2OTLP

Girodazole bound to the large subunit of haloarcula marismortui
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
143
structure length
143
Chain Sequence
b'TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal RNA
publication title The Structures of Antibiotics Bound to the E Site Region of the 50 S Ribosomal Subunit of Haloarcula marismortui: 13-Deoxytedanolide and Girodazole.
pubmed doi rcsb
molecule tags Ribosome
total genus 48
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2007-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 2otlP03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 2otlP01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 2otlP02
1Q81Q 3CXCO 1S72P 1KD1Q 1YI2P 1VQ4P 1VQMP 1QVFO 2OTJP 1N8RQ 1M90Q 1VQ7P 1Q86Q 1VQKP 1K8AQ 2QA4P 1VQ6P 3CCRP 1YJ9P 3CD6P 1Q82Q 3CMAP 1VQPP 3CC2P 1YHQP 3CCVP 1VQ8P 1W2BO 3CCQP 3OW2O 1K73Q 1M1KQ 1VQNP 1YITP 1JJ2O 3CCSP 1VQ5P 3CCUP 1K9MQ 1KQSO 1VQLP 3CC4P 2QEXP 3CCJP 1VQOP 3G71P 3I55P 1KC8Q 3I56P 3G4SP 1YJWP 1YJNP 3CC7P 1YIJP 1VQ9P 2OTLP 3CCEP 3CCLP 3CCMP 1Q7YQ 1QVGO 1NJIQ 3G6EP 3CMEP 3CPWO
chains in the Genus database with same CATH superfamily
2MF4A 1MUUA 2AXCA 1BCCJ 1USDA 1GL2A 2Y0CA 3H1KD 2QNWA 1NYHA 2E75D 2JR8A 2Q7CA 3TGUJ 3SWFA 4L74A 1X3OA 2FYUK 3CLQA 2JJLA 2JBGA 1NTZD 2K0YA 1L0LJ 1YI2P 4D6TJ 1EDJA 2POHA 4PV1B 1T6AA 1DEBA 4BRYA 1NTME 3LW5H 3I5CA 5CBOA 3AE2C 2Z46A 3LW5J 4XFYA 4IL6X 3L74G 2ZYGA 1E0HA 4PD4H 3A7OA 1OIPA 1L0IA 1RF0A 4BWNA 3G6EP 1S9KD 2ZYDA 2ZT9B 1CI6B 1OZHA 1VQ4P 1H88A 2ZJSE 5GTHE 1DD4A 4OWFA 2BUOA 3HUSB 5BS2A 1AA0A 4ZKPA 1XTCC 2RH0A 2L5GB 1FJKA 4GR2A 1L0LK 1EZVI 3AE6C 1KILB 3VTPC 2D2CC 1RF1B 5CBNA 2W27A 2EHSA 2IYOA 1URQA 2W8ZA 3H1LD 3L73G 1DV5A 3VRLC 1AFOA 5APXA 3V2NA 1FZCC 5KAFH 2WPSA 2JO1A 3TNUA 1KC8Q 2K9YA 2E43A 2VSQA 4H0LB 1ZR2A 4H0LC 2K0XA 3BATA 5AW0B 1SQBJ 2FXPA 3G21A 5KKZB 1LNQA 3DS4A 3BCCE 4COPA 2KS1A 1PPJE 3KZIH 2KGDA 3H1KE 5TISE 1VQNP 4XA4A 1PGJA 5H2FE 2YO3A 3DS5A 4U3FJ 1A43A 1KQGB 3OA7A 3HE4B 2I8DA 1SQVK 1NH4A 2H7HA 1NTZE 4U0BA 3GZLA 1JMMA 1HGZA 1SQQK 3RK2B 5AW7B 2KR5A 2QRXA 3O8ZA 3V2PA 3AECC 3KQGA 3SFEC 3VP8A 3D6ZA 3HD7D 1W2BO 1K73Q 1LT9B 5KLIC 3FXEA 1PP9G 3T97B 4AQRD 1Z6MA 2KOQA 3HZQA 1SQBK 2YMYA 1QVGO 2N5HA 1L4AC 1Q81Q 1FE6A 2Y0DA 2J58A 3F89A 2N50A 1JTHA 2B88A 1PGPA 2OGUA 1FU1A 1KB9E 1LWUA 1K9MQ 1N73C 3IFMA 1HY8A 3L72J 1JEKA 2CK3H 3L37A 3L71G 2L6EA 1SP4A 1EXJA 3CWBG 4BRYB 5APTA 2GUSA 2LPKA 2AVAA 2M3EA 1KYOE 1RHZB 2JWAA 4PD4I 3B71A 1CEIA 1PGQA 4BPFA 2FACA 3CPWO 4CA3A 1NWQA 4W7ZA 1GU5A 2CG5B 1M90Q 2BCCG 5E79E 1DIPA 1NTMJ 2K93A 3L74D 3E7KA 1L0NE 2WMMA 1URQB 2WT7A 2LKIA 2M5AB 1VQMP 1IMPA 3L70J 3N7NA 5CCGA 1EC5A 5GTHH 1OR5A 1P84D 5AVSB 2WPVB 1DEEG 2JP3A 5APSA 4RJTA 1AF8A 3DTJA 5CJ0A 2ITAA 3AE8C 2K0DX 3HRNA 2IBZG 5CCHC 2Q1KA 2KS1B 1FOSF 3KXDA 2FY8A 2ZVNB 1NTMK 2BHVA 2FFDC 5KTBA 4H2WC 3CD6P 3U43A 1M8OB 1IK7A 3CE7A 3L73D 1FAVA 2M8PA 3RG6C 3AE4C 4I1LA 3NXSA 1N7LA 2VRSA 3TF5A 1EZVE 1IJDB 2FVFA 3MHVA 1M1JC 1WT6A 4PWVB 2MKVA 3HTKA 3BCCJ 2NRGA 4OGQC 2FAEA 5TISH 3HD7A 1IFMA 2HR3A 1NVOA 1NTKG 1L0HA 1ZMBA 3H1KJ 1FZAA 2VLPA 4XFJA 5AVQB 2K5XA 1RO0A 5F2KA 2O3JA 2E42A 1EMVA 3DS2A 2D2CD 4WYMA 4PH1A 2IYPA 2QJYB 2K3RA 2B9BA 4C7RA 3L4FA 1NTZJ 1OX3A 2E75B 2K2QA 3GG2A 4IFMA 1R8EA 1OW6A 1VQOP 4PJ0E 3IAOA 1SQXG 4L73A 3F5HA 2YO2A 1PP9D 3L74E 2KORA 1AQ5A 3AEDC 5KLVG 2YKQA 3G1IA 4H0LD 2XT1A 2GZEA 1PEQA 3E1RA 2AFDA 4U0CA 5AW1B 3MUDC 2FQ2A 1KB9H 2L4BA 3I55P 3H1HG 2JU2A 7CEIA 2XV6A 4Y99B 4LGDE 3CMEP 4R4LA 3HE5B 2IZ0A 4MN4C 3W67A 4RKUJ 3L71D 2H88C 4K3AA 3CWBD 5CMZA 3G29A 1YBKA 1H0TB 1VQ5P 2KNCA 4DG9A 3AE7C 2MVVA 3C1LA 4LLHA 2BEQD 1YJNP 1NU1G 3SWKA 4DOJA 1JY3P 2WT7B 2JO0A 1L4AD 2OTKE 4RESB 3TK1A 1BSNA 2FYNB 2L91A 5AW6B 2XNXA 4PXHB 3LMOA 4N78E 3CXHE 2BCCD 2LR2A 4JPZB 3DS0A 4PD4E 1UNKA 1GPJA 2WSSH 2KSJA 3GJNA 2V4HA 1X9VA 5APQA 4I6MC 1KILE 1VDFA 2OTJP 1UIIA 1J1EC 2RN0A 1VQ6P 1LP1A 3H25A 4OH8B 1Y9BA 3OW2O 3Q20A 3P8CD 2W6AA 3PP5A 4GOFA 2O1KA 2NPSC 3CX5E 2CPSA 5DJTB 1QGKB 2I1JA 2KI7B 2R44A 1PP9E 5HGNA 1FDIA 3B5NC 3HTKB 2IBZD 1CI6A 1RNIA 2N1TC 5AW2B 1VF5C 3WBHA 1Y47A 3HUSA 3P7KA 3DS3A 5KAFE 2LOLA 1MFZA 2Q3EA 3I56P 2QSIA 1L0NK 1PV3A 1KILA 1GD2E 2ZVOB 5KJ7C 1IFDA 3ZDMA 3L71E 3L75G 3AE9C 4KJMA 2YXRB 3KHUA 1HTLC 1FZCA 2PFXA 1KQSO 3G71P 1NTKD 1RY3A 4JYCA 1KFMA 1KD1Q 5CCHD 3H6PA 3GW6A 3Q5PA 3KPEA 1X8YA 3Q5SA 1KB9I 3GHGB 1JY3O 5CHXA 2BCCE 2N6YA 1JO5A 4PJ0H 2CNRA 1YJWP 3CCLP 2KIKA 5AVTB 1SQXD 3L74J 3HE4A 2PNGA 5KLVD 4U0AA 1EIAA 2K94A 1Q82Q 2Q6QA 1LTJC 1P84H 4OGQD 1E5WA 4WBAA 5APYA 1LT9A 1F80D 1X0TA 3H1HD 1IFNA 2L0QA 5F2NA 2LXBA 2Y9ZA 2VLOA 1A02F 3D71A 4L76A 1OMIA 3AE3C 1Q90D 1SQPG 2QG4A 3RL0C 1JUNA 1EQ7A 1G1JA 1GK6A 1ZV8A 1QX8A 4N6JA 1N73A 3L73J 1GW3A 1NHLA 1JY2P 4YPCA 1NU1D 3BRVB 3H1JG 1LP1B 2PEQA 2JWDA 4R4MA 4ZKUA 1EOQA 3CXHH 2K1AA 1M1KQ 2HODA 2MVUA 1J1DC 2B89A 4F37A 4GOEA 1NTKE 2Z4EA 3PHLA 2B87A 3L70E 3S9OA 2SPZA 4YXDC 3SWYA 1UJZA 3VMXA 2QM8A 2OYHC 3CMAP 3GMAA 2FYUG 2ZFCA 1HJ0A 3CX5H 2ZXEB 3NY7B 3TDKA 1RE4A 1NJIQ 3TYYA 2D2CB 4M3LA 1G1IA 2Z5IA 1MZ8A 1PP9J 2JU1A 2PEIA 1JNMA 1VQKP 2M5AA 1FZCB 2L22A 2QJKC 3CCQP 1RH5B 1X79B 1BXIA 1T8KA 1BCCG 5KP7B 2FVEA 3GF3A 1K05A 2N98A 2MR7A 2KYVA 1OVRA 3H1HE 3H1IE 4I2LC 2R5DA 1EDLA 2VLQA 3EWKA 2A06G 2KW2A 2FQ0A 2WSFH 2W6JH 3Q1MA 3MIWA 2L9FA 3L71J 3L75D 3RK3C 2Y0EA 2WSFJ 3LIEA 3CWBJ 1NQ4A 2NPSD 2LXCB 1ZXGA 2XDJA 3AEGC 5BU8B 4QKOA 2RKLA 1ZOYC 2WSEH 5APUA 3BVHA 2XZ1C 3G9RA 1PEUA 3B5ND 3II6A 1MKMA 2H89C 1P84I 4AUWA 2N1TD 3GLMA 1EDKA 1JY2O 2KZIA 1VF5D 5KLIB 4TLFA 4EOTA 4DJGA 2FYZA 2BCCJ 1ZRTD 1E79H 1L4AB 2E5TA 2ERHA 3B8EB 2V7QH 1S9KE 1N7SC 2JYGA 1OW7A 1AJYA 1VKUA 2V7QJ 5KJ7D 1OXZA 1N86A 4HKZH 1N73B 1VPCA 1JJ2O 2K9JA 2ZAEB 1VL2A 1SQVG 4LC1A 5KP8B 3CC7P 1JB0J 2Z5HA 4MRTC 4EIJA 1SQQG 2GDWA 2EHTA 3D6YA 2Q5UA 1GL2C 2JB0A 2P7JA 2OYIC 1MZ9A 3CXHI 1SQPD 1HGVA 3H1LE 2HODB 2IZ1A 2WPQA 2XZRA 3MTUE 3MUDA 1K30A 4I7ZB 3G1GA 1XTGB 4XFXA 4I7ZC 2B87B 3AEFC 2H43A 2FHSC 2X2BA 2PEMA 3E1IA 3HE5A 3A3YB 1U57A 1YQ4C 3H1JD 3A0BE 3CX5I 4ZMDA 3MP7B 1FBMA 3WUTA 3JCUE 2R3CA 3KYQA 1H0TA 4BPGA 1S3JA 1BSHA 3U59A 2BASA 4CPGA 1NTKJ 2QIWA 2LMLA 3EJDA 2GDXA 3RL0D 3WUUA 3H0DA 1VQ8P 2KXPB 2FYUD 1JY3N 2FKWB 3VYIA 3E2DA 2KLVA 1KMIZ 2MR8A 2YIUC 2KWLA 1ZRTE 4OVNF 2KG8A 3AE5C 1SQXJ 2FFDB 3WUVA 3EJEA 1D7MA 2QJPC 2GZJA 5K5GB 1YTZI 5KLVJ 2QVAA 2RMZA 4ASWA 3M0AA 3CCSP 1FDMA 2GZGA 1Z56A 1FZEA 4U7JA 5KAIH 1BCCD 1NAFA 2A45G 4C7NA 1BDCA 4IZ6A 5I4TG 1M74A 4GT1A 1M1JB 3Q5RA 3H1HJ 1N8RQ 3H1IJ 3TGUD 4OGQB 2P10A 3CCRP 2A06D 1OFCX 2FXMA 2PENA 2N9YB 3EJBA 2M8RA 4B86A 4D6TD 2FBWC 5EW5E 2KOPA 5HVCA 2KGEA 3G3ZA 1NU1J 4NPFX 2K9JB 3H1JE 1S5LE 2CWOA 2KGCA 2KP8A 3A2AA 3PRJA 1Q7YQ 1VQ9P 1GXHA 1HWTC 5CZDB 2IBZI 3G28A 4N3YB 1T2KC 1GXGA 3LRYA 3VN0A 5HV8A 2P1JA 4JBZA 1LWUC 5AVWB 1P84E 2E74C 1BE3G 3GHGA 3RK3D 3MGEA 2OYOA 2FYUE 3AEAC 1KQFB 2C9NY 1SQVD 2BEZF 2AEFA 1NTZK 1SQQD 1KTMA 1BGYG 1Q86Q 4WY4B 4WY4C 1LTJA 1HBWA 3H1LJ 1S4XA 3L73E 3NTEA 2DNWA 2WZ7A 1CZQA 1PPJG 1ZLLA 1D1DA 4A7PA 1LJ2A 4DT0A 3BASA 1N7SD 1FJPA 1G2CB 4U3FD 1SLQA 3A0BH 1TU3F 2HYNA 3JCUH 3P32A 5AVZB 1IFIA 3L75J 2JQ4A 1PIXA 1IFPA 4H13C 5CCGC 2N6ZA 5M1BA 1AV1A 1J1EB 1GL2D 1ZW0A 3U1AA 3VMAA 1YJ9P 2ROQA 5AW4B 1KN7A 3K5BA 2NPSB 3GKLC 2CGQA 2VLNA 1NAYA 4C7NB 1JY2N 2GZIA 1QRJA 3B5NB 2DGYA 1LTBC 2N1TB 2J59M 1EDIA 3QH9A 1VF5B 1FZFA 3L72D 4IOIH 2OYHA 3S4RA 4GDOA 5GTIH 1ZN5A 3VP9A 1SQVE 3EFFK 3A5TA 2IFNA 1K8AQ 3WU2E 2W83C 3CWBE 3SFDC 4HB1A 4U0EA 5EJDA 2KB7P 1QL1A 1SQPJ 1KORA 3O6QB 3S1KA 4UHPB 2M5RA 2M8NA 3RL0g 2Z44A 2P2UA 1NTMD 2WSCH 1JCDA 1GK4A 3HYBA 1S5LH 1HH0A 1PL5A 4COCA 1L0NG 2WPRA 3H1JJ 2QEXP 1ZMEC 2KUBA 3OJAB 4O9BA 4U0FA 2H8PD 5F2OA 1HQBA 1S1CX 3AEEC 1SFCC 1ZR4A 1QEXA 2LKMA 2ZYAA 3IN6A 1KLPA 3LIDA 4H44C 2KG6A 3V6IA 4EYYQ 3W68A 1LTJB 5DJUB 4IL6E 4U0DA 3JC22 3JSVC 1N2DC 3V4QA 2LIWA 3NMDA 3P8CE 5AW8B 3M91A 2N5IA 1BE3D 3M9QA 2JGPA 1WRGA 3AEBC 5AVVB 4DCKA 1AQTA 2UWJE 2FYUJ 1YTZT 1L4AA 2K37A 4QNBA 2WQYC 3M0DC 3RL0B 2PEJA 3M9BA 2IBZE 4BXLA 1FZBA 1BGYD 1GZLA 2HG5D 2N9BA 3CC4P 1JOCA 2LTEA 1EZVG 4BPHA 3FX0A 1Q2NA 1MFTA 1QL2A 2E76C 5CJ4A 3BCCD 4HKGA 3L35A 1PPJD 1T2KD 2XZ0D 1FZGA 2R5BA 1RQUA 4IFFA 2OYIA 3CCVP 3RGUA 1J1DB 2E74D 3PJSK 2IX7C 1NKZB 2FADA 1J2JB 2KK7A 2KOGA 4KHXA 2G8YA 2O01H 2AF8A 4WWIA 1AYIA 2O01J 2Y9YA 4M0IA 2OYHB 4PV1C 1RO2A 2JEEA 4C46A 4WY4D 2WVRA 1PEOA 5AVRB 2EIAA 3H32A 3TSIA 1YIJP 5TJHA 1A02J 3OAKA 2ZT9C 1FR2A 3KDPB 1SQXE 3G0VA 1U7MA 1IFJA 5AVYB 5KLVE 4GR6A 2QJKB 1KB9D 3HUSC 2NZ2A 5HGMA 1RE3C 1HUCA 1OVVA 1BE3E 5HGOA 1KILC 5KAIE 1RF1C 3CXCO 4H13D 3TGUG 5CCHA 5CCGD 1SQVJ 4YXWH 3WU2H 1KYOD 3RK3B 1SQQJ 1YHQP 2FFDA 2YMKA 1BGYE 3B5IA 1L0LG 4D6TG 1NOHA 4ZNCA 3M9HA 2W6BA 2OQQA 1SVFA 3NTNA 1A8OA 1L2PA 2WSEJ 1T8ZA 3CI9A 5KKZC 1NU1E 1DNYA 2PEKA 1M1JA 1H8AA 1YYCA 3SSUA 3N4XA 1NO4A 2FXOA 4NPDA 3P05A 1L0ND 4EDFA 2PP6A 2OTLP 5AW3B 1FOSE 3NFQA 1M57D 1N7SB 1S72P 2AXTE 3V5BA 1MV8A 3RK2C 1PFIA 1M6EX 1LTIC 1FC2C 4IL6H 3MD0A 4R0MA 4L75A 2GA1A 5JPAA 2E1MA 1NKNA 1LT9C 3V4WA 1IK9A 2NO8A 4EI2A 1DH3A 2WITA 1VQ7P 1T3JA 2JKVA 2P58A 3R2PA 1GL2B 2K92A 2OYIB 3WMM0 2XKMA 5BU5A 3P8MC 2BQ1E 1KZUB 2MY5A 1SQBG 1ZP0C 2KG9A 1M56D 1IO4A 1IUQA 4GODA 2AFEA 4XROA 1EZVD 4H2YC 2QM7A 1SFCD 3USSA 3DS1A 3R4YA 4U3FG 2A45H 4H44D 1SS1A 1LTAC 3H32B 2XNDH 4WY4A 3L75E 1X22A 1KQLA 4W7YA 1RF0C 2O01N 2FVAA 3VOPA 4QMAA 3PH0A 5BVZA 1OW8A 4Z1MH 2PAJA 2KLUA 1OVUA 3V2RA 3RG2A 1G2CA 2WPTA 5AW5B 3A0HE 2QE7H 1RE4C 5KP6B 2YIUB 2PEOA 1CSBA 4WB4A 3FGAD 2LL8A 1URQC 2E76D 2ONTA 2HLOA 5AVXB 2IDBA 3L72G 3G26A 2QJPB 3PTZA 3TNUB 3UIAA 2MJZA 1LT1A 5B66E 3Q3DA 5GTIE 2NPSA 2WTYA 1NTKK 4RO0A 1M6NA 1U7JA 2YKPA 2Q3IA 1BE3J 1S2EA 1W2EA 2KGAA 3B5NA 2N1TA 4PV1D 1SQPE 1T3UA 1IZNB 4HYTB 1BGYJ 1QLED 1WMKA 1L0LD 1PEMA 1OWAA 3B4SA 2JYLA 1SQXK 2G3AA 1NTMG 2FQ1A 2ZT9D 4H2XC 1K04A 4GIFA 5B5EE 5KLVK 1LTGC 2KZJA 5BS1A 5C39A 5KJ7A 1CW5A 3CL3D 4N78D 3CXHD 1DX7A 2M8LA 5H2FH 1AVOA 3B4QA 1BDDA 3EQ2A 4PD4D 2PY8A 3L70G 4WVZA 3G4SP 3DPHA 1KILD 3O6QA 1DD3A 3GF7A 1JTHB 2AXTH 1E6JP 2P9XA 2HPCA 2QJYC 5DCKA 3AE1C 1LWUB 2E75C 2LIUA 2GYKA 2E74B 3CX5D 4UB6E 4PH0A 1PZQA 4XRQA 2KSEA 1GU4A 2EG5A 2IPPA 4XE5B 4YTPC 2A45I 5HGLA 1NU1K 1SFCA 2C0XA 2JDIH 4NEOA 3Q2YA 4DZOA 2YXQB 3V2QA 2XU6A 3PLNA 4AYCA 3H1IG 4UB8E 4Y28J 1SQBD 2K88A 2C0WA 2IFMA 3BCCG 4Y99C 2DW3A 1BCCE 2AEMA 5EFWB 2R3SA 3H1KG 3ITKA 3M0DA 3RK2D 2W90A 1VQPP 3TGUE 3H47A 1KYOH 2A06E 2ZXXA 3CCUP 2Q9IA 1S5LX 2GDYA 3RBXA 4K35A 1NTZG 3CCMP 1L0LE 1Y8AA 4D6TE 2WWWA 3QWOC 4H13B 3FWLA 4ASVA 1ZNVA 3VMYA 1JCCA 2FYNC 2I1KA 4KT0J 5E79H 2R32A 2XV5A 1R5LA 1RQVA 3A0HH 1YITP 3FXDA 1BAJA 1LTTC 2LF4A 1PGOA 1L0NJ 3RBZA 1YQ3C 2JAZA 1QVFO 2P67A 5AVUB 2HFED 1KFNA 4NPEA 3BRTB 1W5CE 5APVA 1VQLP 1IC2A 5B66H 3CCJP 2E5YA 1ACPA 3RK3E 4IFDK 3M1MA 1HF9A 5APWA 1LTSC 1GMJA 1LGHB 1HJBA 2YNYA 3H1LG 2PRRA 1NGMB 3ABVC 3HD7B 3C8VA 1SQQE 3MGNA 3HD7C 4JQ0D 3CC2P 3EFGA 1UIXA 2XXMA 2GM4A 1RE3A 3L36A 2KOOA 3CCEP 1SQBE 2O1JA 1FS0E 2HPCB 3U1CA 1RF1A 4JYBA 1URQD 4HJGH 5B5EH 1H89A 2MD9A 5L8RJ 2GUVA 4TT3H 2QA4P 3H4EA 1GTWA 3KZIE 3D70A 4U3FE 2OARA 1IMQA 2WSCJ 3IR9A 1JMBA 1GDTA 1R5SA 1JM0A 3L70D 1SFCB 2CQ8A 2M0BA 4W80A 4H44B 4GKGA 1USEA 5AW9B 3VMZA 1SQPK 2GZFA 3GHGC 1FDOA 2J5UA 2YKOA 4UB6H 1EXIA 4HH2A 2C9LY 1GW4A 4IPYA 1N7SA 1M7LA 3C9IA 1KV4A 1KYOI 2AEJA 3M06A 4JF7A 2EFJA 2KODA 2KNCB 3IF4A 1HVVA 2PGDA 3GZMA 1VHNA 3L72E 4XFZA 2CPBA 2Z45A 3MZWB 4UB8H 2KOSA 1AVYA 3T97A 1AUMA 2M3BA 3H1ID 2E76B 3FWNA
chains in the Genus database with same CATH topology
1D1DA 2M8NA 5HGLA 1S72P 2ONTA 3G21A 1M74A 4WYMA 5I4TG 2Z44A 3DS4A 4PH1A 4COPA 4U0AA 1EIAA 2OTJP 1N8RQ 1M90Q 2PEIA 4M0IA 1M6EX 1VQKP 1VQ6P 3G26A 3CCRP 1Q82Q 3CC2P 3HYBA 1RO2A 1VQNP 3CCQP 3OW2O 3Q20A 1PEOA 4COCA 5JPAA 1K30A 2PENA 3DS5A 2E1MA 2XXMA 2EIAA 2QEXP 1VQOP 1A43A 3G1GA 4XFXA 4U0FA 1YIJP 3CCEP 1M6NA 1VQ7P 5F2OA 5F2NA 5HGNA 3G1IA 2XT1A 1YI2P 2PEMA 1PEQA 3G0VA 4U0BA 1VQMP 1RNIA 4U0CA 2QA4P 1YJ9P 3H4EA 4GR6A 1VQPP 4U0DA 3H47A 2BQ1E 2Z46A 3WBHA 2CWOA 1W2BO 5HGMA 1K73Q 2OARA 3DS3A 4XFYA 3CCUP 3DTJA 3I55P 3I56P 1PEMA 3HZQA 1IUQA 2XV6A 2JYLA 3CCMP 1Q7YQ 5HGOA 4XROA 1QVGO 3G6EP 3CMEP 1VQ9P 1QRJA 1Q81Q 2DGYA 3CXCO 3G28A 1VQ4P 1PEUA 3LRYA 3DS1A 2PEQA 4QNBA 2BHVA 2PEJA 5BS1A 2BUOA 3CD6P 2M8LA 5BS2A 3G29A 1YHQP 1EOQA 3H0DA 1VQ8P 3B5IA 1M1KQ 1YITP 1K9MQ 1VQ5P 1KQSO 3CC4P 3MGEA 4GR2A 2PY8A 3G71P 3G4SP 1YJNP 2M8PA 3RG6C 3E2DA 4IPYA 1BAJA 2LF4A 3DPHA 2L6EA 2JO0A 1KD1Q 2JYGA 1A8OA 1E6JP 2P9XA 1QVFO 5DCKA 2PEKA 1Q86Q 1K8AQ 2EFJA 2KODA 3VRLC 3CMAP 3CCVP 4U0EA 1VQLP 1JJ2O 3CCSP 2EG5A 4PH0A 4XFZA 1ZMBA 3CCJP 2Z45A 3P05A 1KC8Q 3M1MA 4XRQA 3NTEA 1YJWP 3CC7P 1RO0A 3DS0A 2OTLP 2PEOA 3CCLP 5F2KA 1AUMA 1NJIQ 3CPWO 3DS2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q81 Q;  3CXC O;  1S72 P;  1KD1 Q;  1YI2 P;  1VQ4 P;  1VQM P;  1QVF O;  2OTJ P;  1N8R Q;  1M90 Q;  1VQ7 P;  1Q86 Q;  1VQK P;  1K8A Q;  2QA4 P;  1VQ6 P;  3CCR P;  1YJ9 P;  3CD6 P;  1Q82 Q;  3CMA P;  1VQP P;  3CC2 P;  1YHQ P;  3CCV P;  1VQ8 P;  1W2B O;  3CCQ P;  3OW2 O;  1K73 Q;  1M1K Q;  1VQN P;  1YIT P;  1JJ2 O;  3CCS P;  1VQ5 P;  3CCU P;  1K9M Q;  1KQS O;  1VQL P;  3CC4 P;  2QEX P;  3CCJ P;  1VQO P;  3G71 P;  3I55 P;  1KC8 Q;  3I56 P;  3G4S P;  1YJW P;  1YJN P;  3CC7 P;  1YIJ P;  1VQ9 P;  2OTL P;  3CCE P;  3CCL P;  3CCM P;  1Q7Y Q;  1QVG O;  1NJI Q;  3G6E P;  3CME P;  3CPW O; 
#chains in the Genus database with same CATH topology
 2MF4 A;  1MUU A;  2AXC A;  1BCC J;  1USD A;  1GL2 A;  2Y0C A;  3H1K D;  2QNW A;  1NYH A;  2E75 D;  2JR8 A;  2Q7C A;  3TGU J;  3SWF A;  4L74 A;  1X3O A;  2FYU K;  3CLQ A;  2JJL A;  2JBG A;  1NTZ D;  2K0Y A;  1L0L J;  1YI2 P;  4D6T J;  1EDJ A;  2POH A;  4PV1 B;  1T6A A;  1DEB A;  4BRY A;  1NTM E;  3LW5 H;  3I5C A;  5CBO A;  3AE2 C;  2Z46 A;  3LW5 J;  4XFY A;  4IL6 X;  3L74 G;  2ZYG A;  1E0H A;  4PD4 H;  3A7O A;  1OIP A;  1L0I A;  1RF0 A;  4BWN A;  3G6E P;  1S9K D;  2ZYD A;  2ZT9 B;  1CI6 B;  1OZH A;  1VQ4 P;  1H88 A;  2ZJS E;  5GTH E;  1DD4 A;  4OWF A;  2BUO A;  3HUS B;  5BS2 A;  1AA0 A;  4ZKP A;  1XTC C;  2RH0 A;  2L5G B;  1FJK A;  4GR2 A;  1L0L K;  1EZV I;  3AE6 C;  1KIL B;  3VTP C;  2D2C C;  1RF1 B;  5CBN A;  2W27 A;  2EHS A;  2IYO A;  1URQ A;  2W8Z A;  3H1L D;  3L73 G;  1DV5 A;  3VRL C;  1AFO A;  5APX A;  3V2N A;  1FZC C;  5KAF H;  2WPS A;  2JO1 A;  3TNU A;  1KC8 Q;  2K9Y A;  2E43 A;  2VSQ A;  4H0L B;  1ZR2 A;  4H0L C;  2K0X A;  3BAT A;  5AW0 B;  1SQB J;  2FXP A;  3G21 A;  5KKZ B;  1LNQ A;  3DS4 A;  3BCC E;  4COP A;  2KS1 A;  1PPJ E;  3KZI H;  2KGD A;  3H1K E;  5TIS E;  1VQN P;  4XA4 A;  1PGJ A;  5H2F E;  2YO3 A;  3DS5 A;  4U3F J;  1A43 A;  1KQG B;  3OA7 A;  3HE4 B;  2I8D A;  1SQV K;  1NH4 A;  2H7H A;  1NTZ E;  4U0B A;  3GZL A;  1JMM A;  1HGZ A;  1SQQ K;  3RK2 B;  5AW7 B;  2KR5 A;  2QRX A;  3O8Z A;  3V2P A;  3AEC C;  3KQG A;  3SFE C;  3VP8 A;  3D6Z A;  3HD7 D;  1W2B O;  1K73 Q;  1LT9 B;  5KLI C;  3FXE A;  1PP9 G;  3T97 B;  4AQR D;  1Z6M A;  2KOQ A;  3HZQ A;  1SQB K;  2YMY A;  1QVG O;  2N5H A;  1L4A C;  1Q81 Q;  1FE6 A;  2Y0D A;  2J58 A;  3F89 A;  2N50 A;  1JTH A;  2B88 A;  1PGP A;  2OGU A;  1FU1 A;  1KB9 E;  1LWU A;  1K9M Q;  1N73 C;  3IFM A;  1HY8 A;  3L72 J;  1JEK A;  2CK3 H;  3L37 A;  3L71 G;  2L6E A;  1SP4 A;  1EXJ A;  3CWB G;  4BRY B;  5APT A;  2GUS A;  2LPK A;  2AVA A;  2M3E A;  1KYO E;  1RHZ B;  2JWA A;  4PD4 I;  3B71 A;  1CEI A;  1PGQ A;  4BPF A;  2FAC A;  3CPW O;  4CA3 A;  1NWQ A;  4W7Z A;  1GU5 A;  2CG5 B;  1M90 Q;  2BCC G;  5E79 E;  1DIP A;  1NTM J;  2K93 A;  3L74 D;  3E7K A;  1L0N E;  2WMM A;  1URQ B;  2WT7 A;  2LKI A;  2M5A B;  1VQM P;  1IMP A;  3L70 J;  3N7N A;  5CCG A;  1EC5 A;  5GTH H;  1OR5 A;  1P84 D;  5AVS B;  2WPV B;  1DEE G;  2JP3 A;  5APS A;  4RJT A;  1AF8 A;  3DTJ A;  5CJ0 A;  2ITA A;  3AE8 C;  2K0D X;  3HRN A;  2IBZ G;  5CCH C;  2Q1K A;  2KS1 B;  1FOS F;  3KXD A;  2FY8 A;  2ZVN B;  1NTM K;  2BHV A;  2FFD C;  5KTB A;  4H2W C;  3CD6 P;  3U43 A;  1M8O B;  1IK7 A;  3CE7 A;  3L73 D;  1FAV A;  2M8P A;  3RG6 C;  3AE4 C;  4I1L A;  3NXS A;  1N7L A;  2VRS A;  3TF5 A;  1EZV E;  1IJD B;  2FVF A;  3MHV A;  1M1J C;  1WT6 A;  4PWV B;  2MKV A;  3HTK A;  3BCC J;  2NRG A;  4OGQ C;  2FAE A;  5TIS H;  3HD7 A;  1IFM A;  2HR3 A;  1NVO A;  1NTK G;  1L0H A;  1ZMB A;  3H1K J;  1FZA A;  2VLP A;  4XFJ A;  5AVQ B;  2K5X A;  1RO0 A;  5F2K A;  2O3J A;  2E42 A;  1EMV A;  3DS2 A;  2D2C D;  4WYM A;  4PH1 A;  2IYP A;  2QJY B;  2K3R A;  2B9B A;  4C7R A;  3L4F A;  1NTZ J;  1OX3 A;  2E75 B;  2K2Q A;  3GG2 A;  4IFM A;  1R8E A;  1OW6 A;  1VQO P;  4PJ0 E;  3IAO A;  1SQX G;  4L73 A;  3F5H A;  2YO2 A;  1PP9 D;  3L74 E;  2KOR A;  1AQ5 A;  3AED C;  5KLV G;  2YKQ A;  3G1I A;  4H0L D;  2XT1 A;  2GZE A;  1PEQ A;  3E1R A;  2AFD A;  4U0C A;  5AW1 B;  3MUD C;  2FQ2 A;  1KB9 H;  2L4B A;  3I55 P;  3H1H G;  2JU2 A;  7CEI A;  2XV6 A;  4Y99 B;  4LGD E;  3CME P;  4R4L A;  3HE5 B;  2IZ0 A;  4MN4 C;  3W67 A;  4RKU J;  3L71 D;  2H88 C;  4K3A A;  3CWB D;  5CMZ A;  3G29 A;  1YBK A;  1H0T B;  1VQ5 P;  2KNC A;  4DG9 A;  3AE7 C;  2MVV A;  3C1L A;  4LLH A;  2BEQ D;  1YJN P;  1NU1 G;  3SWK A;  4DOJ A;  1JY3 P;  2WT7 B;  2JO0 A;  1L4A D;  2OTK E;  4RES B;  3TK1 A;  1BSN A;  2FYN B;  2L91 A;  5AW6 B;  2XNX A;  4PXH B;  3LMO A;  4N78 E;  3CXH E;  2BCC D;  2LR2 A;  4JPZ B;  3DS0 A;  4PD4 E;  1UNK A;  1GPJ A;  2WSS H;  2KSJ A;  3GJN A;  2V4H A;  1X9V A;  5APQ A;  4I6M C;  1KIL E;  1VDF A;  2OTJ P;  1UII A;  1J1E C;  2RN0 A;  1VQ6 P;  1LP1 A;  3H25 A;  4OH8 B;  1Y9B A;  3OW2 O;  3Q20 A;  3P8C D;  2W6A A;  3PP5 A;  4GOF A;  2O1K A;  2NPS C;  3CX5 E;  2CPS A;  5DJT B;  1QGK B;  2I1J A;  2KI7 B;  2R44 A;  1PP9 E;  5HGN A;  1FDI A;  3B5N C;  3HTK B;  2IBZ D;  1CI6 A;  1RNI A;  2N1T C;  5AW2 B;  1VF5 C;  3WBH A;  1Y47 A;  3HUS A;  3P7K A;  3DS3 A;  5KAF E;  2LOL A;  1MFZ A;  2Q3E A;  3I56 P;  2QSI A;  1L0N K;  1PV3 A;  1KIL A;  1GD2 E;  2ZVO B;  5KJ7 C;  1IFD A;  3ZDM A;  3L71 E;  3L75 G;  3AE9 C;  4KJM A;  2YXR B;  3KHU A;  1HTL C;  1FZC A;  2PFX A;  1KQS O;  3G71 P;  1NTK D;  1RY3 A;  4JYC A;  1KFM A;  1KD1 Q;  5CCH D;  3H6P A;  3GW6 A;  3Q5P A;  3KPE A;  1X8Y A;  3Q5S A;  1KB9 I;  3GHG B;  1JY3 O;  5CHX A;  2BCC E;  2N6Y A;  1JO5 A;  4PJ0 H;  2CNR A;  1YJW P;  3CCL P;  2KIK A;  5AVT B;  1SQX D;  3L74 J;  3HE4 A;  2PNG A;  5KLV D;  4U0A A;  1EIA A;  2K94 A;  1Q82 Q;  2Q6Q A;  1LTJ C;  1P84 H;  4OGQ D;  1E5W A;  4WBA A;  5APY A;  1LT9 A;  1F80 D;  1X0T A;  3H1H D;  1IFN A;  2L0Q A;  5F2N A;  2LXB A;  2Y9Z A;  2VLO A;  1A02 F;  3D71 A;  4L76 A;  1OMI A;  3AE3 C;  1Q90 D;  1SQP G;  2QG4 A;  3RL0 C;  1JUN A;  1EQ7 A;  1G1J A;  1GK6 A;  1ZV8 A;  1QX8 A;  4N6J A;  1N73 A;  3L73 J;  1GW3 A;  1NHL A;  1JY2 P;  4YPC A;  1NU1 D;  3BRV B;  3H1J G;  1LP1 B;  2PEQ A;  2JWD A;  4R4M A;  4ZKU A;  1EOQ A;  3CXH H;  2K1A A;  1M1K Q;  2HOD A;  2MVU A;  1J1D C;  2B89 A;  4F37 A;  4GOE A;  1NTK E;  2Z4E A;  3PHL A;  2B87 A;  3L70 E;  3S9O A;  2SPZ A;  4YXD C;  3SWY A;  1UJZ A;  3VMX A;  2QM8 A;  2OYH C;  3CMA P;  3GMA A;  2FYU G;  2ZFC A;  1HJ0 A;  3CX5 H;  2ZXE B;  3NY7 B;  3TDK A;  1RE4 A;  1NJI Q;  3TYY A;  2D2C B;  4M3L A;  1G1I A;  2Z5I A;  1MZ8 A;  1PP9 J;  2JU1 A;  2PEI A;  1JNM A;  1VQK P;  2M5A A;  1FZC B;  2L22 A;  2QJK C;  3CCQ P;  1RH5 B;  1X79 B;  1BXI A;  1T8K A;  1BCC G;  5KP7 B;  2FVE A;  3GF3 A;  1K05 A;  2N98 A;  2MR7 A;  2KYV A;  1OVR A;  3H1H E;  3H1I E;  4I2L C;  2R5D A;  1EDL A;  2VLQ A;  3EWK A;  2A06 G;  2KW2 A;  2FQ0 A;  2WSF H;  2W6J H;  3Q1M A;  3MIW A;  2L9F A;  3L71 J;  3L75 D;  3RK3 C;  2Y0E A;  2WSF J;  3LIE A;  3CWB J;  1NQ4 A;  2NPS D;  2LXC B;  1ZXG A;  2XDJ A;  3AEG C;  5BU8 B;  4QKO A;  2RKL A;  1ZOY C;  2WSE H;  5APU A;  3BVH A;  2XZ1 C;  3G9R A;  1PEU A;  3B5N D;  3II6 A;  1MKM A;  2H89 C;  1P84 I;  4AUW A;  2N1T D;  3GLM A;  1EDK A;  1JY2 O;  2KZI A;  1VF5 D;  5KLI B;  4TLF A;  4EOT A;  4DJG A;  2FYZ A;  2BCC J;  1ZRT D;  1E79 H;  1L4A B;  2E5T A;  2ERH A;  3B8E B;  2V7Q H;  1S9K E;  1N7S C;  2JYG A;  1OW7 A;  1AJY A;  1VKU A;  2V7Q J;  5KJ7 D;  1OXZ A;  1N86 A;  4HKZ H;  1N73 B;  1VPC A;  1JJ2 O;  2K9J A;  2ZAE B;  1VL2 A;  1SQV G;  4LC1 A;  5KP8 B;  3CC7 P;  1JB0 J;  2Z5H A;  4MRT C;  4EIJ A;  1SQQ G;  2GDW A;  2EHT A;  3D6Y A;  2Q5U A;  1GL2 C;  2JB0 A;  2P7J A;  2OYI C;  1MZ9 A;  3CXH I;  1SQP D;  1HGV A;  3H1L E;  2HOD B;  2IZ1 A;  2WPQ A;  2XZR A;  3MTU E;  3MUD A;  1K30 A;  4I7Z B;  3G1G A;  1XTG B;  4XFX A;  4I7Z C;  2B87 B;  3AEF C;  2H43 A;  2FHS C;  2X2B A;  2PEM A;  3E1I A;  3HE5 A;  3A3Y B;  1U57 A;  1YQ4 C;  3H1J D;  3A0B E;  3CX5 I;  4ZMD A;  3MP7 B;  1FBM A;  3WUT A;  3JCU E;  2R3C A;  3KYQ A;  1H0T A;  4BPG A;  1S3J A;  1BSH A;  3U59 A;  2BAS A;  4CPG A;  1NTK J;  2QIW A;  2LML A;  3EJD A;  2GDX A;  3RL0 D;  3WUU A;  3H0D A;  1VQ8 P;  2KXP B;  2FYU D;  1JY3 N;  2FKW B;  3VYI A;  3E2D A;  2KLV A;  1KMI Z;  2MR8 A;  2YIU C;  2KWL A;  1ZRT E;  4OVN F;  2KG8 A;  3AE5 C;  1SQX J;  2FFD B;  3WUV A;  3EJE A;  1D7M A;  2QJP C;  2GZJ A;  5K5G B;  1YTZ I;  5KLV J;  2QVA A;  2RMZ A;  4ASW A;  3M0A A;  3CCS P;  1FDM A;  2GZG A;  1Z56 A;  1FZE A;  4U7J A;  5KAI H;  1BCC D;  1NAF A;  2A45 G;  4C7N A;  1BDC A;  4IZ6 A;  5I4T G;  1M74 A;  4GT1 A;  1M1J B;  3Q5R A;  3H1H J;  1N8R Q;  3H1I J;  3TGU D;  4OGQ B;  2P10 A;  3CCR P;  2A06 D;  1OFC X;  2FXM A;  2PEN A;  2N9Y B;  3EJB A;  2M8R A;  4B86 A;  4D6T D;  2FBW C;  5EW5 E;  2KOP A;  5HVC A;  2KGE A;  3G3Z A;  1NU1 J;  4NPF X;  2K9J B;  3H1J E;  1S5L E;  2CWO A;  2KGC A;  2KP8 A;  3A2A A;  3PRJ A;  1Q7Y Q;  1VQ9 P;  1GXH A;  1HWT C;  5CZD B;  2IBZ I;  3G28 A;  4N3Y B;  1T2K C;  1GXG A;  3LRY A;  3VN0 A;  5HV8 A;  2P1J A;  4JBZ A;  1LWU C;  5AVW B;  1P84 E;  2E74 C;  1BE3 G;  3GHG A;  3RK3 D;  3MGE A;  2OYO A;  2FYU E;  3AEA C;  1KQF B;  2C9N Y;  1SQV D;  2BEZ F;  2AEF A;  1NTZ K;  1SQQ D;  1KTM A;  1BGY G;  1Q86 Q;  4WY4 B;  4WY4 C;  1LTJ A;  1HBW A;  3H1L J;  1S4X A;  3L73 E;  3NTE A;  2DNW A;  2WZ7 A;  1CZQ A;  1PPJ G;  1ZLL A;  1D1D A;  4A7P A;  1LJ2 A;  4DT0 A;  3BAS A;  1N7S D;  1FJP A;  1G2C B;  4U3F D;  1SLQ A;  3A0B H;  1TU3 F;  2HYN A;  3JCU H;  3P32 A;  5AVZ B;  1IFI A;  3L75 J;  2JQ4 A;  1PIX A;  1IFP A;  4H13 C;  5CCG C;  2N6Z A;  5M1B A;  1AV1 A;  1J1E B;  1GL2 D;  1ZW0 A;  3U1A A;  3VMA A;  1YJ9 P;  2ROQ A;  5AW4 B;  1KN7 A;  3K5B A;  2NPS B;  3GKL C;  2CGQ A;  2VLN A;  1NAY A;  4C7N B;  1JY2 N;  2GZI A;  1QRJ A;  3B5N B;  2DGY A;  1LTB C;  2N1T B;  2J59 M;  1EDI A;  3QH9 A;  1VF5 B;  1FZF A;  3L72 D;  4IOI H;  2OYH A;  3S4R A;  4GDO A;  5GTI H;  1ZN5 A;  3VP9 A;  1SQV E;  3EFF K;  3A5T A;  2IFN A;  1K8A Q;  3WU2 E;  2W83 C;  3CWB E;  3SFD C;  4HB1 A;  4U0E A;  5EJD A;  2KB7 P;  1QL1 A;  1SQP J;  1KOR A;  3O6Q B;  3S1K A;  4UHP B;  2M5R A;  2M8N A;  3RL0 g;  2Z44 A;  2P2U A;  1NTM D;  2WSC H;  1JCD A;  1GK4 A;  3HYB A;  1S5L H;  1HH0 A;  1PL5 A;  4COC A;  1L0N G;  2WPR A;  3H1J J;  2QEX P;  1ZME C;  2KUB A;  3OJA B;  4O9B A;  4U0F A;  2H8P D;  5F2O A;  1HQB A;  1S1C X;  3AEE C;  1SFC C;  1ZR4 A;  1QEX A;  2LKM A;  2ZYA A;  3IN6 A;  1KLP A;  3LID A;  4H44 C;  2KG6 A;  3V6I A;  4EYY Q;  3W68 A;  1LTJ B;  5DJU B;  4IL6 E;  4U0D A;  3JC2 2;  3JSV C;  1N2D C;  3V4Q A;  2LIW A;  3NMD A;  3P8C E;  5AW8 B;  3M91 A;  2N5I A;  1BE3 D;  3M9Q A;  2JGP A;  1WRG A;  3AEB C;  5AVV B;  4DCK A;  1AQT A;  2UWJ E;  2FYU J;  1YTZ T;  1L4A A;  2K37 A;  4QNB A;  2WQY C;  3M0D C;  3RL0 B;  2PEJ A;  3M9B A;  2IBZ E;  4BXL A;  1FZB A;  1BGY D;  1GZL A;  2HG5 D;  2N9B A;  3CC4 P;  1JOC A;  2LTE A;  1EZV G;  4BPH A;  3FX0 A;  1Q2N A;  1MFT A;  1QL2 A;  2E76 C;  5CJ4 A;  3BCC D;  4HKG A;  3L35 A;  1PPJ D;  1T2K D;  2XZ0 D;  1FZG A;  2R5B A;  1RQU A;  4IFF A;  2OYI A;  3CCV P;  3RGU A;  1J1D B;  2E74 D;  3PJS K;  2IX7 C;  1NKZ B;  2FAD A;  1J2J B;  2KK7 A;  2KOG A;  4KHX A;  2G8Y A;  2O01 H;  2AF8 A;  4WWI A;  1AYI A;  2O01 J;  2Y9Y A;  4M0I A;  2OYH B;  4PV1 C;  1RO2 A;  2JEE A;  4C46 A;  4WY4 D;  2WVR A;  1PEO A;  5AVR B;  2EIA A;  3H32 A;  3TSI A;  1YIJ P;  5TJH A;  1A02 J;  3OAK A;  2ZT9 C;  1FR2 A;  3KDP B;  1SQX E;  3G0V A;  1U7M A;  1IFJ A;  5AVY B;  5KLV E;  4GR6 A;  2QJK B;  1KB9 D;  3HUS C;  2NZ2 A;  5HGM A;  1RE3 C;  1HUC A;  1OVV A;  1BE3 E;  5HGO A;  1KIL C;  5KAI E;  1RF1 C;  3CXC O;  4H13 D;  3TGU G;  5CCH A;  5CCG D;  1SQV J;  4YXW H;  3WU2 H;  1KYO D;  3RK3 B;  1SQQ J;  1YHQ P;  2FFD A;  2YMK A;  1BGY E;  3B5I A;  1L0L G;  4D6T G;  1NOH A;  4ZNC A;  3M9H A;  2W6B A;  2OQQ A;  1SVF A;  3NTN A;  1A8O A;  1L2P A;  2WSE J;  1T8Z A;  3CI9 A;  5KKZ C;  1NU1 E;  1DNY A;  2PEK A;  1M1J A;  1H8A A;  1YYC A;  3SSU A;  3N4X A;  1NO4 A;  2FXO A;  4NPD A;  3P05 A;  1L0N D;  4EDF A;  2PP6 A;  2OTL P;  5AW3 B;  1FOS E;  3NFQ A;  1M57 D;  1N7S B;  1S72 P;  2AXT E;  3V5B A;  1MV8 A;  3RK2 C;  1PFI A;  1M6E X;  1LTI C;  1FC2 C;  4IL6 H;  3MD0 A;  4R0M A;  4L75 A;  2GA1 A;  5JPA A;  2E1M A;  1NKN A;  1LT9 C;  3V4W A;  1IK9 A;  2NO8 A;  4EI2 A;  1DH3 A;  2WIT A;  1VQ7 P;  1T3J A;  2JKV A;  2P58 A;  3R2P A;  1GL2 B;  2K92 A;  2OYI B;  3WMM 0;  2XKM A;  5BU5 A;  3P8M C;  2BQ1 E;  1KZU B;  2MY5 A;  1SQB G;  1ZP0 C;  2KG9 A;  1M56 D;  1IO4 A;  1IUQ A;  4GOD A;  2AFE A;  4XRO A;  1EZV D;  4H2Y C;  2QM7 A;  1SFC D;  3USS A;  3DS1 A;  3R4Y A;  4U3F G;  2A45 H;  4H44 D;  1SS1 A;  1LTA C;  3H32 B;  2XND H;  4WY4 A;  3L75 E;  1X22 A;  1KQL A;  4W7Y A;  1RF0 C;  2O01 N;  2FVA A;  3VOP A;  4QMA A;  3PH0 A;  5BVZ A;  1OW8 A;  4Z1M H;  2PAJ A;  2KLU A;  1OVU A;  3V2R A;  3RG2 A;  1G2C A;  2WPT A;  5AW5 B;  3A0H E;  2QE7 H;  1RE4 C;  5KP6 B;  2YIU B;  2PEO A;  1CSB A;  4WB4 A;  3FGA D;  2LL8 A;  1URQ C;  2E76 D;  2ONT A;  2HLO A;  5AVX B;  2IDB A;  3L72 G;  3G26 A;  2QJP B;  3PTZ A;  3TNU B;  3UIA A;  2MJZ A;  1LT1 A;  5B66 E;  3Q3D A;  5GTI E;  2NPS A;  2WTY A;  1NTK K;  4RO0 A;  1M6N A;  1U7J A;  2YKP A;  2Q3I A;  1BE3 J;  1S2E A;  1W2E A;  2KGA A;  3B5N A;  2N1T A;  4PV1 D;  1SQP E;  1T3U A;  1IZN B;  4HYT B;  1BGY J;  1QLE D;  1WMK A;  1L0L D;  1PEM A;  1OWA A;  3B4S A;  2JYL A;  1SQX K;  2G3A A;  1NTM G;  2FQ1 A;  2ZT9 D;  4H2X C;  1K04 A;  4GIF A;  5B5E E;  5KLV K;  1LTG C;  2KZJ A;  5BS1 A;  5C39 A;  5KJ7 A;  1CW5 A;  3CL3 D;  4N78 D;  3CXH D;  1DX7 A;  2M8L A;  5H2F H;  1AVO A;  3B4Q A;  1BDD A;  3EQ2 A;  4PD4 D;  2PY8 A;  3L70 G;  4WVZ A;  3G4S P;  3DPH A;  1KIL D;  3O6Q A;  1DD3 A;  3GF7 A;  1JTH B;  2AXT H;  1E6J P;  2P9X A;  2HPC A;  2QJY C;  5DCK A;  3AE1 C;  1LWU B;  2E75 C;  2LIU A;  2GYK A;  2E74 B;  3CX5 D;  4UB6 E;  4PH0 A;  1PZQ A;  4XRQ A;  2KSE A;  1GU4 A;  2EG5 A;  2IPP A;  4XE5 B;  4YTP C;  2A45 I;  5HGL A;  1NU1 K;  1SFC A;  2C0X A;  2JDI H;  4NEO A;  3Q2Y A;  4DZO A;  2YXQ B;  3V2Q A;  2XU6 A;  3PLN A;  4AYC A;  3H1I G;  4UB8 E;  4Y28 J;  1SQB D;  2K88 A;  2C0W A;  2IFM A;  3BCC G;  4Y99 C;  2DW3 A;  1BCC E;  2AEM A;  5EFW B;  2R3S A;  3H1K G;  3ITK A;  3M0D A;  3RK2 D;  2W90 A;  1VQP P;  3TGU E;  3H47 A;  1KYO H;  2A06 E;  2ZXX A;  3CCU P;  2Q9I A;  1S5L X;  2GDY A;  3RBX A;  4K35 A;  1NTZ G;  3CCM P;  1L0L E;  1Y8A A;  4D6T E;  2WWW A;  3QWO C;  4H13 B;  3FWL A;  4ASV A;  1ZNV A;  3VMY A;  1JCC A;  2FYN C;  2I1K A;  4KT0 J;  5E79 H;  2R32 A;  2XV5 A;  1R5L A;  1RQV A;  3A0H H;  1YIT P;  3FXD A;  1BAJ A;  1LTT C;  2LF4 A;  1PGO A;  1L0N J;  3RBZ A;  1YQ3 C;  2JAZ A;  1QVF O;  2P67 A;  5AVU B;  2HFE D;  1KFN A;  4NPE A;  3BRT B;  1W5C E;  5APV A;  1VQL P;  1IC2 A;  5B66 H;  3CCJ P;  2E5Y A;  1ACP A;  3RK3 E;  4IFD K;  3M1M A;  1HF9 A;  5APW A;  1LTS C;  1GMJ A;  1LGH B;  1HJB A;  2YNY A;  3H1L G;  2PRR A;  1NGM B;  3ABV C;  3HD7 B;  3C8V A;  1SQQ E;  3MGN A;  3HD7 C;  4JQ0 D;  3CC2 P;  3EFG A;  1UIX A;  2XXM A;  2GM4 A;  1RE3 A;  3L36 A;  2KOO A;  3CCE P;  1SQB E;  2O1J A;  1FS0 E;  2HPC B;  3U1C A;  1RF1 A;  4JYB A;  1URQ D;  4HJG H;  5B5E H;  1H89 A;  2MD9 A;  5L8R J;  2GUV A;  4TT3 H;  2QA4 P;  3H4E A;  1GTW A;  3KZI E;  3D70 A;  4U3F E;  2OAR A;  1IMQ A;  2WSC J;  3IR9 A;  1JMB A;  1GDT A;  1R5S A;  1JM0 A;  3L70 D;  1SFC B;  2CQ8 A;  2M0B A;  4W80 A;  4H44 B;  4GKG A;  1USE A;  5AW9 B;  3VMZ A;  1SQP K;  2GZF A;  3GHG C;  1FDO A;  2J5U A;  2YKO A;  4UB6 H;  1EXI A;  4HH2 A;  2C9L Y;  1GW4 A;  4IPY A;  1N7S A;  1M7L A;  3C9I A;  1KV4 A;  1KYO I;  2AEJ A;  3M06 A;  4JF7 A;  2EFJ A;  2KOD A;  2KNC B;  3IF4 A;  1HVV A;  2PGD A;  3GZM A;  1VHN A;  3L72 E;  4XFZ A;  2CPB A;  2Z45 A;  3MZW B;  4UB8 H;  2KOS A;  1AVY A;  3T97 A;  1AUM A;  2M3B A;  3H1I D;  2E76 B;  3FWN A; 
#chains in the Genus database with same CATH homology
 1D1D A;  2M8N A;  5HGL A;  1S72 P;  2ONT A;  3G21 A;  1M74 A;  4WYM A;  5I4T G;  2Z44 A;  3DS4 A;  4PH1 A;  4COP A;  4U0A A;  1EIA A;  2OTJ P;  1N8R Q;  1M90 Q;  2PEI A;  4M0I A;  1M6E X;  1VQK P;  1VQ6 P;  3G26 A;  3CCR P;  1Q82 Q;  3CC2 P;  3HYB A;  1RO2 A;  1VQN P;  3CCQ P;  3OW2 O;  3Q20 A;  1PEO A;  4COC A;  5JPA A;  1K30 A;  2PEN A;  3DS5 A;  2E1M A;  2XXM A;  2EIA A;  2QEX P;  1VQO P;  1A43 A;  3G1G A;  4XFX A;  4U0F A;  1YIJ P;  3CCE P;  1M6N A;  1VQ7 P;  5F2O A;  5F2N A;  5HGN A;  3G1I A;  2XT1 A;  1YI2 P;  2PEM A;  1PEQ A;  3G0V A;  4U0B A;  1VQM P;  1RNI A;  4U0C A;  2QA4 P;  1YJ9 P;  3H4E A;  4GR6 A;  1VQP P;  4U0D A;  3H47 A;  2BQ1 E;  2Z46 A;  3WBH A;  2CWO A;  1W2B O;  5HGM A;  1K73 Q;  2OAR A;  3DS3 A;  4XFY A;  3CCU P;  3DTJ A;  3I55 P;  3I56 P;  1PEM A;  3HZQ A;  1IUQ A;  2XV6 A;  2JYL A;  3CCM P;  1Q7Y Q;  5HGO A;  4XRO A;  1QVG O;  3G6E P;  3CME P;  1VQ9 P;  1QRJ A;  1Q81 Q;  2DGY A;  3CXC O;  3G28 A;  1VQ4 P;  1PEU A;  3LRY A;  3DS1 A;  2PEQ A;  4QNB A;  2BHV A;  2PEJ A;  5BS1 A;  2BUO A;  3CD6 P;  2M8L A;  5BS2 A;  3G29 A;  1YHQ P;  1EOQ A;  3H0D A;  1VQ8 P;  3B5I A;  1M1K Q;  1YIT P;  1K9M Q;  1VQ5 P;  1KQS O;  3CC4 P;  3MGE A;  4GR2 A;  2PY8 A;  3G71 P;  3G4S P;  1YJN P;  2M8P A;  3RG6 C;  3E2D A;  4IPY A;  1BAJ A;  2LF4 A;  3DPH A;  2L6E A;  2JO0 A;  1KD1 Q;  2JYG A;  1A8O A;  1E6J P;  2P9X A;  1QVF O;  5DCK A;  2PEK A;  1Q86 Q;  1K8A Q;  2EFJ A;  2KOD A;  3VRL C;  3CMA P;  3CCV P;  4U0E A;  1VQL P;  1JJ2 O;  3CCS P;  2EG5 A;  4PH0 A;  4XFZ A;  1ZMB A;  3CCJ P;  2Z45 A;  3P05 A;  1KC8 Q;  3M1M A;  4XRQ A;  3NTE A;  1YJW P;  3CC7 P;  1RO0 A;  3DS0 A;  2OTL P;  2PEO A;  3CCL P;  5F2K A;  1AUM A;  1NJI Q;  3CPW O;  3DS2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...