2OTLP

Girodazole bound to the large subunit of haloarcula marismortui
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structures of Antibiotics Bound to the E Site Region of the 50 S Ribosomal Subunit of Haloarcula marismortui: 13-Deoxytedanolide and Girodazole.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S ribosomal RNA
total genus 48
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2007-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 2otlP03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 2otlP01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 2otlP02
1YIJP 3G71P 1VQOP 3CCUP 3CCEP 1K9MQ 1M90Q 1JJ2O 3CCVP 3CCLP 3CPWO 3OW2O 2QEXP 1K73Q 1VQPP 1M1KQ 3G6EP 1S72P 1Q81Q 1YI2P 1VQ9P 1VQLP 1VQ6P 1YHQP 1VQMP 1VQ7P 1QVFO 1YJNP 2QA4P 2OTLP 3CMEP 1VQ5P 1N8RQ 3CCMP 3CCRP 3CC4P 1YJ9P 3CC2P 3G4SP 1QVGO 1NJIQ 3CCQP 1VQ8P 3CCJP 1Q7YQ 1Q82Q 3CC7P 1VQKP 3CCSP 3CXCO 1YITP 1Q86Q 1VQNP 1K8AQ 1KD1Q 1KQSO 1VQ4P 3CMAP 1YJWP 3CD6P 3I56P 3I55P 2OTJP 1W2BO 1KC8Q
chains in the Genus database with same CATH superfamily
3P05A 2K9JA 4WY4C 2GM4A 2W83C 3TGUG 1SVFA 5HGMA 2M5AA 1EIAA 1USEA 1PP9G 2ZVNB 1N8RQ 1PZQA 1N73B 2OYHA 1GMJA 1FBMA 1KORA 1NTKK 1HH0A 2PFXA 2K93A 1VDFA 1ZXGA 3D6YA 2PEIA 3PP5A 2GDYA 3NTEA 1YTZT 2FQ2A 3MTUE 3B5ND 3H47A 1ZN5A 2C9NY 3IR9A 5AW3B 4AUWA 3RK3C 4OH8B 2RH0A 3G1IA 1SP4A 3FXEA 2GDXA 3OW2O 2LXBA 2FBWC 2L91A 1FC2C 3IN6A 3P8CD 2Q1KA 2WPTA 1AUMA 2JDIH 4WYMA 1SQXD 3KZIE 3L73G 1FAVA 2XU6A 5BU5A 4COPA 3SWYA 1QEXA 3M9QA 2W6AA 3EJDA 2FXMA 2VLOA 1NJIQ 2E5TA 3PLNA 1PEOA 2MD9A 1KD1Q 2KK7A 1NTKD 3G21A 2KG8A 3MHVA 1Z6MA 3BCCG 1JJ2O 1JY3O 2BEZF 3RK3B 4C46A 4BPHA 1KTMA 3NMDA 2QJYC 5AVSB 3HD7A 3DS0A 2P7JA 1RO0A 5KLVK 1M6NA 3KPEA 3CCRP 1HF9A 3FXDA 3TK1A 1PP9D 2R3SA 3DPHA 1Q82Q 2FADA 1J2JB 4KT0J 1X22A 3KDPB 2FACA 3DS4A 3G28A 4PD4H 3RBZA 1KV4A 5KKZB 1T8KA 3H1LE 2MJZA 1QVFO 3L72G 1ZR4A 5I4TG 3GKLC 3WMM0 1L0LE 4N78D 4OVNF 1EDIA 5AW4B 2FVEA 1OW7A 1BSHA 3L71J 2AEFA 3R2PA 1PEQA 2XZ1C 3U1CA 2KG6A 2AF8A 3DS3A 3AECC 2N5HA 4U3FE 4YTPC 1VF5D 1BDDA 1M1JB 3M9BA 2P10A 1SQVD 4XE5B 4R0MA 3AEFC 1KILB 3H1JD 2P1JA 4H2WC 4U0EA 1WRGA 2X2BA 2K92A 2Q7CA 3AE3C 1GW3A 3G26A 1YTZI 3RK3D 1SFCA 4RJTA 2VSQA 5AVUB 2Z5HA 2YIUB 1JTHA 1RE4A 1QX8A 3VMYA 2AXTE 2JYLA 3WUVA 2QRXA 1H88A 4JF7A 1RE4C 2FYNC 1EC5A 5KAIH 2WPSA 1LJ2A 3VOPA 3DS2A 1NYHA 3T97A 3AEBC 2RKLA 3HRNA 2AXCA 1WMKA 3MUDC 3M0AA 1ZW0A 3HUSC 5EFWB 3L71D 4KJMA 4WY4A 1HQBA 2WSEH 3G1GA 4U0DA 4H2YC 2ZT9B 1AVOA 3HUSA 5CCGA 2MKVA 4GIFA 4IOIH 1RE3A 2FVAA 1NWQA 1AVYA 1LT9B 1MV8A 1LTJA 3LIEA 1CZQA 3FX0A 1BGYG 2O1JA 3CXHD 1YI2P 1HVVA 1SQPD 2N1TB 2BCCJ 1E6JP 2BCCD 4XFXA 4IFMA 1R5SA 2M8LA 4UHPB 4BRYA 2KOPA 3KXDA 1X0TA 2KP8A 3L4FA 1L0NG 1NTZD 1DH3A 1PFIA 1ZLLA 2P9XA 2FVFA 3A5TA 1DEEG 1PPJG 1IC2A 2GZJA 1LNQA 2ZYDA 1N7SD 4LC1A 2Z5IA 1NHLA 3H6PA 5AVXB 1X79B 4XFYA 5KLVE 2DGYA 1NTMG 5DJUB 3TF5A 1VQMP 4U3FD 3FWLA 2LTEA 1Q90D 3CC2P 3AEDC 3E7KA 1KQGB 3SWKA 1FZEA 2M8PA 4QNBA 2WWWA 1IMQA 2N9BA 4HKZH 2ZT9D 1EQ7A 1JCDA 2SPZA 5EW5E 5CZDB 5BS1A 3CWBG 4HH2A 4C7RA 2FAEA 2FYUG 2KORA 3H1HD 3AE2C 1SQXG 3L73D 1CSBA 4TLFA 3L71G 1OR5A 3GF3A 4EOTA 3V2NA 3H1IE 3GLMA 1SS1A 3NY7B 5AVVB 5CBOA 2LPKA 2FHSC 3EFFK 5APYA 2YKPA 2I8DA 3EJBA 4ZMDA 1FR2A 4XRQA 5AW9B 1AJYA 2IYOA 1SQBG 4GT1A 1Q2NA 1URQC 1VPCA 5DCKA 4RESB 5HGLA 4UB8H 3CX5E 2LOLA 3O8ZA 1K9MQ 2B87A 3H32A 3C8VA 1DV5A 1PGQA 1NU1D 4IL6E 5CBNA 1VQNP 1Q86Q 3H1JG 3ITKA 4H44D 5KLVJ 1OXZA 2E74D 2KXPB 1KILE 4UB6E 4H0LC 3RG6C 2N6YA 2K3RA 2VLNA 1IZNB 3D71A 4D6TD 1KB9I 1AFOA 3CE7A 2E74C 3V4QA 3KHUA 2QJPC 1HJBA 1KQLA 3WU2E 1SFCC 1ZOYC 3I5CA 4GOFA 2AFDA 5KP7B 2D2CB 2KNCB 2N9YB 2C0XA 4KHXA 3AE1C 4H0LB 2GDWA 1ZNVA 2WT7B 1A02J 2PP6A 1FZCB 3F89A 4OGQB 3Q20A 2PEJA 1OFCX 4H13D 1BXIA 1EZVD 1VL2A 2QJPB 2CPSA 5F2OA 1UJZA 2M8NA 1L0LJ 3EWKA 1FDIA 3G71P 2RN0A 4DOJA 2A06D 2GA1A 3V2QA 5M1BA 1LTSC 3NTNA 4PJ0H 3CWBD 1JM0A 4CPGA 2LMLA 2CWOA 4H44B 1A43A 1CI6B 1ZRTD 1A02F 2A06E 1VQ9P 1H89A 1U7JA 2WQYC 1J1EB 1YJNP 1LTJC 2VLPA 3CXHH 2N1TD 2CQ8A 2K88A 1IFMA 3FWNA 3M0DC 2KZIA 2W6JH 2JYGA 2JWAA 2B9BA 3L75G 3SFDC 2KW2A 1URQD 5B66H 1GD2E 1EDKA 2ITAA 4GOEA 2H43A 1EDLA 2R32A 1PPJD 2P58A 1JY2N 1M8OB 2MR7A 1LGHB 1LP1B 3GHGC 2E43A 1KYOE 2Z46A 3MIWA 2FYUJ 3TDKA 3DS1A 3SWFA 2KYVA 3E1RA 4PV1C 3DTJA 2W8ZA 3G3ZA 1RF1C 5TJHA 3PHLA 1PPJE 3CC4P 2JEEA 5E79H 5KLVG 2WITA 2N5IA 2KOQA 2XKMA 4NPDA 4D6TG 3OJAB 3CMAP 1PGPA 1DD4A 5HV8A 2FXPA 2KLVA 2W27A 2Y0DA 1SQBJ 2LR2A 2ZVOB 2W6BA 3W68A 3BATA 5AVWB 4PH0A 1NTMD 1IMPA 4UB6H 5KKZC 1T2KD 3KZIH 3U59A 4C7NA 3M1MA 1PP9E 4CA3A 1BGYE 2OGUA 1VQOP 1L0HA 3S1KA 2YO3A 3CX5I 2JWDA 3H1HJ 3CPWO 1M1KQ 3TGUE 1M74A 1YHQP 2Q3IA 1SQBD 2OYHC 1S3JA 1BE3J 2QM7A 2FFDB 3RGUA 2WSCH 4OGQC 1SQXJ 1G2CA 5AW2B 2Q5UA 4YXDC 3TNUB 3CCLP 1SFCD 1Q81Q 1VKUA 5B66E 2HR3A 3MGEA 2JKVA 4PD4D 5APXA 3CCQP 1LT9A 2JP3A 3GZMA 2K2QA 1VF5C 4K3AA 3WUTA 1GL2A 3D6ZA 1NTZE 2R5BA 1E5WA 1NU1K 1L0NK 1LTIC 4IL6H 3A0BH 5TISH 3IFMA 1H8AA 1S2EA 1NO4A 4IL6X 1DX7A 3TSIA 1BE3E 4XFZA 3T97B 1OVUA 3K5BA 3CX5D 3H1IJ 2FFDC 1FZBA 1QL1A 2BASA 4JYBA 2O01N 4WY4B 4H13B 2GYKA 4GKGA 2B87B 5CCGD 4L74A 1T8ZA 2K1AA 1N73C 2PNGA 4U3FJ 2AEJA 4Y28J 1F80D 1SFCB 1Y8AA 1IO4A 1U7MA 1NKNA 4PXHB 1OVRA 3LW5J 4NEOA 2EG5A 2I1KA 3L72E 2QE7H 3WBHA 2QNWA 4TT3H 1FZAA 1AA0A 5KAFE 4IFDK 3R4YA 1M90Q 3E1IA 4W7ZA 1DNYA 3VYIA 2L6EA 2HYNA 3L74E 3WU2H 4XROA 3RBXA 1M1JA 1Z56A 2NPSD 2IFNA 3BRTB 2JU1A 5CCHC 2KGDA 3H1LD 1PV3A 3V6IA 5KP6B 2XV5A 3HE5B 3CLQA 1ZMBA 3VRLC 3USSA 4JBZA 3L70D 3F5HA 2GZEA 3CCUP 2ONTA 2WSCJ 1M56D 3H1HE 3TGUJ 2Y9YA 2C0WA 3BASA 5KTBA 4D6TJ 1YQ3C 2AFEA 3L35A 1BE3D 1RF0A 1JY3P 3CX5H 2KUBA 1NAYA 4D6TE 3RL0D 4OWFA 3L71E 1NU1J 2LF4A 1ZRTE 3B71A 2KOOA 4MRTC 1SQPG 3NXSA 3RK3E 1OIPA 1R8EA 2DW3A 2IX7C 1GDTA 1NH4A 1OW8A 1PGOA 3QWOC 1X3OA 1NTZK 1BCCD 4R4MA 1EXIA 3A0HE 4N3YB 1SQQD 1RHZB 2E75C 1EXJA 5E79E 1VQ6P 1SQVG 2KGCA 5AVTB 4NPFX 2W90A 2L9FA 3Q3DA 1LWUA 1L0LK 2N1TA 2KR5A 4XA4A 3MUDA 2WT7A 2BQ1E 1ZV8A 1FJPA 2NO8A 1MZ9A 3H25A 2KOSA 5AVRB 2HG5D 5KJ7A 2PENA 4H0LD 4HJGH 5HVCA 2YO2A 3CCMP 1MKMA 3SFEC 3U43A 3C1LA 2XDJA 3H1LG 2PEKA 1LTAC 1RH5B 1UIIA 4I6MC 1IUQA 4WBAA 2FFDA 5L8RJ 3PH0A 3I56P 2M0BA 1FJKA 3L36A 4JPZB 3H1KE 1NTKG 4BXLA 2QIWA 1ZMEC 1GW4A 1JY3N 1KN7A 5APSA 2FQ0A 1VQ5P 3BVHA 2E75B 1HWTC 4O9BA 4YXWH 1GXHA 3AE5C 3H1IG 4Y99C 5CHXA 1RNIA 1X9VA 1J1DC 4BRYB 4IPYA 3N4XA 3L70J 3S9OA 2Y9ZA 3CCEP 4U7JA 2XV6A 1GTWA 2LXCB 1GZLA 2QG4A 1KB9H 4OGQD 4F37A 2OTLP 3ZDMA 1JOCA 3P8MC 1CEIA 5KAFH 3BRVB 1R5LA 1UNKA 1KFNA 1MFZA 1QGKB 3M9HA 5AW8B 4ZKUA 1HUCA 2Y0CA 4EYYQ 5C39A 1OVVA 1GXGA 4RKUJ 2XT1A 1N7SC 2QJKC 1KMIZ 3HTKA 5HGNA 3RG2A 4AQRD 3AE8C 3AEEC 1W5CE 2EFJA 2DNWA 1LTGC 5CJ0A 2M3EA 5EJDA 3GZLA 1KILC 4HYTB 2KNCA 1SQPJ 1S1CX 1KZUB 4YPCA 4GR2A 4R4LA 3AEAC 1IFPA 3L74J 3OA7A 5H2FH 1H0TA 3CC7P 1KYOD 1IFIA 3RL0g 1P84I 1VQ4P 3D70A 2J5UA 1J1EC 1LTJB 1SQBE 3VP9A 1JMMA 4H44C 5TISE 5AW0B 1URQA 2NPSB 3LW5H 3FGAD 5AVQB 2IYPA 1K8AQ 1EZVG 2NZ2A 3DS5A 3Q5RA 1LTTC 1N86A 3GHGB 2YKOA 3P32A 1ZR2A 2OYIB 5GTHH 3GW6A 3W67A 3CI9A 2V7QJ 1FOSF 2A06G 5AW7B 3H1LJ 1K04A 1NVOA 1L4AA 2G3AA 2QVAA 2CG5B 2XNDH 4HB1A 1SQXE 3UIAA 1RF1B 2FYUE 1W2EA 3M06A 3E2DA 5KJ7C 4L76A 2ERHA 1L4AC 2QEXP 2A45G 3TGUD 3O6QA 1BGYJ 3H1ID 3U1AA 1DD3A 1J1DB 3HE4A 1P84D 1JTHB 1KB9E 3V4WA 3B4QA 2HPCB 3LRYA 2C9LY 4U0BA 2JB0A 1K30A 3V5BA 4LLHA 4DCKA 2NPSA 3G0VA 5KLVD 5KLIB 2WSFJ 2FKWB 2HODA 2ZYAA 2HPCA 3V2PA 5AW6B 3KYQA 1Q7YQ 4ASVA 2M5RA 2MF4A 2FYZA 1NTKJ 2Z45A 4W80A 4GR6A 3JC22 3TNUA 3KQGA 2KSEA 1G2CB 2E76C 2WVRA 1GPJA 2KGEA 3G29A 2Y0EA 3H1KJ 4DT0A 1KILD 3OAKA 4U0CA 2ZXXA 4WVZA 1SQXK 2PEOA 2E76D 2M5AB 2O3JA 3BCCJ 5B5EH 2L5GB 2IBZG 1BCCE 1SQQJ 1AQ5A 2E1MA 4U0FA 1NTMK 2ZFCA 2CK3H 3BCCE 2HFED 3CWBJ 1SQVE 1N7LA 2ROQA 2OYOA 5AVYB 1LP1A 1AYIA 3L73J 1N73A 1KQFB 3B5NB 2PRRA 4C7NB 5BU8B 2WPVB 1SQBK 1KC8Q 2K0DX 5F2KA 2QJYB 5APTA 2JO0A 3HD7C 3BCCD 1OX3A 3G6EP 2PAJA 2V4HA 4PD4I 3IF4A 1A8OA 1VQ8P 4BWNA 1YITP 2JU2A 3EFGA 3CD6P 2WSSH 2K0YA 3B5NC 4AYCA 4H13C 5CJ4A 2EIAA 3H1KD 1T2KC 3EQ2A 3Q1MA 1L2PA 3M91A 3O6QB 2GZIA 1HBWA 2GUVA 4JYCA 3TYYA 3G4SP 3HTKB 2KODA 5K5GB 1FZFA 4DZOA 2FYUK 3NFQA 5CCHA 2N6ZA 4QMAA 1T3JA 1ZP0C 1K73Q 2QJKB 2BCCG 2IFMA 2EHTA 2YMYA 5F2NA 2I1JA 2V7QH 4GODA 1E0HA 4IFFA 5KP8B 3HD7D 1NQ4A 2BUOA 1EZVE 3C9IA 4L75A 4W7YA 1JY2O 1MZ8A 1SQQK 1NKZB 4QKOA 1IJDB 2K94A 1OWAA 2IZ0A 3CXHE 3VMXA 1RF0C 2Z44A 2WMMA 2LKIA 5BS2A 4DJGA 2KIKA 1NU1E 2WTYA 5AVZB 2CGQA 5HGOA 3RK2B 3S4RA 2P2UA 5CMZA 1GL2B 3A0HH 2K0XA 1HJ0A 2R44A 2Q9IA 5CCHD 4Y99B 1NTMJ 2NRGA 3H0DA 1MUUA 2IPPA 4MN4C 2O01H 1BSNA 2IBZI 1ACPA 3CXHI 1KLPA 2QA4P 2B89A 3VMAA 1VF5B 2IBZD 1PL5A 1FOSE 2MVUA 1FZCA 1EMVA 2JBGA 4B86A 2FYUD 3RK2C 1BDCA 5GTIH 1BCCJ 2H88C 1P84H 2KLUA 2N50A 1PEUA 3B4SA 2LIWA 2KSJA 2Z4EA 2H7HA 2JQ4A 4WWIA 5CCGC 1YJ9P 1TU3F 3B8EB 3CCJP 1DIPA 1Y47A 3CXCO 2VRSA 3HD7B 2CNRA 2CPBA 3L74D 3L75J 4HKGA 2K9JB 4ZNCA 1SLQA 2K37A 3IAOA 2JGPA 1JEKA 1H0TB 1XTGB 2GZFA 3H4EA 5KJ7D 4LGDE 5APUA 1S4XA 1SQQG 2JO1A 1BE3G 1HGVA 2JR8A 5H2FE 1S5LH 3H1JE 2OYHB 3AE4C 3H32B 3GF7A 3WUUA 1UIXA 1PIXA 2KZJA 2HLOA 2XNXA 2J58A 3MGNA 1AV1A 1JB0J 1S5LX 3PTZA 1L0ND 1NTZG 4JQ0D 3JSVC 2FYNB 1JUNA 3EJEA 3GJNA 5GTIE 1LTBC 1HTLC 1P84E 2LIUA 3I55P 1FE6A 2E76B 3GMAA 2YKQA 2KG9A 2E74B 3LMOA 1SQPE 1RY3A 2AVAA 3M0DA 4Z1MH 3RL0C 3Q5SA 3CMEP 2IBZE 1OMIA 4U3FG 2M8RA 2D2CC 2P67A 7CEIA 3CL3D 1G1JA 1SQQE 1FZGA 1BAJA 3L70E 3HYBA 1GK6A 1LWUB 1NOHA 1OW6A 3LIDA 2K9YA 2D2CD 3VTPC 1D1DA 2Q3EA 2IDBA 3H1HG 2HODB 2ZJSE 3G9RA 1G1IA 1QVGO 3N7NA 2E5YA 2A45H 4RO0A 3RL0B 3CCSP 1KFMA 4ZKPA 4PJ0E 1D7MA 1N7SB 2G8YA 2GUSA 2IZ1A 1M7LA 2XZRA 1YBKA 2B88A 4K35A 1KB9D 4PWVB 3B5NA 1L0LD 4IZ6A 4WB4A 2WZ7A 1PP9J 2GZGA 1RF1A 2FY8A 2FQ1A 2OTJP 3PJSK 1JNMA 1S9KD 1BGYD 3P7KA 5APWA 1L0NJ 1VQLP 4COCA 1LWUC 1FS0E 1L0NE 2YMKA 1XTCC 1IFJA 5B5EE 3CWBE 1S5LE 3A3YB 3A2AA 2O1KA 2WPQA 2K5XA 3A7OA 5BVZA 1FDOA 1QL2A 2L22A 2OARA 1HY8A 3PRJA 2YNYA 3VMZA 1K05A 1MFTA 1E79H 3V2RA 4ASWA 1KYOI 1RO2A 3II6A 3JCUH 3SSUA 1BCCG 1VHNA 2LKMA 1GL2D 3HUSB 2QM8A 1LT1A 1EDJA 3GG2A 1OZHA 1RQVA 2YXQB 1RQUA 3AEGC 2A45I 1PEMA 2BHVA 2BCCE 3MZWB 1GL2C 3L37A 2OTKE 1PGJA 4M0IA 2KI7B 4GDOA 1FDMA 2KS1A 1GU5A 5JPAA 2ZAEB 1KYOH 2N1TC 2MY5A 1JCCA 2PEQA 1NGMB 3Q2YA 4U0AA 1VQ7P 4M3LA 1HGZA 1RE3C 1L4AB 3MP7B 3L75E 1EOQA 5AW1B 1L0LG 2Q6QA 1S9KE 2R3CA 3L74G 5KLIC 1N7SA 1Y9BA 2PY8A 3L70G 2YIUC 1NTZJ 1T6AA 1N2DC 4N78E 3A0BE 2L0QA 3H1JJ 1YQ4C 1CI6A 2PGDA 3L72J 3B5IA 2LL8A 1M57D 4I7ZB 1KILA 1SQPK 1NTKE 2PEMA 3L73E 4UB8E 3AE9C 3HE4B 1IFNA 3CCVP 2KOGA 1S72P 4I1LA 1NU1G 1T3UA 2UWJE 4H2XC 4NPEA 2XZ0D 1IFDA 2WSEJ 2KB7P 4L73A 4DG9A 1M1JC 1USDA 2N98A 2OYIC 1GK4A 2VLQA 1JO5A 2FXOA 4I7ZC 3ABVC 5APVA 3HZQA 3P8CE 1AQTA 2KGAA 2WPRA 2ZT9C 2MVVA 2OYIA 1EZVI 5GTHE 2BEQD 1SQVJ 4EIJA 3VP8A 4BPFA 1YYCA 1CW5A 4PV1D 1L4AD 1VQKP 2KWLA 1KQSO 1DEBA 1W2BO 1YIJP 1QRJA 5KAIE 3Q5PA 1IK7A 3JCUE 2ZYGA 1URQB 5AW5B 1M6EX 2XXMA 2POHA 3HE5A 1JMBA 1L0IA 2O01J 2AXTH 4WY4D 3AE6C 2L4BA 3AE7C 2YXRB 1GU4A 2JAZA 2H89C 1QLED 4XFJA 2E42A 1YJWP 1X8YA 4EI2A 3GHGA 3QH9A 2WSFH 3MD0A 2ZXEB 5APQA 1AF8A 2AEMA 2E75D 2J59M 1FU1A 4PD4E 3H1KG 2NPSC 2EHSA 2H8PD 4N6JA 5DJTB 4BPGA 1FZCC 1VQPP 4I2LC 2M3BA 2R5DA 2RMZA 1LT9C 1NTME 3RK2D 4A7PA 2QSIA 4PV1B 2JJLA 1U57A 1JY2P 1WT6A 1NAFA 1SQVK 4EDFA 3L72D 4PH1A 3VN0A 3L75D 2KS1B 2OQQA 2MR8A 1IK9A
chains in the Genus database with same CATH topology
1K30A 2BQ1E 3HYBA 2JYLA 3P05A 4XFYA 1M90Q 1JJ2O 2EIAA 3HZQA 3CCLP 2DGYA 5HGMA 3G0VA 2L6EA 1PEUA 1Q81Q 1D1DA 4XROA 1PEMA 2BHVA 1VQMP 1EIAA 2PENA 3DS0A 4GR2A 1RO0A 1M6NA 4M0IA 3MGEA 3CCMP 3DS2A 3CCRP 1YJ9P 1N8RQ 3G4SP 1QVGO 3CC2P 3CCQP 3CCJP 1Q7YQ 2M8PA 4QNBA 2KODA 3DPHA 1Q82Q 3CC7P 1ZMBA 3CXCO 2PEKA 3VRLC 3CCSP 1VQKP 1IUQA 5JPAA 1KQSO 1VQ4P 2Z46A 3I56P 3DS1A 2Z45A 1W2BO 1YIJP 1QRJA 3DS4A 5BS1A 3CCUP 4GR6A 2ONTA 3G28A 2PEIA 1K73Q 3DTJA 2PEQA 4U0AA 3NTEA 1M6EX 2XXMA 5F2NA 1VQ7P 1QVFO 5I4TG 1VQ5P 3CC4P 3G29A 3H4EA 1EOQA 3Q20A 3G1GA 4U0DA 2PEJA 3H47A 4U0CA 2BUOA 5F2OA 2PEOA 1RNIA 2M8NA 1K8AQ 4XFZA 3CMAP 1YJWP 1PEQA 4IPYA 3DS5A 3G1IA 2OTJP 3DS3A 3G71P 3CCEP 2XV6A 2E1MA 4U0FA 2PY8A 3OW2O 2Z44A 1YI2P 1VQLP 2LF4A 4COCA 5BS2A 4XRQA 2OTLP 1E6JP 4PH0A 5HGOA 3B5IA 4XFXA 5DCKA 1AUMA 5HGLA 2M8LA 3M1MA 4WYMA 2CWOA 3I55P 1KC8Q 1A43A 4U0EA 5F2KA 2PEMA 1VQOP 1K9MQ 2JO0A 4COPA 3E2DA 3H0DA 3CCVP 2OARA 3CPWO 2QEXP 1M1KQ 1VQPP 3G26A 1M74A 3G6EP 1S72P 1VQ9P 1VQ6P 1YHQP 2XT1A 1YJNP 2QA4P 3CMEP 1RO2A 1A8OA 2P9XA 5HGNA 1NJIQ 1VQ8P 2EG5A 1PEOA 1VQNP 4PH1A 1YITP 1Q86Q 1KD1Q 3LRYA 3WBHA 2JYGA 3G21A 2EFJA 3CD6P 3RG6C 1BAJA 4U0BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YIJ P;  3G71 P;  1VQO P;  3CCU P;  3CCE P;  1K9M Q;  1M90 Q;  1JJ2 O;  3CCV P;  3CCL P;  3CPW O;  3OW2 O;  2QEX P;  1K73 Q;  1VQP P;  1M1K Q;  3G6E P;  1S72 P;  1Q81 Q;  1YI2 P;  1VQ9 P;  1VQL P;  1VQ6 P;  1YHQ P;  1VQM P;  1VQ7 P;  1QVF O;  1YJN P;  2QA4 P;  2OTL P;  3CME P;  1VQ5 P;  1N8R Q;  3CCM P;  3CCR P;  3CC4 P;  1YJ9 P;  3CC2 P;  3G4S P;  1QVG O;  1NJI Q;  3CCQ P;  1VQ8 P;  3CCJ P;  1Q7Y Q;  1Q82 Q;  3CC7 P;  1VQK P;  3CCS P;  3CXC O;  1YIT P;  1Q86 Q;  1VQN P;  1K8A Q;  1KD1 Q;  1KQS O;  1VQ4 P;  3CMA P;  1YJW P;  3CD6 P;  3I56 P;  3I55 P;  2OTJ P;  1W2B O;  1KC8 Q; 
#chains in the Genus database with same CATH topology
 3P05 A;  2K9J A;  4WY4 C;  2GM4 A;  2W83 C;  3TGU G;  1SVF A;  5HGM A;  2M5A A;  1EIA A;  1USE A;  1PP9 G;  2ZVN B;  1N8R Q;  1PZQ A;  1N73 B;  2OYH A;  1GMJ A;  1FBM A;  1KOR A;  1NTK K;  1HH0 A;  2PFX A;  2K93 A;  1VDF A;  1ZXG A;  3D6Y A;  2PEI A;  3PP5 A;  2GDY A;  3NTE A;  1YTZ T;  2FQ2 A;  3MTU E;  3B5N D;  3H47 A;  1ZN5 A;  2C9N Y;  3IR9 A;  5AW3 B;  4AUW A;  3RK3 C;  4OH8 B;  2RH0 A;  3G1I A;  1SP4 A;  3FXE A;  2GDX A;  3OW2 O;  2LXB A;  2FBW C;  2L91 A;  1FC2 C;  3IN6 A;  3P8C D;  2Q1K A;  2WPT A;  1AUM A;  2JDI H;  4WYM A;  1SQX D;  3KZI E;  3L73 G;  1FAV A;  2XU6 A;  5BU5 A;  4COP A;  3SWY A;  1QEX A;  3M9Q A;  2W6A A;  3EJD A;  2FXM A;  2VLO A;  1NJI Q;  2E5T A;  3PLN A;  1PEO A;  2MD9 A;  1KD1 Q;  2KK7 A;  1NTK D;  3G21 A;  2KG8 A;  3MHV A;  1Z6M A;  3BCC G;  1JJ2 O;  1JY3 O;  2BEZ F;  3RK3 B;  4C46 A;  4BPH A;  1KTM A;  3NMD A;  2QJY C;  5AVS B;  3HD7 A;  3DS0 A;  2P7J A;  1RO0 A;  5KLV K;  1M6N A;  3KPE A;  3CCR P;  1HF9 A;  3FXD A;  3TK1 A;  1PP9 D;  2R3S A;  3DPH A;  1Q82 Q;  2FAD A;  1J2J B;  4KT0 J;  1X22 A;  3KDP B;  2FAC A;  3DS4 A;  3G28 A;  4PD4 H;  3RBZ A;  1KV4 A;  5KKZ B;  1T8K A;  3H1L E;  2MJZ A;  1QVF O;  3L72 G;  1ZR4 A;  5I4T G;  3GKL C;  3WMM 0;  1L0L E;  4N78 D;  4OVN F;  1EDI A;  5AW4 B;  2FVE A;  1OW7 A;  1BSH A;  3L71 J;  2AEF A;  3R2P A;  1PEQ A;  2XZ1 C;  3U1C A;  2KG6 A;  2AF8 A;  3DS3 A;  3AEC C;  2N5H A;  4U3F E;  4YTP C;  1VF5 D;  1BDD A;  1M1J B;  3M9B A;  2P10 A;  1SQV D;  4XE5 B;  4R0M A;  3AEF C;  1KIL B;  3H1J D;  2P1J A;  4H2W C;  4U0E A;  1WRG A;  2X2B A;  2K92 A;  2Q7C A;  3AE3 C;  1GW3 A;  3G26 A;  1YTZ I;  3RK3 D;  1SFC A;  4RJT A;  2VSQ A;  5AVU B;  2Z5H A;  2YIU B;  1JTH A;  1RE4 A;  1QX8 A;  3VMY A;  2AXT E;  2JYL A;  3WUV A;  2QRX A;  1H88 A;  4JF7 A;  1RE4 C;  2FYN C;  1EC5 A;  5KAI H;  2WPS A;  1LJ2 A;  3VOP A;  3DS2 A;  1NYH A;  3T97 A;  3AEB C;  2RKL A;  3HRN A;  2AXC A;  1WMK A;  3MUD C;  3M0A A;  1ZW0 A;  3HUS C;  5EFW B;  3L71 D;  4KJM A;  4WY4 A;  1HQB A;  2WSE H;  3G1G A;  4U0D A;  4H2Y C;  2ZT9 B;  1AVO A;  3HUS A;  5CCG A;  2MKV A;  4GIF A;  4IOI H;  1RE3 A;  2FVA A;  1NWQ A;  1AVY A;  1LT9 B;  1MV8 A;  1LTJ A;  3LIE A;  1CZQ A;  3FX0 A;  1BGY G;  2O1J A;  3CXH D;  1YI2 P;  1HVV A;  1SQP D;  2N1T B;  2BCC J;  1E6J P;  2BCC D;  4XFX A;  4IFM A;  1R5S A;  2M8L A;  4UHP B;  4BRY A;  2KOP A;  3KXD A;  1X0T A;  2KP8 A;  3L4F A;  1L0N G;  1NTZ D;  1DH3 A;  1PFI A;  1ZLL A;  2P9X A;  2FVF A;  3A5T A;  1DEE G;  1PPJ G;  1IC2 A;  2GZJ A;  1LNQ A;  2ZYD A;  1N7S D;  4LC1 A;  2Z5I A;  1NHL A;  3H6P A;  5AVX B;  1X79 B;  4XFY A;  5KLV E;  2DGY A;  1NTM G;  5DJU B;  3TF5 A;  1VQM P;  4U3F D;  3FWL A;  2LTE A;  1Q90 D;  3CC2 P;  3AED C;  3E7K A;  1KQG B;  3SWK A;  1FZE A;  2M8P A;  4QNB A;  2WWW A;  1IMQ A;  2N9B A;  4HKZ H;  2ZT9 D;  1EQ7 A;  1JCD A;  2SPZ A;  5EW5 E;  5CZD B;  5BS1 A;  3CWB G;  4HH2 A;  4C7R A;  2FAE A;  2FYU G;  2KOR A;  3H1H D;  3AE2 C;  1SQX G;  3L73 D;  1CSB A;  4TLF A;  3L71 G;  1OR5 A;  3GF3 A;  4EOT A;  3V2N A;  3H1I E;  3GLM A;  1SS1 A;  3NY7 B;  5AVV B;  5CBO A;  2LPK A;  2FHS C;  3EFF K;  5APY A;  2YKP A;  2I8D A;  3EJB A;  4ZMD A;  1FR2 A;  4XRQ A;  5AW9 B;  1AJY A;  2IYO A;  1SQB G;  4GT1 A;  1Q2N A;  1URQ C;  1VPC A;  5DCK A;  4RES B;  5HGL A;  4UB8 H;  3CX5 E;  2LOL A;  3O8Z A;  1K9M Q;  2B87 A;  3H32 A;  3C8V A;  1DV5 A;  1PGQ A;  1NU1 D;  4IL6 E;  5CBN A;  1VQN P;  1Q86 Q;  3H1J G;  3ITK A;  4H44 D;  5KLV J;  1OXZ A;  2E74 D;  2KXP B;  1KIL E;  4UB6 E;  4H0L C;  3RG6 C;  2N6Y A;  2K3R A;  2VLN A;  1IZN B;  3D71 A;  4D6T D;  1KB9 I;  1AFO A;  3CE7 A;  2E74 C;  3V4Q A;  3KHU A;  2QJP C;  1HJB A;  1KQL A;  3WU2 E;  1SFC C;  1ZOY C;  3I5C A;  4GOF A;  2AFD A;  5KP7 B;  2D2C B;  2KNC B;  2N9Y B;  2C0X A;  4KHX A;  3AE1 C;  4H0L B;  2GDW A;  1ZNV A;  2WT7 B;  1A02 J;  2PP6 A;  1FZC B;  3F89 A;  4OGQ B;  3Q20 A;  2PEJ A;  1OFC X;  4H13 D;  1BXI A;  1EZV D;  1VL2 A;  2QJP B;  2CPS A;  5F2O A;  1UJZ A;  2M8N A;  1L0L J;  3EWK A;  1FDI A;  3G71 P;  2RN0 A;  4DOJ A;  2A06 D;  2GA1 A;  3V2Q A;  5M1B A;  1LTS C;  3NTN A;  4PJ0 H;  3CWB D;  1JM0 A;  4CPG A;  2LML A;  2CWO A;  4H44 B;  1A43 A;  1CI6 B;  1ZRT D;  1A02 F;  2A06 E;  1VQ9 P;  1H89 A;  1U7J A;  2WQY C;  1J1E B;  1YJN P;  1LTJ C;  2VLP A;  3CXH H;  2N1T D;  2CQ8 A;  2K88 A;  1IFM A;  3FWN A;  3M0D C;  2KZI A;  2W6J H;  2JYG A;  2JWA A;  2B9B A;  3L75 G;  3SFD C;  2KW2 A;  1URQ D;  5B66 H;  1GD2 E;  1EDK A;  2ITA A;  4GOE A;  2H43 A;  1EDL A;  2R32 A;  1PPJ D;  2P58 A;  1JY2 N;  1M8O B;  2MR7 A;  1LGH B;  1LP1 B;  3GHG C;  2E43 A;  1KYO E;  2Z46 A;  3MIW A;  2FYU J;  3TDK A;  3DS1 A;  3SWF A;  2KYV A;  3E1R A;  4PV1 C;  3DTJ A;  2W8Z A;  3G3Z A;  1RF1 C;  5TJH A;  3PHL A;  1PPJ E;  3CC4 P;  2JEE A;  5E79 H;  5KLV G;  2WIT A;  2N5I A;  2KOQ A;  2XKM A;  4NPD A;  4D6T G;  3OJA B;  3CMA P;  1PGP A;  1DD4 A;  5HV8 A;  2FXP A;  2KLV A;  2W27 A;  2Y0D A;  1SQB J;  2LR2 A;  2ZVO B;  2W6B A;  3W68 A;  3BAT A;  5AVW B;  4PH0 A;  1NTM D;  1IMP A;  4UB6 H;  5KKZ C;  1T2K D;  3KZI H;  3U59 A;  4C7N A;  3M1M A;  1PP9 E;  4CA3 A;  1BGY E;  2OGU A;  1VQO P;  1L0H A;  3S1K A;  2YO3 A;  3CX5 I;  2JWD A;  3H1H J;  3CPW O;  1M1K Q;  3TGU E;  1M74 A;  1YHQ P;  2Q3I A;  1SQB D;  2OYH C;  1S3J A;  1BE3 J;  2QM7 A;  2FFD B;  3RGU A;  2WSC H;  4OGQ C;  1SQX J;  1G2C A;  5AW2 B;  2Q5U A;  4YXD C;  3TNU B;  3CCL P;  1SFC D;  1Q81 Q;  1VKU A;  5B66 E;  2HR3 A;  3MGE A;  2JKV A;  4PD4 D;  5APX A;  3CCQ P;  1LT9 A;  2JP3 A;  3GZM A;  2K2Q A;  1VF5 C;  4K3A A;  3WUT A;  1GL2 A;  3D6Z A;  1NTZ E;  2R5B A;  1E5W A;  1NU1 K;  1L0N K;  1LTI C;  4IL6 H;  3A0B H;  5TIS H;  3IFM A;  1H8A A;  1S2E A;  1NO4 A;  4IL6 X;  1DX7 A;  3TSI A;  1BE3 E;  4XFZ A;  3T97 B;  1OVU A;  3K5B A;  3CX5 D;  3H1I J;  2FFD C;  1FZB A;  1QL1 A;  2BAS A;  4JYB A;  2O01 N;  4WY4 B;  4H13 B;  2GYK A;  4GKG A;  2B87 B;  5CCG D;  4L74 A;  1T8Z A;  2K1A A;  1N73 C;  2PNG A;  4U3F J;  2AEJ A;  4Y28 J;  1F80 D;  1SFC B;  1Y8A A;  1IO4 A;  1U7M A;  1NKN A;  4PXH B;  1OVR A;  3LW5 J;  4NEO A;  2EG5 A;  2I1K A;  3L72 E;  2QE7 H;  3WBH A;  2QNW A;  4TT3 H;  1FZA A;  1AA0 A;  5KAF E;  4IFD K;  3R4Y A;  1M90 Q;  3E1I A;  4W7Z A;  1DNY A;  3VYI A;  2L6E A;  2HYN A;  3L74 E;  3WU2 H;  4XRO A;  3RBX A;  1M1J A;  1Z56 A;  2NPS D;  2IFN A;  3BRT B;  2JU1 A;  5CCH C;  2KGD A;  3H1L D;  1PV3 A;  3V6I A;  5KP6 B;  2XV5 A;  3HE5 B;  3CLQ A;  1ZMB A;  3VRL C;  3USS A;  4JBZ A;  3L70 D;  3F5H A;  2GZE A;  3CCU P;  2ONT A;  2WSC J;  1M56 D;  3H1H E;  3TGU J;  2Y9Y A;  2C0W A;  3BAS A;  5KTB A;  4D6T J;  1YQ3 C;  2AFE A;  3L35 A;  1BE3 D;  1RF0 A;  1JY3 P;  3CX5 H;  2KUB A;  1NAY A;  4D6T E;  3RL0 D;  4OWF A;  3L71 E;  1NU1 J;  2LF4 A;  1ZRT E;  3B71 A;  2KOO A;  4MRT C;  1SQP G;  3NXS A;  3RK3 E;  1OIP A;  1R8E A;  2DW3 A;  2IX7 C;  1GDT A;  1NH4 A;  1OW8 A;  1PGO A;  3QWO C;  1X3O A;  1NTZ K;  1BCC D;  4R4M A;  1EXI A;  3A0H E;  4N3Y B;  1SQQ D;  1RHZ B;  2E75 C;  1EXJ A;  5E79 E;  1VQ6 P;  1SQV G;  2KGC A;  5AVT B;  4NPF X;  2W90 A;  2L9F A;  3Q3D A;  1LWU A;  1L0L K;  2N1T A;  2KR5 A;  4XA4 A;  3MUD A;  2WT7 A;  2BQ1 E;  1ZV8 A;  1FJP A;  2NO8 A;  1MZ9 A;  3H25 A;  2KOS A;  5AVR B;  2HG5 D;  5KJ7 A;  2PEN A;  4H0L D;  4HJG H;  5HVC A;  2YO2 A;  3CCM P;  1MKM A;  3SFE C;  3U43 A;  3C1L A;  2XDJ A;  3H1L G;  2PEK A;  1LTA C;  1RH5 B;  1UII A;  4I6M C;  1IUQ A;  4WBA A;  2FFD A;  5L8R J;  3PH0 A;  3I56 P;  2M0B A;  1FJK A;  3L36 A;  4JPZ B;  3H1K E;  1NTK G;  4BXL A;  2QIW A;  1ZME C;  1GW4 A;  1JY3 N;  1KN7 A;  5APS A;  2FQ0 A;  1VQ5 P;  3BVH A;  2E75 B;  1HWT C;  4O9B A;  4YXW H;  1GXH A;  3AE5 C;  3H1I G;  4Y99 C;  5CHX A;  1RNI A;  1X9V A;  1J1D C;  4BRY B;  4IPY A;  3N4X A;  3L70 J;  3S9O A;  2Y9Z A;  3CCE P;  4U7J A;  2XV6 A;  1GTW A;  2LXC B;  1GZL A;  2QG4 A;  1KB9 H;  4OGQ D;  4F37 A;  2OTL P;  3ZDM A;  1JOC A;  3P8M C;  1CEI A;  5KAF H;  3BRV B;  1R5L A;  1UNK A;  1KFN A;  1MFZ A;  1QGK B;  3M9H A;  5AW8 B;  4ZKU A;  1HUC A;  2Y0C A;  4EYY Q;  5C39 A;  1OVV A;  1GXG A;  4RKU J;  2XT1 A;  1N7S C;  2QJK C;  1KMI Z;  3HTK A;  5HGN A;  3RG2 A;  4AQR D;  3AE8 C;  3AEE C;  1W5C E;  2EFJ A;  2DNW A;  1LTG C;  5CJ0 A;  2M3E A;  5EJD A;  3GZL A;  1KIL C;  4HYT B;  2KNC A;  1SQP J;  1S1C X;  1KZU B;  4YPC A;  4GR2 A;  4R4L A;  3AEA C;  1IFP A;  3L74 J;  3OA7 A;  5H2F H;  1H0T A;  3CC7 P;  1KYO D;  1IFI A;  3RL0 g;  1P84 I;  1VQ4 P;  3D70 A;  2J5U A;  1J1E C;  1LTJ B;  1SQB E;  3VP9 A;  1JMM A;  4H44 C;  5TIS E;  5AW0 B;  1URQ A;  2NPS B;  3LW5 H;  3FGA D;  5AVQ B;  2IYP A;  1K8A Q;  1EZV G;  2NZ2 A;  3DS5 A;  3Q5R A;  1LTT C;  1N86 A;  3GHG B;  2YKO A;  3P32 A;  1ZR2 A;  2OYI B;  5GTH H;  3GW6 A;  3W67 A;  3CI9 A;  2V7Q J;  1FOS F;  2A06 G;  5AW7 B;  3H1L J;  1K04 A;  1NVO A;  1L4A A;  2G3A A;  2QVA A;  2CG5 B;  2XND H;  4HB1 A;  1SQX E;  3UIA A;  1RF1 B;  2FYU E;  1W2E A;  3M06 A;  3E2D A;  5KJ7 C;  4L76 A;  2ERH A;  1L4A C;  2QEX P;  2A45 G;  3TGU D;  3O6Q A;  1BGY J;  3H1I D;  3U1A A;  1DD3 A;  1J1D B;  3HE4 A;  1P84 D;  1JTH B;  1KB9 E;  3V4W A;  3B4Q A;  2HPC B;  3LRY A;  2C9L Y;  4U0B A;  2JB0 A;  1K30 A;  3V5B A;  4LLH A;  4DCK A;  2NPS A;  3G0V A;  5KLV D;  5KLI B;  2WSF J;  2FKW B;  2HOD A;  2ZYA A;  2HPC A;  3V2P A;  5AW6 B;  3KYQ A;  1Q7Y Q;  4ASV A;  2M5R A;  2MF4 A;  2FYZ A;  1NTK J;  2Z45 A;  4W80 A;  4GR6 A;  3JC2 2;  3TNU A;  3KQG A;  2KSE A;  1G2C B;  2E76 C;  2WVR A;  1GPJ A;  2KGE A;  3G29 A;  2Y0E A;  3H1K J;  4DT0 A;  1KIL D;  3OAK A;  4U0C A;  2ZXX A;  4WVZ A;  1SQX K;  2PEO A;  2E76 D;  2M5A B;  2O3J A;  3BCC J;  5B5E H;  2L5G B;  2IBZ G;  1BCC E;  1SQQ J;  1AQ5 A;  2E1M A;  4U0F A;  1NTM K;  2ZFC A;  2CK3 H;  3BCC E;  2HFE D;  3CWB J;  1SQV E;  1N7L A;  2ROQ A;  2OYO A;  5AVY B;  1LP1 A;  1AYI A;  3L73 J;  1N73 A;  1KQF B;  3B5N B;  2PRR A;  4C7N B;  5BU8 B;  2WPV B;  1SQB K;  1KC8 Q;  2K0D X;  5F2K A;  2QJY B;  5APT A;  2JO0 A;  3HD7 C;  3BCC D;  1OX3 A;  3G6E P;  2PAJ A;  2V4H A;  4PD4 I;  3IF4 A;  1A8O A;  1VQ8 P;  4BWN A;  1YIT P;  2JU2 A;  3EFG A;  3CD6 P;  2WSS H;  2K0Y A;  3B5N C;  4AYC A;  4H13 C;  5CJ4 A;  2EIA A;  3H1K D;  1T2K C;  3EQ2 A;  3Q1M A;  1L2P A;  3M91 A;  3O6Q B;  2GZI A;  1HBW A;  2GUV A;  4JYC A;  3TYY A;  3G4S P;  3HTK B;  2KOD A;  5K5G B;  1FZF A;  4DZO A;  2FYU K;  3NFQ A;  5CCH A;  2N6Z A;  4QMA A;  1T3J A;  1ZP0 C;  1K73 Q;  2QJK B;  2BCC G;  2IFM A;  2EHT A;  2YMY A;  5F2N A;  2I1J A;  2V7Q H;  4GOD A;  1E0H A;  4IFF A;  5KP8 B;  3HD7 D;  1NQ4 A;  2BUO A;  1EZV E;  3C9I A;  4L75 A;  4W7Y A;  1JY2 O;  1MZ8 A;  1SQQ K;  1NKZ B;  4QKO A;  1IJD B;  2K94 A;  1OWA A;  2IZ0 A;  3CXH E;  3VMX A;  1RF0 C;  2Z44 A;  2WMM A;  2LKI A;  5BS2 A;  4DJG A;  2KIK A;  1NU1 E;  2WTY A;  5AVZ B;  2CGQ A;  5HGO A;  3RK2 B;  3S4R A;  2P2U A;  5CMZ A;  1GL2 B;  3A0H H;  2K0X A;  1HJ0 A;  2R44 A;  2Q9I A;  5CCH D;  4Y99 B;  1NTM J;  2NRG A;  3H0D A;  1MUU A;  2IPP A;  4MN4 C;  2O01 H;  1BSN A;  2IBZ I;  1ACP A;  3CXH I;  1KLP A;  2QA4 P;  2B89 A;  3VMA A;  1VF5 B;  2IBZ D;  1PL5 A;  1FOS E;  2MVU A;  1FZC A;  1EMV A;  2JBG A;  4B86 A;  2FYU D;  3RK2 C;  1BDC A;  5GTI H;  1BCC J;  2H88 C;  1P84 H;  2KLU A;  2N50 A;  1PEU A;  3B4S A;  2LIW A;  2KSJ A;  2Z4E A;  2H7H A;  2JQ4 A;  4WWI A;  5CCG C;  1YJ9 P;  1TU3 F;  3B8E B;  3CCJ P;  1DIP A;  1Y47 A;  3CXC O;  2VRS A;  3HD7 B;  2CNR A;  2CPB A;  3L74 D;  3L75 J;  4HKG A;  2K9J B;  4ZNC A;  1SLQ A;  2K37 A;  3IAO A;  2JGP A;  1JEK A;  1H0T B;  1XTG B;  2GZF A;  3H4E A;  5KJ7 D;  4LGD E;  5APU A;  1S4X A;  1SQQ G;  2JO1 A;  1BE3 G;  1HGV A;  2JR8 A;  5H2F E;  1S5L H;  3H1J E;  2OYH B;  3AE4 C;  3H32 B;  3GF7 A;  3WUU A;  1UIX A;  1PIX A;  2KZJ A;  2HLO A;  2XNX A;  2J58 A;  3MGN A;  1AV1 A;  1JB0 J;  1S5L X;  3PTZ A;  1L0N D;  1NTZ G;  4JQ0 D;  3JSV C;  2FYN B;  1JUN A;  3EJE A;  3GJN A;  5GTI E;  1LTB C;  1HTL C;  1P84 E;  2LIU A;  3I55 P;  1FE6 A;  2E76 B;  3GMA A;  2YKQ A;  2KG9 A;  2E74 B;  3LMO A;  1SQP E;  1RY3 A;  2AVA A;  3M0D A;  4Z1M H;  3RL0 C;  3Q5S A;  3CME P;  2IBZ E;  1OMI A;  4U3F G;  2M8R A;  2D2C C;  2P67 A;  7CEI A;  3CL3 D;  1G1J A;  1SQQ E;  1FZG A;  1BAJ A;  3L70 E;  3HYB A;  1GK6 A;  1LWU B;  1NOH A;  1OW6 A;  3LID A;  2K9Y A;  2D2C D;  3VTP C;  1D1D A;  2Q3E A;  2IDB A;  3H1H G;  2HOD B;  2ZJS E;  3G9R A;  1G1I A;  1QVG O;  3N7N A;  2E5Y A;  2A45 H;  4RO0 A;  3RL0 B;  3CCS P;  1KFM A;  4ZKP A;  4PJ0 E;  1D7M A;  1N7S B;  2G8Y A;  2GUS A;  2IZ1 A;  1M7L A;  2XZR A;  1YBK A;  2B88 A;  4K35 A;  1KB9 D;  4PWV B;  3B5N A;  1L0L D;  4IZ6 A;  4WB4 A;  2WZ7 A;  1PP9 J;  2GZG A;  1RF1 A;  2FY8 A;  2FQ1 A;  2OTJ P;  3PJS K;  1JNM A;  1S9K D;  1BGY D;  3P7K A;  5APW A;  1L0N J;  1VQL P;  4COC A;  1LWU C;  1FS0 E;  1L0N E;  2YMK A;  1XTC C;  1IFJ A;  5B5E E;  3CWB E;  1S5L E;  3A3Y B;  3A2A A;  2O1K A;  2WPQ A;  2K5X A;  3A7O A;  5BVZ A;  1FDO A;  1QL2 A;  2L22 A;  2OAR A;  1HY8 A;  3PRJ A;  2YNY A;  3VMZ A;  1K05 A;  1MFT A;  1E79 H;  3V2R A;  4ASW A;  1KYO I;  1RO2 A;  3II6 A;  3JCU H;  3SSU A;  1BCC G;  1VHN A;  2LKM A;  1GL2 D;  3HUS B;  2QM8 A;  1LT1 A;  1EDJ A;  3GG2 A;  1OZH A;  1RQV A;  2YXQ B;  1RQU A;  3AEG C;  2A45 I;  1PEM A;  2BHV A;  2BCC E;  3MZW B;  1GL2 C;  3L37 A;  2OTK E;  1PGJ A;  4M0I A;  2KI7 B;  4GDO A;  1FDM A;  2KS1 A;  1GU5 A;  5JPA A;  2ZAE B;  1KYO H;  2N1T C;  2MY5 A;  1JCC A;  2PEQ A;  1NGM B;  3Q2Y A;  4U0A A;  1VQ7 P;  4M3L A;  1HGZ A;  1RE3 C;  1L4A B;  3MP7 B;  3L75 E;  1EOQ A;  5AW1 B;  1L0L G;  2Q6Q A;  1S9K E;  2R3C A;  3L74 G;  5KLI C;  1N7S A;  1Y9B A;  2PY8 A;  3L70 G;  2YIU C;  1NTZ J;  1T6A A;  1N2D C;  4N78 E;  3A0B E;  2L0Q A;  3H1J J;  1YQ4 C;  1CI6 A;  2PGD A;  3L72 J;  3B5I A;  2LL8 A;  1M57 D;  4I7Z B;  1KIL A;  1SQP K;  1NTK E;  2PEM A;  3L73 E;  4UB8 E;  3AE9 C;  3HE4 B;  1IFN A;  3CCV P;  2KOG A;  1S72 P;  4I1L A;  1NU1 G;  1T3U A;  2UWJ E;  4H2X C;  4NPE A;  2XZ0 D;  1IFD A;  2WSE J;  2KB7 P;  4L73 A;  4DG9 A;  1M1J C;  1USD A;  2N98 A;  2OYI C;  1GK4 A;  2VLQ A;  1JO5 A;  2FXO A;  4I7Z C;  3ABV C;  5APV A;  3HZQ A;  3P8C E;  1AQT A;  2KGA A;  2WPR A;  2ZT9 C;  2MVV A;  2OYI A;  1EZV I;  5GTH E;  2BEQ D;  1SQV J;  4EIJ A;  3VP8 A;  4BPF A;  1YYC A;  1CW5 A;  4PV1 D;  1L4A D;  1VQK P;  2KWL A;  1KQS O;  1DEB A;  1W2B O;  1YIJ P;  1QRJ A;  5KAI E;  3Q5P A;  1IK7 A;  3JCU E;  2ZYG A;  1URQ B;  5AW5 B;  1M6E X;  2XXM A;  2POH A;  3HE5 A;  1JMB A;  1L0I A;  2O01 J;  2AXT H;  4WY4 D;  3AE6 C;  2L4B A;  3AE7 C;  2YXR B;  1GU4 A;  2JAZ A;  2H89 C;  1QLE D;  4XFJ A;  2E42 A;  1YJW P;  1X8Y A;  4EI2 A;  3GHG A;  3QH9 A;  2WSF H;  3MD0 A;  2ZXE B;  5APQ A;  1AF8 A;  2AEM A;  2E75 D;  2J59 M;  1FU1 A;  4PD4 E;  3H1K G;  2NPS C;  2EHS A;  2H8P D;  4N6J A;  5DJT B;  4BPG A;  1FZC C;  1VQP P;  4I2L C;  2M3B A;  2R5D A;  2RMZ A;  1LT9 C;  1NTM E;  3RK2 D;  4A7P A;  2QSI A;  4PV1 B;  2JJL A;  1U57 A;  1JY2 P;  1WT6 A;  1NAF A;  1SQV K;  4EDF A;  3L72 D;  4PH1 A;  3VN0 A;  3L75 D;  2KS1 B;  2OQQ A;  2MR8 A;  1IK9 A; 
#chains in the Genus database with same CATH homology
 1K30 A;  2BQ1 E;  3HYB A;  2JYL A;  3P05 A;  4XFY A;  1M90 Q;  1JJ2 O;  2EIA A;  3HZQ A;  3CCL P;  2DGY A;  5HGM A;  3G0V A;  2L6E A;  1PEU A;  1Q81 Q;  1D1D A;  4XRO A;  1PEM A;  2BHV A;  1VQM P;  1EIA A;  2PEN A;  3DS0 A;  4GR2 A;  1RO0 A;  1M6N A;  4M0I A;  3MGE A;  3CCM P;  3DS2 A;  3CCR P;  1YJ9 P;  1N8R Q;  3G4S P;  1QVG O;  3CC2 P;  3CCQ P;  3CCJ P;  1Q7Y Q;  2M8P A;  4QNB A;  2KOD A;  3DPH A;  1Q82 Q;  3CC7 P;  1ZMB A;  3CXC O;  2PEK A;  3VRL C;  3CCS P;  1VQK P;  1IUQ A;  5JPA A;  1KQS O;  1VQ4 P;  2Z46 A;  3I56 P;  3DS1 A;  2Z45 A;  1W2B O;  1YIJ P;  1QRJ A;  3DS4 A;  5BS1 A;  3CCU P;  4GR6 A;  2ONT A;  3G28 A;  2PEI A;  1K73 Q;  3DTJ A;  2PEQ A;  4U0A A;  3NTE A;  1M6E X;  2XXM A;  5F2N A;  1VQ7 P;  1QVF O;  5I4T G;  1VQ5 P;  3CC4 P;  3G29 A;  3H4E A;  1EOQ A;  3Q20 A;  3G1G A;  4U0D A;  2PEJ A;  3H47 A;  4U0C A;  2BUO A;  5F2O A;  2PEO A;  1RNI A;  2M8N A;  1K8A Q;  4XFZ A;  3CMA P;  1YJW P;  1PEQ A;  4IPY A;  3DS5 A;  3G1I A;  2OTJ P;  3DS3 A;  3G71 P;  3CCE P;  2XV6 A;  2E1M A;  4U0F A;  2PY8 A;  3OW2 O;  2Z44 A;  1YI2 P;  1VQL P;  2LF4 A;  4COC A;  5BS2 A;  4XRQ A;  2OTL P;  1E6J P;  4PH0 A;  5HGO A;  3B5I A;  4XFX A;  5DCK A;  1AUM A;  5HGL A;  2M8L A;  3M1M A;  4WYM A;  2CWO A;  3I55 P;  1KC8 Q;  1A43 A;  4U0E A;  5F2K A;  2PEM A;  1VQO P;  1K9M Q;  2JO0 A;  4COP A;  3E2D A;  3H0D A;  3CCV P;  2OAR A;  3CPW O;  2QEX P;  1M1K Q;  1VQP P;  3G26 A;  1M74 A;  3G6E P;  1S72 P;  1VQ9 P;  1VQ6 P;  1YHQ P;  2XT1 A;  1YJN P;  2QA4 P;  3CME P;  1RO2 A;  1A8O A;  2P9X A;  5HGN A;  1NJI Q;  1VQ8 P;  2EG5 A;  1PEO A;  1VQN P;  4PH1 A;  1YIT P;  1Q86 Q;  1KD1 Q;  3LRY A;  3WBH A;  2JYG A;  3G21 A;  2EFJ A;  3CD6 P;  3RG6 C;  1BAJ A;  4U0B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...