2OTLP

Girodazole bound to the large subunit of haloarcula marismortui
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal RNA
publication title The Structures of Antibiotics Bound to the E Site Region of the 50 S Ribosomal Subunit of Haloarcula marismortui: 13-Deoxytedanolide and Girodazole.
pubmed doi rcsb
molecule tags Ribosome
total genus 48
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2007-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 2otlP03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 2otlP01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 2otlP02
1W2BO 1Q86Q 1VQPP 1VQKP 3CCLP 1VQ6P 3G71P 3OW2O 2OTJP 1Q81Q 1YJWP 1YJ9P 1YITP 1VQOP 1YJNP 3CC4P 3CC2P 3CCQP 1QVFO 1VQ4P 1YIJP 2QEXP 1S72P 1YI2P 3CD6P 1VQ7P 1K9MQ 3CCRP 3CCMP 3I56P 3G6EP 3I55P 2QA4P 3CCVP 1VQ5P 1NJIQ 1Q82Q 1N8RQ 3CMEP 3CMAP 1M90Q 3CXCO 3G4SP 3CCEP 1VQMP 1KQSO 1M1KQ 3CC7P 2OTLP 1KC8Q 3CCJP 1YHQP 3CCSP 3CCUP 1JJ2O 1QVGO 1K8AQ 1Q7YQ 1KD1Q 1VQLP 1VQNP 1K73Q 3CPWO 1VQ9P 1VQ8P
chains in the Genus database with same CATH superfamily
2HLOA 5GTHH 3A2AA 2QVAA 5KP6B 5AW3B 1OWAA 1E5WA 4GKGA 1SQQJ 1KQFB 4WBAA 2XZ0D 1OW6A 1CI6B 2PEKA 1LT1A 2WSFH 5GTIH 1JNMA 5KJ7A 2E43A 3C8VA 1GD2E 2FQ2A 3M0AA 2WSEH 1Q86Q 1LTIC 5AVWB 1GL2B 3S1KA 1AYIA 3DS0A 3H25A 4H0LC 5K5GB 1GW4A 4YTPC 1D1DA 2FY8A 2FADA 3D6YA 4PV1C 1NAYA 1SQXG 1NO4A 2AFEA 4QKOA 4N3YB 1BCCD 3BCCJ 3G71P 2JU2A 3CXHE 3R4YA 2KI7B 2NPSC 1N7SD 2O1JA 1BSNA 3EJBA 1CZQA 3PH0A 2R3SA 1A02J 1YQ4C 1VQMP 1K05A 1SQQG 1K04A 1EZVI 2YIUC 3HUSC 4H2YC 1NU1G 3NXSA 2KSJA 1OFCX 5CZDB 4XE5B 2NO8A 1BDDA 1Y8AA 2M8NA 2PRRA 2K0XA 1PEUA 3HD7D 1LTGC 3CX5H 1FR2A 3VTPC 1SQXE 1S3JA 1OXZA 4IOIH 2OARA 5H2FH 1S9KD 1RF0C 3PJSK 2H89C 2ZVOB 1N7SB 3H1HJ 3AEDC 3A7OA 1L0LD 3H47A 3BCCG 2RKLA 2R5BA 1SQVK 2XNXA 2K9YA 2Q9IA 5KP8B 3KYQA 1SQQE 2E75C 1ZP0C 5TISH 1E79H 4ASVA 1JMMA 1LJ2A 4GODA 1QX8A 2A45H 1MV8A 2FYUG 2PENA 4D6TD 1K9MQ 2FAEA 1NU1E 5APWA 3LRYA 1NQ4A 3VN0A 2M3BA 3E1IA 3RL0C 3HD7B 2CQ8A 2Y0DA 1UIXA 1K8AQ 2ZJSE 3KPEA 2XKMA 4H13D 3RK3D 2PEMA 1LWUA 2HPCB 3EWKA 5CCHC 2W6BA 4K3AA 1U7JA 5APQA 1NVOA 3H1ID 2QE7H 2OYHB 1L0NG 4HH2A 1KB9D 3OA7A 3Q5PA 1JB0J 2HODB 4WWIA 3L71G 2WT7B 1NJIQ 3I5CA 3U1CA 2JB0A 3V4QA 1ZR2A 2AVAA 2YXRB 2KNCB 2IFNA 3BCCE 4IZ6A 3H1HG 1T3JA 1NTMK 2P7JA 1XTCC 2ERHA 2KK7A 4XRQA 1S72P 3BRTB 2N98A 3CCRP 2KOQA 3GZMA 3RL0g 2FYUE 3E7KA 2K37A 4U3FG 2OYOA 4GOFA 2LXCB 3RK3B 4H13B 4NPFX 1BE3G 1QL1A 1QL2A 3G28A 4ZKUA 4R4LA 5KAIH 1SFCA 3W68A 2KG6A 2KLUA 1VQ4P 2R32A 3E1RA 3Q5SA 1SQVJ 1ZLLA 1S4XA 1L0NE 4W7ZA 2P9XA 2A06G 4JYCA 3MGEA 3L71E 3TGUJ 2P67A 3RGUA 3OW2O 4I1LA 2WSCJ 2Y0CA 1S2EA 3H1HE 5DCKA 3KZIH 2P2UA 3LW5J 2E74C 3KQGA 1PEOA 3CXHD 3CC7P 3H32B 1ZW0A 2KGEA 4C46A 2WPRA 1L0IA 4PH1A 2JYGA 1NTKK 2E5YA 2CWOA 4U3FE 2CG5B 3A0BE 1KLPA 1BE3E 1DEBA 2C0WA 1FAVA 7CEIA 1NTZK 1OW7A 1L2PA 2GDXA 1K30A 1PEQA 3HTKA 4PJ0E 3WUVA 2B89A 1L4AD 5AVXB 2JYLA 4WVZA 3M06A 1NTMJ 2KS1A 1YYCA 3HRNA 4UB8H 2KGDA 2A06E 2M3EA 1KB9H 1J1EC 1N73A 2PY8A 1SQXD 5BU5A 1NGMB 2AEMA 1L0HA 1SVFA 4Z1MH 3O6QA 2IZ0A 2Z44A 1FZCB 2POHA 1RHZB 3VMZA 4H2WC 2MVVA 3EFFK 4OVNF 2E1MA 4O9BA 4RKUJ 3VYIA 2HYNA 3VMAA 4U0AA 3CD6P 1X22A 1SQQD 3B5IA 3RK2C 1EXJA 1PGQA 2K9JB 1OZHA 2LMLA 5KLVG 1L4AB 1KC8Q 1EDJA 1NU1D 4YXWH 1Z56A 5EJDA 2B87B 4DT0A 3H6PA 5H2FE 1KILA 2JAZA 2AFDA 4L73A 1IO4A 1ACPA 1PEMA 2BHVA 2OYIA 3U43A 4TLFA 1NTKJ 3L74J 3AE4C 3WU2E 5AW4B 2NRGA 2J5UA 5HGNA 3G9RA 1NTZJ 2L5GB 3GZLA 1YJWP 5AW7B 3CXHH 2JBGA 5BVZA 1YI2P 2M0BA 2JO1A 1URQA 2QA4P 3V6IA 1GW3A 1JJ2O 5AVSB 2DW3A 5KLVE 2FYUD 2Y9ZA 4OH8B 2KLVA 2X2BA 3NY7B 1LWUC 3I55P 3CCVP 2WTYA 3CWBG 3V2NA 4Y99C 2O01J 1VQ9P 2E5TA 1MKMA 1L0ND 1GL2A 2KOSA 1SQPK 2BASA 3C1LA 2N1TD 2H43A 3L75J 3L71D 2SPZA 3TDKA 1IFJA 1LT9C 1NTKG 3L74G 2QSIA 2WPSA 3QWOC 2K3RA 4I7ZC 1DV5A 2K88A 3H1HD 3AE5C 3WBHA 2XZ1C 4B86A 1NWQA 2OTJP 1YJNP 4C7NB 1R8EA 4U3FD 1BE3D 1N8RQ 1SFCC 3L36A 2PNGA 1WRGA 1RE3C 3G21A 2LF4A 3CCJP 4H0LD 3RG6C 3CWBE 1MUUA 1PGOA 2B88A 2N1TB 1IFDA 2EFJA 4PV1D 1AUMA 2A06D 3FXDA 3I56P 1JO5A 3L74E 3CMAP 2QJYC 5B66E 3F5HA 3E2DA 2FKWB 3IFMA 1SQBG 1LGHB 2NPSD 2LIUA 4RO0A 4WYMA 4BPFA 2V7QJ 4XFJA 2OQQA 2WPTA 4PD4E 1LNQA 1M1JA 1YJ9P 2KG8A 2KYVA 2IBZI 1N7SA 1OX3A 3IN6A 3L35A 1A8OA 1AQTA 1GXHA 1H0TA 3AE3C 2AF8A 1S1CX 1JY3N 3T97B 2C0XA 2N6ZA 1SQPJ 1ZNVA 4H0LB 2ITAA 5KTBA 1GZLA 3NTNA 4PV1B 1GXGA 4GT1A 1A43A 1EQ7A 3G1GA 2JKVA 3HD7A 5M1BA 2VRSA 2VLOA 3MIWA 1T3UA 2I1KA 1N73C 3MTUE 2NPSB 2KOOA 2FXMA 3BATA 1SQBE 2H7HA 3O8ZA 2ZT9C 5AW8B 1FBMA 1MFTA 2WT7A 2GZGA 2PEOA 2YIUB 2E75D 3HUSB 1FOSF 4YPCA 2FFDA 2JEEA 2GDYA 3CCSP 2KNCA 2WQYC 1HBWA 3V2RA 1HJBA 3SFEC 3A0BH 1EDIA 1IMPA 5KLVD 2D2CC 2IPPA 3S4RA 1GPJA 2EG5A 4PJ0H 5CCHD 2KZIA 1EDKA 1DX7A 3BASA 2BQ1E 1G2CA 2OYIC 3PLNA 1M6EX 1X3OA 2GUVA 3P05A 3ITKA 3L72G 3L37A 1EC5A 2LKMA 2EHSA 3G29A 2RH0A 3WMM0 2KIKA 2I8DA 3ABVC 1JY2P 1S5LE 2E75B 3KXDA 3V4WA 3GF3A 3W67A 3H1KJ 4DJGA 1EMVA 1VQOP 2GZJA 1LTSC 3DS5A 4BRYB 1QEXA 2MF4A 2KGAA 1USDA 4W80A 2WSSH 1X9VA 1KYOI 2GYKA 3TSIA 1FZAA 4HKGA 3H1LJ 1BGYJ 1VQKP 1IK9A 3H1JJ 4IL6E 4EI2A 3CWBD 3NMDA 3M9BA 4OWFA 2Z46A 3K5BA 1GL2C 3L72E 3P8MC 2OGUA 1LP1B 1FDOA 3WU2H 3CL3D 5CBNA 2WZ7A 4LGDE 2Q3IA 4NPEA 3L74D 4IFMA 1ZOYC 3SWKA 2E74D 3N7NA 4HYTB 1XTGB 3FX0A 3S9OA 1VF5C 5KAFE 1VQ7P 1GTWA 5AVYB 4PD4D 2DGYA 1Q82Q 3H1KG 1GK6A 2BCCJ 2QJKC 1JM0A 2WSEJ 1DH3A 2YMYA 2YNYA 2Z5IA 1HF9A 3AEGC 1M8OB 1JOCA 3EQ2A 1M6NA 3MHVA 1VDFA 2K92A 4EDFA 2JP3A 2B87A 2W27A 4DZOA 1PP9J 1JY3P 5E79E 2E74B 2YXQB 4ZNCA 1MZ9A 2R44A 2N9YB 5B5EE 1RO2A 1SQBD 5DJTB 3GJNA 1M1JC 4COCA 2JGPA 3GHGA 3G4SP 2QRXA 4H44C 3B4SA 1GMJA 4HB1A 3L73J 2LXBA 4U0CA 4WY4A 5APXA 1YTZT 3RK2D 2BEZF 2VLPA 2EIAA 2JWDA 4I2LC 1BSHA 4DCKA 4UB6E 2VSQA 2B9BA 2JR8A 4CA3A 2L22A 1P84E 5APSA 4BPGA 1J1EB 4YXDC 5CBOA 2XV5A 1M7LA 1IC2A 1N2DC 5HGOA 4MN4C 3G3ZA 2KWLA 1JTHA 2LKIA 5AVUB 3RBXA 2NZ2A 2HG5D 3R2PA 5B66H 5APVA 2L9FA 1QVGO 2KB7P 1PGJA 1IFIA 2ZYGA 4M3LA 3RK2B 1RQVA 4PD4H 1DEEG 3L70J 2FFDC 2LR2A 5KJ7C 1WMKA 2K93A 1L0LK 1ZXGA 1YQ3C 1AF8A 4N6JA 5AW9B 4RESB 1EZVG 5TJHA 2EHTA 2W6JH 4JYBA 4AQRD 1J1DC 3Q2YA 3HE5B 1KB9I 1RE4A 1ZRTE 3M9HA 3QH9A 4C7NA 1OIPA 1SQVG 3KHUA 2GZFA 4EYYQ 2OTKE 2FVFA 3VRLC 3EJDA 4R0MA 5F2KA 1PZQA 1ZMBA 3MUDA 3PTZA 1RQUA 2WPVB 3D70A 3TGUG 1KQSO 3LIEA 4Y28J 1LTJA 1IK7A 3A0HE 3B5NA 1HGVA 3L72D 2XXMA 1W2EA 4LC1A 1IJDB 1NYHA 2FYNC 1HUCA 3G6EP 2FQ1A 3G0VA 5HGMA 4ZKPA 1KN7A 3BRVB 3L70G 1EZVE 4KT0J 1KV4A 3A5TA 1A02F 1LWUB 1VPCA 2LOLA 1SFCD 4XFZA 4Y99B 3HE4B 1QLED 1LTBC 1SQVE 2BEQD 1HVVA 2IZ1A 1NTMG 3VP9A 3T97A 3CMEP 1KYOE 1VKUA 2QNWA 3M91A 2GZIA 1LT9B 3TGUE 3CCLP 1L0LJ 3MP7B 2Q1KA 3U1AA 4U0FA 5AVTB 1LTAC 2K0YA 5BU8B 4JBZA 2L0QA 3BCCD 2R5DA 5F2NA 1T2KC 3AE8C 1KQLA 5C39A 3CLQA 1S5LH 1M90Q 2AEFA 2G8YA 3VMYA 4JPZB 4NPDA 2AEJA 2QJPC 4D6TJ 1DNYA 2KXPB 3L70E 4IFFA 1SFCB 1JY2N 1CI6A 5CCGA 2M5RA 2GA1A 2K0DX 1JY3O 3SSUA 2N5IA 3DS4A 3HUSA 3V5BA 2JO0A 2P10A 1IUQA 1NTME 1RF1B 1VQNP 4CPGA 1P84D 5AW2B 3H1IJ 4OGQC 1IZNB 4IL6H 2QJYB 3Q20A 2PEQA 1FOSE 2KGCA 3AEFC 3CI9A 1CSBA 2MKVA 1M56D 2AXTE 1NTZG 1L0LG 1HGZA 1YHQP 2IYPA 1CEIA 2ZT9D 3USSA 2RMZA 2C9NY 3TF5A 3AE2C 2KOGA 3Q1MA 3GHGC 3WUUA 2E76C 4U7JA 5APUA 2M5AB 3B4QA 1SQXK 2O01N 4JQ0D 3D6ZA 3D71A 5KAFH 4QMAA 2WVRA 4AUWA 1SS1A 2J58A 1M74A 4WY4C 5HGLA 2YKPA 2XNDH 1IFPA 2KS1B 2D2CD 2JWAA 1Q81Q 2XU6A 1OR5A 2YMKA 5KLIC 3SWYA 3CC4P 1SQQK 1N73B 2KOPA 4I6MC 3FWNA 4BRYA 3VMXA 1OVVA 4IFDK 1N86A 1ZRTD 1U7MA 3C9IA 5CCHA 1EXIA 2G3AA 2KUBA 1NTKE 3CXCO 1E6JP 3TNUB 3IF4A 4DOJA 1NU1K 3DS2A 2ZT9B 3O6QB 5KKZC 3L75G 1NTZE 1L0LE 3MGNA 1JMBA 5E79H 3AE7C 2M8PA 5B5EH 5AW6B 3HYBA 4GIFA 2N9BA 2Q6QA 3V2QA 1FZGA 1FC2C 3RG2A 2FXPA 5L8RJ 1H8AA 2WMMA 1FZEA 4BPHA 2D2CB 4JF7A 2Y0EA 2PFXA 3CC2P 1EZVD 1W5CE 2HFED 3BVHA 4UB6H 3P32A 1P84H 3HZQA 2OYIB 2KG9A 1VQLP 1VHNA 1SQVD 2H8PD 2HPCA 3MUDC 2FYUK 1SQXJ 1KYOD 1GL2D 2JU1A 2KORA 2Q3EA 2GZEA 3L75E 1FJPA 1FS0E 1JEKA 2OYHA 3TGUD 1YIJP 1LTJC 3B5NC 2HODA 1Y9BA 4ASWA 2ZFCA 1VL2A 3MZWB 1X0TA 5CJ0A 3L4FA 1N7LA 1VF5D 2CGQA 2LTEA 3GF7A 1PPJG 2JDIH 1L0NK 1R5SA 3RL0D 3H4EA 2W83C 3G26A 1HTLC 1NU1J 4GDOA 3L70D 1SQPG 5HV8A 3GG2A 1KILC 1ZV8A 2WITA 1PIXA 1AJYA 1G1JA 3AEAC 2K1AA 1FJKA 1NTMD 3AE9C 2MY5A 2IYOA 2PP6A 2CPSA 1VF5B 3TYYA 3GLMA 2Q7CA 3A0HH 1URQC 4DG9A 2ZYDA 4PH0A 1PPJE 3RL0B 3VP8A 4H44D 4A7PA 1T8ZA 2QJKB 3JCUE 4XFXA 2FYUJ 1NH4A 3H32A 2KSEA 3CX5I 4GR6A 2GM4A 3DS3A 5CCGC 4AYCA 1SQPE 2Q5UA 2FVAA 3A3YB 1U57A 1TU3F 1HY8A 3NFQA 2DNWA 1SP4A 3GMAA 1R5LA 1D7MA 5AVRB 3U59A 1UJZA 3FWLA 3MD0A 4GR2A 5BS1A 1KYOH 1L0NJ 2FVEA 1M1KQ 3SFDC 2OTLP 1KD1Q 1HJ0A 4C7RA 3Q3DA 1HH0A 3L71J 3HE5A 4KHXA 4L76A 1H88A 3M0DA 1NTKD 2CK3H 3GKLC 2CPBA 3RBZA 1M1JB 1DIPA 2WSCH 2GUSA 1FZBA 1FE6A 4H44B 1NTZD 2A45I 2WSFJ 1CW5A 3LW5H 2M8LA 4XA4A 2VLNA 1H0TB 1QGKB 1F80D 1FZCA 2W90A 5KJ7D 4KJMA 4WB4A 2IBZG 1VQ8P 4U3FJ 3KDPB 1BE3J 3ZDMA 1IMQA 1ZMEC 2K9JA 4W7YA 1ZN5A 2K94A 2Z5HA 1L4AA 3CCEP 1BGYG 3H1LG 4MRTC 3H1JG 1YTZI 2W8ZA 3IAOA 1H89A 3HE4A 5KLVK 2KZJA 2LL8A 2ZVNB 4F37A 2FACA 5HVCA 2FYZA 3L75D 2PGDA 3Q5RA 3FGAD 1BDCA 1QRJA 2AXTH 4H2XC 1LT9A 1N7SC 2FFDB 2KODA 3CPWO 2UWJE 3H1KE 1MFZA 4EOTA 2IBZE 2MJZA 2BCCG 1OVRA 1J1DB 2IDBA 3P7KA 4U0EA 1NOHA 2QM7A 1T6AA 2L6EA 1NKNA 2ONTA 3H1LE 1BGYE 1VQPP 1G2CB 1NHLA 2ZYAA 3HD7C 2MD9A 1RNIA 1J2JB 2N50A 1BXIA 2Z4EA 1FU1A 1RE3A 3H1JE 2I1JA 1KZUB 2FXOA 3P8CE 5AVZB 3OAKA 1Q2NA 3FXEA 2XT1A 4NEOA 1Q90D 1RF1A 2OYHC 4R4MA 1PP9G 1UIIA 3PRJA 5GTHE 2FYNB 1RH5B 1T2KD 4PD4I 1BAJA 5GTIE 2QIWA 3UIAA 1PPJD 3L73G 2BCCE 1T8KA 2FHSC 2XZRA 2MVUA 1KILE 2PEJA 2YO2A 5KLVJ 1JY2O 3TK1A 2M5AA 4EIJA 1UNKA 1OMIA 1SQPD 3EFGA 3RK3C 1EDLA 4H13C 2XDJA 2MR8A 2GDWA 2LPKA 4K35A 4OGQD 1RO0A 1DD4A 1BCCJ 1USEA 2QG4A 4GOEA 5EFWB 2KR5A 3CCUP 1PL5A 2O01H 1M57D 2CNRA 2QM8A 1PP9E 1FZFA 2N1TA 3V2PA 2K5XA 5AW5B 4PXHB 2Y9YA 2YKQA 1KFNA 4N78E 2ZXEB 4HJGH 3LIDA 4U0DA 2QJPB 1G1IA 3TNUA 3CE7A 2FQ0A 3M9QA 2E76D 2R3CA 3L73E 5EW5E 2L4BA 2A45G 4WY4D 4L74A 1MZ8A 3VOPA 1HWTC 2ROQA 3JSVC 2N6YA 1SQBK 3PHLA 4OGQB 3CX5E 2ZXXA 1KMIZ 3OJAB 1X79B 4LLHA 3DTJA 4L75A 3CWBJ 3LMOA 1AFOA 5DJUB 4I7ZB 1BCCG 3CCQP 1AV1A 2QEXP 3CXHI 1RY3A 3M0DC 2L91A 1VQ5P 1KFMA 1IFNA 3GHGB 2E76B 4M0IA 2NPSA 5JPAA 3H0DA 1PGPA 1W2BO 2V7QH 2HR3A 4WY4B 5TISE 3SWFA 1FDMA 2IFMA 2K2QA 2AXCA 4RJTA 1FZCC 1NAFA 3H1KD 5CMZA 2W6AA 2WWWA 4XROA 3II6A 1PFIA 3JCUH 2IBZD 5F2OA 1KTMA 2LIWA 3G1IA 5APTA 5KLIB 3IR9A 2KP8A 2YKOA 3DPHA 2RN0A 2BUOA 2Z45A 2ZAEB 1Z6MA 1L4AC 5BS2A 1HQBA 1GDTA 1S5LX 3H1LD 1BGYD 1JUNA 4U0BA 1JCCA 1Y47A 5CHXA 3M1MA 1JTHB 4PWVB 2P1JA 3CCMP 5CJ4A 4QNBA 1BCCE 5KKZB 2O3JA 3H1JD 2XV6A 3P8CD 3EJEA 4BWNA 1KORA 2C9LY 1RF0A 1DD3A 3WUTA 1ZR4A 2YO3A 1AQ5A 3NTEA 1NKZB 3B5ND 1VQ6P 1SQBJ 3AE6C 1YITP 3B71A 1WT6A 4BXLA 2PEIA 1OVUA 3HTKB 1AA0A 4D6TG 1EIAA 1YBKA 3AEEC 1GU5A 4IL6X 5APYA 2E42A 2BCCD 5KAIE 2V4HA 1X8YA 2JJLA 1GU4A 3JC22 1KILD 1JCDA 3AE1C 3GW6A 3B8EB 3H1IG 2H88C 2N5HA 2WPQA 3F89A 5AVVB 1K73Q 1S9KE 1AVOA 1LTJB 4IPYA 3B5NB 2IX7C 3AECC 2VLQA 1RF1C 1QVFO 5I4TG 3KZIE 2PAJA 1PP9D 1IFMA 3N4XA 1AVYA 1URQD 4TT3H 2M8RA 1LP1A 1PV3A 4N78D 2P58A 2MR7A 2KW2A 4D6TE 3DS1A 1OW8A 3L73D 1KILB 5AW0B 5CCGD 1SLQA 1KQGB 3RK3E 4UHPB 1LTTC 2J59M 1P84I 1RE4C 4COPA 5AVQB 3AEBC 4UB8E 3H1IE 3CX5D 1KB9E 4XFYA 4HKZH 2O1KA 5KP7B 1FDIA 1GK4A 1URQB 4ZMDA 2JQ4A 2N1TC 1E0HA 1EOQA 3L72J 2FBWC 1Q7YQ 3PP5A 5AW1B
chains in the Genus database with same CATH topology
3G28A 2E1MA 2OARA 1VQOP 3CCQP 1VQ4P 2M8PA 2QEXP 3VRLC 1BAJA 4U0AA 3CD6P 1RO2A 3HYBA 2PEKA 5F2KA 3B5IA 1ZMBA 1A43A 3G1GA 3DS5A 3DS4A 1VQ5P 3H47A 4COCA 3G4SP 3CCEP 2P9XA 1KQSO 1KC8Q 2JO0A 1IUQA 3MGEA 4M0IA 1VQNP 1K73Q 5JPAA 3H0DA 2PEJA 4U0CA 3WBHA 1W2BO 4IPYA 1Q86Q 2XXMA 1VQKP 3OW2O 2OTJP 2EIAA 1YJNP 3DS0A 4PH0A 3CC2P 1QVFO 3Q20A 2PEQA 5I4TG 5DCKA 2PENA 1PEMA 2BHVA 2Z46A 1K9MQ 3G6EP 3LRYA 4XROA 1RO0A 3HZQA 4XFXA 1PEOA 2PEOA 3G0VA 1D1DA 1N8RQ 5F2OA 3CC7P 1QRJA 3G21A 5HGMA 3G1IA 2LF4A 4GR6A 3CCJP 3DS3A 3CCSP 3CCUP 1YHQP 1K8AQ 1VQLP 2KODA 5HGNA 3RG6C 3CPWO 3DPHA 2PEMA 2BUOA 2JYGA 4PH1A 2CWOA 2Z45A 5HGOA 3DS1A 3G71P 5BS2A 1YJWP 2EFJA 4XFZA 1YIJP 1AUMA 4U0BA 1YI2P 1VQ7P 3M1MA 1K30A 3I56P 1M74A 4QNBA 4U0DA 5HGLA 3CCMP 1PEQA 2EG5A 2QA4P 2DGYA 1NJIQ 1Q82Q 2XV6A 3CMEP 4GR2A 4U0EA 4COPA 5BS1A 3CMAP 1VQMP 1M1KQ 3E2DA 2OTLP 2JYLA 1JJ2O 1QVGO 1KD1Q 2L6EA 4WYMA 2ONTA 2BQ1E 3NTEA 1VQPP 1M6EX 3CCLP 1VQ6P 1RNIA 1Q81Q 4U0FA 4XFYA 1YJ9P 1YITP 3CC4P 3P05A 3H4EA 4XRQA 1VQ8P 2PY8A 1A8OA 1S72P 3G26A 3CCRP 2XT1A 5F2NA 3G29A 1M6NA 2M8LA 3I55P 2PEIA 2M8NA 3CCVP 1EOQA 1PEUA 1M90Q 3CXCO 1E6JP 1EIAA 3DS2A 1Q7YQ 2Z44A 1VQ9P 3DTJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W2B O;  1Q86 Q;  1VQP P;  1VQK P;  3CCL P;  1VQ6 P;  3G71 P;  3OW2 O;  2OTJ P;  1Q81 Q;  1YJW P;  1YJ9 P;  1YIT P;  1VQO P;  1YJN P;  3CC4 P;  3CC2 P;  3CCQ P;  1QVF O;  1VQ4 P;  1YIJ P;  2QEX P;  1S72 P;  1YI2 P;  3CD6 P;  1VQ7 P;  1K9M Q;  3CCR P;  3CCM P;  3I56 P;  3G6E P;  3I55 P;  2QA4 P;  3CCV P;  1VQ5 P;  1NJI Q;  1Q82 Q;  1N8R Q;  3CME P;  3CMA P;  1M90 Q;  3CXC O;  3G4S P;  3CCE P;  1VQM P;  1KQS O;  1M1K Q;  3CC7 P;  2OTL P;  1KC8 Q;  3CCJ P;  1YHQ P;  3CCS P;  3CCU P;  1JJ2 O;  1QVG O;  1K8A Q;  1Q7Y Q;  1KD1 Q;  1VQL P;  1VQN P;  1K73 Q;  3CPW O;  1VQ9 P;  1VQ8 P; 
#chains in the Genus database with same CATH topology
 2HLO A;  5GTH H;  3A2A A;  2QVA A;  5KP6 B;  5AW3 B;  1OWA A;  1E5W A;  4GKG A;  1SQQ J;  1KQF B;  4WBA A;  2XZ0 D;  1OW6 A;  1CI6 B;  2PEK A;  1LT1 A;  2WSF H;  5GTI H;  1JNM A;  5KJ7 A;  2E43 A;  3C8V A;  1GD2 E;  2FQ2 A;  3M0A A;  2WSE H;  1Q86 Q;  1LTI C;  5AVW B;  1GL2 B;  3S1K A;  1AYI A;  3DS0 A;  3H25 A;  4H0L C;  5K5G B;  1GW4 A;  4YTP C;  1D1D A;  2FY8 A;  2FAD A;  3D6Y A;  4PV1 C;  1NAY A;  1SQX G;  1NO4 A;  2AFE A;  4QKO A;  4N3Y B;  1BCC D;  3BCC J;  3G71 P;  2JU2 A;  3CXH E;  3R4Y A;  2KI7 B;  2NPS C;  1N7S D;  2O1J A;  1BSN A;  3EJB A;  1CZQ A;  3PH0 A;  2R3S A;  1A02 J;  1YQ4 C;  1VQM P;  1K05 A;  1SQQ G;  1K04 A;  1EZV I;  2YIU C;  3HUS C;  4H2Y C;  1NU1 G;  3NXS A;  2KSJ A;  1OFC X;  5CZD B;  4XE5 B;  2NO8 A;  1BDD A;  1Y8A A;  2M8N A;  2PRR A;  2K0X A;  1PEU A;  3HD7 D;  1LTG C;  3CX5 H;  1FR2 A;  3VTP C;  1SQX E;  1S3J A;  1OXZ A;  4IOI H;  2OAR A;  5H2F H;  1S9K D;  1RF0 C;  3PJS K;  2H89 C;  2ZVO B;  1N7S B;  3H1H J;  3AED C;  3A7O A;  1L0L D;  3H47 A;  3BCC G;  2RKL A;  2R5B A;  1SQV K;  2XNX A;  2K9Y A;  2Q9I A;  5KP8 B;  3KYQ A;  1SQQ E;  2E75 C;  1ZP0 C;  5TIS H;  1E79 H;  4ASV A;  1JMM A;  1LJ2 A;  4GOD A;  1QX8 A;  2A45 H;  1MV8 A;  2FYU G;  2PEN A;  4D6T D;  1K9M Q;  2FAE A;  1NU1 E;  5APW A;  3LRY A;  1NQ4 A;  3VN0 A;  2M3B A;  3E1I A;  3RL0 C;  3HD7 B;  2CQ8 A;  2Y0D A;  1UIX A;  1K8A Q;  2ZJS E;  3KPE A;  2XKM A;  4H13 D;  3RK3 D;  2PEM A;  1LWU A;  2HPC B;  3EWK A;  5CCH C;  2W6B A;  4K3A A;  1U7J A;  5APQ A;  1NVO A;  3H1I D;  2QE7 H;  2OYH B;  1L0N G;  4HH2 A;  1KB9 D;  3OA7 A;  3Q5P A;  1JB0 J;  2HOD B;  4WWI A;  3L71 G;  2WT7 B;  1NJI Q;  3I5C A;  3U1C A;  2JB0 A;  3V4Q A;  1ZR2 A;  2AVA A;  2YXR B;  2KNC B;  2IFN A;  3BCC E;  4IZ6 A;  3H1H G;  1T3J A;  1NTM K;  2P7J A;  1XTC C;  2ERH A;  2KK7 A;  4XRQ A;  1S72 P;  3BRT B;  2N98 A;  3CCR P;  2KOQ A;  3GZM A;  3RL0 g;  2FYU E;  3E7K A;  2K37 A;  4U3F G;  2OYO A;  4GOF A;  2LXC B;  3RK3 B;  4H13 B;  4NPF X;  1BE3 G;  1QL1 A;  1QL2 A;  3G28 A;  4ZKU A;  4R4L A;  5KAI H;  1SFC A;  3W68 A;  2KG6 A;  2KLU A;  1VQ4 P;  2R32 A;  3E1R A;  3Q5S A;  1SQV J;  1ZLL A;  1S4X A;  1L0N E;  4W7Z A;  2P9X A;  2A06 G;  4JYC A;  3MGE A;  3L71 E;  3TGU J;  2P67 A;  3RGU A;  3OW2 O;  4I1L A;  2WSC J;  2Y0C A;  1S2E A;  3H1H E;  5DCK A;  3KZI H;  2P2U A;  3LW5 J;  2E74 C;  3KQG A;  1PEO A;  3CXH D;  3CC7 P;  3H32 B;  1ZW0 A;  2KGE A;  4C46 A;  2WPR A;  1L0I A;  4PH1 A;  2JYG A;  1NTK K;  2E5Y A;  2CWO A;  4U3F E;  2CG5 B;  3A0B E;  1KLP A;  1BE3 E;  1DEB A;  2C0W A;  1FAV A;  7CEI A;  1NTZ K;  1OW7 A;  1L2P A;  2GDX A;  1K30 A;  1PEQ A;  3HTK A;  4PJ0 E;  3WUV A;  2B89 A;  1L4A D;  5AVX B;  2JYL A;  4WVZ A;  3M06 A;  1NTM J;  2KS1 A;  1YYC A;  3HRN A;  4UB8 H;  2KGD A;  2A06 E;  2M3E A;  1KB9 H;  1J1E C;  1N73 A;  2PY8 A;  1SQX D;  5BU5 A;  1NGM B;  2AEM A;  1L0H A;  1SVF A;  4Z1M H;  3O6Q A;  2IZ0 A;  2Z44 A;  1FZC B;  2POH A;  1RHZ B;  3VMZ A;  4H2W C;  2MVV A;  3EFF K;  4OVN F;  2E1M A;  4O9B A;  4RKU J;  3VYI A;  2HYN A;  3VMA A;  4U0A A;  3CD6 P;  1X22 A;  1SQQ D;  3B5I A;  3RK2 C;  1EXJ A;  1PGQ A;  2K9J B;  1OZH A;  2LML A;  5KLV G;  1L4A B;  1KC8 Q;  1EDJ A;  1NU1 D;  4YXW H;  1Z56 A;  5EJD A;  2B87 B;  4DT0 A;  3H6P A;  5H2F E;  1KIL A;  2JAZ A;  2AFD A;  4L73 A;  1IO4 A;  1ACP A;  1PEM A;  2BHV A;  2OYI A;  3U43 A;  4TLF A;  1NTK J;  3L74 J;  3AE4 C;  3WU2 E;  5AW4 B;  2NRG A;  2J5U A;  5HGN A;  3G9R A;  1NTZ J;  2L5G B;  3GZL A;  1YJW P;  5AW7 B;  3CXH H;  2JBG A;  5BVZ A;  1YI2 P;  2M0B A;  2JO1 A;  1URQ A;  2QA4 P;  3V6I A;  1GW3 A;  1JJ2 O;  5AVS B;  2DW3 A;  5KLV E;  2FYU D;  2Y9Z A;  4OH8 B;  2KLV A;  2X2B A;  3NY7 B;  1LWU C;  3I55 P;  3CCV P;  2WTY A;  3CWB G;  3V2N A;  4Y99 C;  2O01 J;  1VQ9 P;  2E5T A;  1MKM A;  1L0N D;  1GL2 A;  2KOS A;  1SQP K;  2BAS A;  3C1L A;  2N1T D;  2H43 A;  3L75 J;  3L71 D;  2SPZ A;  3TDK A;  1IFJ A;  1LT9 C;  1NTK G;  3L74 G;  2QSI A;  2WPS A;  3QWO C;  2K3R A;  4I7Z C;  1DV5 A;  2K88 A;  3H1H D;  3AE5 C;  3WBH A;  2XZ1 C;  4B86 A;  1NWQ A;  2OTJ P;  1YJN P;  4C7N B;  1R8E A;  4U3F D;  1BE3 D;  1N8R Q;  1SFC C;  3L36 A;  2PNG A;  1WRG A;  1RE3 C;  3G21 A;  2LF4 A;  3CCJ P;  4H0L D;  3RG6 C;  3CWB E;  1MUU A;  1PGO A;  2B88 A;  2N1T B;  1IFD A;  2EFJ A;  4PV1 D;  1AUM A;  2A06 D;  3FXD A;  3I56 P;  1JO5 A;  3L74 E;  3CMA P;  2QJY C;  5B66 E;  3F5H A;  3E2D A;  2FKW B;  3IFM A;  1SQB G;  1LGH B;  2NPS D;  2LIU A;  4RO0 A;  4WYM A;  4BPF A;  2V7Q J;  4XFJ A;  2OQQ A;  2WPT A;  4PD4 E;  1LNQ A;  1M1J A;  1YJ9 P;  2KG8 A;  2KYV A;  2IBZ I;  1N7S A;  1OX3 A;  3IN6 A;  3L35 A;  1A8O A;  1AQT A;  1GXH A;  1H0T A;  3AE3 C;  2AF8 A;  1S1C X;  1JY3 N;  3T97 B;  2C0X A;  2N6Z A;  1SQP J;  1ZNV A;  4H0L B;  2ITA A;  5KTB A;  1GZL A;  3NTN A;  4PV1 B;  1GXG A;  4GT1 A;  1A43 A;  1EQ7 A;  3G1G A;  2JKV A;  3HD7 A;  5M1B A;  2VRS A;  2VLO A;  3MIW A;  1T3U A;  2I1K A;  1N73 C;  3MTU E;  2NPS B;  2KOO A;  2FXM A;  3BAT A;  1SQB E;  2H7H A;  3O8Z A;  2ZT9 C;  5AW8 B;  1FBM A;  1MFT A;  2WT7 A;  2GZG A;  2PEO A;  2YIU B;  2E75 D;  3HUS B;  1FOS F;  4YPC A;  2FFD A;  2JEE A;  2GDY A;  3CCS P;  2KNC A;  2WQY C;  1HBW A;  3V2R A;  1HJB A;  3SFE C;  3A0B H;  1EDI A;  1IMP A;  5KLV D;  2D2C C;  2IPP A;  3S4R A;  1GPJ A;  2EG5 A;  4PJ0 H;  5CCH D;  2KZI A;  1EDK A;  1DX7 A;  3BAS A;  2BQ1 E;  1G2C A;  2OYI C;  3PLN A;  1M6E X;  1X3O A;  2GUV A;  3P05 A;  3ITK A;  3L72 G;  3L37 A;  1EC5 A;  2LKM A;  2EHS A;  3G29 A;  2RH0 A;  3WMM 0;  2KIK A;  2I8D A;  3ABV C;  1JY2 P;  1S5L E;  2E75 B;  3KXD A;  3V4W A;  3GF3 A;  3W67 A;  3H1K J;  4DJG A;  1EMV A;  1VQO P;  2GZJ A;  1LTS C;  3DS5 A;  4BRY B;  1QEX A;  2MF4 A;  2KGA A;  1USD A;  4W80 A;  2WSS H;  1X9V A;  1KYO I;  2GYK A;  3TSI A;  1FZA A;  4HKG A;  3H1L J;  1BGY J;  1VQK P;  1IK9 A;  3H1J J;  4IL6 E;  4EI2 A;  3CWB D;  3NMD A;  3M9B A;  4OWF A;  2Z46 A;  3K5B A;  1GL2 C;  3L72 E;  3P8M C;  2OGU A;  1LP1 B;  1FDO A;  3WU2 H;  3CL3 D;  5CBN A;  2WZ7 A;  4LGD E;  2Q3I A;  4NPE A;  3L74 D;  4IFM A;  1ZOY C;  3SWK A;  2E74 D;  3N7N A;  4HYT B;  1XTG B;  3FX0 A;  3S9O A;  1VF5 C;  5KAF E;  1VQ7 P;  1GTW A;  5AVY B;  4PD4 D;  2DGY A;  1Q82 Q;  3H1K G;  1GK6 A;  2BCC J;  2QJK C;  1JM0 A;  2WSE J;  1DH3 A;  2YMY A;  2YNY A;  2Z5I A;  1HF9 A;  3AEG C;  1M8O B;  1JOC A;  3EQ2 A;  1M6N A;  3MHV A;  1VDF A;  2K92 A;  4EDF A;  2JP3 A;  2B87 A;  2W27 A;  4DZO A;  1PP9 J;  1JY3 P;  5E79 E;  2E74 B;  2YXQ B;  4ZNC A;  1MZ9 A;  2R44 A;  2N9Y B;  5B5E E;  1RO2 A;  1SQB D;  5DJT B;  3GJN A;  1M1J C;  4COC A;  2JGP A;  3GHG A;  3G4S P;  2QRX A;  4H44 C;  3B4S A;  1GMJ A;  4HB1 A;  3L73 J;  2LXB A;  4U0C A;  4WY4 A;  5APX A;  1YTZ T;  3RK2 D;  2BEZ F;  2VLP A;  2EIA A;  2JWD A;  4I2L C;  1BSH A;  4DCK A;  4UB6 E;  2VSQ A;  2B9B A;  2JR8 A;  4CA3 A;  2L22 A;  1P84 E;  5APS A;  4BPG A;  1J1E B;  4YXD C;  5CBO A;  2XV5 A;  1M7L A;  1IC2 A;  1N2D C;  5HGO A;  4MN4 C;  3G3Z A;  2KWL A;  1JTH A;  2LKI A;  5AVU B;  3RBX A;  2NZ2 A;  2HG5 D;  3R2P A;  5B66 H;  5APV A;  2L9F A;  1QVG O;  2KB7 P;  1PGJ A;  1IFI A;  2ZYG A;  4M3L A;  3RK2 B;  1RQV A;  4PD4 H;  1DEE G;  3L70 J;  2FFD C;  2LR2 A;  5KJ7 C;  1WMK A;  2K93 A;  1L0L K;  1ZXG A;  1YQ3 C;  1AF8 A;  4N6J A;  5AW9 B;  4RES B;  1EZV G;  5TJH A;  2EHT A;  2W6J H;  4JYB A;  4AQR D;  1J1D C;  3Q2Y A;  3HE5 B;  1KB9 I;  1RE4 A;  1ZRT E;  3M9H A;  3QH9 A;  4C7N A;  1OIP A;  1SQV G;  3KHU A;  2GZF A;  4EYY Q;  2OTK E;  2FVF A;  3VRL C;  3EJD A;  4R0M A;  5F2K A;  1PZQ A;  1ZMB A;  3MUD A;  3PTZ A;  1RQU A;  2WPV B;  3D70 A;  3TGU G;  1KQS O;  3LIE A;  4Y28 J;  1LTJ A;  1IK7 A;  3A0H E;  3B5N A;  1HGV A;  3L72 D;  2XXM A;  1W2E A;  4LC1 A;  1IJD B;  1NYH A;  2FYN C;  1HUC A;  3G6E P;  2FQ1 A;  3G0V A;  5HGM A;  4ZKP A;  1KN7 A;  3BRV B;  3L70 G;  1EZV E;  4KT0 J;  1KV4 A;  3A5T A;  1A02 F;  1LWU B;  1VPC A;  2LOL A;  1SFC D;  4XFZ A;  4Y99 B;  3HE4 B;  1QLE D;  1LTB C;  1SQV E;  2BEQ D;  1HVV A;  2IZ1 A;  1NTM G;  3VP9 A;  3T97 A;  3CME P;  1KYO E;  1VKU A;  2QNW A;  3M91 A;  2GZI A;  1LT9 B;  3TGU E;  3CCL P;  1L0L J;  3MP7 B;  2Q1K A;  3U1A A;  4U0F A;  5AVT B;  1LTA C;  2K0Y A;  5BU8 B;  4JBZ A;  2L0Q A;  3BCC D;  2R5D A;  5F2N A;  1T2K C;  3AE8 C;  1KQL A;  5C39 A;  3CLQ A;  1S5L H;  1M90 Q;  2AEF A;  2G8Y A;  3VMY A;  4JPZ B;  4NPD A;  2AEJ A;  2QJP C;  4D6T J;  1DNY A;  2KXP B;  3L70 E;  4IFF A;  1SFC B;  1JY2 N;  1CI6 A;  5CCG A;  2M5R A;  2GA1 A;  2K0D X;  1JY3 O;  3SSU A;  2N5I A;  3DS4 A;  3HUS A;  3V5B A;  2JO0 A;  2P10 A;  1IUQ A;  1NTM E;  1RF1 B;  1VQN P;  4CPG A;  1P84 D;  5AW2 B;  3H1I J;  4OGQ C;  1IZN B;  4IL6 H;  2QJY B;  3Q20 A;  2PEQ A;  1FOS E;  2KGC A;  3AEF C;  3CI9 A;  1CSB A;  2MKV A;  1M56 D;  2AXT E;  1NTZ G;  1L0L G;  1HGZ A;  1YHQ P;  2IYP A;  1CEI A;  2ZT9 D;  3USS A;  2RMZ A;  2C9N Y;  3TF5 A;  3AE2 C;  2KOG A;  3Q1M A;  3GHG C;  3WUU A;  2E76 C;  4U7J A;  5APU A;  2M5A B;  3B4Q A;  1SQX K;  2O01 N;  4JQ0 D;  3D6Z A;  3D71 A;  5KAF H;  4QMA A;  2WVR A;  4AUW A;  1SS1 A;  2J58 A;  1M74 A;  4WY4 C;  5HGL A;  2YKP A;  2XND H;  1IFP A;  2KS1 B;  2D2C D;  2JWA A;  1Q81 Q;  2XU6 A;  1OR5 A;  2YMK A;  5KLI C;  3SWY A;  3CC4 P;  1SQQ K;  1N73 B;  2KOP A;  4I6M C;  3FWN A;  4BRY A;  3VMX A;  1OVV A;  4IFD K;  1N86 A;  1ZRT D;  1U7M A;  3C9I A;  5CCH A;  1EXI A;  2G3A A;  2KUB A;  1NTK E;  3CXC O;  1E6J P;  3TNU B;  3IF4 A;  4DOJ A;  1NU1 K;  3DS2 A;  2ZT9 B;  3O6Q B;  5KKZ C;  3L75 G;  1NTZ E;  1L0L E;  3MGN A;  1JMB A;  5E79 H;  3AE7 C;  2M8P A;  5B5E H;  5AW6 B;  3HYB A;  4GIF A;  2N9B A;  2Q6Q A;  3V2Q A;  1FZG A;  1FC2 C;  3RG2 A;  2FXP A;  5L8R J;  1H8A A;  2WMM A;  1FZE A;  4BPH A;  2D2C B;  4JF7 A;  2Y0E A;  2PFX A;  3CC2 P;  1EZV D;  1W5C E;  2HFE D;  3BVH A;  4UB6 H;  3P32 A;  1P84 H;  3HZQ A;  2OYI B;  2KG9 A;  1VQL P;  1VHN A;  1SQV D;  2H8P D;  2HPC A;  3MUD C;  2FYU K;  1SQX J;  1KYO D;  1GL2 D;  2JU1 A;  2KOR A;  2Q3E A;  2GZE A;  3L75 E;  1FJP A;  1FS0 E;  1JEK A;  2OYH A;  3TGU D;  1YIJ P;  1LTJ C;  3B5N C;  2HOD A;  1Y9B A;  4ASW A;  2ZFC A;  1VL2 A;  3MZW B;  1X0T A;  5CJ0 A;  3L4F A;  1N7L A;  1VF5 D;  2CGQ A;  2LTE A;  3GF7 A;  1PPJ G;  2JDI H;  1L0N K;  1R5S A;  3RL0 D;  3H4E A;  2W83 C;  3G26 A;  1HTL C;  1NU1 J;  4GDO A;  3L70 D;  1SQP G;  5HV8 A;  3GG2 A;  1KIL C;  1ZV8 A;  2WIT A;  1PIX A;  1AJY A;  1G1J A;  3AEA C;  2K1A A;  1FJK A;  1NTM D;  3AE9 C;  2MY5 A;  2IYO A;  2PP6 A;  2CPS A;  1VF5 B;  3TYY A;  3GLM A;  2Q7C A;  3A0H H;  1URQ C;  4DG9 A;  2ZYD A;  4PH0 A;  1PPJ E;  3RL0 B;  3VP8 A;  4H44 D;  4A7P A;  1T8Z A;  2QJK B;  3JCU E;  4XFX A;  2FYU J;  1NH4 A;  3H32 A;  2KSE A;  3CX5 I;  4GR6 A;  2GM4 A;  3DS3 A;  5CCG C;  4AYC A;  1SQP E;  2Q5U A;  2FVA A;  3A3Y B;  1U57 A;  1TU3 F;  1HY8 A;  3NFQ A;  2DNW A;  1SP4 A;  3GMA A;  1R5L A;  1D7M A;  5AVR B;  3U59 A;  1UJZ A;  3FWL A;  3MD0 A;  4GR2 A;  5BS1 A;  1KYO H;  1L0N J;  2FVE A;  1M1K Q;  3SFD C;  2OTL P;  1KD1 Q;  1HJ0 A;  4C7R A;  3Q3D A;  1HH0 A;  3L71 J;  3HE5 A;  4KHX A;  4L76 A;  1H88 A;  3M0D A;  1NTK D;  2CK3 H;  3GKL C;  2CPB A;  3RBZ A;  1M1J B;  1DIP A;  2WSC H;  2GUS A;  1FZB A;  1FE6 A;  4H44 B;  1NTZ D;  2A45 I;  2WSF J;  1CW5 A;  3LW5 H;  2M8L A;  4XA4 A;  2VLN A;  1H0T B;  1QGK B;  1F80 D;  1FZC A;  2W90 A;  5KJ7 D;  4KJM A;  4WB4 A;  2IBZ G;  1VQ8 P;  4U3F J;  3KDP B;  1BE3 J;  3ZDM A;  1IMQ A;  1ZME C;  2K9J A;  4W7Y A;  1ZN5 A;  2K94 A;  2Z5H A;  1L4A A;  3CCE P;  1BGY G;  3H1L G;  4MRT C;  3H1J G;  1YTZ I;  2W8Z A;  3IAO A;  1H89 A;  3HE4 A;  5KLV K;  2KZJ A;  2LL8 A;  2ZVN B;  4F37 A;  2FAC A;  5HVC A;  2FYZ A;  3L75 D;  2PGD A;  3Q5R A;  3FGA D;  1BDC A;  1QRJ A;  2AXT H;  4H2X C;  1LT9 A;  1N7S C;  2FFD B;  2KOD A;  3CPW O;  2UWJ E;  3H1K E;  1MFZ A;  4EOT A;  2IBZ E;  2MJZ A;  2BCC G;  1OVR A;  1J1D B;  2IDB A;  3P7K A;  4U0E A;  1NOH A;  2QM7 A;  1T6A A;  2L6E A;  1NKN A;  2ONT A;  3H1L E;  1BGY E;  1VQP P;  1G2C B;  1NHL A;  2ZYA A;  3HD7 C;  2MD9 A;  1RNI A;  1J2J B;  2N50 A;  1BXI A;  2Z4E A;  1FU1 A;  1RE3 A;  3H1J E;  2I1J A;  1KZU B;  2FXO A;  3P8C E;  5AVZ B;  3OAK A;  1Q2N A;  3FXE A;  2XT1 A;  4NEO A;  1Q90 D;  1RF1 A;  2OYH C;  4R4M A;  1PP9 G;  1UII A;  3PRJ A;  5GTH E;  2FYN B;  1RH5 B;  1T2K D;  4PD4 I;  1BAJ A;  5GTI E;  2QIW A;  3UIA A;  1PPJ D;  3L73 G;  2BCC E;  1T8K A;  2FHS C;  2XZR A;  2MVU A;  1KIL E;  2PEJ A;  2YO2 A;  5KLV J;  1JY2 O;  3TK1 A;  2M5A A;  4EIJ A;  1UNK A;  1OMI A;  1SQP D;  3EFG A;  3RK3 C;  1EDL A;  4H13 C;  2XDJ A;  2MR8 A;  2GDW A;  2LPK A;  4K35 A;  4OGQ D;  1RO0 A;  1DD4 A;  1BCC J;  1USE A;  2QG4 A;  4GOE A;  5EFW B;  2KR5 A;  3CCU P;  1PL5 A;  2O01 H;  1M57 D;  2CNR A;  2QM8 A;  1PP9 E;  1FZF A;  2N1T A;  3V2P A;  2K5X A;  5AW5 B;  4PXH B;  2Y9Y A;  2YKQ A;  1KFN A;  4N78 E;  2ZXE B;  4HJG H;  3LID A;  4U0D A;  2QJP B;  1G1I A;  3TNU A;  3CE7 A;  2FQ0 A;  3M9Q A;  2E76 D;  2R3C A;  3L73 E;  5EW5 E;  2L4B A;  2A45 G;  4WY4 D;  4L74 A;  1MZ8 A;  3VOP A;  1HWT C;  2ROQ A;  3JSV C;  2N6Y A;  1SQB K;  3PHL A;  4OGQ B;  3CX5 E;  2ZXX A;  1KMI Z;  3OJA B;  1X79 B;  4LLH A;  3DTJ A;  4L75 A;  3CWB J;  3LMO A;  1AFO A;  5DJU B;  4I7Z B;  1BCC G;  3CCQ P;  1AV1 A;  2QEX P;  3CXH I;  1RY3 A;  3M0D C;  2L91 A;  1VQ5 P;  1KFM A;  1IFN A;  3GHG B;  2E76 B;  4M0I A;  2NPS A;  5JPA A;  3H0D A;  1PGP A;  1W2B O;  2V7Q H;  2HR3 A;  4WY4 B;  5TIS E;  3SWF A;  1FDM A;  2IFM A;  2K2Q A;  2AXC A;  4RJT A;  1FZC C;  1NAF A;  3H1K D;  5CMZ A;  2W6A A;  2WWW A;  4XRO A;  3II6 A;  1PFI A;  3JCU H;  2IBZ D;  5F2O A;  1KTM A;  2LIW A;  3G1I A;  5APT A;  5KLI B;  3IR9 A;  2KP8 A;  2YKO A;  3DPH A;  2RN0 A;  2BUO A;  2Z45 A;  2ZAE B;  1Z6M A;  1L4A C;  5BS2 A;  1HQB A;  1GDT A;  1S5L X;  3H1L D;  1BGY D;  1JUN A;  4U0B A;  1JCC A;  1Y47 A;  5CHX A;  3M1M A;  1JTH B;  4PWV B;  2P1J A;  3CCM P;  5CJ4 A;  4QNB A;  1BCC E;  5KKZ B;  2O3J A;  3H1J D;  2XV6 A;  3P8C D;  3EJE A;  4BWN A;  1KOR A;  2C9L Y;  1RF0 A;  1DD3 A;  3WUT A;  1ZR4 A;  2YO3 A;  1AQ5 A;  3NTE A;  1NKZ B;  3B5N D;  1VQ6 P;  1SQB J;  3AE6 C;  1YIT P;  3B71 A;  1WT6 A;  4BXL A;  2PEI A;  1OVU A;  3HTK B;  1AA0 A;  4D6T G;  1EIA A;  1YBK A;  3AEE C;  1GU5 A;  4IL6 X;  5APY A;  2E42 A;  2BCC D;  5KAI E;  2V4H A;  1X8Y A;  2JJL A;  1GU4 A;  3JC2 2;  1KIL D;  1JCD A;  3AE1 C;  3GW6 A;  3B8E B;  3H1I G;  2H88 C;  2N5H A;  2WPQ A;  3F89 A;  5AVV B;  1K73 Q;  1S9K E;  1AVO A;  1LTJ B;  4IPY A;  3B5N B;  2IX7 C;  3AEC C;  2VLQ A;  1RF1 C;  1QVF O;  5I4T G;  3KZI E;  2PAJ A;  1PP9 D;  1IFM A;  3N4X A;  1AVY A;  1URQ D;  4TT3 H;  2M8R A;  1LP1 A;  1PV3 A;  4N78 D;  2P58 A;  2MR7 A;  2KW2 A;  4D6T E;  3DS1 A;  1OW8 A;  3L73 D;  1KIL B;  5AW0 B;  5CCG D;  1SLQ A;  1KQG B;  3RK3 E;  4UHP B;  1LTT C;  2J59 M;  1P84 I;  1RE4 C;  4COP A;  5AVQ B;  3AEB C;  4UB8 E;  3H1I E;  3CX5 D;  1KB9 E;  4XFY A;  4HKZ H;  2O1K A;  5KP7 B;  1FDI A;  1GK4 A;  1URQ B;  4ZMD A;  2JQ4 A;  2N1T C;  1E0H A;  1EOQ A;  3L72 J;  2FBW C;  1Q7Y Q;  3PP5 A;  5AW1 B; 
#chains in the Genus database with same CATH homology
 3G28 A;  2E1M A;  2OAR A;  1VQO P;  3CCQ P;  1VQ4 P;  2M8P A;  2QEX P;  3VRL C;  1BAJ A;  4U0A A;  3CD6 P;  1RO2 A;  3HYB A;  2PEK A;  5F2K A;  3B5I A;  1ZMB A;  1A43 A;  3G1G A;  3DS5 A;  3DS4 A;  1VQ5 P;  3H47 A;  4COC A;  3G4S P;  3CCE P;  2P9X A;  1KQS O;  1KC8 Q;  2JO0 A;  1IUQ A;  3MGE A;  4M0I A;  1VQN P;  1K73 Q;  5JPA A;  3H0D A;  2PEJ A;  4U0C A;  3WBH A;  1W2B O;  4IPY A;  1Q86 Q;  2XXM A;  1VQK P;  3OW2 O;  2OTJ P;  2EIA A;  1YJN P;  3DS0 A;  4PH0 A;  3CC2 P;  1QVF O;  3Q20 A;  2PEQ A;  5I4T G;  5DCK A;  2PEN A;  1PEM A;  2BHV A;  2Z46 A;  1K9M Q;  3G6E P;  3LRY A;  4XRO A;  1RO0 A;  3HZQ A;  4XFX A;  1PEO A;  2PEO A;  3G0V A;  1D1D A;  1N8R Q;  5F2O A;  3CC7 P;  1QRJ A;  3G21 A;  5HGM A;  3G1I A;  2LF4 A;  4GR6 A;  3CCJ P;  3DS3 A;  3CCS P;  3CCU P;  1YHQ P;  1K8A Q;  1VQL P;  2KOD A;  5HGN A;  3RG6 C;  3CPW O;  3DPH A;  2PEM A;  2BUO A;  2JYG A;  4PH1 A;  2CWO A;  2Z45 A;  5HGO A;  3DS1 A;  3G71 P;  5BS2 A;  1YJW P;  2EFJ A;  4XFZ A;  1YIJ P;  1AUM A;  4U0B A;  1YI2 P;  1VQ7 P;  3M1M A;  1K30 A;  3I56 P;  1M74 A;  4QNB A;  4U0D A;  5HGL A;  3CCM P;  1PEQ A;  2EG5 A;  2QA4 P;  2DGY A;  1NJI Q;  1Q82 Q;  2XV6 A;  3CME P;  4GR2 A;  4U0E A;  4COP A;  5BS1 A;  3CMA P;  1VQM P;  1M1K Q;  3E2D A;  2OTL P;  2JYL A;  1JJ2 O;  1QVG O;  1KD1 Q;  2L6E A;  4WYM A;  2ONT A;  2BQ1 E;  3NTE A;  1VQP P;  1M6E X;  3CCL P;  1VQ6 P;  1RNI A;  1Q81 Q;  4U0F A;  4XFY A;  1YJ9 P;  1YIT P;  3CC4 P;  3P05 A;  3H4E A;  4XRQ A;  1VQ8 P;  2PY8 A;  1A8O A;  1S72 P;  3G26 A;  3CCR P;  2XT1 A;  5F2N A;  3G29 A;  1M6N A;  2M8L A;  3I55 P;  2PEI A;  2M8N A;  3CCV P;  1EOQ A;  1PEU A;  1M90 Q;  3CXC O;  1E6J P;  1EIA A;  3DS2 A;  1Q7Y Q;  2Z44 A;  1VQ9 P;  3DTJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...