2OTKE

Structure of alzheimer ab peptide in complex with an engineered binding protein
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
43
structure length
43
Chain Sequence
GEIVYLPNLNPDQLCAFIHSLHDDPSQSANLLAEAKKLNDAQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Amyloid beta A4 protein
publication title Stabilization of a beta-hairpin in monomeric Alzheimer's amyloid-beta peptide inhibits amyloid formation.
pubmed doi rcsb
source organism Engineered binding protein
molecule tags De novo protein, peptide binding protein
total genus 16
structure length 43
sequence length 43
chains with identical sequence F
ec nomenclature
pdb deposition date 2007-02-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 2otkE00
1H0TB 1OVUA 1EDLA 1ZW0A 4IOIH 1SS1A 4ASVA 4ZMDA 3FXDA 1JMBA 4NPEA 2LR2A 2SPZA 1BDDA 3MZWB 2B89A 4JBZA 1EC5A 5DJUB 3FXEA 2B88A 1EDKA 4WWIA 2B87A 4ZNCA 2KUBA 5C39A 2KS1B 4CPGA 2M5AA 1JM0A 4HB1A 2ZAEB 4HKZH 2UWJE 2KZIA 4ASWA 4EYYQ 2LXBA 1LP1A 1FC2C 5CBOA 1Y47A 2RKLA 4GOFA 3RGUA 4K3AA 2LXCB 2K3RA 4GOEA 2B87B 1U7MA 1OVRA 2WMMA 2M5AB 2QRXA 1MFTA 1DEEG 4HJGH 1LT1A 5EFWB 4NPFX 4NPDA 3QWOC 2R44A 2I8DA 1BDCA 2HR3A 1LP1B 4BXLA 1EDIA 1OVVA 3PH0A 3S1KA 2P58A 2KZJA 1U7JA 1ZXGA 2KIKA 4KJMA 1S3JA 2M0BA 2JWDA 2KI7B 1Q2NA 1X0TA 5K5GB 3ZDMA 4MN4C 3MHVA 2Q1KA 2OTKE 1EDJA 4K35A 1H0TA 5CBNA 1NVOA 2QVAA 4GODA 5DJTB
chains in the Genus database with same CATH superfamily
1ZW0A 2XNXA 1SS1A 1FE6A 1SQBD 1JY2N 1KQGB 3FX0A 1K04A 2B88A 2WVRA 1EDKA 4WWIA 4ZNCA 1SLQA 3RK3E 5KKZB 1IFIA 2QJKB 3L70J 3AE3C 2V7QJ 1YQ4C 3KZIE 1HWTC 1AVOA 5TISH 1SQXK 3N4XA 3N7NA 2Q9IA 1GU5A 2ZT9B 2FXOA 3QH9A 3AEGC 4I7ZC 1SQPK 1SVFA 2OYHB 2W27A 1NHLA 1BSNA 5KAIE 4LLHA 2FYUK 2QM8A 5AW4B 5KLIC 4H44B 4C46A 2E75D 1RE3A 2RN0A 3H1KD 2PFXA 5CJ0A 2WSCJ 5AW8B 4UB8H 2JEEA 1S5LX 4EIJA 1ZR4A 2FFDC 1FZCB 4PJ0E 1DD3A 3H1IE 1SQQG 1RF0A 1VQOP 4YPCA 4GDOA 1FZBA 1IK7A 1L0LG 2FKWB 5AVVB 2IX7C 2K9JA 1NTKD 4K35A 2Q3EA 5APQA 2K9JB 2ZXEB 3CL3D 1KN7A 1LWUC 3L72E 3VMYA 3VOPA 3AECC 3FXDA 4NPEA 4DJGA 2HYNA 1E5WA 2H89C 3A2AA 3WUTA 2WQYC 2KS1A 1KYOE 2QSIA 1GMJA 1NTME 1KB9D 1LT9C 2KUBA 1RQUA 2KS1B 4L74A 3GW6A 1M8OB 5KLVD 3LW5H 3O8ZA 2FYNB 1S9KD 3L73G 2BCCG 2IBZE 3A3YB 5KJ7A 1M1JA 2PGDA 3RL0C 3L72J 1PIXA 2E75B 3CX5D 3MP7B 1NTMJ 1AQ5A 3D6ZA 2QJPC 3Q1MA 2PRRA 2G8YA 1ZV8A 2XNDH 2QEXP 2H88C 3CCEP 2E42A 2K9YA 1S4XA 3P8CE 1MZ9A 4MN4C 2C9LY 1N73A 2ZFCA 3VP9A 1EZVD 1SQVE 1IFPA 1LTIC 1LTAC 1J1EC 2QE7H 2N1TA 1NWQA 1BDDA 4XFJA 3MZWB 2P67A 2KP8A 2KSEA 1L4AD 3OW2O 2OYIC 2B9BA 3L4FA 3AE1C 3L70D 1DEBA 3A0HH 1GD2E 4UB8E 2WZ7A 5AVXB 2KZIA 1NOHA 2E74C 2AXTE 1NTZE 2JP3A 2R3CA 5AW5B 1D7MA 2YNYA 3RL0D 2RKLA 1SQVJ 1DIPA 2QA4P 1YJWP 2JR8A 3U1CA 4I6MC 4GKGA 5AVQB 4AQRD 4R4MA 4HJGH 3RK3D 5EFWB 2FFDB 5BVZA 2OTLP 1QGKB 2FYZA 2E76C 2POHA 1SQPG 2HODA 5CJ4A 3AE8C 3B4SA 1FZAA 1NTZJ 3B5NA 3HRNA 2FYUG 4M3LA 4D6TE 2QG4A 3B5NB 3LIEA 1X0TA 1RE4A 3NMDA 4TLFA 2OTKE 1LTJC 1SQBK 5CCHA 1JEKA 1L4AB 2NRGA 1KILC 4ASVA 3CC4P 1LT9B 5AW0B 2HFED 5AW2B 3CWBE 2D2CC 1GK4A 1E79H 1FOSF 1YQ3C 1NAYA 2M3BA 1USDA 2OYOA 3H1ID 1P84I 1L0NE 2A06E 2NPSC 1DD4A 3FWLA 1RY3A 3CC7P 1BCCG 3LW5J 2UWJE 2YMYA 2YMKA 1FC2C 2V4HA 1PZQA 3G71P 1BCCD 1Y47A 2XV5A 3IR9A 1Q7YQ 1X79B 1ZP0C 1T3JA 2N9BA 3RK3B 1PPJE 3C8VA 3L71D 2WMMA 1KYOD 1LTGC 1X22A 1VQ5P 1KMIZ 1BE3G 1LT1A 1URQD 1JOCA 5KAFE 5KKZC 1L0NJ 2QJKC 4OGQD 5H2FE 2P7JA 3AEBC 2R5BA 2YIUC 1YTZT 5GTIH 1W2EA 2BEZF 4DCKA 2IBZD 1QVGO 2KZJA 1NTKK 4Z1MH 3H1HE 1M7LA 1Q2NA 2WPQA 1IFDA 3CC2P 3KXDA 2LKMA 2Y0DA 4JYCA 1YYCA 2W6AA 1KILD 5AW3B 2JKVA 1JMBA 3H32A 1Z56A 1DH3A 3TF5A 1RE3C 2D2CD 3H32B 3M91A 3JCUH 3TGUE 1YIJP 5KLVK 1FZCC 2NPSD 1QL1A 1NU1E 3WU2H 3H1HJ 4HKZH 1RF0C 2Q3IA 1SQVD 1NKNA 1NKZB 1N86A 1PGOA 2IZ1A 2W6BA 2I1KA 3II6A 4WY4A 2IFNA 2IYPA 1GW4A 3AE5C 1KQLA 1URQB 1P84H 4OGQB 1L0LJ 1OVRA 2M5AB 5APSA 1Y9BA 4IL6X 4RKUJ 2Y0CA 2XZRA 3H1LG 4C7NA 1R5LA 3PTZA 3HD7A 2CPBA 1HJBA 1KTMA 3HD7B 3TDKA 1EDIA 1LTJB 3V6IA 1QL2A 1GDTA 3M0DA 3HE4A 1N7LA 1TU3F 1M1JC 3HE4B 3SSUA 1OMIA 3U1AA 2I1JA 3AE2C 3JSVC 2E75C 4DT0A 1W2BO 1XTGB 4B86A 3L73J 3BCCD 2D2CB 1U57A 2BCCJ 1KFNA 2W83C 1YJ9P 3V2QA 2NPSB 1RQVA 2B89A 2DW3A 2R32A 3KYQA 4JBZA 3V2NA 3VN0A 3KPEA 2O01N 3MD0A 1NH4A 4D6TD 1FAVA 5GTIE 2BASA 1EXJA 1LJ2A 3C1LA 3PRJA 5AW6B 3I5CA 1S1CX 4W7YA 3Q5RA 3CXHI 2WPVB 3M0AA 4L75A 3P32A 3OA7A 2Q5UA 2O01H 1VQNP 2A45I 2N1TC 3CWBD 1SP4A 2YIUB 1NAFA 1YITP 3T97A 1DEEG 2A06D 3MTUE 2HPCA 3CCMP 2L91A 2I8DA 3H1JD 2HPCB 3G9RA 1KZUB 3EFFK 1SQXE 3MGNA 5KJ7D 3H1KG 2M0BA 1BGYE 1MFZA 4RO0A 1PPJD 3VMXA 5K5GB 1OZHA 3U59A 3NFQA 1SFCA 2FXPA 1AJYA 3V2PA 2Q6QA 1NTKG 4ZMDA 5CMZA 1JB0J 5B66E 4PD4E 1Q82Q 1PFIA 1N8RQ 1HF9A 1FDIA 1KFMA 1R8EA 1LTBC 1MUUA 1VF5B 5GTHH 3TK1A 3WUUA 4QMAA 1FBMA 1IK9A 2G3AA 4Y99B 3B5NC 1SQXJ 1BGYJ 3R2PA 1UIIA 4EYYQ 5AW1B 5KTBA 1SQPJ 1J1DB 1L4AC 3VP8A 5CCHC 2J58A 2KLVA 5KLVG 2FYUJ 3CD6P 2N1TD 2K3RA 4GOEA 3TGUD 1M90Q 2JJLA 1NU1D 3G4SP 2JO1A 4GIFA 3E7KA 1VQ8P 4N78E 1CZQA 1VDFA 1KB9I 1M1JB 1CI6A 3IFMA 3CXHH 4PV1B 4YTPC 2FY8A 3PH0A 5L8RJ 4OVNF 2A45H 1GU4A 1VQ7P 4R4LA 3BRVB 1GL2A 5APUA 4EI2A 3RK3C 1H0TA 4U7JA 3KHUA 1H0TB 4U3FE 4UB6H 1JMMA 3CX5I 1KV4A 4BRYA 3CMEP 1EZVG 5AVTB 1LGHB 3IF4A 1FJKA 5APTA 4BRYB 5TISE 4TT3H 1YTZI 1JCCA 3L75E 3B5ND 3V2RA 1SQVK 1N73B 4AYCA 1RF1A 3L70G 1RF1B 2N1TB 2GUSA 5CCHD 3AE9C 2M8RA 5CCGA 1OX3A 1EZVI 4K3AA 4U3FJ 1A02J 1QVFO 2RH0A 2O01J 4W80A 3CCRP 2Y0EA 2W8ZA 1T6AA 3L75J 1ZLLA 1JUNA 1U7JA 2O1JA 2Z5HA 1AQTA 1AVYA 2WSEH 3NXSA 3L35A 2VRSA 4RJTA 1QLED 3B8EB 3L36A 1URQC 1VQKP 2ZJSE 4WY4C 3H6PA 1HUCA 4OGQC 3H25A 3PLNA 1PP9E 3E1IA 1KB9H 1N2DC 2HODB 3M9BA 5E79H 1KD1Q 3F89A 1EC5A 5DJUB 3HD7C 5AVSB 1JY3P 1BGYD 5C39A 1KORA 4CPGA 1NJIQ 3M0DC 2E43A 4HB1A 1LWUA 4IFDK 2AEMA 2O1KA 2ZVOB 4ZKPA 3M9HA 5APXA 3H1IG 1RH5B 3L74E 3CX5H 1ZN5A 1PP9J 1SQBE 1LTTC 2H8PD 1M1KQ 1H8AA 2GA1A 2W90A 4PD4D 5AW7B 1G2CA 3BVHA 1M57D 2IPPA 3CPWO 1MFTA 1S5LH 3CI9A 2KSJA 3E1RA 3WUVA 4NPFX 4JPZB 1VPCA 1W5CE 3L72D 3EFGA 3L71G 4KT0J 3D6YA 1NTMG 3TSIA 2JWAA 1JO5A 2NZ2A 2XU6A 3L74J 4GT1A 1NTMD 4HYTB 1SQBJ 2J5UA 3ZDMA 3CCVP 2IBZG 1HVVA 4WY4D 1Q81Q 3IN6A 2KK7A 2ZYGA 5TJHA 2QVAA 1N7SA 1KYOI 1FS0E 4JYBA 3A0HE 3RK2C 3I55P 3BASA 3SWFA 3CCQP 2OGUA 3CCLP 3Q2YA 2PP6A 3HD7D 2QJYB 2WWWA 1VQ6P 2GM4A 2B87A 4OWFA 2IBZI 3A0BH 1DX7A 1SQQE 4XA4A 5B5EH 1LP1A 3GF3A 2P2UA 1L0LE 2RMZA 3D71A 3AEDC 2KLUA 2KNCA 3VMZA 2KB7P 3MIWA 3KZIH 2KNCB 4WB4A 3H1KJ 1SQVG 1NU1K 3P8CD 2FXMA 3MUDA 1IZNB 1PGQA 3G3ZA 1KB9E 1VF5C 2QRXA 2E5TA 4NPDA 3QWOC 5E79E 2P1JA 4Y99C 2Q7CA 3O6QA 4H0LB 1SQQJ 1QX8A 3S9OA 4JF7A 1WRGA 3O6QB 3VTPC 4WY4B 1KQFB 2WT7A 1J1DC 4I2LC 2IZ0A 3L73E 5CHXA 1FDOA 4KJMA 2BCCE 2IYOA 2WSEJ 1YHQP 3ITKA 1GK6A 1IJDB 3CX5E 4EDFA 1NTZD 4GODA 4C7NB 5AW9B 1JY3N 3RK2D 3RBXA 1QEXA 2LR2A 3RL0g 1FZFA 5KLVJ 5KJ7C 3BCCG 1KQSO 4PV1C 1MV8A 1VQMP 1FU1A 3TNUA 1FDMA 3C9IA 2ZAEB 2AEFA 2WPSA 1KYOH 4D6TG 2ZXXA 1FZEA 1SFCD 3A7OA 3FWNA 4GOFA 3RGUA 4KHXA 1PGJA 1OWAA 3FGAD 4N3YB 1VF5D 4IFFA 1JTHA 1N73C 3CWBG 3HTKA 3G6EP 1JTHB 1X9VA 1L0NG 3HTKB 1RF1C 2A06G 3GHGA 3L74D 1L2PA 5AVZB 3H1JG 1OXZA 3GHGB 2JWDA 3A0BE 3R4YA 1L0ND 3GMAA 5CCGC 5B5EE 1OFCX 1KC8Q 3T97B 3RK2B 1K9MQ 1EDJA 2WSFH 5CBNA 3JCUE 1FZGA 1IFJA 1H88A 1CSBA 1PPJG 2GUVA 4H13B 3HUSA 3WU2E 1T2KD 3GF7A 3AE7C 3UIAA 3HUSB 5BU5A 4PV1D 1VQ9P 2IFMA 2KOGA 4WVZA 2OYHA 1SQPE 1NO4A 3P8MC 2FYUE 5M1BA 1SFCB 1GL2D 1K05A 1P84E 4YXDC 1FOSE 3CCUP 3H1HG 1T3UA 3KQGA 4RESB 3CCJP 3W67A 1Q90D 1JCDA 1X8YA 2FBWC 3OAKA 1HJ0A 3AEAC 1GTWA 1FZCA 3H1HD 2AXTH 1HH0A 2L5GB 1EQ7A 1RE4C 4YXWH 4O9BA 1SQQD 3TGUG 2KXPB 3PP5A 1L0LD 1NTMK 1NU1G 1BCCE 1LTSC 2AXCA 3EQ2A 3S1KA 2ITAA 1XTCC 2AEJA 1FJPA 5CCGD 3GLMA 3L71E 1JY3O 4L73A 3SWYA 3V5BA 3B71A 2J59M 3H1IJ 2Y9ZA 3M9QA 1PL5A 3AEEC 3M06A 1CI6B 1BE3E 2W6JH 1YI2P 3USSA 3L73D 1GL2B 1BSHA 1BCCJ 2BCCD 2CPSA 2OTJP 3LIDA 4OH8B 1VQLP 4ASWA 3L71J 2QIWA 1KILE 1WT6A 5CBOA 5AVYB 3JC22 2K37A 4WBAA 4IL6H 3Q3DA 1N7SC 1EXIA 3ABVC 2YXRB 3A5TA 1HGVA 1HBWA 1BE3J 3S4RA 1GW3A 1VL2A 2HLOA 2QJYC 3PJSK 3L37A 2R44A 2HR3A 2MJZA 2YKPA 3SWKA 1JY2O 2OARA 5APVA 2KIKA 2HG5D 5KAFH 1MKMA 1R5SA 5H2FH 1NTZK 1ZRTE 3MHVA 5APYA 2WSFJ 3Q5SA 3MUDC 1K8AQ 5DJTB 5GTHE 2BEQD 3VMAA 4I7ZB 1ZOYC 2SPZA 3H1LE 4H0LC 1G1IA 1RHZB 3EWKA 3CCSP 1IFMA 5KLIB 1WMKA 1JNMA 3BRTB 5AVWB 1VQPP 2XKMA 2FFDA 1Y8AA 1SQXG 3BCCE 1BGYG 2ZYAA 2QM7A 2M3EA 1N7SD 4EOTA 4DOJA 1SQXD 2YKQA 1H89A 2ZYDA 1SQPD 3CXHE 2YO2A 3H1LJ 3NTNA 2R3SA 1LWUB 1M56D 2Y9YA 3F5HA 4XE5B 2YO3A 2FYUD 3SFDC 3TYYA 3BATA 1L4AA 2YKOA 3SFEC 1P84D 4HH2A 4N6JA 3AE4C 1L0NK 1LT9A 3CMAP 2H43A 2Z5IA 4A7PA 3CLQA 3L72G 3BCCJ 1AA0A 1IC2A 1ZXGA 2E5YA 3AEFC 1USEA 1G2CB 1OW6A 4IFMA 2JDIH 4UB6E 3PHLA 1HTLC 1K73Q 3Q5PA 4PD4I 4IL6E 4JQ0D 3H1JE 3RL0B 1OVUA 4D6TJ 2K88A 2E74D 4IOIH 1NYHA 4H0LD 2H7HA 5APWA 1S2EA 3FXEA 2OQQA 3GHGC 3K5BA 2ZVNB 1JY2P 2V7QH 3IAOA 1N7SB 2QJPB 3H1KE 4N78D 3CWBJ 1PGPA 2WTYA 3GG2A 4C7RA 2P10A 2E76D 2XDJA 3OJAB 1NGMB 3RBZA 3H1JJ 1BE3D 4H13C 5AVRB 1LNQA 2B87B 1NTKE 3HUSC 4U3FG 2ZT9C 1SQQK 1AV1A 1J1EB 1G1JA 2OYHC 1L0LK 2K1AA 4U3FD 1BDCA 3D70A 1LP1B 1ZMEC 2KYVA 3P7KA 2OYIA 3WMM0 4BXLA 2WSCH 1SFCC 2YXQB 4DZOA 2OYIB 3W68A 3L75G 3HE5A 2O3JA 4H44C 4L76A 3HE5B 1S3JA 1A02F 3L75D 1UIXA 4W7ZA 4LC1A 3KDPB 5KLVE 1S9KE 2Q1KA 2E74B 4Y28J 3I56P 1NTKJ 5KAIH 1IFNA 1Q86Q 1OIPA 4AUWA 1CW5A 1EDLA 2C9NY 1OW8A 2WITA 2WPRA 1PV3A 2WT7B 2MKVA 1NTZG 1URQA 1YBKA 2M5AA 4PJ0H 1JM0A 1HGZA 5B66H 1ZRTD 2Z4EA 4PD4H 2E76B 2LXBA 3TGUJ 1T2KC 2N9YB 2C0XA 1NU1J 1S5LE 2FYNC 4H13D 3AE6C 2LXCB 1LTJA 1PP9G 1U7MA 3H1LD 2CK3H 2ZT9D 2WSSH 1IO4A 1KILA 3TNUB 1OW7A 1EZVE 2IDBA 1GL2C 4ZKUA 1PP9D 1KILB 5AVUB 1S72P 3V4WA 1J2JB 3V4QA 2C0WA 4LGDE 1ZR2A 1AFOA 4H44D 1GZLA 2NPSA 3VYIA 1OVVA 2P58A 3L70E 2KI7B 2R5DA 4I1LA 1YJNP 2A45G 3L74G 1T8ZA 2PAJA 3CXHD 1SQBG 4BWNA 1VQ4P 1NVOA 5BU8B
chains in the Genus database with same CATH topology
1H0TB 1OVUA 1EDLA 1ZW0A 4IOIH 1SS1A 4ASVA 4ZMDA 3FXDA 1JMBA 4NPEA 2LR2A 2SPZA 1BDDA 3MZWB 2B89A 4JBZA 1EC5A 5DJUB 3FXEA 2B88A 1EDKA 4WWIA 2B87A 4ZNCA 2KUBA 5C39A 2KS1B 4CPGA 2M5AA 1JM0A 4HB1A 2ZAEB 4HKZH 2UWJE 2KZIA 4ASWA 4EYYQ 2LXBA 1LP1A 1FC2C 5CBOA 1Y47A 2RKLA 4GOFA 3RGUA 4K3AA 2LXCB 2K3RA 4GOEA 2B87B 1U7MA 1OVRA 2WMMA 2M5AB 2QRXA 1MFTA 1DEEG 4HJGH 1LT1A 5EFWB 4NPFX 4NPDA 3QWOC 2R44A 2I8DA 1BDCA 2HR3A 1LP1B 4BXLA 1EDIA 1OVVA 3PH0A 3S1KA 2P58A 2KZJA 1U7JA 1ZXGA 2KIKA 4KJMA 1S3JA 2M0BA 2JWDA 2KI7B 1Q2NA 1X0TA 5K5GB 3ZDMA 4MN4C 3MHVA 2Q1KA 2OTKE 1EDJA 4K35A 1H0TA 5CBNA 1NVOA 2QVAA 4GODA 5DJTB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H0T B;  1OVU A;  1EDL A;  1ZW0 A;  4IOI H;  1SS1 A;  4ASV A;  4ZMD A;  3FXD A;  1JMB A;  4NPE A;  2LR2 A;  2SPZ A;  1BDD A;  3MZW B;  2B89 A;  4JBZ A;  1EC5 A;  5DJU B;  3FXE A;  2B88 A;  1EDK A;  4WWI A;  2B87 A;  4ZNC A;  2KUB A;  5C39 A;  2KS1 B;  4CPG A;  2M5A A;  1JM0 A;  4HB1 A;  2ZAE B;  4HKZ H;  2UWJ E;  2KZI A;  4ASW A;  4EYY Q;  2LXB A;  1LP1 A;  1FC2 C;  5CBO A;  1Y47 A;  2RKL A;  4GOF A;  3RGU A;  4K3A A;  2LXC B;  2K3R A;  4GOE A;  2B87 B;  1U7M A;  1OVR A;  2WMM A;  2M5A B;  2QRX A;  1MFT A;  1DEE G;  4HJG H;  1LT1 A;  5EFW B;  4NPF X;  4NPD A;  3QWO C;  2R44 A;  2I8D A;  1BDC A;  2HR3 A;  1LP1 B;  4BXL A;  1EDI A;  1OVV A;  3PH0 A;  3S1K A;  2P58 A;  2KZJ A;  1U7J A;  1ZXG A;  2KIK A;  4KJM A;  1S3J A;  2M0B A;  2JWD A;  2KI7 B;  1Q2N A;  1X0T A;  5K5G B;  3ZDM A;  4MN4 C;  3MHV A;  2Q1K A;  2OTK E;  1EDJ A;  4K35 A;  1H0T A;  5CBN A;  1NVO A;  2QVA A;  4GOD A;  5DJT B; 
#chains in the Genus database with same CATH topology
 1ZW0 A;  2XNX A;  1SS1 A;  1FE6 A;  1SQB D;  1JY2 N;  1KQG B;  3FX0 A;  1K04 A;  2B88 A;  2WVR A;  1EDK A;  4WWI A;  4ZNC A;  1SLQ A;  3RK3 E;  5KKZ B;  1IFI A;  2QJK B;  3L70 J;  3AE3 C;  2V7Q J;  1YQ4 C;  3KZI E;  1HWT C;  1AVO A;  5TIS H;  1SQX K;  3N4X A;  3N7N A;  2Q9I A;  1GU5 A;  2ZT9 B;  2FXO A;  3QH9 A;  3AEG C;  4I7Z C;  1SQP K;  1SVF A;  2OYH B;  2W27 A;  1NHL A;  1BSN A;  5KAI E;  4LLH A;  2FYU K;  2QM8 A;  5AW4 B;  5KLI C;  4H44 B;  4C46 A;  2E75 D;  1RE3 A;  2RN0 A;  3H1K D;  2PFX A;  5CJ0 A;  2WSC J;  5AW8 B;  4UB8 H;  2JEE A;  1S5L X;  4EIJ A;  1ZR4 A;  2FFD C;  1FZC B;  4PJ0 E;  1DD3 A;  3H1I E;  1SQQ G;  1RF0 A;  1VQO P;  4YPC A;  4GDO A;  1FZB A;  1IK7 A;  1L0L G;  2FKW B;  5AVV B;  2IX7 C;  2K9J A;  1NTK D;  4K35 A;  2Q3E A;  5APQ A;  2K9J B;  2ZXE B;  3CL3 D;  1KN7 A;  1LWU C;  3L72 E;  3VMY A;  3VOP A;  3AEC C;  3FXD A;  4NPE A;  4DJG A;  2HYN A;  1E5W A;  2H89 C;  3A2A A;  3WUT A;  2WQY C;  2KS1 A;  1KYO E;  2QSI A;  1GMJ A;  1NTM E;  1KB9 D;  1LT9 C;  2KUB A;  1RQU A;  2KS1 B;  4L74 A;  3GW6 A;  1M8O B;  5KLV D;  3LW5 H;  3O8Z A;  2FYN B;  1S9K D;  3L73 G;  2BCC G;  2IBZ E;  3A3Y B;  5KJ7 A;  1M1J A;  2PGD A;  3RL0 C;  3L72 J;  1PIX A;  2E75 B;  3CX5 D;  3MP7 B;  1NTM J;  1AQ5 A;  3D6Z A;  2QJP C;  3Q1M A;  2PRR A;  2G8Y A;  1ZV8 A;  2XND H;  2QEX P;  2H88 C;  3CCE P;  2E42 A;  2K9Y A;  1S4X A;  3P8C E;  1MZ9 A;  4MN4 C;  2C9L Y;  1N73 A;  2ZFC A;  3VP9 A;  1EZV D;  1SQV E;  1IFP A;  1LTI C;  1LTA C;  1J1E C;  2QE7 H;  2N1T A;  1NWQ A;  1BDD A;  4XFJ A;  3MZW B;  2P67 A;  2KP8 A;  2KSE A;  1L4A D;  3OW2 O;  2OYI C;  2B9B A;  3L4F A;  3AE1 C;  3L70 D;  1DEB A;  3A0H H;  1GD2 E;  4UB8 E;  2WZ7 A;  5AVX B;  2KZI A;  1NOH A;  2E74 C;  2AXT E;  1NTZ E;  2JP3 A;  2R3C A;  5AW5 B;  1D7M A;  2YNY A;  3RL0 D;  2RKL A;  1SQV J;  1DIP A;  2QA4 P;  1YJW P;  2JR8 A;  3U1C A;  4I6M C;  4GKG A;  5AVQ B;  4AQR D;  4R4M A;  4HJG H;  3RK3 D;  5EFW B;  2FFD B;  5BVZ A;  2OTL P;  1QGK B;  2FYZ A;  2E76 C;  2POH A;  1SQP G;  2HOD A;  5CJ4 A;  3AE8 C;  3B4S A;  1FZA A;  1NTZ J;  3B5N A;  3HRN A;  2FYU G;  4M3L A;  4D6T E;  2QG4 A;  3B5N B;  3LIE A;  1X0T A;  1RE4 A;  3NMD A;  4TLF A;  2OTK E;  1LTJ C;  1SQB K;  5CCH A;  1JEK A;  1L4A B;  2NRG A;  1KIL C;  4ASV A;  3CC4 P;  1LT9 B;  5AW0 B;  2HFE D;  5AW2 B;  3CWB E;  2D2C C;  1GK4 A;  1E79 H;  1FOS F;  1YQ3 C;  1NAY A;  2M3B A;  1USD A;  2OYO A;  3H1I D;  1P84 I;  1L0N E;  2A06 E;  2NPS C;  1DD4 A;  3FWL A;  1RY3 A;  3CC7 P;  1BCC G;  3LW5 J;  2UWJ E;  2YMY A;  2YMK A;  1FC2 C;  2V4H A;  1PZQ A;  3G71 P;  1BCC D;  1Y47 A;  2XV5 A;  3IR9 A;  1Q7Y Q;  1X79 B;  1ZP0 C;  1T3J A;  2N9B A;  3RK3 B;  1PPJ E;  3C8V A;  3L71 D;  2WMM A;  1KYO D;  1LTG C;  1X22 A;  1VQ5 P;  1KMI Z;  1BE3 G;  1LT1 A;  1URQ D;  1JOC A;  5KAF E;  5KKZ C;  1L0N J;  2QJK C;  4OGQ D;  5H2F E;  2P7J A;  3AEB C;  2R5B A;  2YIU C;  1YTZ T;  5GTI H;  1W2E A;  2BEZ F;  4DCK A;  2IBZ D;  1QVG O;  2KZJ A;  1NTK K;  4Z1M H;  3H1H E;  1M7L A;  1Q2N A;  2WPQ A;  1IFD A;  3CC2 P;  3KXD A;  2LKM A;  2Y0D A;  4JYC A;  1YYC A;  2W6A A;  1KIL D;  5AW3 B;  2JKV A;  1JMB A;  3H32 A;  1Z56 A;  1DH3 A;  3TF5 A;  1RE3 C;  2D2C D;  3H32 B;  3M91 A;  3JCU H;  3TGU E;  1YIJ P;  5KLV K;  1FZC C;  2NPS D;  1QL1 A;  1NU1 E;  3WU2 H;  3H1H J;  4HKZ H;  1RF0 C;  2Q3I A;  1SQV D;  1NKN A;  1NKZ B;  1N86 A;  1PGO A;  2IZ1 A;  2W6B A;  2I1K A;  3II6 A;  4WY4 A;  2IFN A;  2IYP A;  1GW4 A;  3AE5 C;  1KQL A;  1URQ B;  1P84 H;  4OGQ B;  1L0L J;  1OVR A;  2M5A B;  5APS A;  1Y9B A;  4IL6 X;  4RKU J;  2Y0C A;  2XZR A;  3H1L G;  4C7N A;  1R5L A;  3PTZ A;  3HD7 A;  2CPB A;  1HJB A;  1KTM A;  3HD7 B;  3TDK A;  1EDI A;  1LTJ B;  3V6I A;  1QL2 A;  1GDT A;  3M0D A;  3HE4 A;  1N7L A;  1TU3 F;  1M1J C;  3HE4 B;  3SSU A;  1OMI A;  3U1A A;  2I1J A;  3AE2 C;  3JSV C;  2E75 C;  4DT0 A;  1W2B O;  1XTG B;  4B86 A;  3L73 J;  3BCC D;  2D2C B;  1U57 A;  2BCC J;  1KFN A;  2W83 C;  1YJ9 P;  3V2Q A;  2NPS B;  1RQV A;  2B89 A;  2DW3 A;  2R32 A;  3KYQ A;  4JBZ A;  3V2N A;  3VN0 A;  3KPE A;  2O01 N;  3MD0 A;  1NH4 A;  4D6T D;  1FAV A;  5GTI E;  2BAS A;  1EXJ A;  1LJ2 A;  3C1L A;  3PRJ A;  5AW6 B;  3I5C A;  1S1C X;  4W7Y A;  3Q5R A;  3CXH I;  2WPV B;  3M0A A;  4L75 A;  3P32 A;  3OA7 A;  2Q5U A;  2O01 H;  1VQN P;  2A45 I;  2N1T C;  3CWB D;  1SP4 A;  2YIU B;  1NAF A;  1YIT P;  3T97 A;  1DEE G;  2A06 D;  3MTU E;  2HPC A;  3CCM P;  2L91 A;  2I8D A;  3H1J D;  2HPC B;  3G9R A;  1KZU B;  3EFF K;  1SQX E;  3MGN A;  5KJ7 D;  3H1K G;  2M0B A;  1BGY E;  1MFZ A;  4RO0 A;  1PPJ D;  3VMX A;  5K5G B;  1OZH A;  3U59 A;  3NFQ A;  1SFC A;  2FXP A;  1AJY A;  3V2P A;  2Q6Q A;  1NTK G;  4ZMD A;  5CMZ A;  1JB0 J;  5B66 E;  4PD4 E;  1Q82 Q;  1PFI A;  1N8R Q;  1HF9 A;  1FDI A;  1KFM A;  1R8E A;  1LTB C;  1MUU A;  1VF5 B;  5GTH H;  3TK1 A;  3WUU A;  4QMA A;  1FBM A;  1IK9 A;  2G3A A;  4Y99 B;  3B5N C;  1SQX J;  1BGY J;  3R2P A;  1UII A;  4EYY Q;  5AW1 B;  5KTB A;  1SQP J;  1J1D B;  1L4A C;  3VP8 A;  5CCH C;  2J58 A;  2KLV A;  5KLV G;  2FYU J;  3CD6 P;  2N1T D;  2K3R A;  4GOE A;  3TGU D;  1M90 Q;  2JJL A;  1NU1 D;  3G4S P;  2JO1 A;  4GIF A;  3E7K A;  1VQ8 P;  4N78 E;  1CZQ A;  1VDF A;  1KB9 I;  1M1J B;  1CI6 A;  3IFM A;  3CXH H;  4PV1 B;  4YTP C;  2FY8 A;  3PH0 A;  5L8R J;  4OVN F;  2A45 H;  1GU4 A;  1VQ7 P;  4R4L A;  3BRV B;  1GL2 A;  5APU A;  4EI2 A;  3RK3 C;  1H0T A;  4U7J A;  3KHU A;  1H0T B;  4U3F E;  4UB6 H;  1JMM A;  3CX5 I;  1KV4 A;  4BRY A;  3CME P;  1EZV G;  5AVT B;  1LGH B;  3IF4 A;  1FJK A;  5APT A;  4BRY B;  5TIS E;  4TT3 H;  1YTZ I;  1JCC A;  3L75 E;  3B5N D;  3V2R A;  1SQV K;  1N73 B;  4AYC A;  1RF1 A;  3L70 G;  1RF1 B;  2N1T B;  2GUS A;  5CCH D;  3AE9 C;  2M8R A;  5CCG A;  1OX3 A;  1EZV I;  4K3A A;  4U3F J;  1A02 J;  1QVF O;  2RH0 A;  2O01 J;  4W80 A;  3CCR P;  2Y0E A;  2W8Z A;  1T6A A;  3L75 J;  1ZLL A;  1JUN A;  1U7J A;  2O1J A;  2Z5H A;  1AQT A;  1AVY A;  2WSE H;  3NXS A;  3L35 A;  2VRS A;  4RJT A;  1QLE D;  3B8E B;  3L36 A;  1URQ C;  1VQK P;  2ZJS E;  4WY4 C;  3H6P A;  1HUC A;  4OGQ C;  3H25 A;  3PLN A;  1PP9 E;  3E1I A;  1KB9 H;  1N2D C;  2HOD B;  3M9B A;  5E79 H;  1KD1 Q;  3F89 A;  1EC5 A;  5DJU B;  3HD7 C;  5AVS B;  1JY3 P;  1BGY D;  5C39 A;  1KOR A;  4CPG A;  1NJI Q;  3M0D C;  2E43 A;  4HB1 A;  1LWU A;  4IFD K;  2AEM A;  2O1K A;  2ZVO B;  4ZKP A;  3M9H A;  5APX A;  3H1I G;  1RH5 B;  3L74 E;  3CX5 H;  1ZN5 A;  1PP9 J;  1SQB E;  1LTT C;  2H8P D;  1M1K Q;  1H8A A;  2GA1 A;  2W90 A;  4PD4 D;  5AW7 B;  1G2C A;  3BVH A;  1M57 D;  2IPP A;  3CPW O;  1MFT A;  1S5L H;  3CI9 A;  2KSJ A;  3E1R A;  3WUV A;  4NPF X;  4JPZ B;  1VPC A;  1W5C E;  3L72 D;  3EFG A;  3L71 G;  4KT0 J;  3D6Y A;  1NTM G;  3TSI A;  2JWA A;  1JO5 A;  2NZ2 A;  2XU6 A;  3L74 J;  4GT1 A;  1NTM D;  4HYT B;  1SQB J;  2J5U A;  3ZDM A;  3CCV P;  2IBZ G;  1HVV A;  4WY4 D;  1Q81 Q;  3IN6 A;  2KK7 A;  2ZYG A;  5TJH A;  2QVA A;  1N7S A;  1KYO I;  1FS0 E;  4JYB A;  3A0H E;  3RK2 C;  3I55 P;  3BAS A;  3SWF A;  3CCQ P;  2OGU A;  3CCL P;  3Q2Y A;  2PP6 A;  3HD7 D;  2QJY B;  2WWW A;  1VQ6 P;  2GM4 A;  2B87 A;  4OWF A;  2IBZ I;  3A0B H;  1DX7 A;  1SQQ E;  4XA4 A;  5B5E H;  1LP1 A;  3GF3 A;  2P2U A;  1L0L E;  2RMZ A;  3D71 A;  3AED C;  2KLU A;  2KNC A;  3VMZ A;  2KB7 P;  3MIW A;  3KZI H;  2KNC B;  4WB4 A;  3H1K J;  1SQV G;  1NU1 K;  3P8C D;  2FXM A;  3MUD A;  1IZN B;  1PGQ A;  3G3Z A;  1KB9 E;  1VF5 C;  2QRX A;  2E5T A;  4NPD A;  3QWO C;  5E79 E;  2P1J A;  4Y99 C;  2Q7C A;  3O6Q A;  4H0L B;  1SQQ J;  1QX8 A;  3S9O A;  4JF7 A;  1WRG A;  3O6Q B;  3VTP C;  4WY4 B;  1KQF B;  2WT7 A;  1J1D C;  4I2L C;  2IZ0 A;  3L73 E;  5CHX A;  1FDO A;  4KJM A;  2BCC E;  2IYO A;  2WSE J;  1YHQ P;  3ITK A;  1GK6 A;  1IJD B;  3CX5 E;  4EDF A;  1NTZ D;  4GOD A;  4C7N B;  5AW9 B;  1JY3 N;  3RK2 D;  3RBX A;  1QEX A;  2LR2 A;  3RL0 g;  1FZF A;  5KLV J;  5KJ7 C;  3BCC G;  1KQS O;  4PV1 C;  1MV8 A;  1VQM P;  1FU1 A;  3TNU A;  1FDM A;  3C9I A;  2ZAE B;  2AEF A;  2WPS A;  1KYO H;  4D6T G;  2ZXX A;  1FZE A;  1SFC D;  3A7O A;  3FWN A;  4GOF A;  3RGU A;  4KHX A;  1PGJ A;  1OWA A;  3FGA D;  4N3Y B;  1VF5 D;  4IFF A;  1JTH A;  1N73 C;  3CWB G;  3HTK A;  3G6E P;  1JTH B;  1X9V A;  1L0N G;  3HTK B;  1RF1 C;  2A06 G;  3GHG A;  3L74 D;  1L2P A;  5AVZ B;  3H1J G;  1OXZ A;  3GHG B;  2JWD A;  3A0B E;  3R4Y A;  1L0N D;  3GMA A;  5CCG C;  5B5E E;  1OFC X;  1KC8 Q;  3T97 B;  3RK2 B;  1K9M Q;  1EDJ A;  2WSF H;  5CBN A;  3JCU E;  1FZG A;  1IFJ A;  1H88 A;  1CSB A;  1PPJ G;  2GUV A;  4H13 B;  3HUS A;  3WU2 E;  1T2K D;  3GF7 A;  3AE7 C;  3UIA A;  3HUS B;  5BU5 A;  4PV1 D;  1VQ9 P;  2IFM A;  2KOG A;  4WVZ A;  2OYH A;  1SQP E;  1NO4 A;  3P8M C;  2FYU E;  5M1B A;  1SFC B;  1GL2 D;  1K05 A;  1P84 E;  4YXD C;  1FOS E;  3CCU P;  3H1H G;  1T3U A;  3KQG A;  4RES B;  3CCJ P;  3W67 A;  1Q90 D;  1JCD A;  1X8Y A;  2FBW C;  3OAK A;  1HJ0 A;  3AEA C;  1GTW A;  1FZC A;  3H1H D;  2AXT H;  1HH0 A;  2L5G B;  1EQ7 A;  1RE4 C;  4YXW H;  4O9B A;  1SQQ D;  3TGU G;  2KXP B;  3PP5 A;  1L0L D;  1NTM K;  1NU1 G;  1BCC E;  1LTS C;  2AXC A;  3EQ2 A;  3S1K A;  2ITA A;  1XTC C;  2AEJ A;  1FJP A;  5CCG D;  3GLM A;  3L71 E;  1JY3 O;  4L73 A;  3SWY A;  3V5B A;  3B71 A;  2J59 M;  3H1I J;  2Y9Z A;  3M9Q A;  1PL5 A;  3AEE C;  3M06 A;  1CI6 B;  1BE3 E;  2W6J H;  1YI2 P;  3USS A;  3L73 D;  1GL2 B;  1BSH A;  1BCC J;  2BCC D;  2CPS A;  2OTJ P;  3LID A;  4OH8 B;  1VQL P;  4ASW A;  3L71 J;  2QIW A;  1KIL E;  1WT6 A;  5CBO A;  5AVY B;  3JC2 2;  2K37 A;  4WBA A;  4IL6 H;  3Q3D A;  1N7S C;  1EXI A;  3ABV C;  2YXR B;  3A5T A;  1HGV A;  1HBW A;  1BE3 J;  3S4R A;  1GW3 A;  1VL2 A;  2HLO A;  2QJY C;  3PJS K;  3L37 A;  2R44 A;  2HR3 A;  2MJZ A;  2YKP A;  3SWK A;  1JY2 O;  2OAR A;  5APV A;  2KIK A;  2HG5 D;  5KAF H;  1MKM A;  1R5S A;  5H2F H;  1NTZ K;  1ZRT E;  3MHV A;  5APY A;  2WSF J;  3Q5S A;  3MUD C;  1K8A Q;  5DJT B;  5GTH E;  2BEQ D;  3VMA A;  4I7Z B;  1ZOY C;  2SPZ A;  3H1L E;  4H0L C;  1G1I A;  1RHZ B;  3EWK A;  3CCS P;  1IFM A;  5KLI B;  1WMK A;  1JNM A;  3BRT B;  5AVW B;  1VQP P;  2XKM A;  2FFD A;  1Y8A A;  1SQX G;  3BCC E;  1BGY G;  2ZYA A;  2QM7 A;  2M3E A;  1N7S D;  4EOT A;  4DOJ A;  1SQX D;  2YKQ A;  1H89 A;  2ZYD A;  1SQP D;  3CXH E;  2YO2 A;  3H1L J;  3NTN A;  2R3S A;  1LWU B;  1M56 D;  2Y9Y A;  3F5H A;  4XE5 B;  2YO3 A;  2FYU D;  3SFD C;  3TYY A;  3BAT A;  1L4A A;  2YKO A;  3SFE C;  1P84 D;  4HH2 A;  4N6J A;  3AE4 C;  1L0N K;  1LT9 A;  3CMA P;  2H43 A;  2Z5I A;  4A7P A;  3CLQ A;  3L72 G;  3BCC J;  1AA0 A;  1IC2 A;  1ZXG A;  2E5Y A;  3AEF C;  1USE A;  1G2C B;  1OW6 A;  4IFM A;  2JDI H;  4UB6 E;  3PHL A;  1HTL C;  1K73 Q;  3Q5P A;  4PD4 I;  4IL6 E;  4JQ0 D;  3H1J E;  3RL0 B;  1OVU A;  4D6T J;  2K88 A;  2E74 D;  4IOI H;  1NYH A;  4H0L D;  2H7H A;  5APW A;  1S2E A;  3FXE A;  2OQQ A;  3GHG C;  3K5B A;  2ZVN B;  1JY2 P;  2V7Q H;  3IAO A;  1N7S B;  2QJP B;  3H1K E;  4N78 D;  3CWB J;  1PGP A;  2WTY A;  3GG2 A;  4C7R A;  2P10 A;  2E76 D;  2XDJ A;  3OJA B;  1NGM B;  3RBZ A;  3H1J J;  1BE3 D;  4H13 C;  5AVR B;  1LNQ A;  2B87 B;  1NTK E;  3HUS C;  4U3F G;  2ZT9 C;  1SQQ K;  1AV1 A;  1J1E B;  1G1J A;  2OYH C;  1L0L K;  2K1A A;  4U3F D;  1BDC A;  3D70 A;  1LP1 B;  1ZME C;  2KYV A;  3P7K A;  2OYI A;  3WMM 0;  4BXL A;  2WSC H;  1SFC C;  2YXQ B;  4DZO A;  2OYI B;  3W68 A;  3L75 G;  3HE5 A;  2O3J A;  4H44 C;  4L76 A;  3HE5 B;  1S3J A;  1A02 F;  3L75 D;  1UIX A;  4W7Z A;  4LC1 A;  3KDP B;  5KLV E;  1S9K E;  2Q1K A;  2E74 B;  4Y28 J;  3I56 P;  1NTK J;  5KAI H;  1IFN A;  1Q86 Q;  1OIP A;  4AUW A;  1CW5 A;  1EDL A;  2C9N Y;  1OW8 A;  2WIT A;  2WPR A;  1PV3 A;  2WT7 B;  2MKV A;  1NTZ G;  1URQ A;  1YBK A;  2M5A A;  4PJ0 H;  1JM0 A;  1HGZ A;  5B66 H;  1ZRT D;  2Z4E A;  4PD4 H;  2E76 B;  2LXB A;  3TGU J;  1T2K C;  2N9Y B;  2C0X A;  1NU1 J;  1S5L E;  2FYN C;  4H13 D;  3AE6 C;  2LXC B;  1LTJ A;  1PP9 G;  1U7M A;  3H1L D;  2CK3 H;  2ZT9 D;  2WSS H;  1IO4 A;  1KIL A;  3TNU B;  1OW7 A;  1EZV E;  2IDB A;  1GL2 C;  4ZKU A;  1PP9 D;  1KIL B;  5AVU B;  1S72 P;  3V4W A;  1J2J B;  3V4Q A;  2C0W A;  4LGD E;  1ZR2 A;  1AFO A;  4H44 D;  1GZL A;  2NPS A;  3VYI A;  1OVV A;  2P58 A;  3L70 E;  2KI7 B;  2R5D A;  4I1L A;  1YJN P;  2A45 G;  3L74 G;  1T8Z A;  2PAJ A;  3CXH D;  1SQB G;  4BWN A;  1VQ4 P;  1NVO A;  5BU8 B; 
#chains in the Genus database with same CATH homology
 1H0T B;  1OVU A;  1EDL A;  1ZW0 A;  4IOI H;  1SS1 A;  4ASV A;  4ZMD A;  3FXD A;  1JMB A;  4NPE A;  2LR2 A;  2SPZ A;  1BDD A;  3MZW B;  2B89 A;  4JBZ A;  1EC5 A;  5DJU B;  3FXE A;  2B88 A;  1EDK A;  4WWI A;  2B87 A;  4ZNC A;  2KUB A;  5C39 A;  2KS1 B;  4CPG A;  2M5A A;  1JM0 A;  4HB1 A;  2ZAE B;  4HKZ H;  2UWJ E;  2KZI A;  4ASW A;  4EYY Q;  2LXB A;  1LP1 A;  1FC2 C;  5CBO A;  1Y47 A;  2RKL A;  4GOF A;  3RGU A;  4K3A A;  2LXC B;  2K3R A;  4GOE A;  2B87 B;  1U7M A;  1OVR A;  2WMM A;  2M5A B;  2QRX A;  1MFT A;  1DEE G;  4HJG H;  1LT1 A;  5EFW B;  4NPF X;  4NPD A;  3QWO C;  2R44 A;  2I8D A;  1BDC A;  2HR3 A;  1LP1 B;  4BXL A;  1EDI A;  1OVV A;  3PH0 A;  3S1K A;  2P58 A;  2KZJ A;  1U7J A;  1ZXG A;  2KIK A;  4KJM A;  1S3J A;  2M0B A;  2JWD A;  2KI7 B;  1Q2N A;  1X0T A;  5K5G B;  3ZDM A;  4MN4 C;  3MHV A;  2Q1K A;  2OTK E;  1EDJ A;  4K35 A;  1H0T A;  5CBN A;  1NVO A;  2QVA A;  4GOD A;  5DJT B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...