2OTLP

Girodazole bound to the large subunit of haloarcula marismortui
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal RNA
publication title The Structures of Antibiotics Bound to the E Site Region of the 50 S Ribosomal Subunit of Haloarcula marismortui: 13-Deoxytedanolide and Girodazole.
pubmed doi rcsb
molecule tags Ribosome
total genus 48
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2007-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 2otlP03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 2otlP01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 2otlP02
1VQNP 1VQKP 3G6EP 1YHQP 3G71P 3G4SP 2QEXP 3CCMP 1M1KQ 1VQ5P 1VQ4P 3CCLP 3CCUP 3I56P 3CCEP 1Q82Q 1KD1Q 2QA4P 1N8RQ 2OTJP 3CCVP 3CCSP 3CCQP 3OW2O 1VQPP 1YITP 1Q86Q 1W2BO 1NJIQ 1VQMP 1YI2P 1QVGO 1VQ9P 3CC7P 1VQOP 3CPWO 3CMAP 1M90Q 3CXCO 3CMEP 1QVFO 1Q7YQ 1K8AQ 1JJ2O 1YIJP 2OTLP 3I55P 1Q81Q 1KC8Q 1VQ7P 1VQLP 1VQ6P 1S72P 1VQ8P 1KQSO 3CC2P 3CCJP 1YJ9P 1YJWP 3CCRP 1K73Q 3CC4P 1K9MQ 3CD6P 1YJNP
chains in the Genus database with same CATH superfamily
1MUUA 3U59A 3KXDA 2L0QA 1J1DC 1NTMG 2O3JA 3CWBG 1Q86Q 1GPJA 1LTSC 1FJPA 2KGAA 2ZYDA 1SQPJ 2B88A 1HGZA 3G3ZA 3RK3B 2KK7A 1RF1A 1SQQG 2KORA 3AECC 1L0LE 2K0YA 3A0BE 1NTZK 5KP6B 2B89A 2E5YA 2H88C 1KZUB 3CPWO 3O6QA 2EHSA 1BGYD 1SQVK 2K0XA 1GD2E 1MZ9A 1EDJA 4PH0A 1L0NE 1XTCC 1RHZB 3GF3A 3RL0D 1VQ5P 4GOEA 1JUNA 2KOQA 1VQMP 1RY3A 5APVA 2K9JA 1Q7YQ 4HB1A 2FYUK 2KOGA 4PXHB 1KC8Q 1FBMA 3H1KG 1ACPA 2AF8A 3H1HJ 4PJ0H 1YJ9P 3AEBC 1KILE 2K0DX 1NO4A 3L72J 3HD7C 4H13C 1EIAA 2KOOA 2LKIA 4HKZH 1ZMBA 2E76B 1URQA 2E74D 1EZVG 4IFFA 1DX7A 1RF0A 3M0DC 4L76A 2QJYC 5KAFH 1SQXE 1OW6A 3L37A 3HE5B 3G6EP 3VMAA 1UIIA 1KYOE 1AA0A 4M3LA 5KLVJ 3RK2B 3CXHI 2J58A 4ZKPA 4NPFX 4JF7A 3BCCG 5EFWB 5EJDA 2PAJA 2KGCA 3KYQA 1SFCD 5B66E 2CK3H 1IZNB 3CC4P 3AE1C 1RE3C 5TISH 1IMQA 2WPSA 1JY3N 2M8LA 3VMYA 3C1LA 2JAZA 3SWYA 2N1TD 4L74A 3HUSC 1DEBA 4EDFA 4GR6A 1NTZJ 3H4EA 1VF5C 2L22A 3GZLA 3CCRP 1T3JA 1FAVA 3FXDA 5AW9B 3AE7C 1SQVJ 2KOSA 2PENA 2RKLA 2LIUA 4XFJA 2IZ1A 1JMBA 1MZ8A 1YYCA 1T3UA 2V4HA 3V4WA 2ZXEB 3MUDA 3CMEP 2LR2A 3W68A 2BCCE 1L0LD 2YKPA 1S72P 3NY7B 1H8AA 3H1JG 1PGPA 3TGUG 4JPZB 1URQD 1X8YA 1CZQA 2FYUJ 2FVFA 3G0VA 2IYPA 4U3FD 1OW8A 5APWA 4BRYB 4YXWH 1JEKA 1MFTA 3P7KA 5I4TG 2WPQA 3JSVC 1X79B 3GLMA 2PEIA 3IR9A 5CBNA 2JEEA 4W7ZA 1S2EA 1H0TB 1NKNA 4NPDA 2OYIB 4IZ6A 4QMAA 1VHNA 2L5GB 3L73J 5E79H 4D6TG 3AEAC 2O1JA 4YXDC 2LMLA 1KILD 1J1DB 3RBXA 2YIUC 2AXCA 1QVGO 3GHGC 3L75E 2JU1A 2M5AB 2YXQB 3IFMA 1NU1J 2Y0CA 3CC2P 4GR2A 2E75B 2JYLA 1JY2O 3AE9C 5CCGD 4C7RA 2QRXA 2AXTH 1DH3A 3WUVA 3E1RA 1KMIZ 1KYOD 2C0XA 2OYIA 4NPEA 1BCCG 3CL3D 3H1LG 2A06D 4DJGA 2M5AA 4IL6E 3PTZA 5AW2B 2WSSH 3AE3C 3TSIA 2WTYA 2FVEA 1HQBA 1VL2A 5BS1A 5CCHA 4LGDE 2Q3EA 1L0LK 1EDLA 3USSA 1PL5A 1AF8A 2JWAA 2QG4A 3U1CA 1AV1A 2YKQA 3AEGC 4H2XC 3P8MC 2KG6A 4WB4A 3H0DA 5B5EE 2FXOA 3KQGA 2PGDA 4EI2A 3Q2YA 2VLOA 3HE4B 1NWQA 1YJWP 1FDMA 1IFDA 1LNQA 5M1BA 3AE4C 1LGHB 2Z5IA 1AJYA 1NTME 2KS1B 3MGNA 3F89A 4OGQD 1DIPA 1GW4A 3P8CE 4ZMDA 2FXPA 2BQ1E 2ZJSE 1RO0A 4IOIH 2WT7A 4PV1D 1ZW0A 1NHLA 3S1KA 1RE4A 3SWFA 1PP9J 1SFCC 4XE5B 3L70G 3MIWA 3QWOC 1BE3D 1SQXK 2K93A 2H8PD 2GA1A 3W67A 1FZEA 1X22A 4GODA 3FGAD 3AE8C 3H6PA 2P7JA 2OTJP 1E5WA 1D1DA 4K3AA 2N1TC 2LXCB 2HPCB 5CCHD 1FZGA 2QM7A 1NYHA 2EIAA 2KUBA 1RQUA 1YQ4C 1M90Q 3VMZA 2HODB 5HGNA 3DS0A 3M1MA 3LIDA 4WY4B 1GU4A 1QL2A 5AVXB 5H2FH 3H1KE 1ZR2A 2AFEA 4F37A 2VLNA 4COPA 1QX8A 1L0LJ 2CPSA 3EWKA 1A02J 3VOPA 1URQC 3D70A 2PEQA 1OXZA 3VTPC 5KAIH 2P2UA 2GZIA 1SQBG 5HVCA 3CCJP 1FZCA 1HF9A 5HGMA 4XFYA 4Y99B 1L0NJ 4IPYA 1HJ0A 1J1EC 1NTKG 1FC2C 4H0LB 2OARA 2ZYAA 4WY4A 2Z46A 4COCA 2M3BA 2OYOA 1A8OA 1R5SA 3RBZA 1M56D 2KB7P 1KILC 1U57A 2QE7H 2KP8A 3TK1A 1BGYE 3DS2A 1K05A 1T6AA 2KODA 2D2CD 4YTPC 1FDIA 5GTIE 3KZIH 3TF5A 3IN6A 2IDBA 4IL6X 2L91A 2NPSC 2O01H 3CX5H 1LT9A 2OTLP 1GZLA 5CCGC 2ZVOB 4R4LA 1ZNVA 1NTMD 1MKMA 3WU2H 1SQXJ 1VDFA 3CWBD 4WWIA 1RNIA 3NFQA 1PIXA 2N5IA 1M1KQ 4AQRD 1BSHA 3CCSP 2WSCJ 2JDIH 2MKVA 5C39A 3MGEA 1CSBA 1NH4A 5KKZC 2YKOA 1SQQD 3Q5SA 2H89C 3NMDA 1EMVA 3TGUE 1FZFA 2LTEA 2KR5A 2R3SA 2Y0DA 2V7QH 3B5NA 3H1HG 3MP7B 2PP6A 3G26A 1LWUC 1HVVA 3M0AA 2L9FA 5F2OA 4WY4D 3LW5H 1N7SB 3VRLC 2QM8A 5AW1B 4K35A 3G4SP 3SWKA 1QEXA 1ZRTD 3H1KD 1M74A 1S5LE 2CG5B 4QNBA 4WBAA 2KLVA 1NAYA 3JCUH 1IFMA 2BCCJ 3OJAB 1VQ8P 2Y9YA 2C0WA 3CXHE 2GZJA 4I2LC 5KLVG 3CD6P 2M3EA 1EZVD 1USEA 1VQ4P 2FKWB 1FU1A 4KT0J 3U43A 3DS4A 3CCQP 3L71G 3R4YA 2IBZI 1N7SA 2EFJA 3E7KA 4R4MA 4PV1C 2GYKA 5KP8B 2JO0A 4JYCA 1BCCE 1NTMK 3BCCD 2QIWA 1GL2B 1EQ7A 2HYNA 1LP1B 3OAKA 1NTZG 3L75J 2GUSA 3A2AA 4U3FE 3B5ND 2JB0A 1LTJB 1SQQK 2CPBA 1CEIA 5AW3B 5HGOA 1JMMA 3O8ZA 1X0TA 4C46A 4PD4H 1UJZA 1S3JA 5AVWB 5CJ0A 2JO1A 2HG5D 1VQ6P 1L4AC 2FYUG 3H1IG 4HJGH 1GL2A 2WSFH 3WUTA 4EIJA 1LP1A 3CX5I 1WRGA 1J1EB 3H1JD 3TGUD 2ZT9B 3FX0A 2IZ0A 4H44D 1N73B 1LTJA 1KQGB 3I55P 1Q81Q 2JGPA 3P05A 2XZRA 1QLED 2YMKA 5B66H 1JY2N 2P67A 1ZV8A 3N7NA 3L73G 4L75A 1NGMB 3R2PA 3RGUA 1DNYA 1M1JB 3PJSK 4ASVA 2Z45A 1R5LA 1NU1G 2Q7CA 2FYNC 3DS5A 3L70E 2WWWA 2QJKB 2L6EA 2QVAA 2M5RA 2HLOA 2A06E 2D2CC 4PJ0E 4D6TD 5AVSB 1AYIA 2IBZG 1BSNA 4JYBA 1N73A 2KWLA 1T8KA 4UB6H 3CXHD 1SP4A 1MV8A 1NTMJ 3Q5PA 3GZMA 3CMAP 1JNMA 2PEKA 1ZP0C 1Z6MA 1KQSO 3HE5A 1M1JA 4OVNF 2IYOA 5KAFE 2B87B 2IFNA 2P58A 5CMZA 2R5DA 2R3CA 2WPTA 4LLHA 3RK3D 4H2YC 2KG9A 4QKOA 4GIFA 2X2BA 1BCCD 1RO2A 1TU3F 2GM4A 1D7MA 2XKMA 1KQLA 1S5LX 4U0AA 3SSUA 2WITA 3H1LD 5AW5B 1SQBE 3UIAA 4TT3H 1YBKA 1RQVA 5TISE 2P9XA 4IFDK 5CJ4A 3NTEA 2MR7A 1FS0E 3CCVP 1S1CX 2OYHC 1CI6B 4U0BA 2PEJA 3F5HA 1AQTA 4UB8H 1ZLLA 4I7ZB 1HBWA 3H1KJ 2FFDC 2WPRA 1BE3E 1JTHB 2P1JA 1GK4A 1FZBA 4GKGA 1FZAA 2WZ7A 5KJ7A 2IFMA 3L36A 2E76D 3D6YA 2E42A 4KHXA 4PD4I 2KOPA 4BRYA 2XT1A 1PP9G 1EDKA 3GMAA 1NKZB 1CI6A 1SLQA 1J2JB 2XV5A 3G21A 4U7JA 3RK2D 2CQ8A 1H0TA 1PGOA 3S9OA 4PD4D 2Y9ZA 3BATA 3V5BA 3PH0A 5GTHH 3I5CA 3MTUE 2Y0EA 2FHSC 1JTHA 3G29A 3L70D 2K37A 4ASWA 5E79E 1BGYJ 1CW5A 2L4BA 5DJTB 4JBZA 3RL0C 1GTWA 3ZDMA 2JR8A 4DT0A 2WVRA 2K94A 1PGJA 1IK7A 4I6MC 3HD7B 5HV8A 2FY8A 3B4SA 4H13B 2AXTE 3NTNA 2XZ0D 1FOSF 2FQ0A 1UIXA 3HZQA 2K88A 3G1IA 1OWAA 1L0NG 1HGVA 4A7PA 4PH1A 2LXBA 2KSEA 1S9KD 2KGDA 3TGUJ 4H44C 1BDCA 5APSA 2E74C 2QJYB 2PEOA 3H25A 4CPGA 2N5HA 3D71A 3AE6C 4Y28J 2YNYA 1SQBD 3S4RA 1NAFA 1VQ9P 4U0DA 1QVFO 3CWBE 1P84H 3L71E 3PRJA 1M7LA 2JWDA 1LTTC 3HD7A 1X9VA 5APXA 1RF1C 2K2QA 1SQQE 1ZMEC 5KP7B 3FWLA 1PEUA 1IFIA 3HE4A 2Z4EA 3M0DA 1SQXG 3L4FA 3HUSB 3IF4A 1JM0A 1VKUA 1KORA 4RESB 1BAJA 1YJNP 1VF5B 1VQNP 1W5CE 1L0IA 2WSEJ 5BVZA 2KS1A 3L74G 3DS3A 2E75D 5DJUB 1LTBC 2HR3A 1R8EA 3C8VA 2I1KA 1U7JA 4DZOA 2Z5HA 2M8RA 2EG5A 3MD0A 4AUWA 3D6ZA 1RE3A 1ZRTE 4ZKUA 1JCDA 1BCCJ 1DD4A 3H1IE 5F2NA 4I1LA 2I8DA 2J5UA 2PFXA 3BRTB 1AQ5A 5K5GB 1LTIC 2FXMA 4OWFA 1GDTA 1GU5A 1HTLC 1EZVE 1IJDB 1RF0C 4U3FJ 2VLPA 2NO8A 4XFXA 1FR2A 2HPCA 2IX7C 3SFEC 2W83C 3CCMP 1JOCA 3H1HD 2AEMA 1WT6A 4U0FA 2W27A 1IMPA 1WMKA 4N3YB 2HODA 1PGQA 2LOLA 2BCCG 2YXRB 1NJIQ 2N9YB 4XFZA 3HD7D 1OVRA 1N2DC 1SQBK 2YIUB 3BCCE 2Q6QA 3GHGB 1Z56A 1VPCA 1JY3P 5H2FE 3HYBA 1GXHA 4Z1MH 5AVQB 2QEXP 4N6JA 2G8YA 2E76C 3CCUP 5AW4B 1HH0A 1KD1Q 1L2PA 1SQPG 5KLVD 2ITAA 4BPGA 2RH0A 3BRVB 1M57D 3MZWB 1KB9H 2K3RA 3L71D 1OX3A 3RK2C 1T8ZA 3SFDC 1QL1A 3L75G 3GHGA 1W2BO 2W90A 1L0HA 3MUDC 2JYGA 3L70J 3P32A 2KNCB 2I1JA 4GT1A 3H1JE 3A0HH 1KQFB 3CI9A 1P84I 2W8ZA 1NTZD 4JQ0D 2G3AA 2BEZF 3KZIE 2CWOA 2N98A 1NOHA 2KGEA 1JB0J 2LL8A 1KV4A 2BASA 3CE7A 3GKLC 3L72G 3WU2E 2YMYA 1IC2A 1P84D 1S4XA 2LKMA 2E74B 1H89A 1Q2NA 3G28A 1IFPA 2Q3IA 2FYUD 4D6TE 3VP9A 1XTGB 2FYZA 2KNCA 5DCKA 3H1ID 2QNWA 3GJNA 3V4QA 4L73A 1K73Q 1Y9BA 4WVZA 1SQBJ 4OGQC 3BVHA 4RKUJ 2EHTA 3B4QA 3A0BH 2FADA 4H0LD 3FXEA 3L73D 5KLIC 1SFCB 4XROA 4GOFA 3A3YB 2KSJA 3RK3E 2OYIC 2R32A 5KLVK 3RG6C 3WBHA 2Z44A 2H7HA 3V2PA 1NU1D 3KHUA 3LRYA 3NXSA 3LIEA 1BE3J 2Q1KA 2KZJA 1SS1A 2N1TB 3ITKA 4EYYQ 3H1LE 4AYCA 2MD9A 2JU2A 1GMJA 3AEEC 2C9NY 4EOTA 2XU6A 2IBZD 4W80A 3JCUE 2W6BA 1VQLP 1KFNA 5BS2A 5APYA 1SQVG 2K9JB 2E75C 5CCHC 3AE2C 2VRSA 2GZGA 1KFMA 2Q9IA 2GDYA 4H2WC 1SFCA 2AEJA 3KDPB 2E5TA 1OW7A 5AW6B 2GDXA 4HH2A 2OQQA 3H32B 2QJPC 2Q5UA 2XXMA 1URQB 5AW0B 1A02F 2R44A 1FE6A 2SPZA 2N1TA 2KLUA 1KYOH 4LC1A 3TYYA 5HGLA 2WSCH 1HY8A 2KZIA 2XV6A 1KB9I 3C9IA 4DOJA 3U1AA 2K92A 2XNXA 1YTZI 1PPJG 1AVYA 1N7LA 2XDJA 2R5BA 1IO4A 2JJLA 1OVVA 1YHQP 1KILB 3CX5D 1N7SD 3H32A 3CCLP 1HUCA 3G9RA 3M06A 1JO5A 1G1JA 3Q20A 1SVFA 4PD4E 1RE4C 1KB9D 2O01N 3Q1MA 3IAOA 1NVOA 1G1IA 1W2EA 3DTJA 2E43A 2A45I 1E0HA 2RN0A 2XZ1C 2NPSB 4B86A 2ZXXA 2C9LY 3V6IA 2AEFA 3PHLA 2MVVA 2N6YA 5APTA 3H47A 1NU1K 3L74E 1N8RQ 2N50A 2GZEA 1EDIA 1QRJA 4BPFA 5CHXA 1YI2P 2M8NA 1PP9D 3CWBJ 1K04A 3L71J 2N6ZA 1KILA 5F2KA 2KW2A 1E6JP 1BGYG 1OVUA 5KKZB 2WMMA 3AEDC 2GDWA 1GW3A 2M8PA 2W6AA 2ROQA 1PEOA 2DW3A 3EQ2A 1SQQJ 1FDOA 2NPSA 3WMM0 1GL2D 5AW8B 1S9KE 1OFCX 3EJEA 5CCGA 4W7YA 1LWUB 1M8OB 5AVYB 1FZCC 4N78E 4WYMA 2KIKA 1HJBA 1QGKB 2W6JH 1IFNA 2YO2A 1NTKE 2NZ2A 3DPHA 1F80D 4UB6E 4WY4C 3K5BA 1EC5A 3B5IA 2MF4A 1X3OA 2YO3A 2POHA 1K8AQ 5KTBA 2B87A 1UNKA 3V2RA 3PP5A 3H1IJ 4OGQB 2E1MA 1OZHA 1L0ND 1VQPP 3MHVA 5AVUB 4DCKA 3DS1A 1LWUA 2IPPA 3GW6A 5KLIB 1SQPE 2FQ2A 2ZT9D 1LT9C 4Y99C 4PV1B 4H0LC 4TLFA 2A45G 1VQKP 5AVRB 1G2CB 3G1GA 1IFJA 4IL6H 1PEQA 1KN7A 1HWTC 2FAEA 4RO0A 2ZFCA 1KYOI 3BCCJ 3OA7A 4UB8E 2NPSD 2RMZA 5AVVB 1Q82Q 2LIWA 2OTKE 1SQXD 3B5NC 4R0MA 3E1IA 5B5EH 3M9BA 3A7OA 4BXLA 4XRQA 5APUA 1YIJP 2FACA 2QJPB 4IFMA 1LT1A 3H1HE 3L74D 1IUQA 1JCCA 1G2CA 5AW7B 2AVAA 1L4AB 1PV3A 3L72E 3RG2A 1L0LG 1KTMA 1FOSE 2J59M 3VYIA 2MJZA 1AUMA 3V2QA 4U3FG 1JY3O 2JBGA 1VQ7P 3PLNA 3EJDA 7CEIA 1YQ3C 3RL0g 5GTHE 3H1JJ 1N86A 3B71A 2FQ1A 5KJ7D 5KLVE 2GZFA 4MN4C 5CZDB 2QSIA 2ZVNB 2MY5A 4HKGA 2WT7B 2B9BA 4N78D 1KLPA 1L0NK 3EFFK 1L4AA 2FYNB 1N7SC 4MRTC 2O01J 4BWNA 1NTKD 1T2KD 3AE5C 2FBWC 3QH9A 2HFED 2D2CB 2BCCD 4U0CA 3KPEA 2JP3A 1PEMA 3CCEP 2M0BA 4C7NB 3CC7P 4OH8B 3T97B 3ABVC 5L8RJ 4D6TJ 2PNGA 1NTZE 1EXIA 4UHPB 1ZR4A 5JPAA 1SQVE 1M6EX 1SQPD 2ERHA 3HTKB 2MR8A 2V7QJ 2VLQA 2A06G 1OR5A 1U7MA 1P84E 1NQ4A 5APQA 2UWJE 4O9BA 2FVAA 1LTGC 3GF7A 3B8EB 3RK3C 2NRGA 1GXGA 2VSQA 1LJ2A 2JKVA 3L75D 3LW5J 2FYUE 1K9MQ 3GG2A 4C7NA 1FZCB 1GL2C 2PY8A 1GK6A 3FWNA 3T97A 4ZNCA 3OW2O 2P10A 1YITP 2LF4A 2CNRA 3H1LJ 1JY2P 3EFGA 3HUSA 1BXIA 2OYHB 5CBOA 2BHVA 1YTZT 1LTJC 3TNUB 1DEEG 1PPJE 3HRNA 2AFDA 3V2NA 3HTKA 2K5XA 4U0EA 3L73E 1L4AD 2FFDB 4GDOA 3WUUA 5GTIH 4CA3A 3EJBA 2O1KA 2MVUA 3L72D 4KJMA 1OMIA 3VP8A 4H13D 3Q3DA 2KXPB 1NU1E 1USDA 1EXJA 3II6A 4RJTA 2JQ4A 1LT9B 1NTKK 4YPCA 2K9YA 2KG8A 1AVOA 2WQYC 2ONTA 2CGQA 2IBZE 4HYTB 2ZT9C 2OYHA 1N73C 2BUOA 3L35A 1DD3A 3TNUA 2WPVB 1ZN5A 3M91A 3BASA 5EW5E 5KAIE 1LTAC 2FFDA 1BE3G 1M1JC 1IK9A 3G71P 1PFIA 3CLQA 1M6NA 4NEOA 1SQPK 2LPKA 4DG9A 2QJKC 5BU5A 1FJKA 1PZQA 3B5NB 3CXCO 1A43A 3AEFC 2H43A 1E79H 4M0IA 1ZXGA 3RL0B 5AVZB 2XNDH 3Q5RA 2WSFJ 5TJHA 2A45H 2PRRA 1RH5B 1VF5D 3P8CD 3JC22 1MFZA 2KI7B 3E2DA 3L74J 1Q90D 2K1AA 1SQVD 1S5LH 1AFOA 3LMOA 2DGYA 3VN0A 2BEQD 3CX5E 1ZOYC 5BU8B 1OIPA 3CXHH 3N4XA 2N9BA 1KB9E 2WSEH 1K30A 1Y47A 4PWVB 3M9QA 2KYVA 4H44B 2PEMA 1EOQA 1DV5A 1JJ2O 2ZAEB 5AVTB 5KJ7C 3A5TA 3A0HE 1EZVI 2GUVA 1Y8AA 3I56P 1PP9E 4BPHA 2QA4P 2DNWA 1PPJD 1T2KC 1NTKJ 1RF1B 2ZYGA 3VMXA 1VQOP 2OGUA 1H88A 1BDDA 4I7ZC 3TDKA 4XA4A 3O6QB 3M9HA
chains in the Genus database with same CATH topology
3G6EP 2M8PA 3G71P 3G4SP 5F2NA 2P9XA 2OARA 1PEOA 1M6NA 3NTEA 1Q82Q 3CCVP 1M74A 1Q86Q 2CWOA 2Z46A 4COCA 1QVGO 4U0BA 4XRQA 2PEJA 4QNBA 3CXCO 1A8OA 2XXMA 1A43A 3HZQA 1YIJP 3I55P 1Q81Q 3G1IA 3P05A 4PH1A 1VQ8P 3CC2P 1IUQA 4M0IA 4XFXA 3CC4P 1K9MQ 3CD6P 4GR2A 4WYMA 2JYLA 2PY8A 2BQ1E 3CCMP 1RO0A 2PEOA 3DS2A 1VQ4P 5HGLA 4U0FA 2KODA 2Z45A 1AUMA 3DPHA 3G28A 2XV6A 3OW2O 3E2DA 3DS4A 3CCQP 2LF4A 2M8LA 1YITP 1NJIQ 1VQ9P 3B5IA 4XFZA 4U0DA 3DS5A 1QVFO 3CPWO 5DCKA 1K8AQ 2EFJA 2L6EA 2OTLP 2BHVA 1VQ7P 2DGYA 4GR6A 3H4EA 2JO0A 3CCRP 4PH0A 1K73Q 2XT1A 3HYBA 2OTJP 1D1DA 1YHQP 1RNIA 1K30A 2PENA 4U0EA 2QEXP 1M1KQ 1VQ5P 3CCLP 2E1MA 3CCUP 1KD1Q 3Q20A 2PEMA 3CCSP 1VQPP 2EIAA 1VQMP 3DS1A 3G21A 1PEUA 4XROA 3CMAP 1M90Q 3DTJA 1EOQA 3CMEP 1Q7YQ 1JJ2O 5HGNA 3DS0A 3M1MA 3MGEA 1KC8Q 1S72P 2PEKA 1KQSO 5BS1A 3RG6C 1YJ9P 3WBHA 2Z44A 1BAJA 3G29A 1YJNP 1VQNP 1VQKP 3G0VA 2ONTA 4U0CA 3H47A 5HGOA 3G1GA 3LRYA 4COPA 3I56P 1PEMA 1PEQA 3DS3A 3CCEP 1EIAA 2QA4P 1N8RQ 1ZMBA 2BUOA 1QRJA 5I4TG 1W2BO 1YI2P 1RO2A 3H0DA 3CC7P 2PEQA 1VQOP 3G26A 2JYGA 2PEIA 2M8NA 5F2OA 1VQLP 1VQ6P 5BS2A 4U0AA 2EG5A 3CCJP 1YJWP 5F2KA 1E6JP 5HGMA 3VRLC 5JPAA 4XFYA 1M6EX 4IPYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQN P;  1VQK P;  3G6E P;  1YHQ P;  3G71 P;  3G4S P;  2QEX P;  3CCM P;  1M1K Q;  1VQ5 P;  1VQ4 P;  3CCL P;  3CCU P;  3I56 P;  3CCE P;  1Q82 Q;  1KD1 Q;  2QA4 P;  1N8R Q;  2OTJ P;  3CCV P;  3CCS P;  3CCQ P;  3OW2 O;  1VQP P;  1YIT P;  1Q86 Q;  1W2B O;  1NJI Q;  1VQM P;  1YI2 P;  1QVG O;  1VQ9 P;  3CC7 P;  1VQO P;  3CPW O;  3CMA P;  1M90 Q;  3CXC O;  3CME P;  1QVF O;  1Q7Y Q;  1K8A Q;  1JJ2 O;  1YIJ P;  2OTL P;  3I55 P;  1Q81 Q;  1KC8 Q;  1VQ7 P;  1VQL P;  1VQ6 P;  1S72 P;  1VQ8 P;  1KQS O;  3CC2 P;  3CCJ P;  1YJ9 P;  1YJW P;  3CCR P;  1K73 Q;  3CC4 P;  1K9M Q;  3CD6 P;  1YJN P; 
#chains in the Genus database with same CATH topology
 1MUU A;  3U59 A;  3KXD A;  2L0Q A;  1J1D C;  1NTM G;  2O3J A;  3CWB G;  1Q86 Q;  1GPJ A;  1LTS C;  1FJP A;  2KGA A;  2ZYD A;  1SQP J;  2B88 A;  1HGZ A;  3G3Z A;  3RK3 B;  2KK7 A;  1RF1 A;  1SQQ G;  2KOR A;  3AEC C;  1L0L E;  2K0Y A;  3A0B E;  1NTZ K;  5KP6 B;  2B89 A;  2E5Y A;  2H88 C;  1KZU B;  3CPW O;  3O6Q A;  2EHS A;  1BGY D;  1SQV K;  2K0X A;  1GD2 E;  1MZ9 A;  1EDJ A;  4PH0 A;  1L0N E;  1XTC C;  1RHZ B;  3GF3 A;  3RL0 D;  1VQ5 P;  4GOE A;  1JUN A;  2KOQ A;  1VQM P;  1RY3 A;  5APV A;  2K9J A;  1Q7Y Q;  4HB1 A;  2FYU K;  2KOG A;  4PXH B;  1KC8 Q;  1FBM A;  3H1K G;  1ACP A;  2AF8 A;  3H1H J;  4PJ0 H;  1YJ9 P;  3AEB C;  1KIL E;  2K0D X;  1NO4 A;  3L72 J;  3HD7 C;  4H13 C;  1EIA A;  2KOO A;  2LKI A;  4HKZ H;  1ZMB A;  2E76 B;  1URQ A;  2E74 D;  1EZV G;  4IFF A;  1DX7 A;  1RF0 A;  3M0D C;  4L76 A;  2QJY C;  5KAF H;  1SQX E;  1OW6 A;  3L37 A;  3HE5 B;  3G6E P;  3VMA A;  1UII A;  1KYO E;  1AA0 A;  4M3L A;  5KLV J;  3RK2 B;  3CXH I;  2J58 A;  4ZKP A;  4NPF X;  4JF7 A;  3BCC G;  5EFW B;  5EJD A;  2PAJ A;  2KGC A;  3KYQ A;  1SFC D;  5B66 E;  2CK3 H;  1IZN B;  3CC4 P;  3AE1 C;  1RE3 C;  5TIS H;  1IMQ A;  2WPS A;  1JY3 N;  2M8L A;  3VMY A;  3C1L A;  2JAZ A;  3SWY A;  2N1T D;  4L74 A;  3HUS C;  1DEB A;  4EDF A;  4GR6 A;  1NTZ J;  3H4E A;  1VF5 C;  2L22 A;  3GZL A;  3CCR P;  1T3J A;  1FAV A;  3FXD A;  5AW9 B;  3AE7 C;  1SQV J;  2KOS A;  2PEN A;  2RKL A;  2LIU A;  4XFJ A;  2IZ1 A;  1JMB A;  1MZ8 A;  1YYC A;  1T3U A;  2V4H A;  3V4W A;  2ZXE B;  3MUD A;  3CME P;  2LR2 A;  3W68 A;  2BCC E;  1L0L D;  2YKP A;  1S72 P;  3NY7 B;  1H8A A;  3H1J G;  1PGP A;  3TGU G;  4JPZ B;  1URQ D;  1X8Y A;  1CZQ A;  2FYU J;  2FVF A;  3G0V A;  2IYP A;  4U3F D;  1OW8 A;  5APW A;  4BRY B;  4YXW H;  1JEK A;  1MFT A;  3P7K A;  5I4T G;  2WPQ A;  3JSV C;  1X79 B;  3GLM A;  2PEI A;  3IR9 A;  5CBN A;  2JEE A;  4W7Z A;  1S2E A;  1H0T B;  1NKN A;  4NPD A;  2OYI B;  4IZ6 A;  4QMA A;  1VHN A;  2L5G B;  3L73 J;  5E79 H;  4D6T G;  3AEA C;  2O1J A;  4YXD C;  2LML A;  1KIL D;  1J1D B;  3RBX A;  2YIU C;  2AXC A;  1QVG O;  3GHG C;  3L75 E;  2JU1 A;  2M5A B;  2YXQ B;  3IFM A;  1NU1 J;  2Y0C A;  3CC2 P;  4GR2 A;  2E75 B;  2JYL A;  1JY2 O;  3AE9 C;  5CCG D;  4C7R A;  2QRX A;  2AXT H;  1DH3 A;  3WUV A;  3E1R A;  1KMI Z;  1KYO D;  2C0X A;  2OYI A;  4NPE A;  1BCC G;  3CL3 D;  3H1L G;  2A06 D;  4DJG A;  2M5A A;  4IL6 E;  3PTZ A;  5AW2 B;  2WSS H;  3AE3 C;  3TSI A;  2WTY A;  2FVE A;  1HQB A;  1VL2 A;  5BS1 A;  5CCH A;  4LGD E;  2Q3E A;  1L0L K;  1EDL A;  3USS A;  1PL5 A;  1AF8 A;  2JWA A;  2QG4 A;  3U1C A;  1AV1 A;  2YKQ A;  3AEG C;  4H2X C;  3P8M C;  2KG6 A;  4WB4 A;  3H0D A;  5B5E E;  2FXO A;  3KQG A;  2PGD A;  4EI2 A;  3Q2Y A;  2VLO A;  3HE4 B;  1NWQ A;  1YJW P;  1FDM A;  1IFD A;  1LNQ A;  5M1B A;  3AE4 C;  1LGH B;  2Z5I A;  1AJY A;  1NTM E;  2KS1 B;  3MGN A;  3F89 A;  4OGQ D;  1DIP A;  1GW4 A;  3P8C E;  4ZMD A;  2FXP A;  2BQ1 E;  2ZJS E;  1RO0 A;  4IOI H;  2WT7 A;  4PV1 D;  1ZW0 A;  1NHL A;  3S1K A;  1RE4 A;  3SWF A;  1PP9 J;  1SFC C;  4XE5 B;  3L70 G;  3MIW A;  3QWO C;  1BE3 D;  1SQX K;  2K93 A;  2H8P D;  2GA1 A;  3W67 A;  1FZE A;  1X22 A;  4GOD A;  3FGA D;  3AE8 C;  3H6P A;  2P7J A;  2OTJ P;  1E5W A;  1D1D A;  4K3A A;  2N1T C;  2LXC B;  2HPC B;  5CCH D;  1FZG A;  2QM7 A;  1NYH A;  2EIA A;  2KUB A;  1RQU A;  1YQ4 C;  1M90 Q;  3VMZ A;  2HOD B;  5HGN A;  3DS0 A;  3M1M A;  3LID A;  4WY4 B;  1GU4 A;  1QL2 A;  5AVX B;  5H2F H;  3H1K E;  1ZR2 A;  2AFE A;  4F37 A;  2VLN A;  4COP A;  1QX8 A;  1L0L J;  2CPS A;  3EWK A;  1A02 J;  3VOP A;  1URQ C;  3D70 A;  2PEQ A;  1OXZ A;  3VTP C;  5KAI H;  2P2U A;  2GZI A;  1SQB G;  5HVC A;  3CCJ P;  1FZC A;  1HF9 A;  5HGM A;  4XFY A;  4Y99 B;  1L0N J;  4IPY A;  1HJ0 A;  1J1E C;  1NTK G;  1FC2 C;  4H0L B;  2OAR A;  2ZYA A;  4WY4 A;  2Z46 A;  4COC A;  2M3B A;  2OYO A;  1A8O A;  1R5S A;  3RBZ A;  1M56 D;  2KB7 P;  1KIL C;  1U57 A;  2QE7 H;  2KP8 A;  3TK1 A;  1BGY E;  3DS2 A;  1K05 A;  1T6A A;  2KOD A;  2D2C D;  4YTP C;  1FDI A;  5GTI E;  3KZI H;  3TF5 A;  3IN6 A;  2IDB A;  4IL6 X;  2L91 A;  2NPS C;  2O01 H;  3CX5 H;  1LT9 A;  2OTL P;  1GZL A;  5CCG C;  2ZVO B;  4R4L A;  1ZNV A;  1NTM D;  1MKM A;  3WU2 H;  1SQX J;  1VDF A;  3CWB D;  4WWI A;  1RNI A;  3NFQ A;  1PIX A;  2N5I A;  1M1K Q;  4AQR D;  1BSH A;  3CCS P;  2WSC J;  2JDI H;  2MKV A;  5C39 A;  3MGE A;  1CSB A;  1NH4 A;  5KKZ C;  2YKO A;  1SQQ D;  3Q5S A;  2H89 C;  3NMD A;  1EMV A;  3TGU E;  1FZF A;  2LTE A;  2KR5 A;  2R3S A;  2Y0D A;  2V7Q H;  3B5N A;  3H1H G;  3MP7 B;  2PP6 A;  3G26 A;  1LWU C;  1HVV A;  3M0A A;  2L9F A;  5F2O A;  4WY4 D;  3LW5 H;  1N7S B;  3VRL C;  2QM8 A;  5AW1 B;  4K35 A;  3G4S P;  3SWK A;  1QEX A;  1ZRT D;  3H1K D;  1M74 A;  1S5L E;  2CG5 B;  4QNB A;  4WBA A;  2KLV A;  1NAY A;  3JCU H;  1IFM A;  2BCC J;  3OJA B;  1VQ8 P;  2Y9Y A;  2C0W A;  3CXH E;  2GZJ A;  4I2L C;  5KLV G;  3CD6 P;  2M3E A;  1EZV D;  1USE A;  1VQ4 P;  2FKW B;  1FU1 A;  4KT0 J;  3U43 A;  3DS4 A;  3CCQ P;  3L71 G;  3R4Y A;  2IBZ I;  1N7S A;  2EFJ A;  3E7K A;  4R4M A;  4PV1 C;  2GYK A;  5KP8 B;  2JO0 A;  4JYC A;  1BCC E;  1NTM K;  3BCC D;  2QIW A;  1GL2 B;  1EQ7 A;  2HYN A;  1LP1 B;  3OAK A;  1NTZ G;  3L75 J;  2GUS A;  3A2A A;  4U3F E;  3B5N D;  2JB0 A;  1LTJ B;  1SQQ K;  2CPB A;  1CEI A;  5AW3 B;  5HGO A;  1JMM A;  3O8Z A;  1X0T A;  4C46 A;  4PD4 H;  1UJZ A;  1S3J A;  5AVW B;  5CJ0 A;  2JO1 A;  2HG5 D;  1VQ6 P;  1L4A C;  2FYU G;  3H1I G;  4HJG H;  1GL2 A;  2WSF H;  3WUT A;  4EIJ A;  1LP1 A;  3CX5 I;  1WRG A;  1J1E B;  3H1J D;  3TGU D;  2ZT9 B;  3FX0 A;  2IZ0 A;  4H44 D;  1N73 B;  1LTJ A;  1KQG B;  3I55 P;  1Q81 Q;  2JGP A;  3P05 A;  2XZR A;  1QLE D;  2YMK A;  5B66 H;  1JY2 N;  2P67 A;  1ZV8 A;  3N7N A;  3L73 G;  4L75 A;  1NGM B;  3R2P A;  3RGU A;  1DNY A;  1M1J B;  3PJS K;  4ASV A;  2Z45 A;  1R5L A;  1NU1 G;  2Q7C A;  2FYN C;  3DS5 A;  3L70 E;  2WWW A;  2QJK B;  2L6E A;  2QVA A;  2M5R A;  2HLO A;  2A06 E;  2D2C C;  4PJ0 E;  4D6T D;  5AVS B;  1AYI A;  2IBZ G;  1BSN A;  4JYB A;  1N73 A;  2KWL A;  1T8K A;  4UB6 H;  3CXH D;  1SP4 A;  1MV8 A;  1NTM J;  3Q5P A;  3GZM A;  3CMA P;  1JNM A;  2PEK A;  1ZP0 C;  1Z6M A;  1KQS O;  3HE5 A;  1M1J A;  4OVN F;  2IYO A;  5KAF E;  2B87 B;  2IFN A;  2P58 A;  5CMZ A;  2R5D A;  2R3C A;  2WPT A;  4LLH A;  3RK3 D;  4H2Y C;  2KG9 A;  4QKO A;  4GIF A;  2X2B A;  1BCC D;  1RO2 A;  1TU3 F;  2GM4 A;  1D7M A;  2XKM A;  1KQL A;  1S5L X;  4U0A A;  3SSU A;  2WIT A;  3H1L D;  5AW5 B;  1SQB E;  3UIA A;  4TT3 H;  1YBK A;  1RQV A;  5TIS E;  2P9X A;  4IFD K;  5CJ4 A;  3NTE A;  2MR7 A;  1FS0 E;  3CCV P;  1S1C X;  2OYH C;  1CI6 B;  4U0B A;  2PEJ A;  3F5H A;  1AQT A;  4UB8 H;  1ZLL A;  4I7Z B;  1HBW A;  3H1K J;  2FFD C;  2WPR A;  1BE3 E;  1JTH B;  2P1J A;  1GK4 A;  1FZB A;  4GKG A;  1FZA A;  2WZ7 A;  5KJ7 A;  2IFM A;  3L36 A;  2E76 D;  3D6Y A;  2E42 A;  4KHX A;  4PD4 I;  2KOP A;  4BRY A;  2XT1 A;  1PP9 G;  1EDK A;  3GMA A;  1NKZ B;  1CI6 A;  1SLQ A;  1J2J B;  2XV5 A;  3G21 A;  4U7J A;  3RK2 D;  2CQ8 A;  1H0T A;  1PGO A;  3S9O A;  4PD4 D;  2Y9Z A;  3BAT A;  3V5B A;  3PH0 A;  5GTH H;  3I5C A;  3MTU E;  2Y0E A;  2FHS C;  1JTH A;  3G29 A;  3L70 D;  2K37 A;  4ASW A;  5E79 E;  1BGY J;  1CW5 A;  2L4B A;  5DJT B;  4JBZ A;  3RL0 C;  1GTW A;  3ZDM A;  2JR8 A;  4DT0 A;  2WVR A;  2K94 A;  1PGJ A;  1IK7 A;  4I6M C;  3HD7 B;  5HV8 A;  2FY8 A;  3B4S A;  4H13 B;  2AXT E;  3NTN A;  2XZ0 D;  1FOS F;  2FQ0 A;  1UIX A;  3HZQ A;  2K88 A;  3G1I A;  1OWA A;  1L0N G;  1HGV A;  4A7P A;  4PH1 A;  2LXB A;  2KSE A;  1S9K D;  2KGD A;  3TGU J;  4H44 C;  1BDC A;  5APS A;  2E74 C;  2QJY B;  2PEO A;  3H25 A;  4CPG A;  2N5H A;  3D71 A;  3AE6 C;  4Y28 J;  2YNY A;  1SQB D;  3S4R A;  1NAF A;  1VQ9 P;  4U0D A;  1QVF O;  3CWB E;  1P84 H;  3L71 E;  3PRJ A;  1M7L A;  2JWD A;  1LTT C;  3HD7 A;  1X9V A;  5APX A;  1RF1 C;  2K2Q A;  1SQQ E;  1ZME C;  5KP7 B;  3FWL A;  1PEU A;  1IFI A;  3HE4 A;  2Z4E A;  3M0D A;  1SQX G;  3L4F A;  3HUS B;  3IF4 A;  1JM0 A;  1VKU A;  1KOR A;  4RES B;  1BAJ A;  1YJN P;  1VF5 B;  1VQN P;  1W5C E;  1L0I A;  2WSE J;  5BVZ A;  2KS1 A;  3L74 G;  3DS3 A;  2E75 D;  5DJU B;  1LTB C;  2HR3 A;  1R8E A;  3C8V A;  2I1K A;  1U7J A;  4DZO A;  2Z5H A;  2M8R A;  2EG5 A;  3MD0 A;  4AUW A;  3D6Z A;  1RE3 A;  1ZRT E;  4ZKU A;  1JCD A;  1BCC J;  1DD4 A;  3H1I E;  5F2N A;  4I1L A;  2I8D A;  2J5U A;  2PFX A;  3BRT B;  1AQ5 A;  5K5G B;  1LTI C;  2FXM A;  4OWF A;  1GDT A;  1GU5 A;  1HTL C;  1EZV E;  1IJD B;  1RF0 C;  4U3F J;  2VLP A;  2NO8 A;  4XFX A;  1FR2 A;  2HPC A;  2IX7 C;  3SFE C;  2W83 C;  3CCM P;  1JOC A;  3H1H D;  2AEM A;  1WT6 A;  4U0F A;  2W27 A;  1IMP A;  1WMK A;  4N3Y B;  2HOD A;  1PGQ A;  2LOL A;  2BCC G;  2YXR B;  1NJI Q;  2N9Y B;  4XFZ A;  3HD7 D;  1OVR A;  1N2D C;  1SQB K;  2YIU B;  3BCC E;  2Q6Q A;  3GHG B;  1Z56 A;  1VPC A;  1JY3 P;  5H2F E;  3HYB A;  1GXH A;  4Z1M H;  5AVQ B;  2QEX P;  4N6J A;  2G8Y A;  2E76 C;  3CCU P;  5AW4 B;  1HH0 A;  1KD1 Q;  1L2P A;  1SQP G;  5KLV D;  2ITA A;  4BPG A;  2RH0 A;  3BRV B;  1M57 D;  3MZW B;  1KB9 H;  2K3R A;  3L71 D;  1OX3 A;  3RK2 C;  1T8Z A;  3SFD C;  1QL1 A;  3L75 G;  3GHG A;  1W2B O;  2W90 A;  1L0H A;  3MUD C;  2JYG A;  3L70 J;  3P32 A;  2KNC B;  2I1J A;  4GT1 A;  3H1J E;  3A0H H;  1KQF B;  3CI9 A;  1P84 I;  2W8Z A;  1NTZ D;  4JQ0 D;  2G3A A;  2BEZ F;  3KZI E;  2CWO A;  2N98 A;  1NOH A;  2KGE A;  1JB0 J;  2LL8 A;  1KV4 A;  2BAS A;  3CE7 A;  3GKL C;  3L72 G;  3WU2 E;  2YMY A;  1IC2 A;  1P84 D;  1S4X A;  2LKM A;  2E74 B;  1H89 A;  1Q2N A;  3G28 A;  1IFP A;  2Q3I A;  2FYU D;  4D6T E;  3VP9 A;  1XTG B;  2FYZ A;  2KNC A;  5DCK A;  3H1I D;  2QNW A;  3GJN A;  3V4Q A;  4L73 A;  1K73 Q;  1Y9B A;  4WVZ A;  1SQB J;  4OGQ C;  3BVH A;  4RKU J;  2EHT A;  3B4Q A;  3A0B H;  2FAD A;  4H0L D;  3FXE A;  3L73 D;  5KLI C;  1SFC B;  4XRO A;  4GOF A;  3A3Y B;  2KSJ A;  3RK3 E;  2OYI C;  2R32 A;  5KLV K;  3RG6 C;  3WBH A;  2Z44 A;  2H7H A;  3V2P A;  1NU1 D;  3KHU A;  3LRY A;  3NXS A;  3LIE A;  1BE3 J;  2Q1K A;  2KZJ A;  1SS1 A;  2N1T B;  3ITK A;  4EYY Q;  3H1L E;  4AYC A;  2MD9 A;  2JU2 A;  1GMJ A;  3AEE C;  2C9N Y;  4EOT A;  2XU6 A;  2IBZ D;  4W80 A;  3JCU E;  2W6B A;  1VQL P;  1KFN A;  5BS2 A;  5APY A;  1SQV G;  2K9J B;  2E75 C;  5CCH C;  3AE2 C;  2VRS A;  2GZG A;  1KFM A;  2Q9I A;  2GDY A;  4H2W C;  1SFC A;  2AEJ A;  3KDP B;  2E5T A;  1OW7 A;  5AW6 B;  2GDX A;  4HH2 A;  2OQQ A;  3H32 B;  2QJP C;  2Q5U A;  2XXM A;  1URQ B;  5AW0 B;  1A02 F;  2R44 A;  1FE6 A;  2SPZ A;  2N1T A;  2KLU A;  1KYO H;  4LC1 A;  3TYY A;  5HGL A;  2WSC H;  1HY8 A;  2KZI A;  2XV6 A;  1KB9 I;  3C9I A;  4DOJ A;  3U1A A;  2K92 A;  2XNX A;  1YTZ I;  1PPJ G;  1AVY A;  1N7L A;  2XDJ A;  2R5B A;  1IO4 A;  2JJL A;  1OVV A;  1YHQ P;  1KIL B;  3CX5 D;  1N7S D;  3H32 A;  3CCL P;  1HUC A;  3G9R A;  3M06 A;  1JO5 A;  1G1J A;  3Q20 A;  1SVF A;  4PD4 E;  1RE4 C;  1KB9 D;  2O01 N;  3Q1M A;  3IAO A;  1NVO A;  1G1I A;  1W2E A;  3DTJ A;  2E43 A;  2A45 I;  1E0H A;  2RN0 A;  2XZ1 C;  2NPS B;  4B86 A;  2ZXX A;  2C9L Y;  3V6I A;  2AEF A;  3PHL A;  2MVV A;  2N6Y A;  5APT A;  3H47 A;  1NU1 K;  3L74 E;  1N8R Q;  2N50 A;  2GZE A;  1EDI A;  1QRJ A;  4BPF A;  5CHX A;  1YI2 P;  2M8N A;  1PP9 D;  3CWB J;  1K04 A;  3L71 J;  2N6Z A;  1KIL A;  5F2K A;  2KW2 A;  1E6J P;  1BGY G;  1OVU A;  5KKZ B;  2WMM A;  3AED C;  2GDW A;  1GW3 A;  2M8P A;  2W6A A;  2ROQ A;  1PEO A;  2DW3 A;  3EQ2 A;  1SQQ J;  1FDO A;  2NPS A;  3WMM 0;  1GL2 D;  5AW8 B;  1S9K E;  1OFC X;  3EJE A;  5CCG A;  4W7Y A;  1LWU B;  1M8O B;  5AVY B;  1FZC C;  4N78 E;  4WYM A;  2KIK A;  1HJB A;  1QGK B;  2W6J H;  1IFN A;  2YO2 A;  1NTK E;  2NZ2 A;  3DPH A;  1F80 D;  4UB6 E;  4WY4 C;  3K5B A;  1EC5 A;  3B5I A;  2MF4 A;  1X3O A;  2YO3 A;  2POH A;  1K8A Q;  5KTB A;  2B87 A;  1UNK A;  3V2R A;  3PP5 A;  3H1I J;  4OGQ B;  2E1M A;  1OZH A;  1L0N D;  1VQP P;  3MHV A;  5AVU B;  4DCK A;  3DS1 A;  1LWU A;  2IPP A;  3GW6 A;  5KLI B;  1SQP E;  2FQ2 A;  2ZT9 D;  1LT9 C;  4Y99 C;  4PV1 B;  4H0L C;  4TLF A;  2A45 G;  1VQK P;  5AVR B;  1G2C B;  3G1G A;  1IFJ A;  4IL6 H;  1PEQ A;  1KN7 A;  1HWT C;  2FAE A;  4RO0 A;  2ZFC A;  1KYO I;  3BCC J;  3OA7 A;  4UB8 E;  2NPS D;  2RMZ A;  5AVV B;  1Q82 Q;  2LIW A;  2OTK E;  1SQX D;  3B5N C;  4R0M A;  3E1I A;  5B5E H;  3M9B A;  3A7O A;  4BXL A;  4XRQ A;  5APU A;  1YIJ P;  2FAC A;  2QJP B;  4IFM A;  1LT1 A;  3H1H E;  3L74 D;  1IUQ A;  1JCC A;  1G2C A;  5AW7 B;  2AVA A;  1L4A B;  1PV3 A;  3L72 E;  3RG2 A;  1L0L G;  1KTM A;  1FOS E;  2J59 M;  3VYI A;  2MJZ A;  1AUM A;  3V2Q A;  4U3F G;  1JY3 O;  2JBG A;  1VQ7 P;  3PLN A;  3EJD A;  7CEI A;  1YQ3 C;  3RL0 g;  5GTH E;  3H1J J;  1N86 A;  3B71 A;  2FQ1 A;  5KJ7 D;  5KLV E;  2GZF A;  4MN4 C;  5CZD B;  2QSI A;  2ZVN B;  2MY5 A;  4HKG A;  2WT7 B;  2B9B A;  4N78 D;  1KLP A;  1L0N K;  3EFF K;  1L4A A;  2FYN B;  1N7S C;  4MRT C;  2O01 J;  4BWN A;  1NTK D;  1T2K D;  3AE5 C;  2FBW C;  3QH9 A;  2HFE D;  2D2C B;  2BCC D;  4U0C A;  3KPE A;  2JP3 A;  1PEM A;  3CCE P;  2M0B A;  4C7N B;  3CC7 P;  4OH8 B;  3T97 B;  3ABV C;  5L8R J;  4D6T J;  2PNG A;  1NTZ E;  1EXI A;  4UHP B;  1ZR4 A;  5JPA A;  1SQV E;  1M6E X;  1SQP D;  2ERH A;  3HTK B;  2MR8 A;  2V7Q J;  2VLQ A;  2A06 G;  1OR5 A;  1U7M A;  1P84 E;  1NQ4 A;  5APQ A;  2UWJ E;  4O9B A;  2FVA A;  1LTG C;  3GF7 A;  3B8E B;  3RK3 C;  2NRG A;  1GXG A;  2VSQ A;  1LJ2 A;  2JKV A;  3L75 D;  3LW5 J;  2FYU E;  1K9M Q;  3GG2 A;  4C7N A;  1FZC B;  1GL2 C;  2PY8 A;  1GK6 A;  3FWN A;  3T97 A;  4ZNC A;  3OW2 O;  2P10 A;  1YIT P;  2LF4 A;  2CNR A;  3H1L J;  1JY2 P;  3EFG A;  3HUS A;  1BXI A;  2OYH B;  5CBO A;  2BHV A;  1YTZ T;  1LTJ C;  3TNU B;  1DEE G;  1PPJ E;  3HRN A;  2AFD A;  3V2N A;  3HTK A;  2K5X A;  4U0E A;  3L73 E;  1L4A D;  2FFD B;  4GDO A;  3WUU A;  5GTI H;  4CA3 A;  3EJB A;  2O1K A;  2MVU A;  3L72 D;  4KJM A;  1OMI A;  3VP8 A;  4H13 D;  3Q3D A;  2KXP B;  1NU1 E;  1USD A;  1EXJ A;  3II6 A;  4RJT A;  2JQ4 A;  1LT9 B;  1NTK K;  4YPC A;  2K9Y A;  2KG8 A;  1AVO A;  2WQY C;  2ONT A;  2CGQ A;  2IBZ E;  4HYT B;  2ZT9 C;  2OYH A;  1N73 C;  2BUO A;  3L35 A;  1DD3 A;  3TNU A;  2WPV B;  1ZN5 A;  3M91 A;  3BAS A;  5EW5 E;  5KAI E;  1LTA C;  2FFD A;  1BE3 G;  1M1J C;  1IK9 A;  3G71 P;  1PFI A;  3CLQ A;  1M6N A;  4NEO A;  1SQP K;  2LPK A;  4DG9 A;  2QJK C;  5BU5 A;  1FJK A;  1PZQ A;  3B5N B;  3CXC O;  1A43 A;  3AEF C;  2H43 A;  1E79 H;  4M0I A;  1ZXG A;  3RL0 B;  5AVZ B;  2XND H;  3Q5R A;  2WSF J;  5TJH A;  2A45 H;  2PRR A;  1RH5 B;  1VF5 D;  3P8C D;  3JC2 2;  1MFZ A;  2KI7 B;  3E2D A;  3L74 J;  1Q90 D;  2K1A A;  1SQV D;  1S5L H;  1AFO A;  3LMO A;  2DGY A;  3VN0 A;  2BEQ D;  3CX5 E;  1ZOY C;  5BU8 B;  1OIP A;  3CXH H;  3N4X A;  2N9B A;  1KB9 E;  2WSE H;  1K30 A;  1Y47 A;  4PWV B;  3M9Q A;  2KYV A;  4H44 B;  2PEM A;  1EOQ A;  1DV5 A;  1JJ2 O;  2ZAE B;  5AVT B;  5KJ7 C;  3A5T A;  3A0H E;  1EZV I;  2GUV A;  1Y8A A;  3I56 P;  1PP9 E;  4BPH A;  2QA4 P;  2DNW A;  1PPJ D;  1T2K C;  1NTK J;  1RF1 B;  2ZYG A;  3VMX A;  1VQO P;  2OGU A;  1H88 A;  1BDD A;  4I7Z C;  3TDK A;  4XA4 A;  3O6Q B;  3M9H A; 
#chains in the Genus database with same CATH homology
 3G6E P;  2M8P A;  3G71 P;  3G4S P;  5F2N A;  2P9X A;  2OAR A;  1PEO A;  1M6N A;  3NTE A;  1Q82 Q;  3CCV P;  1M74 A;  1Q86 Q;  2CWO A;  2Z46 A;  4COC A;  1QVG O;  4U0B A;  4XRQ A;  2PEJ A;  4QNB A;  3CXC O;  1A8O A;  2XXM A;  1A43 A;  3HZQ A;  1YIJ P;  3I55 P;  1Q81 Q;  3G1I A;  3P05 A;  4PH1 A;  1VQ8 P;  3CC2 P;  1IUQ A;  4M0I A;  4XFX A;  3CC4 P;  1K9M Q;  3CD6 P;  4GR2 A;  4WYM A;  2JYL A;  2PY8 A;  2BQ1 E;  3CCM P;  1RO0 A;  2PEO A;  3DS2 A;  1VQ4 P;  5HGL A;  4U0F A;  2KOD A;  2Z45 A;  1AUM A;  3DPH A;  3G28 A;  2XV6 A;  3OW2 O;  3E2D A;  3DS4 A;  3CCQ P;  2LF4 A;  2M8L A;  1YIT P;  1NJI Q;  1VQ9 P;  3B5I A;  4XFZ A;  4U0D A;  3DS5 A;  1QVF O;  3CPW O;  5DCK A;  1K8A Q;  2EFJ A;  2L6E A;  2OTL P;  2BHV A;  1VQ7 P;  2DGY A;  4GR6 A;  3H4E A;  2JO0 A;  3CCR P;  4PH0 A;  1K73 Q;  2XT1 A;  3HYB A;  2OTJ P;  1D1D A;  1YHQ P;  1RNI A;  1K30 A;  2PEN A;  4U0E A;  2QEX P;  1M1K Q;  1VQ5 P;  3CCL P;  2E1M A;  3CCU P;  1KD1 Q;  3Q20 A;  2PEM A;  3CCS P;  1VQP P;  2EIA A;  1VQM P;  3DS1 A;  3G21 A;  1PEU A;  4XRO A;  3CMA P;  1M90 Q;  3DTJ A;  1EOQ A;  3CME P;  1Q7Y Q;  1JJ2 O;  5HGN A;  3DS0 A;  3M1M A;  3MGE A;  1KC8 Q;  1S72 P;  2PEK A;  1KQS O;  5BS1 A;  3RG6 C;  1YJ9 P;  3WBH A;  2Z44 A;  1BAJ A;  3G29 A;  1YJN P;  1VQN P;  1VQK P;  3G0V A;  2ONT A;  4U0C A;  3H47 A;  5HGO A;  3G1G A;  3LRY A;  4COP A;  3I56 P;  1PEM A;  1PEQ A;  3DS3 A;  3CCE P;  1EIA A;  2QA4 P;  1N8R Q;  1ZMB A;  2BUO A;  1QRJ A;  5I4T G;  1W2B O;  1YI2 P;  1RO2 A;  3H0D A;  3CC7 P;  2PEQ A;  1VQO P;  3G26 A;  2JYG A;  2PEI A;  2M8N A;  5F2O A;  1VQL P;  1VQ6 P;  5BS2 A;  4U0A A;  2EG5 A;  3CCJ P;  1YJW P;  5F2K A;  1E6J P;  5HGM A;  3VRL C;  5JPA A;  4XFY A;  1M6E X;  4IPY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...