3GMAA 4L76A 1GK6A 3CC2P 1OWAA 4XFJA 3B4SA 4KT0J 3CMEP 3KZIE 4UB6E 3SFEC 1PZQA 4HB1A 1SQXE 2OGUA 3HUSB 2IYPA 3AEBC 3CPWO 1HGVA 3VP8A 1LTJA 1MV8A 3CWBE 2XNDH 2OYHB 1SQQG 1T3UA 1U7MA 3D70A 3H6PA 4EI2A 4W80A 3BASA 5AVQB 2D2CC 1K8AQ 3L72J 1KILC 2HPCB 1X0TA 2Q3EA 1JY3O 2Q6QA 2N1TB 1ZR4A 1N7SC 1L0NK 2H88C 3VMXA 2K37A 3FX0A 1JY2N 3V6IA 3I5CA 1L0LK 1AVOA 1OIPA 2QJKC 3G6EP 2Y9ZA 2QJPC 1GL2A 3SSUA 3L75G 4AQRD 2K9JA 2K9YA 3H1KJ 1T6AA 2POHA 5KAFE 1ZR2A 1VQ6P 1LWUB 1RQVA 2IDBA 2M5AA 3CCEP 2IX7C 1YIJP 2E43A 3RK3E 3D6YA 4BWNA 2YKQA 1P84E 1SQPJ 2JO1A 3TGUE 3MTUE 1KMIZ 1SS1A 2LR2A 2NPSD 1NWQA 3PHLA 4U3FJ 4L75A 2N9BA 2P10A 1FZAA 3BRVB 2G8YA 3PRJA 1G2CB 1NAFA 4PJ0E 1KORA 1ZXGA 1PGQA 1T3JA 2FXOA 3IF4A 3L75E 3M0AA 3RL0C 3WUUA 1EC5A 1FZEA 5CCHC 1S72P 1S3JA 3TNUB 1KILD 1ZV8A 3KXDA 4H0LC 5CBOA 2BCCD 4JF7A 1JTHA 1FE6A 2R3SA 1SQVK 1L4AB 1KYOD 1OW7A 1QGKB 3M9QA 1S2EA 1LWUC 1IFDA 2P1JA 3MHVA 1FDIA 3N7NA 5BU5A 2WT7B 1VQLP 4NPFX 4PV1C 2WPQA 1VF5B 2RN0A 4WY4C 1FS0E 2I1KA 5AVYB 5CCGC 1KB9D 4K3AA 2K88A 1SFCC 2P67A 3AE5C 4PV1B 4WY4B 1FAVA 5AVTB 3L72E 5AVWB 4ASWA 1IFPA 5KTBA 2XKMA 1KZUB 2JR8A 2W8ZA 2J58A 2WT7A 3GF7A 3H1JE 1SQQK 2D2CB 1SQBJ 2PGDA 3CCUP 3AE1C 4KJMA 2A45I 4Y99C 5AW3B 3H1HD 4UB8H 5GTIH 1GMJA 1N7SB 1ZW0A 2FYUD 3EWKA 4N78E 3CCVP 2E74D 3MD0A 1AFOA 2WSCJ 2BEZF 2E76C 1IZNB 2C0WA 3A0HE 2DW3A 1XTCC 2KXPB 3KPEA 1H0TB 4RKUJ
chains in the Genus database with same CATH topology
2LXBA 1LP1B 1LP1A 4MN4C 1H0TB 4ASVA 1JMBA 1EDKA 2M5AB 3FXDA 1EDLA 4HKZH 3MZWB 1OVUA 4GOFA 5DJUB 1MFTA 3FXEA 1OVVA 2R44A 4K35A 1FC2C 1EDJA 2M0BA 4NPDA 2KIKA 4JBZA 3S1KA 1NVOA 4BXLA 2OTKE 5CBNA 2LXCB 2K3RA 4HB1A 2QRXA 2JWDA 5K5GB 5EFWB 1U7MA 1X0TA 2P58A 1BDDA 2ZAEB 1DEEG 4GODA 3RGUA 4GOEA 2WMMA 1H0TA 1JM0A 2KS1B 2M5AA 2LR2A 1SS1A 1EDIA 1Q2NA 1LT1A 2B89A 1ZXGA 4HJGH 4WWIA 1BDCA 1EC5A 4ZNCA 1S3JA 2KZIA 1U7JA 5CBOA 4EYYQ 3MHVA 4IOIH 2B87A 2Q1KA 2B88A 4NPEA 4NPFX 4K3AA 3QWOC 4ASWA 2QVAA 2KI7B 3PH0A 1Y47A 2B87B 5C39A 2I8DA 4CPGA 4KJMA 1OVRA 2KUBA 2KZJA 3ZDMA 1ZW0A 2HR3A 2SPZA 2UWJE 4ZMDA 2RKLA 5DJTB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LXB A;  1LP1 B;  1LP1 A;  4MN4 C;  1H0T B;  4ASV A;  1JMB A;  1EDK A;  2M5A B;  3FXD A;  1EDL A;  4HKZ H;  3MZW B;  1OVU A;  4GOF A;  5DJU B;  1MFT A;  3FXE A;  1OVV A;  2R44 A;  4K35 A;  1FC2 C;  1EDJ A;  2M0B A;  4NPD A;  2KIK A;  4JBZ A;  3S1K A;  1NVO A;  4BXL A;  2OTK E;  5CBN A;  2LXC B;  2K3R A;  4HB1 A;  2QRX A;  2JWD A;  5K5G B;  5EFW B;  1U7M A;  1X0T A;  2P58 A;  1BDD A;  2ZAE B;  1DEE G;  4GOD A;  3RGU A;  4GOE A;  2WMM A;  1H0T A;  1JM0 A;  2KS1 B;  2M5A A;  2LR2 A;  1SS1 A;  1EDI A;  1Q2N A;  1LT1 A;  2B89 A;  1ZXG A;  4HJG H;  4WWI A;  1BDC A;  1EC5 A;  4ZNC A;  1S3J A;  2KZI A;  1U7J A;  5CBO A;  4EYY Q;  3MHV A;  4IOI H;  2B87 A;  2Q1K A;  2B88 A;  4NPE A;  4NPF X;  4K3A A;  3QWO C;  4ASW A;  2QVA A;  2KI7 B;  3PH0 A;  1Y47 A;  2B87 B;  5C39 A;  2I8D A;  4CPG A;  4KJM A;  1OVR A;  2KUB A;  2KZJ A;  3ZDM A;  1ZW0 A;  2HR3 A;  2SPZ A;  2UWJ E;  4ZMD A;  2RKL A;  5DJT B; 
#chains in the Genus database with same CATH topology
 1N73 B;  3CWB J;  2JDI H;  1M7L A;  2IBZ I;  3C8V A;  3H1J G;  1L0L E;  4RO0 A;  3CX5 I;  3GHG A;  4ZNC A;  3HD7 C;  4HYT B;  3TF5 A;  5AW5 B;  5KLV K;  3LW5 H;  2AEJ A;  2OYO A;  1NU1 D;  1S5L E;  2JEE A;  2M5A B;  3AEE C;  4C46 A;  2BCC J;  4WB4 A;  1Q7Y Q;  1KB9 I;  2ZYG A;  5CJ0 A;  2RMZ A;  5KAI H;  1JUN A;  1YTZ I;  3O6Q A;  3A7O A;  1JCD A;  3B8E B;  2OTJ P;  2YIU B;  2ZXX A;  1R5L A;  3OW2 O;  2CPS A;  1BGY D;  3V4W A;  4GOF A;  3N4X A;  5E79 E;  1M1J A;  1URQ D;  2FYN B;  5DJU B;  3S9O A;  1JY3 N;  1P84 D;  3RBX A;  3HE4 A;  3AEC C;  1L0L J;  3GW6 A;  2WZ7 A;  2ZFC A;  2ZT9 D;  4I6M C;  1BCC D;  1RF0 C;  1SQB D;  4WBA A;  5AVV B;  1QVG O;  1KC8 Q;  3CXH I;  3IAO A;  4JQ0 D;  3HD7 D;  4K35 A;  3L70 J;  3HUS C;  4PD4 D;  3W68 A;  4C7N B;  2JWA A;  1AJY A;  1EDJ A;  3CCL P;  1Z56 A;  4N3Y B;  4OVN F;  1NU1 G;  1EZV G;  3BCC G;  4NPD A;  1YJN P;  1GU4 A;  1NH4 A;  3CC4 P;  1FZC B;  2KYV A;  1VQK P;  2ZXE B;  2YIU C;  4BRY A;  1LTT C;  2O01 N;  3B5N D;  3JCU E;  1SQB E;  3PLN A;  1SQV D;  1GL2 D;  1SQP K;  4I2L C;  2ZVO B;  1SFC B;  2OTK E;  2PRR A;  5AVZ B;  3H1L J;  2LXC B;  3GG2 A;  4OGQ B;  4GT1 A;  2W6A A;  1P84 I;  4H44 B;  2HOD A;  2IZ1 A;  2K3R A;  2XNX A;  3G71 P;  3H32 B;  1M8O B;  5KAI E;  2JWD A;  1HGZ A;  1BGY J;  2R5D A;  1NJI Q;  2WPV B;  5EFW B;  2LKM A;  3H1H E;  3VMZ A;  2PAJ A;  1YIT P;  1T2K C;  1ZME C;  4L73 A;  2AEM A;  3L71 D;  3CD6 P;  3GLM A;  1Y9B A;  2FFD A;  1EZV D;  3BCC D;  2NPS B;  4IFM A;  4ASV A;  1K04 A;  3W67 A;  4RJT A;  1KQF B;  1LNQ A;  3RL0 D;  5CCH D;  3CLQ A;  1S4X A;  1RE4 A;  4I1L A;  2QA4 P;  4D6T E;  2P7J A;  3Q5P A;  1K73 Q;  2RH0 A;  4U7J A;  1NGM B;  1SQV G;  1VL2 A;  4JYC A;  1T2K D;  3L70 G;  3T97 A;  3I55 P;  2NPS C;  3RGU A;  2KNC A;  1KIL B;  4GOE A;  2IFM A;  1AVY A;  1JM0 A;  1JMM A;  2KS1 B;  1BGY E;  3IR9 A;  1FDO A;  1OW6 A;  2BCC E;  5APW A;  5AW1 B;  2E75 D;  2YMY A;  1WRG A;  3PTZ A;  3M0D C;  2HG5 D;  1CZQ A;  3HTK B;  1KB9 H;  3CL3 D;  1Q2N A;  2Z5I A;  3FWL A;  2H89 C;  2Q7C A;  3V2Q A;  3SWF A;  4H0L B;  3G9R A;  4HJG H;  5TIS E;  1JNM A;  2OYH A;  1XTG B;  1M1J B;  3B5N C;  2E5T A;  4WWI A;  1FBM A;  3HTK A;  5APY A;  2Z4E A;  1NTM G;  3II6 A;  1NTZ G;  2H8P D;  2BCC G;  2W83 C;  2D2C D;  2KZI A;  2H43 A;  5AW4 B;  4LC1 A;  3V5B A;  3L73 J;  1L4A A;  2FYU G;  2KNC B;  3NXS A;  3S4R A;  2V7Q H;  2AEF A;  1W5C E;  2QJY B;  2O3J A;  4IOI H;  5BVZ A;  5H2F H;  1VPC A;  1HJB A;  3SWY A;  1KYO E;  2QM7 A;  1A02 F;  3SWK A;  1TU3 F;  1D7M A;  4PJ0 H;  3U1C A;  3GHG B;  1LT9 C;  2WQY C;  3QWO C;  1J1D C;  1FDM A;  3FGA D;  2KI7 B;  2OQQ A;  1Y47 A;  1QX8 A;  3E1I A;  1KB9 E;  5C39 A;  1KN7 A;  3BAT A;  1BE3 G;  2E76 B;  3AEF C;  3F89 A;  3M9H A;  1VQ5 P;  1URQ C;  1QVF O;  1OVR A;  2KUB A;  2FBW C;  2KZJ A;  1M1K Q;  4EOT A;  1R5S A;  3O6Q B;  3JCU H;  2N1T C;  3L37 A;  2SPZ A;  5KAF H;  1RE3 A;  1FJK A;  2I1J A;  2J5U A;  2UWJ E;  1JY2 P;  2OYI A;  1AA0 A;  4ZMD A;  1VQP P;  3A2A A;  3VOP A;  1NO4 A;  3TGU J;  4XA4 A;  1KQS O;  1HJ0 A;  5AW8 B;  2LXB A;  4PD4 H;  3OA7 A;  1YBK A;  5KLI C;  1ZOY C;  3GF3 A;  1JEK A;  1JCC A;  3L71 E;  1L0N J;  4AUW A;  2NRG A;  1J1E C;  2KOG A;  5AVS B;  1IFM A;  2KS1 A;  1Q82 Q;  1EDL A;  1GW3 A;  4LLH A;  3L74 J;  1PL5 A;  5CJ4 A;  2P2U A;  1RQU A;  3EFF K;  4IL6 E;  4N78 D;  3RK3 C;  4H13 B;  1KV4 A;  1N73 C;  1QL1 A;  1YQ3 C;  1S9K D;  2M8R A;  2PFX A;  2N1T D;  1NTM K;  2YKP A;  3AEG C;  1NOH A;  1VQ7 P;  1JB0 J;  1ZP0 C;  1BSN A;  3RK2 C;  3WMM 0;  3WUT A;  1FJP A;  3FXE A;  4DZO A;  3ABV C;  3AE3 C;  3VTP C;  2R44 A;  3RK2 B;  3NFQ A;  2A06 G;  1NAY A;  1SFC D;  3A0B E;  4PD4 I;  3MUD A;  1S5L H;  1FZC A;  3L35 A;  5CCG D;  1OXZ A;  4AYC A;  3CX5 E;  2ZJS E;  2WSE J;  2V7Q J;  4H44 D;  3TDK A;  2M0B A;  1DIP A;  1YTZ T;  3EQ2 A;  2R32 A;  3E1R A;  2QJP B;  1L2P A;  2KIK A;  2W6J H;  2XDJ A;  4JBZ A;  3S1K A;  3TGU D;  1L0N E;  3TSI A;  4D6T J;  3SFD C;  4H13 C;  3KDP B;  4JYB A;  5KKZ C;  3CCR P;  1GU5 A;  2NZ2 A;  3U1A A;  5KJ7 A;  1IK7 A;  1L0N D;  3CI9 A;  3WUV A;  2HLO A;  2E42 A;  1YYC A;  2HYN A;  2GM4 A;  1AQ5 A;  1NTM E;  4BXL A;  3CC7 P;  4HH2 A;  1N73 A;  1PPJ E;  1SQP E;  1H88 A;  3D71 A;  1GW4 A;  2CK3 H;  3RL0 B;  1L0L G;  2C9L Y;  1RF1 C;  1Q81 Q;  1NU1 E;  4OH8 B;  3HRN A;  1VQM P;  3BRT B;  2KSJ A;  3MP7 B;  3VMY A;  3L70 D;  3Q5S A;  1YI2 P;  4C7N A;  2E75 C;  3L74 G;  3VYI A;  4GIF A;  2QRX A;  2A06 D;  5K5G B;  1RF1 A;  2JP3 A;  5AVX B;  1KTM A;  5AW6 B;  1KYO H;  2R3C A;  2QE7 H;  5CMZ A;  3AE9 C;  1VQN P;  2WSS H;  1IC2 A;  3CCQ P;  3VMA A;  3R2P A;  3V4Q A;  3TGU G;  5KJ7 C;  1RE3 C;  2N1T A;  1CI6 A;  1LTB C;  1N7S D;  1BDD A;  3V2N A;  1J1D B;  1W2B O;  1VQO P;  1USD A;  1FU1 A;  1URQ A;  1AQT A;  5B5E E;  1DH3 A;  2WWW A;  4GOD A;  2O1K A;  2VRS A;  4OWF A;  1J2J B;  4D6T D;  1MFZ A;  2WMM A;  3V2R A;  2QJY C;  1FZC C;  1QEX A;  3MUD C;  3LIE A;  1LT9 A;  2QIW A;  3HE5 A;  4DOJ A;  4IFD K;  1WMK A;  2L91 A;  3RBZ A;  2ZVN B;  1K9M Q;  1G1J A;  1EDI A;  1NTK E;  3Q2Y A;  4TT3 H;  1LT1 A;  2IFN A;  4YPC A;  4ZKU A;  1SQX J;  1R8E A;  2B89 A;  1KQL A;  5KLV E;  2GA1 A;  1JY2 O;  1NTM D;  3K5B A;  3I56 P;  1KIL E;  1PGJ A;  1NTZ K;  1BE3 D;  3CXH D;  2WSE H;  1PFI A;  3M06 A;  1FOS F;  1BCC E;  1BGY G;  1NYH A;  4YXD C;  2FYN C;  4R4M A;  1BE3 E;  2OYH C;  2GUV A;  5APX A;  2A45 H;  2FY8 A;  3CX5 H;  3P8M C;  3CCM P;  1PP9 J;  2OYI B;  5H2F E;  2B87 A;  4EDF A;  1MZ9 A;  2AXT E;  3AE2 C;  3Q3D A;  2B88 A;  1NTK D;  1HUC A;  4NPE A;  1EXJ A;  4DCK A;  2KLU A;  2QEX P;  3P8C E;  3V2P A;  5KLV D;  3H1K E;  2IBZ E;  1SLQ A;  1IO4 A;  3PH0 A;  4A7P A;  1WT6 A;  1J1E B;  2B87 B;  2QM8 A;  2ZT9 C;  2A45 G;  2HPC A;  2WSC H;  2OYI C;  1HBW A;  1RH5 B;  2ITA A;  3BVH A;  2FYU E;  1P84 H;  3L4F A;  1T8Z A;  3KHU A;  3ITK A;  4GKG A;  4QMA A;  1RE4 C;  1GK4 A;  1H89 A;  4GDO A;  3L73 E;  2HR3 A;  2Y0D A;  3E7K A;  4H13 D;  4XE5 B;  2OTL P;  1G2C A;  4JPZ B;  2O01 H;  1GL2 B;  2Q5U A;  2KLV A;  1S9K E;  3G3Z A;  1KD1 Q;  3L73 D;  2RKL A;  3LW5 J;  5DJT B;  3CMA P;  1NHL A;  2L5G B;  4OGQ D;  1YQ4 C;  1AV1 A;  1NTM J;  2IBZ D;  1VQ4 P;  4M3L A;  1PP9 G;  1LP1 A;  2HOD B;  1VF5 C;  4EIJ A;  1HVV A;  1SQQ J;  5GTH E;  1KYO I;  1SQX G;  2CPB A;  5M1B A;  1IJD B;  3AED C;  3PJS K;  3H1I E;  3RK2 D;  1L4A C;  3MGN A;  1E5W A;  1LTI C;  4IL6 X;  4DT0 A;  2KB7 P;  1HTL C;  1ZN5 A;  1ZRT D;  2A06 E;  2JKV A;  1RHZ B;  1S5L X;  2QJK B;  3AEA C;  4WVZ A;  4HKZ H;  2YXQ B;  3WU2 E;  1X79 B;  4W7Z A;  1VQ8 P;  1OVU A;  3B5N A;  5E79 H;  5KLV J;  1PP9 E;  3QH9 A;  3L75 J;  2Y9Y A;  3RK3 D;  2MKV A;  3TK1 A;  2Z5H A;  2W90 A;  1U57 A;  3OJA B;  1BSH A;  1L4A D;  2XV5 A;  3CXH E;  3C9I A;  1LTJ B;  1HH0 A;  1OW8 A;  3M0D A;  3C1L A;  1RY3 A;  3H1I D;  1VF5 D;  3H1L E;  2AXT H;  2JJL A;  3L72 G;  3HUS A;  1FOS E;  1VQ9 P;  4PV1 D;  4WY4 D;  2NPS A;  2M3E A;  1RF0 A;  3L74 D;  3IFM A;  3CX5 D;  5B66 H;  1KFN A;  2ZYA A;  1M57 D;  1EQ7 A;  1OZH A;  2Y0C A;  4H0L D;  1SQX K;  1M56 D;  5TIS H;  1H8A A;  2FFD C;  3H1L G;  1NVO A;  4UB8 E;  4I7Z C;  3KQG A;  2MJZ A;  2FKW B;  2XZR A;  5CBN A;  4YXW H;  3H1K D;  1LTS C;  2YKO A;  4RES B;  2IYO A;  1Q90 D;  3OAK A;  1DD4 A;  1MUU A;  3H1J D;  5L8R J;  2O01 J;  4D6T G;  3G4S P;  3HD7 A;  3H1I G;  4O9B A;  3IN6 A;  2AXC A;  5B5E H;  2FXP A;  3Q5R A;  1NKN A;  4U3F D;  1X9V A;  1IFN A;  5AVU B;  2FYZ A;  1FZG A;  1PPJ G;  1SQP G;  2FXM A;  1GZL A;  3AE7 C;  3AE8 C;  1OMI A;  3H1I J;  2P58 A;  1YHQ P;  3A3Y B;  1UII A;  1LTA C;  1FZF A;  1IFJ A;  5APV A;  2ZAE B;  1DEE G;  2WPR A;  3A0B H;  1YJ9 P;  4YTP C;  3CWB G;  1N2D C;  3T97 B;  2O1J A;  2FYU K;  1IK9 A;  1MKM A;  1SQQ E;  1H0T A;  3JSV C;  3HD7 B;  2HFE D;  5AW2 B;  5CCG A;  3RL0 g;  1EZV E;  3BCC E;  3VN0 A;  2YNY A;  4KHX A;  2N9Y B;  3M91 A;  1LWU A;  2QSI A;  3WU2 H;  3CCJ P;  1M1J C;  2K1A A;  2C0X A;  2KSE A;  2WVR A;  4U3F G;  1SVF A;  4DJG A;  3A5T A;  1SQV E;  3FWN A;  4BRY B;  1RF1 B;  2WTY A;  3H1J J;  3H1H J;  2W6B A;  1BDC A;  1CI6 B;  1VDF A;  1S1C X;  2FYU J;  2M3B A;  2R5B A;  4N6J A;  5GTH H;  3NTN A;  3B5N B;  5KJ7 D;  3CCS P;  5CHX A;  1G1I A;  1JY3 P;  5CCH A;  2YO3 A;  1U7J A;  1Q86 Q;  4PD4 E;  4R4L A;  1JTH B;  4EYY Q;  3USS A;  2WSF J;  1NTK G;  5KKZ B;  1DX7 A;  3CWB D;  1JOC A;  2Q1K A;  2Y0E A;  3KYQ A;  2KP8 A;  3L74 E;  3L73 G;  3GHG C;  3HE5 B;  4L74 A;  2PP6 A;  5AVR B;  3JC2 2;  5KLV G;  1YJW P;  1NTZ J;  1NU1 J;  1M90 Q;  4TLF A;  2KK7 A;  2QVA A;  5AW7 B;  5BU8 B;  2FFD B;  3KZI H;  2B9B A;  2I8D A;  2WPS A;  1IFI A;  4UB6 H;  1SQX D;  4CPG A;  4ZKP A;  1GD2 E;  1GL2 C;  1HF9 A;  3L71 G;  4Z1M H;  1UIX A;  3NMD A;  4LGD E;  1L0N G;  3ZDM A;  1BE3 J;  5APS A;  1N7S A;  2WSF H;  4IL6 H;  1PGP A;  1FZB A;  3L70 E;  2K9J B;  1CSB A;  2IBZ G;  1PGO A;  1NKZ B;  1L0L D;  3HE4 B;  3M9B A;  3O8Z A;  1PP9 D;  1BCC J;  2OAR A;  4H44 C;  3B71 A;  1SFC A;  3L36 A;  4Y28 J;  1SP4 A;  1LTG C;  1LP1 B;  4Y99 B;  1LTJ C;  1NTK J;  1PIX A;  5APU A;  3RK3 B;  4WY4 A;  2E75 B;  3AE6 C;  1JO5 A;  2YMK A;  4MN4 C;  1EXI A;  4B86 A;  1USE A;  2J59 M;  1ZRT E;  1EDK A;  1JMB A;  1QLE D;  5APT A;  1DD3 A;  3A0H H;  3FXD A;  2Q3I A;  3PP5 A;  3D6Z A;  4OGQ C;  1NU1 K;  1X22 A;  3H1H G;  4W7Y A;  1ZLL A;  2E74 B;  3AE4 C;  3CXH H;  3TYY A;  5GTI E;  1NTZ E;  2V4H A;  1DEB A;  3MIW A;  1N86 A;  3VP9 A;  3MZW B;  1GTW A;  2ZYD A;  1LGH B;  1QL2 A;  1CW5 A;  1E79 H;  1OX3 A;  2YO2 A;  1NTZ D;  2BAS A;  1HWT C;  1SQV J;  3P32 A;  1A02 J;  3LID A;  1NTK K;  5AW9 B;  3R4Y A;  3H1L D;  3UIA A;  5B66 E;  3P8C D;  1MFT A;  2Q9I A;  2QG4 A;  1GDT A;  1Y8A A;  1OVV A;  5KLI B;  3L72 D;  4C7R A;  2C9N Y;  1K05 A;  1OFC X;  1KQG B;  2E5Y A;  3H1K G;  1SQB G;  1FC2 C;  1KFM A;  1SQB K;  1N7L A;  2IZ0 A;  2W27 A;  3H32 A;  1SQQ D;  1EZV I;  4IFF A;  5AW0 B;  3Q1M A;  1LT9 B;  1W2E A;  2IPP A;  1N8R Q;  2H7H A;  1X8Y A;  3L71 J;  2YXR B;  2E76 D;  4I7Z B;  3P7K A;  3TNU A;  3BCC J;  1PV3 A;  2E74 C;  1URQ B;  5APQ A;  3H25 A;  4U3F E;  1LJ2 A;  3F5H A;  5TJH A;  2BEQ D;  1PPJ D;  1SQP D;  3EFG A;  1KIL A;  2G3A A;  2WIT A;  2ZT9 B;  3U59 A;  2GUS A;  3L75 D;  1BCC G;  2XU6 A;  3GMA A;  4L76 A;  1GK6 A;  3CC2 P;  1OWA A;  4XFJ A;  3B4S A;  4KT0 J;  3CME P;  3KZI E;  4UB6 E;  3SFE C;  1PZQ A;  4HB1 A;  1SQX E;  2OGU A;  3HUS B;  2IYP A;  3AEB C;  3CPW O;  1HGV A;  3VP8 A;  1LTJ A;  1MV8 A;  3CWB E;  2XND H;  2OYH B;  1SQQ G;  1T3U A;  1U7M A;  3D70 A;  3H6P A;  4EI2 A;  4W80 A;  3BAS A;  5AVQ B;  2D2C C;  1K8A Q;  3L72 J;  1KIL C;  2HPC B;  1X0T A;  2Q3E A;  1JY3 O;  2Q6Q A;  2N1T B;  1ZR4 A;  1N7S C;  1L0N K;  2H88 C;  3VMX A;  2K37 A;  3FX0 A;  1JY2 N;  3V6I A;  3I5C A;  1L0L K;  1AVO A;  1OIP A;  2QJK C;  3G6E P;  2Y9Z A;  2QJP C;  1GL2 A;  3SSU A;  3L75 G;  4AQR D;  2K9J A;  2K9Y A;  3H1K J;  1T6A A;  2POH A;  5KAF E;  1ZR2 A;  1VQ6 P;  1LWU B;  1RQV A;  2IDB A;  2M5A A;  3CCE P;  2IX7 C;  1YIJ P;  2E43 A;  3RK3 E;  3D6Y A;  4BWN A;  2YKQ A;  1P84 E;  1SQP J;  2JO1 A;  3TGU E;  3MTU E;  1KMI Z;  1SS1 A;  2LR2 A;  2NPS D;  1NWQ A;  3PHL A;  4U3F J;  4L75 A;  2N9B A;  2P10 A;  1FZA A;  3BRV B;  2G8Y A;  3PRJ A;  1G2C B;  1NAF A;  4PJ0 E;  1KOR A;  1ZXG A;  1PGQ A;  1T3J A;  2FXO A;  3IF4 A;  3L75 E;  3M0A A;  3RL0 C;  3WUU A;  1EC5 A;  1FZE A;  5CCH C;  1S72 P;  1S3J A;  3TNU B;  1KIL D;  1ZV8 A;  3KXD A;  4H0L C;  5CBO A;  2BCC D;  4JF7 A;  1JTH A;  1FE6 A;  2R3S A;  1SQV K;  1L4A B;  1KYO D;  1OW7 A;  1QGK B;  3M9Q A;  1S2E A;  1LWU C;  1IFD A;  2P1J A;  3MHV A;  1FDI A;  3N7N A;  5BU5 A;  2WT7 B;  1VQL P;  4NPF X;  4PV1 C;  2WPQ A;  1VF5 B;  2RN0 A;  4WY4 C;  1FS0 E;  2I1K A;  5AVY B;  5CCG C;  1KB9 D;  4K3A A;  2K88 A;  1SFC C;  2P67 A;  3AE5 C;  4PV1 B;  4WY4 B;  1FAV A;  5AVT B;  3L72 E;  5AVW B;  4ASW A;  1IFP A;  5KTB A;  2XKM A;  1KZU B;  2JR8 A;  2W8Z A;  2J58 A;  2WT7 A;  3GF7 A;  3H1J E;  1SQQ K;  2D2C B;  1SQB J;  2PGD A;  3CCU P;  3AE1 C;  4KJM A;  2A45 I;  4Y99 C;  5AW3 B;  3H1H D;  4UB8 H;  5GTI H;  1GMJ A;  1N7S B;  1ZW0 A;  2FYU D;  3EWK A;  4N78 E;  3CCV P;  2E74 D;  3MD0 A;  1AFO A;  2WSC J;  2BEZ F;  2E76 C;  1IZN B;  2C0W A;  3A0H E;  2DW3 A;  1XTC C;  2KXP B;  3KPE A;  1H0T B;  4RKU J; 
#chains in the Genus database with same CATH homology
 2LXB A;  1LP1 B;  1LP1 A;  4MN4 C;  1H0T B;  4ASV A;  1JMB A;  1EDK A;  2M5A B;  3FXD A;  1EDL A;  4HKZ H;  3MZW B;  1OVU A;  4GOF A;  5DJU B;  1MFT A;  3FXE A;  1OVV A;  2R44 A;  4K35 A;  1FC2 C;  1EDJ A;  2M0B A;  4NPD A;  2KIK A;  4JBZ A;  3S1K A;  1NVO A;  4BXL A;  2OTK E;  5CBN A;  2LXC B;  2K3R A;  4HB1 A;  2QRX A;  2JWD A;  5K5G B;  5EFW B;  1U7M A;  1X0T A;  2P58 A;  1BDD A;  2ZAE B;  1DEE G;  4GOD A;  3RGU A;  4GOE A;  2WMM A;  1H0T A;  1JM0 A;  2KS1 B;  2M5A A;  2LR2 A;  1SS1 A;  1EDI A;  1Q2N A;  1LT1 A;  2B89 A;  1ZXG A;  4HJG H;  4WWI A;  1BDC A;  1EC5 A;  4ZNC A;  1S3J A;  2KZI A;  1U7J A;  5CBO A;  4EYY Q;  3MHV A;  4IOI H;  2B87 A;  2Q1K A;  2B88 A;  4NPE A;  4NPF X;  4K3A A;  3QWO C;  4ASW A;  2QVA A;  2KI7 B;  3PH0 A;  1Y47 A;  2B87 B;  5C39 A;  2I8D A;  4CPG A;  4KJM A;  1OVR A;  2KUB A;  2KZJ A;  3ZDM A;  1ZW0 A;  2HR3 A;  2SPZ A;  2UWJ E;  4ZMD A;  2RKL A;  5DJT B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...