2OTLP

Girodazole bound to the large subunit of haloarcula marismortui
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structures of Antibiotics Bound to the E Site Region of the 50 S Ribosomal Subunit of Haloarcula marismortui: 13-Deoxytedanolide and Girodazole.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S ribosomal RNA
total genus 48
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2007-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 2otlP03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 2otlP01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 2otlP02
1S72P 1VQMP 1KC8Q 1YJNP 1VQPP 1KD1Q 3CD6P 1M1KQ 3CMEP 1VQ6P 1VQNP 3CCEP 3CC4P 3CCJP 3CCMP 1VQKP 1QVFO 3OW2O 3G6EP 3CMAP 1YI2P 3CCRP 1K73Q 1Q82Q 2QEXP 1YJWP 2OTLP 3CXCO 3I55P 1YJ9P 1Q86Q 1K9MQ 3CC2P 1VQLP 3CCUP 1VQ5P 1YIJP 3G71P 3CPWO 1N8RQ 1NJIQ 3G4SP 1W2BO 1M90Q 1VQ7P 1QVGO 1Q7YQ 1JJ2O 3CCSP 3CCLP 1YHQP 3CC7P 1KQSO 1YITP 1Q81Q 1VQ9P 1VQOP 1K8AQ 3I56P 2OTJP 1VQ4P 3CCQP 3CCVP 1VQ8P 2QA4P
chains in the Genus database with same CATH superfamily
1HH0A 1N86A 2N9YB 4ZNCA 2QJYC 5KJ7C 3PTZA 5CJ4A 3G28A 3KZIH 5HGNA 1NTZG 1A02J 4A7PA 4IL6X 4WYMA 2ONTA 2IFMA 1EDKA 3GHGC 1YTZT 1JMMA 2H88C 1GL2C 5KAFH 2BCCJ 3MUDA 4NPFX 3DS5A 1VQOP 3V2QA 3L36A 1BE3G 4PD4H 2EG5A 4XE5B 1X0TA 2GA1A 1MFTA 5AW5B 2FVEA 5KLVG 4JBZA 3GHGB 1NU1E 1LWUC 2HG5D 2V7QJ 1H8AA 3RGUA 2IFNA 1DH3A 1U7MA 4PJ0E 1JCDA 2LIUA 3HZQA 2IBZG 5GTHH 2XXMA 2L91A 2IYPA 2QRXA 1E5WA 4GOEA 3FWNA 1KQLA 4UB8H 3H1LG 2WSEH 3M0DC 2PEOA 1JB0J 2H8PD 1FOSF 2JAZA 2FFDA 1LTJA 2BHVA 5L8RJ 1BCCG 1EMVA 3G6EP 2LKIA 3B71A 3G21A 2MKVA 5KP8B 1NU1J 1GMJA 1FE6A 2DW3A 2K37A 2ZXEB 2E75C 2AVAA 2FYUK 2OQQA 4W7YA 2KSJA 2CNRA 1URQD 1L0LD 3A5TA 2C0WA 2WPQA 3CE7A 1RF0C 2E74C 2EHTA 3USSA 2KS1B 2KG6A 1JY3N 3G1IA 5APQA 5H2FE 3V4WA 4BRYA 4DT0A 5M1BA 1AJYA 3SWFA 2YIUC 3CXHI 2LXCB 2W27A 1YHQP 4BPGA 1KYOE 2L5GB 2K88A 2JO1A 1PL5A 2Q3IA 2KZIA 1MZ8A 2M5AA 1PPJE 1HBWA 2PP6A 3CC4P 4AQRD 1ZNVA 3RK2C 3H1LE 2QE7H 3U43A 1K04A 3KZIE 1CI6A 1W5CE 2P1JA 1GU4A 3HYBA 3L73D 3M9BA 1N73B 2W6JH 2E42A 2FFDC 5HGLA 2XZRA 2Z4EA 3RL0D 1S4XA 2JO0A 2R32A 1GXGA 1L0NJ 1GXHA 5KLIC 1FJPA 2W8ZA 1AV1A 1CSBA 5APVA 1MZ9A 2Z46A 5BVZA 1ZOYC 3LIEA 3BRVB 2FFDB 1SS1A 1HY8A 1DNYA 1FBMA 3BCCD 1RF1C 3EWKA 1M90Q 5KLIB 4C7NA 5TJHA 1M1JA 3AE9C 3IR9A 1N7SD 1VKUA 2P7JA 3D71A 2QSIA 4D6TG 2MVVA 1SQPK 2N98A 3VYIA 5H2FH 1FS0E 2AF8A 3RL0g 1NTKK 2KGEA 1Q86Q 5APXA 3HTKA 1NH4A 1IFPA 3TNUB 3VMYA 3O6QB 2WSSH 3A7OA 3RL0B 1AYIA 1VF5D 3I5CA 1KC8Q 4WVZA 2KS1A 4QMAA 3H1LD 3L70J 2FHSC 1L4AB 2Y0DA 4Y28J 2OGUA 1ZRTD 3AECC 1RH5B 2N50A 3FGAD 1Z56A 2OYHA 2D2CD 5KJ7A 1EDIA 1NTMK 2WQYC 1M7LA 3Q3DA 4AYCA 4PWVB 3H1IE 3FX0A 3WBHA 1P84H 5TISE 2DGYA 4DOJA 1HGVA 1USDA 2R44A 2WSEJ 2KOGA 1SFCB 3PH0A 2K9JB 5KKZB 3L75J 3TGUJ 2N1TA 1ZMEC 2JDIH 1L0LG 4H0LD 1JOCA 2IZ0A 4HJGH 2BQ1E 3B4SA 1UJZA 4H44D 2KNCB 4C7RA 5KLVJ 1LTBC 4XA4A 4IL6H 3MHVA 2IYOA 1YI2P 1YJWP 5AW6B 2W90A 2YKPA 4LC1A 2Q7CA 1GK6A 1T2KD 2L9FA 1HGZA 3L74G 2V4HA 2VLPA 4WY4B 2FQ1A 2AFDA 3W67A 3EFFK 3AEGC 2PGDA 1ZRTE 4N3YB 3G0VA 5AVTB 2VSQA 2BASA 2WSFH 1ZXGA 1SQXG 3L72D 3H1JJ 2XZ1C 3IN6A 3H1ID 2D2CB 3T97A 3CWBJ 2ZVNB 1S1CX 5KAIH 2BUOA 1T3JA 1S72P 2FQ2A 4IOIH 1FU1A 2O1KA 2EIAA 3OW2O 4GODA 2K0YA 2FAEA 1GK4A 4WB4A 2WPSA 5KLVE 1OVRA 4H2XC 4N6JA 4D6TD 1SFCD 3L4FA 2R5BA 1BE3E 3BASA 3H1KJ 2FBWC 2N1TB 1KYOI 3E7KA 1QRJA 1IMPA 5GTIE 1T6AA 4WBAA 1IMQA 1YJNP 3V6IA 1CI6B 1GD2E 1IJDB 4H44B 1W2EA 3EFGA 1CEIA 3CXCO 5CCHD 3H4EA 2KI7B 1BGYD 4RESB 4UHPB 1KORA 4B86A 1WRGA 2KK7A 5CBOA 3AE7C 1X8YA 2Z5HA 2O3JA 2AXTE 1URQB 1H88A 2JWAA 1EZVE 3Q5SA 1H0TA 1DX7A 3NXSA 4LGDE 1BSNA 1A43A 1NTKJ 1ZP0C 3BCCJ 3AEAC 2X2BA 1KFMA 1ZMBA 2M8PA 2A06E 1ZV8A 2H7HA 1SVFA 2OTKE 3H25A 1GW3A 1SQBG 1JUNA 2MF4A 2XV5A 2KIKA 2FQ0A 2R3CA 1NGMB 1RNIA 4YXDC 3V5BA 1SQVD 1PP9G 1SQXE 3CLQA 1PEOA 3CX5D 5K5GB 3N4XA 3HE4B 2NPSA 3BCCE 4BPHA 2B9BA 4I7ZC 3A0HH 2FYNC 4IPYA 4JPZB 3HUSA 2R3SA 1BGYE 3D70A 2N9BA 4L74A 1G1IA 3WUUA 1J2JB 1QX8A 3DS0A 2OTJP 5BS1A 2RH0A 3RK3E 1KYOD 1E6JP 2YIUB 2YO2A 5CHXA 2QM7A 2Q3EA 3H1IG 1MKMA 5E79H 4IFMA 2B89A 2ZT9B 3VMZA 5AVXB 1H0TB 5B66E 1VQ8P 1DEEG 3QWOC 3L75G 3TGUG 2GDYA 5KLVK 1N73C 5AW3B 1PGQA 2GZIA 4XFZA 3VMAA 3SFDC 1IFDA 3KDPB 3M9QA 4QKOA 5HGMA 1PEMA 3HE5A 2LL8A 3QH9A 4NPEA 1M56D 3CX5E 2K9JA 2QJYB 4DZOA 4COCA 1VHNA 3HUSC 3O8ZA 1LGHB 3AE1C 4BXLA 2JU2A 3L74D 2LTEA 3PP5A 2ZJSE 1HUCA 1YBKA 3KXDA 3JCUH 4LLHA 4R0MA 1SQVK 1NHLA 2OYHB 4GKGA 2VLQA 2HODB 1GDTA 2V7QH 2L4BA 3VMXA 3L71E 4U0EA 4H44C 2IX7C 5AVVB 1AQ5A 3L72G 3F5HA 1BGYJ 2B87A 2AEJA 1YTZI 1SQPJ 2E76D 1SQBD 2P58A 1JY2P 2GDWA 3MGNA 2FACA 1Q2NA 1PPJG 1PEUA 1SQQD 1SP4A 3P8CD 4WY4A 3H1HD 2E43A 5KLVD 5KAIE 1IC2A 2P10A 3NTEA 1EXIA 1ACPA 1LT9A 3L75E 3TGUE 1JTHB 2CQ8A 5APSA 5JPAA 1FDMA 3HRNA 2NPSB 2ZFCA 3P8MC 2KOOA 4C46A 3MUDC 1EC5A 4RKUJ 4HKGA 2E5YA 1YJ9P 2P67A 4UB6E 3D6YA 3Q5RA 1HF9A 1L4AD 1S2EA 1VQ4P 2PY8A 3L72J 2FKWB 2GZFA 2BCCG 2Y0CA 2POHA 3EQ2A 1OVVA 1URQA 3H1KD 1VQ7P 1YYCA 2CPSA 1Z6MA 1EOQA 2OYOA 1NAYA 2N6ZA 2B88A 1AUMA 3L37A 3HD7B 3BRTB 4H0LB 1N7SB 1AFOA 1BE3J 3IAOA 5B5EH 2I1KA 2M3BA 1PIXA 3DPHA 5APYA 3H32A 3B5NB 1ZR4A 3C1LA 3CCSP 2KOQA 5KTBA 5KKZC 1NU1G 1IFMA 4JYBA 1R5LA 1NVOA 1OX3A 2Y9YA 1NQ4A 5BU8B 4U7JA 4OGQB 3EJDA 1L0NE 4PD4D 1IFIA 3CWBE 1BAJA 1M1JB 2KW2A 4U0FA 2KORA 1LNQA 1G1JA 3U59A 3L73J 2JEEA 1JTHA 1E0HA 2QEXP 2W6AA 1P84D 2E75D 1RF1A 2Z44A 5AVZB 3II6A 1VQ9P 3R4YA 1PPJD 5AVRB 3H1HG 2I8DA 1KD1Q 3CD6P 3MD0A 2LOLA 3Q20A 2I1JA 5AW0B 5DCKA 4MRTC 2MVUA 3CXHE 2LR2A 3HD7C 2O1JA 3E1IA 2MD9A 2JYLA 5APUA 4U0BA 1RQUA 4GDOA 1VL2A 4UB6H 4KHXA 2SPZA 3HD7D 1KFNA 3N7NA 2WPVB 2N1TC 3KPEA 2KB7P 4I6MC 1CZQA 3U1CA 5DJUB 4I2LC 4XFJA 4OVNF 1NTZJ 4DCKA 2ROQA 3W68A 2Q1KA 5EFWB 2WSCJ 3PJSK 4U3FG 2CPBA 1LTIC 2WT7A 2ZT9D 5AVSB 3WU2E 1XTCC 1AF8A 1P84I 1S5LE 3DTJA 2J59M 2Z45A 1IK9A 4H13C 2GM4A 2JU1A 2KOSA 5BU5A 1GU5A 2CWOA 1RY3A 1G2CB 3NY7B 1OW7A 1VQPP 2K2QA 3P8CE 2BEQD 1L2PA 3A0BH 2FYZA 3O6QA 4U3FE 1KLPA 2BEZF 2JP3A 1KZUB 2E74B 1SQBE 5CCGA 5AW8B 1L0LJ 2UWJE 4K3AA 2LKMA 1EIAA 2ZYAA 3DS1A 1AQTA 1QL2A 1JCCA 2AXTH 3DS2A 5AW9B 1SQQE 2QA4P 2E1MA 4AUWA 3H1HE 1VQKP 1TU3F 2NO8A 2PEMA 4MN4C 2OTLP 1AVOA 3AEFC 4H13B 3K5BA 3GZLA 1N2DC 4C7NB 3P05A 2KSEA 1SQXD 1NKNA 1AA0A 2FYUD 5HVCA 1SQQJ 1IK7A 2WVRA 2K3RA 4JQ0D 3CCRP 2XT1A 1SQBJ 1ZW0A 3GLMA 4PV1D 2M5AB 2N5IA 3ITKA 1SQXJ 2ZYDA 3H1JG 1D7MA 3SFEC 1QGKB 1FAVA 4BRYB 3HD7A 1HQBA 1J1EB 1IFNA 3CMAP 1ZLLA 2RKLA 1KYOH 2IDBA 2NPSD 2HODA 4PJ0H 1PV3A 3KHUA 3CX5H 2HLOA 1IZNB 1Q90D 3BATA 3L74J 2PAJA 1BXIA 1DIPA 4N78E 2CGQA 4M0IA 4PD4E 2YKOA 3CWBG 2HYNA 3GKLC 1L0NG 3DS3A 2AXCA 1LJ2A 1PP9D 1RE3C 1LTJC 1GTWA 1BSHA 2ZXXA 1KB9E 2M0BA 1OVUA 2C9LY 5AW4B 2XNDH 4ASWA 4ZKPA 5KAFE 1NTZK 2K1AA 1M8OB 3CMEP 1JY2N 1LTJB 2FXMA 2M8LA 2O01J 2KR5A 3L74E 4EI2A 3M0AA 5AVYB 2WZ7A 2PEJA 1YIJP 3C9IA 4GR6A 3UIAA 5TISH 2WSCH 4H13D 4L73A 3LRYA 1FZCA 3KQGA 1OWAA 1FZBA 1EDJA 2QIWA 2BCCE 3RK3B 1VQ6P 3OA7A 2WMMA 1VDFA 4BWNA 2ITAA 3LW5J 1M74A 3CC2P 3S1KA 1KV4A 1J1EC 5CZDB 1OW8A 3L75D 3TGUD 3MGEA 2FXOA 3VTPC 1RF1B 4W80A 1HVVA 2QVAA 3PLNA 3G1GA 2K0DX 1G2CA 3Q2YA 5F2OA 3H0DA 3B5NC 2ERHA 2XZ0D 1VPCA 3TF5A 3P7KA 1NTMD 4Y99C 1SLQA 2FVAA 2KODA 1OFCX 5APTA 3M9HA 2Y0EA 3B4QA 4PH0A 1YITP 1J1DC 2E75B 1JY3O 2KNCA 5EJDA 1LTTC 4F37A 2K94A 2KZJA 3AEDC 5F2NA 1K30A 4EDFA 1EZVD 2HFED 2PEIA 1S9KE 2NZ2A 4WY4D 1P84E 3M91A 1NTKD 1JM0A 3WU2H 3RBXA 1PGPA 2M5RA 1HJBA 3MP7B 3H32B 1BCCJ 3E2DA 2FYUJ 2KGAA 3AEEC 1OW6A 2PENA 2CG5B 1Y47A 1N7SA 2DNWA 4QNBA 3GJNA 3DS4A 1EDLA 3FXDA 4I7ZB 4U3FD 3A2AA 1R5SA 3G71P 4OWFA 1FZFA 1NTZD 3CXHD 3H1IJ 1RE4A 2JWDA 3NMDA 1PFIA 4YXWH 4XFYA 2C9NY 3AE2C 2J58A 2KGCA 3FXEA 4KJMA 4K35A 3ABVC 2M3EA 1FC2C 2A45G 2HPCA 3R2PA 4HH2A 1YQ4C 2WPTA 2YMKA 2MJZA 3Q1MA 4NEOA 1NKZB 1M1JC 2K5XA 4I1LA 3TYYA 1K8AQ 3CCQP 2KG9A 2W83C 3PRJA 4XFXA 2CK3H 3GG2A 1FOSE 1OZHA 1Q82Q 2KXPB 2KOPA 1K9MQ 1NOHA 1JEKA 3AE4C 3H1JD 3MIWA 2QNWA 3V4QA 3CC7P 3H1KE 1Q81Q 5AVQB 4XRQA 1LTAC 3B5NA 4JYCA 4BPFA 2YXQB 1L4AC 3RBZA 1R8EA 3P32A 1IFJA 1U57A 1LWUB 3B8EB 3GMAA 2Q5UA 1HTLC 3CCLP 1LT1A 2ZAEB 4PXHB 1L0IA 1SQVE 1SFCC 3G3ZA 1NTKG 3A0BE 3LW5H 1BGYG 3M0DA 1UNKA 2AEMA 1PGJA 4N78D 3A0HE 2A45I 3JSVC 4KT0J 3M1MA 3JC22 1FDOA 5I4TG 5KP7B 3G9RA 4L76A 1KILB 1FZCC 3PHLA 2C0XA 2KUBA 3VP8A 1PP9E 1SQBK 2XDJA 4U0CA 1NU1K 2E5TA 2MR7A 2M8RA 1EZVG 2JGPA 2JBGA 4JF7A 1VQMP 2JR8A 2PRRA 2WT7B 1NWQA 3OJAB 1YQ3C 2GZJA 1SFCA 3E1RA 3D6ZA 2WITA 3CCUP 3CPWO 2Q9IA 2N5HA 1DEBA 3CI9A 1EXJA 3TSIA 2JQ4A 1J1DB 1T2KC 2KWLA 1OIPA 4L75A 1Y9BA 1KQFB 5GTIH 3CCJP 3S9OA 2PFXA 1LT9B 2FYNB 2XV6A 4DG9A 1RQVA 3AE3C 1HJ0A 4IL6E 4PD4I 4H0LC 3Q5PA 1MFZA 1A8OA 2RN0A 3WMM0 1JNMA 4IFFA 1DD4A 1RF0A 2IZ1A 2GUSA 1NTME 1FZAA 5AVWB 4YPCA 1VQLP 4GT1A 4OGQC 3VOPA 2O01N 1NAFA 3GHGA 1KMIZ 1KILC 1L0NK 2PEKA 3G29A 2YKQA 5C39A 4H2YC 1BCCD 1M6EX 3MTUE 4PV1B 3B5ND 2IBZD 1RE4C 3VN0A 1KILD 3V2RA 1A02F 3G4SP 4O9BA 5B66H 2WTYA 4OGQD 3VP9A 1Y8AA 2QJKC 2LXBA 1RHZB 1KQSO 4ZKUA 3VRLC 3WUTA 5BS2A 3OAKA 2KLVA 1JY3P 2IBZI 1FZEA 3HE5B 1SQPE 3H1KG 2L22A 4Z1MH 1NTKE 2YO3A 2QJPC 4D6TJ 3BVHA 2JB0A 1X79B 1NTMJ 3L71J 2K92A 5DJTB 2XU6A 3L70G 1FR2A 3AE6C 4H2WC 2OYIA 4EYYQ 1QVFO 2M8NA 1PZQA 3L73G 3H47A 3H1HJ 3TNUA 1N7LA 4YTPC 1NU1D 2FADA 3JCUE 1L0LE 5F2KA 4ASVA 2PEQA 3RG2A 2LPKA 2EFJA 1ZR2A 3GF7A 2K9YA 1S3JA 1T3UA 1M1KQ 2FXPA 2JJLA 2WPRA 2G8YA 1FZCB 1CW5A 2GZGA 4R4MA 2R5DA 5HV8A 1PGOA 1S5LH 3RG6C 2Q6QA 1JJ2O 1T8KA 1GZLA 3FWLA 5CMZA 2MY5A 1MUUA 4W7ZA 2NPSC 3V2PA 1LTGC 2ZYGA 2QJKB 3MZWB 2A06D 2P9XA 3CCEP 2E74D 1X3OA 1PP9J 2XKMA 3L71G 1URQC 2N6YA 3NTNA 2O01H 3KYQA 2JKVA 1NYHA 5CCHC 3EJEA 2GYKA 2OARA 2VLNA 5APWA 1WMKA 1JO5A 3TDKA 4U0DA 3M06A 4HB1A 3I55P 1KB9I 4D6TE 1KILA 4UB8E 1QLED 1LP1A 7CEIA 1L0ND 3GZMA 3CX5I 2GDXA 2QM8A 4RO0A 5HGOA 1K73Q 1M6NA 3IF4A 2W6BA 1S9KD 1SQXK 2OYHC 4NPDA 1SQQK 1USEA 4OH8B 4U0AA 2G3AA 3CCVP 1QL1A 3CCMP 4R4LA 4IZ6A 3SSUA 2KP8A 4GOFA 3L73E 1RE3A 1GL2D 5GTHE 1MV8A 4ZMDA 1QEXA 2GUVA 1IUQA 4EOTA 4DJGA 3V2NA 1L4AA 4M3LA 2WWWA 3CL3D 2ZT9C 5KJ7D 1EZVI 1RO2A 2A45H 4WY4C 2KGDA 3AE8C 2XNXA 4EIJA 2H89C 1UIIA 3LMOA 1BCCE 2L6EA 2N1TD 4U3FJ 1KQGB 2LMLA 3WUVA 2IBZE 1K05A 4Y99B 3SWYA 1F80D 1PEQA 1X22A 5CBNA 1L0LK 2AEFA 4PH1A 3RK2B 2YNYA 1WT6A 3HUSB 3RK3D 2A06G 2D2CC 2AFEA 1DD3A 4COPA 1L0HA 1XTGB 5CCGC 1UIXA 3C8VA 5AW1B 1VQNP 2GZEA 3HE4A 3L71D 3CXHH 1VF5C 2KYVA 2NRGA 1SQPD 3GW6A 3L72E 4TT3H 3H1JE 1VQ5P 1NTMG 2VRSA 3G26A 5EW5E 1FJKA 2HR3A 5CCHA 1NTZE 3H1LJ 4XROA 3L70D 2H43A 3I56P 3B5IA 1GL2B 2J5UA 2BCCD 4IFDK 3GF3A 1RO0A 1SQVJ 2L0QA 1N7SC 4RJTA 2KLUA 1OXZA 2IPPA 1NO4A 1OMIA 2KG8A 1M57D 5B5EE 3NFQA 1JY2O 2WSFJ 3ZDMA 3CWBD 1LWUA 1LP1B 3L35A 1U7JA 4GIFA 4GR2A 3RL0C 3HTKB 1NJIQ 2MR8A 1W2BO 3F89A 1QVGO 2K93A 2ZVOB 5CJ0A 1GL2A 1AVYA 1GPJA 2VLOA 1BDCA 1KN7A 2P2UA 3RK2D 2Z5IA 1GW4A 1BDDA 2QG4A 1IO4A 1SQQG 5AW2B 2YMYA 4TLFA 1VF5B 1JMBA 1FZGA 1ZN5A 3H6PA 3AE5C 3L70E 1BE3D 1N73A 1SQVG 1D1DA 2EHSA 1LTSC 2HPCB 2Y9ZA 2FYUG 5AVUB 3T97B 1FDIA 1SQPG 3BCCG 4HYTB 3AEBC 4PV1C 2YXRB 1T8ZA 1KB9D 2B87B 2FYUE 2OYIB 2JYGA 2LIWA 5CCGD 3U1AA 1OR5A 2PNGA 1E79H 1N8RQ 5E79E 1KILE 2FY8A 3RK3C 1KTMA 4CPGA 3EJBA 3TK1A 1HWTC 2OYIC 1S5LX 3IFMA 5AW7B 2FVFA 1H89A 2E76B 3A3YB 4HKZH 2QJPB 1EQ7A 3SWKA 1LT9C 3LIDA 3S4RA 1X9VA 4WWIA 2E76C 4CA3A 1Q7YQ 5KP6B 2RMZA 1DV5A 2LF4A 2K0XA 1KB9H
chains in the Genus database with same CATH topology
1S72P 1VQMP 1KC8Q 1VQ6P 2L6EA 2EIAA 3G28A 4U0EA 3OW2O 3CCRP 2XT1A 3G1IA 1M74A 4U0DA 5HGNA 3I55P 4IPYA 1PEQA 3CC2P 3CCUP 3DPHA 3CPWO 4PH1A 4WYMA 2ONTA 3CCSP 1YHQP 3MGEA 1K8AQ 1QRJA 3WBHA 3DS0A 2OTJP 4COPA 5BS1A 3DS5A 3CCQP 3G1GA 2DGYA 1VQOP 4XFXA 1YJNP 1D1DA 5F2OA 1E6JP 3H0DA 2EG5A 1VQNP 3CC4P 3CCJP 1PEUA 1BAJA 1QVFO 2M8NA 5HGOA 3CMAP 1K73Q 1M6NA 3H47A 1Q82Q 2XV6A 3CXCO 1K9MQ 2KODA 3DTJA 1VQ5P 3HYBA 3H4EA 3NTEA 2Z45A 4U0FA 3G26A 5HGLA 4PH0A 2BQ1E 3CC7P 1YITP 1Q81Q 2CWOA 3HZQA 4XROA 5JPAA 3I56P 4XRQA 2JO0A 3B5IA 5F2KA 2PEQA 1A8OA 4U0AA 2EFJA 4M0IA 3CCVP 1VQ8P 2XXMA 1RO0A 1VQPP 1M1KQ 2Z46A 3CCMP 5F2NA 1K30A 2JYGA 1YI2P 2QEXP 2PEIA 3DS3A 1YJWP 1YJ9P 1A43A 4XFZA 1VQLP 2Z44A 1N8RQ 3RG6C 1M90Q 2PEOA 1JJ2O 3CCLP 5HGMA 1PEMA 1IUQA 1VQ9P 2PEKA 1EIAA 3DS1A 3E2DA 3G29A 1ZMBA 2M8PA 3DS2A 1VQ4P 2QA4P 2PENA 1KD1Q 2PY8A 1M6EX 3CD6P 2E1MA 2BHVA 3Q20A 3M1MA 2P9XA 3CCEP 3CMEP 2M8LA 4COCA 1VQKP 5I4TG 3G0VA 4QNBA 3G6EP 2PEMA 3DS4A 4GR2A 2OTLP 5DCKA 1Q86Q 1RNIA 1RO2A 3G21A 2PEJA 1YIJP 3G71P 4GR6A 1NJIQ 3G4SP 1W2BO 2JYLA 1VQ7P 1QVGO 1Q7YQ 4U0BA 3P05A 1EOQA 4U0CA 1KQSO 3LRYA 2LF4A 4XFYA 3VRLC 2OARA 1PEOA 2BUOA 1AUMA 5BS2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S72 P;  1VQM P;  1KC8 Q;  1YJN P;  1VQP P;  1KD1 Q;  3CD6 P;  1M1K Q;  3CME P;  1VQ6 P;  1VQN P;  3CCE P;  3CC4 P;  3CCJ P;  3CCM P;  1VQK P;  1QVF O;  3OW2 O;  3G6E P;  3CMA P;  1YI2 P;  3CCR P;  1K73 Q;  1Q82 Q;  2QEX P;  1YJW P;  2OTL P;  3CXC O;  3I55 P;  1YJ9 P;  1Q86 Q;  1K9M Q;  3CC2 P;  1VQL P;  3CCU P;  1VQ5 P;  1YIJ P;  3G71 P;  3CPW O;  1N8R Q;  1NJI Q;  3G4S P;  1W2B O;  1M90 Q;  1VQ7 P;  1QVG O;  1Q7Y Q;  1JJ2 O;  3CCS P;  3CCL P;  1YHQ P;  3CC7 P;  1KQS O;  1YIT P;  1Q81 Q;  1VQ9 P;  1VQO P;  1K8A Q;  3I56 P;  2OTJ P;  1VQ4 P;  3CCQ P;  3CCV P;  1VQ8 P;  2QA4 P; 
#chains in the Genus database with same CATH topology
 1HH0 A;  1N86 A;  2N9Y B;  4ZNC A;  2QJY C;  5KJ7 C;  3PTZ A;  5CJ4 A;  3G28 A;  3KZI H;  5HGN A;  1NTZ G;  1A02 J;  4A7P A;  4IL6 X;  4WYM A;  2ONT A;  2IFM A;  1EDK A;  3GHG C;  1YTZ T;  1JMM A;  2H88 C;  1GL2 C;  5KAF H;  2BCC J;  3MUD A;  4NPF X;  3DS5 A;  1VQO P;  3V2Q A;  3L36 A;  1BE3 G;  4PD4 H;  2EG5 A;  4XE5 B;  1X0T A;  2GA1 A;  1MFT A;  5AW5 B;  2FVE A;  5KLV G;  4JBZ A;  3GHG B;  1NU1 E;  1LWU C;  2HG5 D;  2V7Q J;  1H8A A;  3RGU A;  2IFN A;  1DH3 A;  1U7M A;  4PJ0 E;  1JCD A;  2LIU A;  3HZQ A;  2IBZ G;  5GTH H;  2XXM A;  2L91 A;  2IYP A;  2QRX A;  1E5W A;  4GOE A;  3FWN A;  1KQL A;  4UB8 H;  3H1L G;  2WSE H;  3M0D C;  2PEO A;  1JB0 J;  2H8P D;  1FOS F;  2JAZ A;  2FFD A;  1LTJ A;  2BHV A;  5L8R J;  1BCC G;  1EMV A;  3G6E P;  2LKI A;  3B71 A;  3G21 A;  2MKV A;  5KP8 B;  1NU1 J;  1GMJ A;  1FE6 A;  2DW3 A;  2K37 A;  2ZXE B;  2E75 C;  2AVA A;  2FYU K;  2OQQ A;  4W7Y A;  2KSJ A;  2CNR A;  1URQ D;  1L0L D;  3A5T A;  2C0W A;  2WPQ A;  3CE7 A;  1RF0 C;  2E74 C;  2EHT A;  3USS A;  2KS1 B;  2KG6 A;  1JY3 N;  3G1I A;  5APQ A;  5H2F E;  3V4W A;  4BRY A;  4DT0 A;  5M1B A;  1AJY A;  3SWF A;  2YIU C;  3CXH I;  2LXC B;  2W27 A;  1YHQ P;  4BPG A;  1KYO E;  2L5G B;  2K88 A;  2JO1 A;  1PL5 A;  2Q3I A;  2KZI A;  1MZ8 A;  2M5A A;  1PPJ E;  1HBW A;  2PP6 A;  3CC4 P;  4AQR D;  1ZNV A;  3RK2 C;  3H1L E;  2QE7 H;  3U43 A;  1K04 A;  3KZI E;  1CI6 A;  1W5C E;  2P1J A;  1GU4 A;  3HYB A;  3L73 D;  3M9B A;  1N73 B;  2W6J H;  2E42 A;  2FFD C;  5HGL A;  2XZR A;  2Z4E A;  3RL0 D;  1S4X A;  2JO0 A;  2R32 A;  1GXG A;  1L0N J;  1GXH A;  5KLI C;  1FJP A;  2W8Z A;  1AV1 A;  1CSB A;  5APV A;  1MZ9 A;  2Z46 A;  5BVZ A;  1ZOY C;  3LIE A;  3BRV B;  2FFD B;  1SS1 A;  1HY8 A;  1DNY A;  1FBM A;  3BCC D;  1RF1 C;  3EWK A;  1M90 Q;  5KLI B;  4C7N A;  5TJH A;  1M1J A;  3AE9 C;  3IR9 A;  1N7S D;  1VKU A;  2P7J A;  3D71 A;  2QSI A;  4D6T G;  2MVV A;  1SQP K;  2N98 A;  3VYI A;  5H2F H;  1FS0 E;  2AF8 A;  3RL0 g;  1NTK K;  2KGE A;  1Q86 Q;  5APX A;  3HTK A;  1NH4 A;  1IFP A;  3TNU B;  3VMY A;  3O6Q B;  2WSS H;  3A7O A;  3RL0 B;  1AYI A;  1VF5 D;  3I5C A;  1KC8 Q;  4WVZ A;  2KS1 A;  4QMA A;  3H1L D;  3L70 J;  2FHS C;  1L4A B;  2Y0D A;  4Y28 J;  2OGU A;  1ZRT D;  3AEC C;  1RH5 B;  2N50 A;  3FGA D;  1Z56 A;  2OYH A;  2D2C D;  5KJ7 A;  1EDI A;  1NTM K;  2WQY C;  1M7L A;  3Q3D A;  4AYC A;  4PWV B;  3H1I E;  3FX0 A;  3WBH A;  1P84 H;  5TIS E;  2DGY A;  4DOJ A;  1HGV A;  1USD A;  2R44 A;  2WSE J;  2KOG A;  1SFC B;  3PH0 A;  2K9J B;  5KKZ B;  3L75 J;  3TGU J;  2N1T A;  1ZME C;  2JDI H;  1L0L G;  4H0L D;  1JOC A;  2IZ0 A;  4HJG H;  2BQ1 E;  3B4S A;  1UJZ A;  4H44 D;  2KNC B;  4C7R A;  5KLV J;  1LTB C;  4XA4 A;  4IL6 H;  3MHV A;  2IYO A;  1YI2 P;  1YJW P;  5AW6 B;  2W90 A;  2YKP A;  4LC1 A;  2Q7C A;  1GK6 A;  1T2K D;  2L9F A;  1HGZ A;  3L74 G;  2V4H A;  2VLP A;  4WY4 B;  2FQ1 A;  2AFD A;  3W67 A;  3EFF K;  3AEG C;  2PGD A;  1ZRT E;  4N3Y B;  3G0V A;  5AVT B;  2VSQ A;  2BAS A;  2WSF H;  1ZXG A;  1SQX G;  3L72 D;  3H1J J;  2XZ1 C;  3IN6 A;  3H1I D;  2D2C B;  3T97 A;  3CWB J;  2ZVN B;  1S1C X;  5KAI H;  2BUO A;  1T3J A;  1S72 P;  2FQ2 A;  4IOI H;  1FU1 A;  2O1K A;  2EIA A;  3OW2 O;  4GOD A;  2K0Y A;  2FAE A;  1GK4 A;  4WB4 A;  2WPS A;  5KLV E;  1OVR A;  4H2X C;  4N6J A;  4D6T D;  1SFC D;  3L4F A;  2R5B A;  1BE3 E;  3BAS A;  3H1K J;  2FBW C;  2N1T B;  1KYO I;  3E7K A;  1QRJ A;  1IMP A;  5GTI E;  1T6A A;  4WBA A;  1IMQ A;  1YJN P;  3V6I A;  1CI6 B;  1GD2 E;  1IJD B;  4H44 B;  1W2E A;  3EFG A;  1CEI A;  3CXC O;  5CCH D;  3H4E A;  2KI7 B;  1BGY D;  4RES B;  4UHP B;  1KOR A;  4B86 A;  1WRG A;  2KK7 A;  5CBO A;  3AE7 C;  1X8Y A;  2Z5H A;  2O3J A;  2AXT E;  1URQ B;  1H88 A;  2JWA A;  1EZV E;  3Q5S A;  1H0T A;  1DX7 A;  3NXS A;  4LGD E;  1BSN A;  1A43 A;  1NTK J;  1ZP0 C;  3BCC J;  3AEA C;  2X2B A;  1KFM A;  1ZMB A;  2M8P A;  2A06 E;  1ZV8 A;  2H7H A;  1SVF A;  2OTK E;  3H25 A;  1GW3 A;  1SQB G;  1JUN A;  2MF4 A;  2XV5 A;  2KIK A;  2FQ0 A;  2R3C A;  1NGM B;  1RNI A;  4YXD C;  3V5B A;  1SQV D;  1PP9 G;  1SQX E;  3CLQ A;  1PEO A;  3CX5 D;  5K5G B;  3N4X A;  3HE4 B;  2NPS A;  3BCC E;  4BPH A;  2B9B A;  4I7Z C;  3A0H H;  2FYN C;  4IPY A;  4JPZ B;  3HUS A;  2R3S A;  1BGY E;  3D70 A;  2N9B A;  4L74 A;  1G1I A;  3WUU A;  1J2J B;  1QX8 A;  3DS0 A;  2OTJ P;  5BS1 A;  2RH0 A;  3RK3 E;  1KYO D;  1E6J P;  2YIU B;  2YO2 A;  5CHX A;  2QM7 A;  2Q3E A;  3H1I G;  1MKM A;  5E79 H;  4IFM A;  2B89 A;  2ZT9 B;  3VMZ A;  5AVX B;  1H0T B;  5B66 E;  1VQ8 P;  1DEE G;  3QWO C;  3L75 G;  3TGU G;  2GDY A;  5KLV K;  1N73 C;  5AW3 B;  1PGQ A;  2GZI A;  4XFZ A;  3VMA A;  3SFD C;  1IFD A;  3KDP B;  3M9Q A;  4QKO A;  5HGM A;  1PEM A;  3HE5 A;  2LL8 A;  3QH9 A;  4NPE A;  1M56 D;  3CX5 E;  2K9J A;  2QJY B;  4DZO A;  4COC A;  1VHN A;  3HUS C;  3O8Z A;  1LGH B;  3AE1 C;  4BXL A;  2JU2 A;  3L74 D;  2LTE A;  3PP5 A;  2ZJS E;  1HUC A;  1YBK A;  3KXD A;  3JCU H;  4LLH A;  4R0M A;  1SQV K;  1NHL A;  2OYH B;  4GKG A;  2VLQ A;  2HOD B;  1GDT A;  2V7Q H;  2L4B A;  3VMX A;  3L71 E;  4U0E A;  4H44 C;  2IX7 C;  5AVV B;  1AQ5 A;  3L72 G;  3F5H A;  1BGY J;  2B87 A;  2AEJ A;  1YTZ I;  1SQP J;  2E76 D;  1SQB D;  2P58 A;  1JY2 P;  2GDW A;  3MGN A;  2FAC A;  1Q2N A;  1PPJ G;  1PEU A;  1SQQ D;  1SP4 A;  3P8C D;  4WY4 A;  3H1H D;  2E43 A;  5KLV D;  5KAI E;  1IC2 A;  2P10 A;  3NTE A;  1EXI A;  1ACP A;  1LT9 A;  3L75 E;  3TGU E;  1JTH B;  2CQ8 A;  5APS A;  5JPA A;  1FDM A;  3HRN A;  2NPS B;  2ZFC A;  3P8M C;  2KOO A;  4C46 A;  3MUD C;  1EC5 A;  4RKU J;  4HKG A;  2E5Y A;  1YJ9 P;  2P67 A;  4UB6 E;  3D6Y A;  3Q5R A;  1HF9 A;  1L4A D;  1S2E A;  1VQ4 P;  2PY8 A;  3L72 J;  2FKW B;  2GZF A;  2BCC G;  2Y0C A;  2POH A;  3EQ2 A;  1OVV A;  1URQ A;  3H1K D;  1VQ7 P;  1YYC A;  2CPS A;  1Z6M A;  1EOQ A;  2OYO A;  1NAY A;  2N6Z A;  2B88 A;  1AUM A;  3L37 A;  3HD7 B;  3BRT B;  4H0L B;  1N7S B;  1AFO A;  1BE3 J;  3IAO A;  5B5E H;  2I1K A;  2M3B A;  1PIX A;  3DPH A;  5APY A;  3H32 A;  3B5N B;  1ZR4 A;  3C1L A;  3CCS P;  2KOQ A;  5KTB A;  5KKZ C;  1NU1 G;  1IFM A;  4JYB A;  1R5L A;  1NVO A;  1OX3 A;  2Y9Y A;  1NQ4 A;  5BU8 B;  4U7J A;  4OGQ B;  3EJD A;  1L0N E;  4PD4 D;  1IFI A;  3CWB E;  1BAJ A;  1M1J B;  2KW2 A;  4U0F A;  2KOR A;  1LNQ A;  1G1J A;  3U59 A;  3L73 J;  2JEE A;  1JTH A;  1E0H A;  2QEX P;  2W6A A;  1P84 D;  2E75 D;  1RF1 A;  2Z44 A;  5AVZ B;  3II6 A;  1VQ9 P;  3R4Y A;  1PPJ D;  5AVR B;  3H1H G;  2I8D A;  1KD1 Q;  3CD6 P;  3MD0 A;  2LOL A;  3Q20 A;  2I1J A;  5AW0 B;  5DCK A;  4MRT C;  2MVU A;  3CXH E;  2LR2 A;  3HD7 C;  2O1J A;  3E1I A;  2MD9 A;  2JYL A;  5APU A;  4U0B A;  1RQU A;  4GDO A;  1VL2 A;  4UB6 H;  4KHX A;  2SPZ A;  3HD7 D;  1KFN A;  3N7N A;  2WPV B;  2N1T C;  3KPE A;  2KB7 P;  4I6M C;  1CZQ A;  3U1C A;  5DJU B;  4I2L C;  4XFJ A;  4OVN F;  1NTZ J;  4DCK A;  2ROQ A;  3W68 A;  2Q1K A;  5EFW B;  2WSC J;  3PJS K;  4U3F G;  2CPB A;  1LTI C;  2WT7 A;  2ZT9 D;  5AVS B;  3WU2 E;  1XTC C;  1AF8 A;  1P84 I;  1S5L E;  3DTJ A;  2J59 M;  2Z45 A;  1IK9 A;  4H13 C;  2GM4 A;  2JU1 A;  2KOS A;  5BU5 A;  1GU5 A;  2CWO A;  1RY3 A;  1G2C B;  3NY7 B;  1OW7 A;  1VQP P;  2K2Q A;  3P8C E;  2BEQ D;  1L2P A;  3A0B H;  2FYZ A;  3O6Q A;  4U3F E;  1KLP A;  2BEZ F;  2JP3 A;  1KZU B;  2E74 B;  1SQB E;  5CCG A;  5AW8 B;  1L0L J;  2UWJ E;  4K3A A;  2LKM A;  1EIA A;  2ZYA A;  3DS1 A;  1AQT A;  1QL2 A;  1JCC A;  2AXT H;  3DS2 A;  5AW9 B;  1SQQ E;  2QA4 P;  2E1M A;  4AUW A;  3H1H E;  1VQK P;  1TU3 F;  2NO8 A;  2PEM A;  4MN4 C;  2OTL P;  1AVO A;  3AEF C;  4H13 B;  3K5B A;  3GZL A;  1N2D C;  4C7N B;  3P05 A;  2KSE A;  1SQX D;  1NKN A;  1AA0 A;  2FYU D;  5HVC A;  1SQQ J;  1IK7 A;  2WVR A;  2K3R A;  4JQ0 D;  3CCR P;  2XT1 A;  1SQB J;  1ZW0 A;  3GLM A;  4PV1 D;  2M5A B;  2N5I A;  3ITK A;  1SQX J;  2ZYD A;  3H1J G;  1D7M A;  3SFE C;  1QGK B;  1FAV A;  4BRY B;  3HD7 A;  1HQB A;  1J1E B;  1IFN A;  3CMA P;  1ZLL A;  2RKL A;  1KYO H;  2IDB A;  2NPS D;  2HOD A;  4PJ0 H;  1PV3 A;  3KHU A;  3CX5 H;  2HLO A;  1IZN B;  1Q90 D;  3BAT A;  3L74 J;  2PAJ A;  1BXI A;  1DIP A;  4N78 E;  2CGQ A;  4M0I A;  4PD4 E;  2YKO A;  3CWB G;  2HYN A;  3GKL C;  1L0N G;  3DS3 A;  2AXC A;  1LJ2 A;  1PP9 D;  1RE3 C;  1LTJ C;  1GTW A;  1BSH A;  2ZXX A;  1KB9 E;  2M0B A;  1OVU A;  2C9L Y;  5AW4 B;  2XND H;  4ASW A;  4ZKP A;  5KAF E;  1NTZ K;  2K1A A;  1M8O B;  3CME P;  1JY2 N;  1LTJ B;  2FXM A;  2M8L A;  2O01 J;  2KR5 A;  3L74 E;  4EI2 A;  3M0A A;  5AVY B;  2WZ7 A;  2PEJ A;  1YIJ P;  3C9I A;  4GR6 A;  3UIA A;  5TIS H;  2WSC H;  4H13 D;  4L73 A;  3LRY A;  1FZC A;  3KQG A;  1OWA A;  1FZB A;  1EDJ A;  2QIW A;  2BCC E;  3RK3 B;  1VQ6 P;  3OA7 A;  2WMM A;  1VDF A;  4BWN A;  2ITA A;  3LW5 J;  1M74 A;  3CC2 P;  3S1K A;  1KV4 A;  1J1E C;  5CZD B;  1OW8 A;  3L75 D;  3TGU D;  3MGE A;  2FXO A;  3VTP C;  1RF1 B;  4W80 A;  1HVV A;  2QVA A;  3PLN A;  3G1G A;  2K0D X;  1G2C A;  3Q2Y A;  5F2O A;  3H0D A;  3B5N C;  2ERH A;  2XZ0 D;  1VPC A;  3TF5 A;  3P7K A;  1NTM D;  4Y99 C;  1SLQ A;  2FVA A;  2KOD A;  1OFC X;  5APT A;  3M9H A;  2Y0E A;  3B4Q A;  4PH0 A;  1YIT P;  1J1D C;  2E75 B;  1JY3 O;  2KNC A;  5EJD A;  1LTT C;  4F37 A;  2K94 A;  2KZJ A;  3AED C;  5F2N A;  1K30 A;  4EDF A;  1EZV D;  2HFE D;  2PEI A;  1S9K E;  2NZ2 A;  4WY4 D;  1P84 E;  3M91 A;  1NTK D;  1JM0 A;  3WU2 H;  3RBX A;  1PGP A;  2M5R A;  1HJB A;  3MP7 B;  3H32 B;  1BCC J;  3E2D A;  2FYU J;  2KGA A;  3AEE C;  1OW6 A;  2PEN A;  2CG5 B;  1Y47 A;  1N7S A;  2DNW A;  4QNB A;  3GJN A;  3DS4 A;  1EDL A;  3FXD A;  4I7Z B;  4U3F D;  3A2A A;  1R5S A;  3G71 P;  4OWF A;  1FZF A;  1NTZ D;  3CXH D;  3H1I J;  1RE4 A;  2JWD A;  3NMD A;  1PFI A;  4YXW H;  4XFY A;  2C9N Y;  3AE2 C;  2J58 A;  2KGC A;  3FXE A;  4KJM A;  4K35 A;  3ABV C;  2M3E A;  1FC2 C;  2A45 G;  2HPC A;  3R2P A;  4HH2 A;  1YQ4 C;  2WPT A;  2YMK A;  2MJZ A;  3Q1M A;  4NEO A;  1NKZ B;  1M1J C;  2K5X A;  4I1L A;  3TYY A;  1K8A Q;  3CCQ P;  2KG9 A;  2W83 C;  3PRJ A;  4XFX A;  2CK3 H;  3GG2 A;  1FOS E;  1OZH A;  1Q82 Q;  2KXP B;  2KOP A;  1K9M Q;  1NOH A;  1JEK A;  3AE4 C;  3H1J D;  3MIW A;  2QNW A;  3V4Q A;  3CC7 P;  3H1K E;  1Q81 Q;  5AVQ B;  4XRQ A;  1LTA C;  3B5N A;  4JYC A;  4BPF A;  2YXQ B;  1L4A C;  3RBZ A;  1R8E A;  3P32 A;  1IFJ A;  1U57 A;  1LWU B;  3B8E B;  3GMA A;  2Q5U A;  1HTL C;  3CCL P;  1LT1 A;  2ZAE B;  4PXH B;  1L0I A;  1SQV E;  1SFC C;  3G3Z A;  1NTK G;  3A0B E;  3LW5 H;  1BGY G;  3M0D A;  1UNK A;  2AEM A;  1PGJ A;  4N78 D;  3A0H E;  2A45 I;  3JSV C;  4KT0 J;  3M1M A;  3JC2 2;  1FDO A;  5I4T G;  5KP7 B;  3G9R A;  4L76 A;  1KIL B;  1FZC C;  3PHL A;  2C0X A;  2KUB A;  3VP8 A;  1PP9 E;  1SQB K;  2XDJ A;  4U0C A;  1NU1 K;  2E5T A;  2MR7 A;  2M8R A;  1EZV G;  2JGP A;  2JBG A;  4JF7 A;  1VQM P;  2JR8 A;  2PRR A;  2WT7 B;  1NWQ A;  3OJA B;  1YQ3 C;  2GZJ A;  1SFC A;  3E1R A;  3D6Z A;  2WIT A;  3CCU P;  3CPW O;  2Q9I A;  2N5H A;  1DEB A;  3CI9 A;  1EXJ A;  3TSI A;  2JQ4 A;  1J1D B;  1T2K C;  2KWL A;  1OIP A;  4L75 A;  1Y9B A;  1KQF B;  5GTI H;  3CCJ P;  3S9O A;  2PFX A;  1LT9 B;  2FYN B;  2XV6 A;  4DG9 A;  1RQV A;  3AE3 C;  1HJ0 A;  4IL6 E;  4PD4 I;  4H0L C;  3Q5P A;  1MFZ A;  1A8O A;  2RN0 A;  3WMM 0;  1JNM A;  4IFF A;  1DD4 A;  1RF0 A;  2IZ1 A;  2GUS A;  1NTM E;  1FZA A;  5AVW B;  4YPC A;  1VQL P;  4GT1 A;  4OGQ C;  3VOP A;  2O01 N;  1NAF A;  3GHG A;  1KMI Z;  1KIL C;  1L0N K;  2PEK A;  3G29 A;  2YKQ A;  5C39 A;  4H2Y C;  1BCC D;  1M6E X;  3MTU E;  4PV1 B;  3B5N D;  2IBZ D;  1RE4 C;  3VN0 A;  1KIL D;  3V2R A;  1A02 F;  3G4S P;  4O9B A;  5B66 H;  2WTY A;  4OGQ D;  3VP9 A;  1Y8A A;  2QJK C;  2LXB A;  1RHZ B;  1KQS O;  4ZKU A;  3VRL C;  3WUT A;  5BS2 A;  3OAK A;  2KLV A;  1JY3 P;  2IBZ I;  1FZE A;  3HE5 B;  1SQP E;  3H1K G;  2L22 A;  4Z1M H;  1NTK E;  2YO3 A;  2QJP C;  4D6T J;  3BVH A;  2JB0 A;  1X79 B;  1NTM J;  3L71 J;  2K92 A;  5DJT B;  2XU6 A;  3L70 G;  1FR2 A;  3AE6 C;  4H2W C;  2OYI A;  4EYY Q;  1QVF O;  2M8N A;  1PZQ A;  3L73 G;  3H47 A;  3H1H J;  3TNU A;  1N7L A;  4YTP C;  1NU1 D;  2FAD A;  3JCU E;  1L0L E;  5F2K A;  4ASV A;  2PEQ A;  3RG2 A;  2LPK A;  2EFJ A;  1ZR2 A;  3GF7 A;  2K9Y A;  1S3J A;  1T3U A;  1M1K Q;  2FXP A;  2JJL A;  2WPR A;  2G8Y A;  1FZC B;  1CW5 A;  2GZG A;  4R4M A;  2R5D A;  5HV8 A;  1PGO A;  1S5L H;  3RG6 C;  2Q6Q A;  1JJ2 O;  1T8K A;  1GZL A;  3FWL A;  5CMZ A;  2MY5 A;  1MUU A;  4W7Z A;  2NPS C;  3V2P A;  1LTG C;  2ZYG A;  2QJK B;  3MZW B;  2A06 D;  2P9X A;  3CCE P;  2E74 D;  1X3O A;  1PP9 J;  2XKM A;  3L71 G;  1URQ C;  2N6Y A;  3NTN A;  2O01 H;  3KYQ A;  2JKV A;  1NYH A;  5CCH C;  3EJE A;  2GYK A;  2OAR A;  2VLN A;  5APW A;  1WMK A;  1JO5 A;  3TDK A;  4U0D A;  3M06 A;  4HB1 A;  3I55 P;  1KB9 I;  4D6T E;  1KIL A;  4UB8 E;  1QLE D;  1LP1 A;  7CEI A;  1L0N D;  3GZM A;  3CX5 I;  2GDX A;  2QM8 A;  4RO0 A;  5HGO A;  1K73 Q;  1M6N A;  3IF4 A;  2W6B A;  1S9K D;  1SQX K;  2OYH C;  4NPD A;  1SQQ K;  1USE A;  4OH8 B;  4U0A A;  2G3A A;  3CCV P;  1QL1 A;  3CCM P;  4R4L A;  4IZ6 A;  3SSU A;  2KP8 A;  4GOF A;  3L73 E;  1RE3 A;  1GL2 D;  5GTH E;  1MV8 A;  4ZMD A;  1QEX A;  2GUV A;  1IUQ A;  4EOT A;  4DJG A;  3V2N A;  1L4A A;  4M3L A;  2WWW A;  3CL3 D;  2ZT9 C;  5KJ7 D;  1EZV I;  1RO2 A;  2A45 H;  4WY4 C;  2KGD A;  3AE8 C;  2XNX A;  4EIJ A;  2H89 C;  1UII A;  3LMO A;  1BCC E;  2L6E A;  2N1T D;  4U3F J;  1KQG B;  2LML A;  3WUV A;  2IBZ E;  1K05 A;  4Y99 B;  3SWY A;  1F80 D;  1PEQ A;  1X22 A;  5CBN A;  1L0L K;  2AEF A;  4PH1 A;  3RK2 B;  2YNY A;  1WT6 A;  3HUS B;  3RK3 D;  2A06 G;  2D2C C;  2AFE A;  1DD3 A;  4COP A;  1L0H A;  1XTG B;  5CCG C;  1UIX A;  3C8V A;  5AW1 B;  1VQN P;  2GZE A;  3HE4 A;  3L71 D;  3CXH H;  1VF5 C;  2KYV A;  2NRG A;  1SQP D;  3GW6 A;  3L72 E;  4TT3 H;  3H1J E;  1VQ5 P;  1NTM G;  2VRS A;  3G26 A;  5EW5 E;  1FJK A;  2HR3 A;  5CCH A;  1NTZ E;  3H1L J;  4XRO A;  3L70 D;  2H43 A;  3I56 P;  3B5I A;  1GL2 B;  2J5U A;  2BCC D;  4IFD K;  3GF3 A;  1RO0 A;  1SQV J;  2L0Q A;  1N7S C;  4RJT A;  2KLU A;  1OXZ A;  2IPP A;  1NO4 A;  1OMI A;  2KG8 A;  1M57 D;  5B5E E;  3NFQ A;  1JY2 O;  2WSF J;  3ZDM A;  3CWB D;  1LWU A;  1LP1 B;  3L35 A;  1U7J A;  4GIF A;  4GR2 A;  3RL0 C;  3HTK B;  1NJI Q;  2MR8 A;  1W2B O;  3F89 A;  1QVG O;  2K93 A;  2ZVO B;  5CJ0 A;  1GL2 A;  1AVY A;  1GPJ A;  2VLO A;  1BDC A;  1KN7 A;  2P2U A;  3RK2 D;  2Z5I A;  1GW4 A;  1BDD A;  2QG4 A;  1IO4 A;  1SQQ G;  5AW2 B;  2YMY A;  4TLF A;  1VF5 B;  1JMB A;  1FZG A;  1ZN5 A;  3H6P A;  3AE5 C;  3L70 E;  1BE3 D;  1N73 A;  1SQV G;  1D1D A;  2EHS A;  1LTS C;  2HPC B;  2Y9Z A;  2FYU G;  5AVU B;  3T97 B;  1FDI A;  1SQP G;  3BCC G;  4HYT B;  3AEB C;  4PV1 C;  2YXR B;  1T8Z A;  1KB9 D;  2B87 B;  2FYU E;  2OYI B;  2JYG A;  2LIW A;  5CCG D;  3U1A A;  1OR5 A;  2PNG A;  1E79 H;  1N8R Q;  5E79 E;  1KIL E;  2FY8 A;  3RK3 C;  1KTM A;  4CPG A;  3EJB A;  3TK1 A;  1HWT C;  2OYI C;  1S5L X;  3IFM A;  5AW7 B;  2FVF A;  1H89 A;  2E76 B;  3A3Y B;  4HKZ H;  2QJP B;  1EQ7 A;  3SWK A;  1LT9 C;  3LID A;  3S4R A;  1X9V A;  4WWI A;  2E76 C;  4CA3 A;  1Q7Y Q;  5KP6 B;  2RMZ A;  1DV5 A;  2LF4 A;  2K0X A;  1KB9 H; 
#chains in the Genus database with same CATH homology
 1S72 P;  1VQM P;  1KC8 Q;  1VQ6 P;  2L6E A;  2EIA A;  3G28 A;  4U0E A;  3OW2 O;  3CCR P;  2XT1 A;  3G1I A;  1M74 A;  4U0D A;  5HGN A;  3I55 P;  4IPY A;  1PEQ A;  3CC2 P;  3CCU P;  3DPH A;  3CPW O;  4PH1 A;  4WYM A;  2ONT A;  3CCS P;  1YHQ P;  3MGE A;  1K8A Q;  1QRJ A;  3WBH A;  3DS0 A;  2OTJ P;  4COP A;  5BS1 A;  3DS5 A;  3CCQ P;  3G1G A;  2DGY A;  1VQO P;  4XFX A;  1YJN P;  1D1D A;  5F2O A;  1E6J P;  3H0D A;  2EG5 A;  1VQN P;  3CC4 P;  3CCJ P;  1PEU A;  1BAJ A;  1QVF O;  2M8N A;  5HGO A;  3CMA P;  1K73 Q;  1M6N A;  3H47 A;  1Q82 Q;  2XV6 A;  3CXC O;  1K9M Q;  2KOD A;  3DTJ A;  1VQ5 P;  3HYB A;  3H4E A;  3NTE A;  2Z45 A;  4U0F A;  3G26 A;  5HGL A;  4PH0 A;  2BQ1 E;  3CC7 P;  1YIT P;  1Q81 Q;  2CWO A;  3HZQ A;  4XRO A;  5JPA A;  3I56 P;  4XRQ A;  2JO0 A;  3B5I A;  5F2K A;  2PEQ A;  1A8O A;  4U0A A;  2EFJ A;  4M0I A;  3CCV P;  1VQ8 P;  2XXM A;  1RO0 A;  1VQP P;  1M1K Q;  2Z46 A;  3CCM P;  5F2N A;  1K30 A;  2JYG A;  1YI2 P;  2QEX P;  2PEI A;  3DS3 A;  1YJW P;  1YJ9 P;  1A43 A;  4XFZ A;  1VQL P;  2Z44 A;  1N8R Q;  3RG6 C;  1M90 Q;  2PEO A;  1JJ2 O;  3CCL P;  5HGM A;  1PEM A;  1IUQ A;  1VQ9 P;  2PEK A;  1EIA A;  3DS1 A;  3E2D A;  3G29 A;  1ZMB A;  2M8P A;  3DS2 A;  1VQ4 P;  2QA4 P;  2PEN A;  1KD1 Q;  2PY8 A;  1M6E X;  3CD6 P;  2E1M A;  2BHV A;  3Q20 A;  3M1M A;  2P9X A;  3CCE P;  3CME P;  2M8L A;  4COC A;  1VQK P;  5I4T G;  3G0V A;  4QNB A;  3G6E P;  2PEM A;  3DS4 A;  4GR2 A;  2OTL P;  5DCK A;  1Q86 Q;  1RNI A;  1RO2 A;  3G21 A;  2PEJ A;  1YIJ P;  3G71 P;  4GR6 A;  1NJI Q;  3G4S P;  1W2B O;  2JYL A;  1VQ7 P;  1QVG O;  1Q7Y Q;  4U0B A;  3P05 A;  1EOQ A;  4U0C A;  1KQS O;  3LRY A;  2LF4 A;  4XFY A;  3VRL C;  2OAR A;  1PEO A;  2BUO A;  1AUM A;  5BS2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...