2OTLQ

Girodazole bound to the large subunit of haloarcula marismortui
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
95
structure length
95
Chain Sequence
b'PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal RNA
publication title The Structures of Antibiotics Bound to the E Site Region of the 50 S Ribosomal Subunit of Haloarcula marismortui: 13-Deoxytedanolide and Girodazole.
pubmed doi rcsb
molecule tags Ribosome
total genus 19
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2007-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01157 Ribosomal_L21e Ribosomal protein L21e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 2otlQ00
3CCLQ 1KC8R 1KD1R 1M1KR 3CC7Q 2OTLQ 3I56Q 3CCJQ 3G4SQ 1VQMQ 1VQ5Q 1VQKQ 3CCVQ 1QVFP 1JJ2P 3CD6Q 1VQ7Q 3CCRQ 1K8AR 3CC2Q 2QEXQ 1YJ9Q 1QVGP 3G6EQ 2OTJQ 3OW2P 1Q81R 3CC4Q 1YITQ 1YJNQ 3CCQQ 1YIJQ 3CCSQ 1VQNQ 3CXCP 1Q86R 1M90R 1S72Q 2QA4Q 1YI2Q 1VQ6Q 3CCUQ 3CCMQ 1K9MR 1KQSP 3I55Q 1NJIR 1VQLQ 3CCEQ 1W2BP 1Q7YR 1YJWQ 1VQ8Q 1VQPQ 1VQOQ 3CPWP 3G71Q 1K73R 3CMAQ 1YHQQ 1VQ4Q 3CMEQ 1N8RR 1Q82R 1VQ9Q
chains in the Genus database with same CATH superfamily
3EG9B 4QQ6A 4ANJA 3PIPA 3X20B 4J6XA 1LPLA 4EMKA 3G71T 4M7AC 1SHGA 2QEXQ 1NLPC 1XQHA 5HK3A 1YIJQ 1TWBA 2LC4A 5FLXE 4ZN3A 2MMPA 3EFOA 4CI0C 3EHQA 1W2BA 1S72T 2H8HA 1OPKA 2M1HA 5GAMe 3OYYA 2EYZA 2HD0A 4MDXA 4IUTA 2JJ9A 2RQWA 1KQ1A 2HDAA 1TOVA 5DY9A 1ZUYA 2ED1A 1JEGA 3GPLA 4ZGEB 4C8QB 2HAXA 3CC4A 4WF2A 3QYGB 2HSEB 2RN8A 1KK7A 2V1QA 5GMKh 2OJ2A 1Q82R 4BB7A 3I35A 3J81E 1KD1R 2DX1A 3M0TA 4LNPA 1ACMB 2DJZA 3CMEA 1VQOT 2EIFA 4QVDA 3GOXA 2GFUA 2NUTA 1WIEA 2LT4A 3JRZA 3QO3A 4LUEA 1BBZA 2E4HA 1K9AA 1BCOA 4KRTA 2OTLT 3UF4A 2JW4A 2YLBA 4PFOA 3R6NA 3G6EA 1AZEA 4FM4B 4RG2A 4PJOG 1K73R 1WJRA 2IIMA 4JPBW 1KC8R 1M1FA 2AK5A 5LJ5d 4IUPA 2VYTA 1IHVA 4M7AE 3VS3A 2DE0X 2BIVA 1VQ5A 3QWXX 1YWOA 1CSKA 1UGRB 2XMFA 1U1TA 4OB1B 2DYIA 3OYHA 4N4GA 3SB2A 1WYXA 2O88A 4LE9A 5IT9E 1EFNA 1VYTA 2V26A 2CP5A 2CZ0B 5GAMj 1G8XA 4JRIA 3EG0A 1T0HA 1WHKA 3QZ9B 2WSEE 4RKUE 3CCQQ 5D6XA 1YI2Q 1RAAB 1RACB 2DL4A 5D6WA 1J3TA 2OAWA 1YJNT 1O9SA 2CP3A 3LW5E 4TVRA 2DERA 1Q95G 3CD6Q 3M56A 4Z89A 2DF6A 5FU6C 4PJOB 2DLPA 2M51A 4M78C 2XDBA 1M8VA 4D8KA 2E41A 4GLMA 1SRMA 4MMLA 2X4JA 3LH5A 3VJPA 1D0ZA 3G71Q 1O75A 1M2VB 2DAQA 4OB0B 2V8KA 3M0PA 2EGCA 3ME9A 1VYUA 4D6WA 4E7IA 4DOVA 3CC7A 4J9DA 4IURA 5GMKm 1M1KC 3D7SB 5I21A 3E9GA 4M75B 4C0GA 2ZAEA 4JZ3A 3JB9G 1UGQB 2PVGB 3EFOB 4HT9A 2CT4A 2ROLA 2FO0A 2YWWA 2COWA 1M4ZA 3M0QA 1M1KR 4J83A 3BW1A 2P4TA 5FWCA 4C0DC 1ZHIA 2D1XA 5CO7A 1X6BA 3EHRA 2RM4A 3META 3OYEA 5GAMd 1RUWA 4FIBA 2HBWA 2M0OA 2JS0A 1D09B 1GBQA 4OMNA 1VQOQ 1MMDA 1WHLA 1FYNA 2E3IA 3A98A 3P8HA 4AT1B 1M90U 2OTLQ 3PT9A 1C1AA 5GAN6 4C92E 3OS0A 1UGSB 1OZ2A 4FYWB 1H3HA 4M78E 3A1PA 3RKXA 5IN1A 3T9NA 4ELYC 4KUDK 3AHUA 4K11A 3I5SA 2D8HA 2MYSA 3KUFA 2LVMA 2O2OA 2YXYA 4OMQA 4A4EA 4N0AA 1B3QA 3CCMT 1VQPT 2KRSA 7AT1B 4RUGA 4XU0A 2DETA 1RL2A 2HQHA 3SFMA 1VQMA 5KYUA 2OTJT 3OW2A 4HVWA 3MKDA 3RKWA 3G1JA 3UA6A 1NEBA 1QP3A 1AWJA 3INZA 1WXUA 3HL8A 5J3BA 1RAEB 2LCLA 2DK3A 5IXFA 2FZGB 4XU1A 2ROTA 2NUZA 1UUEA 5A2QE 1VQKQ 1MV0B 2RQUA 4A4FA 3LH0A 4QKUA 1YJNQ 1YJ9A 1HK9A 4N4IA 5LJ3e 3CXCA 1WLPB 5IH2A 2H3JA 4DBHA 1IXDA 3OMCA 2KAFA 5KE2A 5CKDA 1I4K1 3CCUT 3QJ6A 3S6WA 1HSQA 3UT1A 3RMQA 2DBKA 2L3PA 1VQ9T 1TUDA 4ZNXA 1EIFA 1ZQ1A 4F7UE 1AWXA 3QWYA 2ZPBB 4M7DE 4A53A 1W2BP 3M9QA 1WNLA 1Q86C 4KULA 3AT1B 1UJ0A 1YCYA 3I55T 4XTXA 1WA7A 1VOMA 3VS1A 1SSHA 2QTXA 2M0YA 4OF1A 1WXTA 4E7SA 1OZ3A 2EGEA 2MWOA 2RJCA 5CAIA 1KQSA 2E65A 1OU8A 4FYVB 1N9SA 1PC0A 1RAGB 1Y0MA 2EJGA 3SD4A 5D6YA 3OYNA 3CMAA 4KGXB 2OAUA 4PNOA 4M7AD 2Y90A 1PKTA 4LN2A 4LD9K 3TEEA 2LJ3A 4AG2C 1QVGA 3GLXA 2FRYA 2RJFA 1N8RU 2GQIA 2K9GA 3CCRA 5D7UA 1NYFA 2MWPA 1JB0E 3CC4T 1PD1A 1WHGA 3JCMb 3F70A 1W2BS 2O4XA 2XG8D 1GCQC 1GCPA 3UA7A 3CCLQ 2P4RA 2KK4A 3JCMJ 2VGMA 2PTKA 1E6HA 1K1ZA 5I11A 3M58A 1NZ9A 3CMET 4C8QC 3X26B 3JCMg 3J7AF 4PK4A 4DQ2A 2JMAA 4E7KA 3G6ET 2EFIA 4RTZA 1M90C 2DEUA 3M0RA 2JMCA 2LCSA 5GANe 2LMJA 2OTJQ 1JBMA 2NUPA 1QCFA 1BK2A 4KBMB 3CBPA 2E10A 3JCMc 2MK5A 2LP5A 1WJSA 3E19A 3ULRB 1ZUKA 3MP1A 1M90R 1NBEB 1VQ5T 2K79A 1AD5A 3FEOA 3R6OA 3UDCA 2KMTA 2EQKA 4J6YA 4L59A 4HXJA 3CCEA 2F2VA 2EGAA 3H41A 2EQJA 5CKHA 2HMAA 4LD6A 1C0MA 1YWPA 2V8JA 1BI3A 1WI7A 2FYKA 1UB4A 4PLLA 4B9WA 3VYGA 4NS5A 1BCMA 2DIQA 2HQEA 4HA8A 3CCSA 1K8AU 4BE1A 2QQAA 3EG1A 4AG1C 2EYWA 3M4YA 2A28A 4P5NA 5LJ3d 1TXQA 3O8VA 1I5LA 2KE9A 3FJPA 4M7AF 4C8QE 3OYMA 3E2UA 5GAOl 1JU5C 1KHIA 5KH6A 4CC7A 1V29B 5HKCA 5KYWA 2EKOA 3MP8A 3MP6A 2VXEA 1K4US 2LQ8A 2EQIA 3UWNA 1OX8A 1VQPA 5IXBA 1GXIE 4C92D 4J9IA 2LNVA 3CCJQ 1G3YA 4M78D 3C95A 4AFZC 4X9DA 2VUBA 2L3QA 2V8IA 4EIKA 1Y7XA 3I9QA 3M57A 2H3EB 3CC7T 1ZX6A 5DLOA 3RESA 3CQTA 2JT4A 1H8KA 2VB6A 1QCOA 4KH0B 4BY6B 4FYYB 1R0CB 1ZLMA 4M75C 3OYBA 1RAIB 2K7AA 4IKFA 2J6KA 1SG5A 3OSSC 1VYVA 2Y4XA 1RADB 1CKBA 3MHXA 2XI9A 5CKEA 3OYJA 2O4XB 1UHCA 3CMEQ 2ZPHB 3JCMP 2RNAA 2LRQA 1VQ8T 2LCCA 1E7OA 5ECAA 2DD5A 1BI2A 2J7IA 3G6EQ 3OW2P 4M77A 3V7SA 1JO8A 4C5IA 4RMOA 2DTHA 2O31A 3H9NA 4RTXA 3SHWA 3VS5A 1M5Q1 1UEBA 1VQNA 2AKKA 3UPUA 3J80E 1N8RR 2AIRB 2I2LA 4O5VA 4HVVA 3ZFJA 3OS2A 3NHNA 1VQ5Q 4LDWA 2O01E 1WQ7A 3SWNA 1RI0A 1LNXA 2RI3A 1GFDA 3OB9A 3TQ7P 1AHJB 5GANd 1OQKA 1VQMT 4JZ4A 3CXCP 2PU9B 4JRPA 4FT2A 2A37A 1YFNA 1YITA 1N6AA 1QMCA 2BTTA 4C0FA 5C6SA 1PKSA 1IGUA 2CUBA 2AHJB 2C0TA 4E2FB 1X2KA 4MZMA 2ZPIB 2J6FA 2RI5A 1Q82C 1H641 2RA2A 4M75E 4M78F 1KD1C 3OW2S 2GCXA 1V1CA 3A8GB 1YJ9T 4BDZA 3REAB 4MZPA 1UECA 3RIRA 4Z8AA 2PZ1A 4IIOA 3BDLA 1A0NB 2LT1A 1YNZA 2QXFA 5A0LA 1Z9ZA 3Q1JA 4GBQA 2DXUA 1K73C 2BE9B 2DRKA 2RJDA 4BE2A 2RHIA 2KQWA 1KC8C 1Y57A 2EWNA 2ZZDA 1ZSZA 3NFCA 1FMKA 3OYLA 3SDZA 3CXCS 3WXMB 5KYWB 4M77G 3EH1A 1QQJA 4Y92A 1MNDA 1NPRA 4OGCA 2WSCE 3KXTA 1D1BA 1YHQA 4GY5A 3CC7Q 1M3BA 1D3BA 3JCMe 1K8AR 2LX7A 1Q7YU 1QVGP 4M7AA 1ABQA 3OS5A 4FYXB 1SHFA 2ZPEB 4JJBA 1YJWQ 4NOYA 5EC7A 3OYCA 5KYXA 1T3LA 2DPPB 1WFWA 3CMAT 2HL3A 2L5QA 3GIBA 2KXDA 2XK0A 1UFFA 3BFMA 4F7UF 3CCRT 1K9MR 2AT1B 3DB4A 2YDLA 2QGGA 1TUCA 3QYHB 2OI3A 2CDTA 2EBPA 5GAN7 3A5ZB 2XKOC 2YUOA 4DBFA 4HKEA 5LJ3h 3VYHB 4C92C 2CP7A 4F17A 1IREB 1QVGS 4M77B 2A3LA 1VQ7A 1ZBXA 4KH1B 1H92A 2QGFB 2L8DA 4BDYA 2MAMA 3EGDA 2R5MA 3CEYA 1VQ6A 4X34A 3JCMQ 5GMKi 3ZBDA 4IUUA 4JJDA 2WACA 4XK8E 4C8QD 1OI1A 1YP5A 4EMKB 1RLPC 2D9TA 2QASA 1HD3A 3U23A 1X01A 3VRZA 1JXMA 3OBWA 3UATA 1S72Q 4J9FA 1UJYA 1X6OA 2EYYA 3H8ZA 2E5KA 4AFUC 1MNEA 4M7AG 4NL2A 4OMPA 2DD4A 5A0GA 4II1A 1OV3A 3QKJA 5IAYA 3CCET 1R77A 1SPKA 3CBMA 4J7IA 1AWOA 9ATCB 1PSEA 4PJNA 4PLIA 4V2SA 3I56A 2LQKA 2X51A 5GAOm 3VS6A 1OPLA 2RB6A 5FROA 4FSSA 4C0ZA 3CCST 1CKAA 4BUGA 4DOWA 1G5VA 3L2VA 3L1AA 1VQ8A 4MZTA 1BYMA 3M59A 3KBGA 2CZ6B 2VV5A 2E64A 1QVFA 1LVKA 2NUTB 3JB9J 4M78A 4J9CA 5GJWB 5I2MA 4X1VA 2EYXA 1ZSZB 5CK9A 2ZPGB 3CCQA 4M7DC 2KBTA 2M02A 1W6XA 5LJ5g 2M9UA 3V8LA 3H0IA 2CYZB 1PWTA 2JXBA 3MJXA 3VS7A 2RHYA 1X43A 2SRCA 2LTOA 1W1FA 2ZGWA 1SF9A 1I0CA 5GANh 2KSSA 3NMZC 3LYIA 2EPDA 2VVKA 2CT3A 3JCMd 3H0HA 5LJ5f 1R0BG 2RHZA 4PL6A 3OYFA 1VQLA 2DEQA 1ZA2B 1MV3A 3M54A 3CCRQ 1AVZC 2M16A 4C8QF 3CC2A 2HL5C 3TREA 4B9XA 5I22A 2BZ8A 3OYGA 2L89A 1Q7YR 1SRLA 3H6ZA 4XTWA 3PIOA 2K5FA 1PRMC 4BY6C 4E7ZA 2IG0A 2KR3A 4M75D 2K2MA 2KT8A 1XOVA 5GAN3 3OA6A 5GMKj 2FZCB 2L0AA 4DBRA 4F7UA 4QQDA 2DYBA 2EJFA 2RQVA 4NL3A 3RNJA 1VQNT 4M78G 2EAYA 2PQWA 1TUGB 4ELZC 2DRMA 1NPPA 4KUIA 1UG1A 2DO3A 3QBYA 4XTYA 2QQSA 5LJ5h 1PNJA 2NWMA 3QSUA 4XU3A 2R57A 4AMCA 2CZ1B 2KYBA 3EAEA 1UGVA 2E6ZA 3WVDB 4X9CA 1UHFA 3CCEQ 3OYIA 5KE3A 3TU4K 1YITT 1HXDA 3PNWC 3EG3A 3CPWA 4C5EA 2FPEA 2R58A 2AZSA 3EG2A 3NTKA 3WVEB 4IUVA 5GAN2 3FIFA 5KCOA 3REBB 2DTIA 2ATCB 8AT1B 4Z88A 3JSCA 3CCSQ 4J9EA 1GRIA 1T3SA 1PG5B 1B34A 4J6WA 1D0YA 2AZVA 4A63B 3HRSA 3E9FA 4AFQC 1WX6A 2QK0A 2JTMA 5GAMf 3I5RA 5FWBA 1N27A 2BZXA 3L42A 1VQKA 3C94A 3HP9A 4R56A 2D0QB 1M3AA 2C0IA 1B7TA 1JQQA 1X69A 1M8MA 3CCMQ 1QKXA 3V7RA 4BI3A 2G3RA 3EGXA 2F1LA 1VQPQ 2JS2A 4RTWA 2YRVA 3HFOA 4F7UG 1OEBA 2D8JA 4R55A 4EMHA 2L3SA 1YHQT 2I0NA 3M55A 4ORZA 3QUIA 3M0SA 4M75F 5KYUB 2X9HA 1LCKA 2CSQA 4B6MA 1SEMA 2HZYA 2QA4A 1X75C 2E12A 4WTOB 4JJNK 3VS4A 5CCAA 3EG9A 4CC3A 1Z9QA 3GBQA 2GTJA 1Y71A 2ZCFB 5IHNA 4C0DB 3OS1A 1UGPB 3G4SA 5J26A 2FHDA 4OVAA 1PHTA 2KY9A 2X35A 3ASKA 3CCUQ 4L5GA 5GAMh 3DKMA 4E6RA 3L2QA 5CKFA 3VUZA 4F16A 1YCSB 3GP8A 3NPFA 2VC8A 2X3WD 2YHTA 1VQ9Q 1GCQA 2MPXC 2CH4A 5C0MA 3VS2A 2EQMA 5GMKl 3QHSA 5CVIA 1VQNQ 1GFCA 4C8QA 1N9RA 1VQ7T 1FXXA 3I55Q 2HSPA 4IIMA 1M2OA 1Q81U 1VQ6T 4JLIA 2RK2A 1T0JA 1PD0A 5J39A 4JRQA 1LJOA 3HTRA 4PJJA 1IRXA 4PJOC 4E47A 1K9MU 1UTIA 3CCLA 2E70A 4ZGJB 5AT1B 3CCVA 1U5SA 1YITQ 3P8DA 2QYZA 1BIAA 2DL5A 1WHJA 4A4HA 1U8RA 2FL7A 1OX9A 2GBQA 2PVOB 3QIIA 3M53A 3L2ZA 4EMKC 1I8FA 1NYGA 1TU0B 1QVFP 2RH2A 1M30A 2KRNA 1U06A 3QDFA 1KHCA 4C5GA 2J05A 3CC4Q 2K3YA 3RDVA 3I56T 2VASA 1K76A 1VIFA 4J9HA 1B34B 3L2UA 1AZGB 3EFRA 4OGEA 1NLOC 4KT0E 3TCJA 4JS4A 1KFZA 2DVEA 2RQTA 3PFSA 4J7FA 4BE0A 2G6FX 2RF0A 1X2QA 4O6JA 3VUBA 4ZTFA 2LJ1A 3ZEHA 3H0FA 1N8RC 2JNGA 2CGHA 2JZ2A 3PMIA 2E5QA 3HPWA 2KDSA 2FVUA 4E7JA 1PCXA 1QLYA 4VUBA 2DL3A 2RI2A 3EGXB 2QQBA 3CCQT 2K6DA 1BIBA 3FJ5A 4C8QG 2C06A 3N5BB 4M4ZA 2NUPB 3TSZA 3JB9H 4PJOE 3OQ5A 1NJIU 1OYXA 1I1JA 1QVFS 4M77E 1WJQA 2EKHA 2HKQB 2DL8A 1QWEA 2QI2A 4PJMA 3FB9A 4M7DD 1WDXA 2QQRA 2YT6A 3PMTA 3VKIA 3X25B 2BZYA 2JTFA 3JCMX 2DM1A 5LJ5j 2B8AA 1D1CA 2RMOA 3LLRA 3THKA 3HKSA 3FDRA 2EYQA 4OB2B 2PNIA 2A0FB 2HQXA 1VQLT 2CS7A 1VQ4A 2DXCA 1IHWA 4RCBA 4FL6A 3CCJA 3QG1A 2KYMA 4C92F 4M75A 1SKUB 1G83A 2EW3A 1M3CA 2JUFA 2JTEA 1KSWA 3CC2T 3HSBA 1QCNA 1I5OB 2KXCA 1BKBA 5CKBA 5LJ3g 3OYDA 2DL7A 5FW9A 2QDYB 1AEYA 4ATOA 4XTVA 2RPNA 1G3WA 5CIUA 3RUXA 1VQ7Q 1MHNA 3G7ZA 4JDSA 3MEWA 3OBYA 2YUNA 2VGNA 1UE9A 1PSFA 3HHTB 4BACA 1G3TA 4EDUA 1WHHA 2A36A 3FRNA 1VQ6Q 4LDXA 1K8AC 1KQSP 2FB7A 5LJ3f 2HNIA 3OMGA 2DFUA 3CPWP 5CR2A 3MEUA 1F1BB 2JM9A 4FU6A 4HCCA 4RTVA 2F2WA 3RMSA 2JM8A 2F5KA 2XDPA 4EMGA 2CZ7B 3VRYA 2X4XA 1M1GA 4OMFB 4AFSC 4Z02A 3PTAA 3A8HB 3A8OB 2GFAA 1Q81C 2GGRA 1WHMA 1I07A 2K3XA 1FWZA 1ARKA 4Q5WA 1K9MC 1W4SA 4A4GA 3X24B 1OU9A 4A4KA 3I56Q 1D1AA 4OMMA 2A7YA 2DVJA 2K5IA 2RQRA 4DEYA 3HRTA 1IO6A 1WXBA 1IB8A 1Q81R 4DEXA 4EPCA 2QTVA 2K2VA 3VS0A 2QEXA 2VXFA 2D6FA 1YIJA 4RTTA 1KQSS 1VQ8Q 4M7DF 5GAN5 2MIOA 4M75G 2MCNA 1MUZA 1RLQC 3CPWS 2YUPA 1PM3A 4J5YA 2O9VA 5M9OA 5KYNA 5CQYA 1IGQA 2COYA 2P0PA 1WZOA 5FRMA 2NLUA 3URGA 1JJ2A 2XHCA 2JVVA 2QG9B 1VQKT 2K57A 2COZA 1WGSA 2DA9A 4GLKA 2SEMA 2JOYA 2GQVA 3LX7A 2LQWA 2LNHB 1FX7A 4J9BA 3VU3C 5GJVB 1HYOA 2C0OA 1Q86U 4PKCC 2GF7A 1QP2A 2RHUA 5GANg 1VQMQ 1PRLC 2AKLA 2K4YA 4XU2A 4JUVA 4LDYA 3SWNB 2FEIA 2YUQA 2BE7D 2DMOA 2CREA 3CPFA 1MMNA 2GNCA 1Y07A 1VQLQ 2K5LA 4HCKA 2K3BA 1LOJA 4N0AC 5FU7B 2HEQA 4C5HA 1BU1A 2QA4T 3QXEB 2KNBB 2CH4W 1NJIC 2LX9A 4ZN1A 3S3MA 2EVRA 5GANf 4HT8A 4JLGA 2CP2A 3LGFA 1YJ9Q 3CC2Q 5GAOr 4OB3B 2XIDA 4DA4A 1G2BA 3G4ST 1SSFA 3L2RA 4MDWA 4BI4A 1NJIR 4XTUA 1Y96A 3O5ZA 4RTYA 4ZTJA 2P0QA 3A8MB 3IQLA 1YJWA 1X27A 2ZPFB 3C4SA 2KEAA 3L2WA 2FRWA 3C12A 5GMKe 3RERA 2R5AA 2OX7A 4C92A 4CC2A 1YBYA 3S3NA 2DZ9A 2WSFE 3CBOA 3FC3A 4WCIA 4ME7A 3S3OA 4BI8B 1B07A 2DTOA 1YI2A 5KYYA 3SEMA 1VA7A 1U1SA 3EH2A 4KGZB 2L2PA 2BKDN 1TS9A 2E3HA 3GNFB 1JRIA 1D3BB 2KGTA 1DJ7B 2FPDA 2J6OA 3CCLT 1MGQA 4M7AB 3CD6A 3VV0A 2EQUA 3CCVT 2DXTA 2ECZA 1VUBA 3NTIA 1XTDA 1S1NA 3X28B 3CMAQ 5KYXB 2W10A 3PVQA 4PJOD 2HCKA 4QVZA 2RHXA 2KT1A 1Q7YC 2L3RA 3G71A 4M77D 2QDLA 3GNGA 8ATCB 2B86A 2X4WA 4RTUA 3M4GA 1ZSGA 1EX4A 4LDVA 5GAN8 1KQ2A 2LDMA 1X6GA 4LUDA 2RD1A 1NE8A 1E6GA 1S72A 4J8OA 4JRKA 1RAHB 4Y28E 4F04B 4F14A 3A8LB 3BY7A 1WPYA 4HCZA 3EFSA 3PGGA 4PJLA 1VIEA 2FG0A 1P92A 4RG8A 1G3SA 2ED0A 4PFPA 4E7LA 4KGVB 2RO0A 1MMAA 4JS5A 5HK0A 4QW2A 1YN8A 4UC4A 1OULA 3TVTA 1FMWA 4M7DA 3MCAB 4C92G 3EGDB 2XICA 3FLGA 1GBRA 3MEVA 1VQOA 3MPUB 2D0NA 4OP0A 2O9SA 2X3XD 5CQXA 1XNIA 1RI9A 2OTLA 1MMGA 1TSFA 2QA4Q 2E6NA 1BI1A 1W70A 2CP6A 5GAOq 1NM7A 4J9GA 2KRMA 4DBQA 1HJDA 3C0CA 1WQWA 4QVCA 2ABLA 3QDRB 1ZA1B 3G4SQ 2LQNA 1BB9A 5GAMg 1VQ4T 2F2XA 3GF5A 3CCJT 1Q86R 3RR6A 1V76A 5HCKA 1Y96B 2LZ6B 3NTHA 3JV3A 3JCMV 1IZ6A 1RAFB 3JB9D 2E1HA 3QJYA 1RABB 4BD3A 5GAOp 4PJOF 3OYKA 2P84A 4C92B 4M77F 2V1RA 2VWFA 2YLCA 5FU6B 2F69A 4XTZA 4M78B 2GTOA 2XU8A 1YJNA 5LJ3j 1NG2A 2KVQG 6AT1B 5I2SA 2FZKB 2XD0A 4OMLA 5KYYB 4HCBA 2KI7A 4HVUA 5LL6S 2CSIA 2EJ9A 3OYAA 4CRIA 4M7DG 3CCVQ 2CP0A 2DBMA 3QZ5B 1M27C 1QWFA 2ENMA 2YRCA 3OY9A 2YRDA 1C6VX 4L6V5 2CKKA 1NEGA 4FSXA 4RCCA 2IVWA 1QVPA 1TTHB 3V7CA 1AOJA 5IHKA 2DZCA 3DB3A 5DM7R 1JJ2P 1BI0A 3JCMf 1KG1A 1EZZB 5FRNA 1Q82U 2NYSA 4OMOA 1KD1U 2QEXT 1ZUUA 3V8JA 3HFNA 4FCYA 3MEAA 1YIJT 5AYFA 3JB9I 1KIKA 1UDLA 2P0KA 4N4HA 3PVLA 3ER0A 1M9SA 1QKWA 2HKNA 1ABOA 2PUOB 2IPOB 1K73U 4E7HA 3EGUA 1QW1A 3DLMA 1GL5A 1KC8U 2MI6A 4F7UB 4LDUA 5HY6A 4M7DB 2KROA 1JXOA 4A54A 2DNUA 1TH7A 1U3OA 3QPHA 2W0ZA 3DLLA 2BUDA 2PVDB 3OSVA 3LWIA 3JB9F 4M77C 5IHIA 3M5AA 1JJ2S 4D8DA 1ZBJA 3ZL7C 3MO8A 5DLQE 2F5TX 2RJEA 4CC4B 1AT1B 2DILA 2DKGA 2QQ9A 5LJ5e 2ESWA 2LJ0A 3CCMA 2YSQA 3BDUA 3JCMh 1VQ4Q 3P8BB 3JAME 3E1SA 5A0DA 1XJWB 2QAZA 3V8KA 5GAOn 1AWWA 5GANj 1R8OB 3SWNC 4YTLA 1TG0A 5GAN4 2OTJA 1K0SA 3RKYA 5FU7C 3M0UA 1K0XA 2MF2A 2MOXA 2CUDA 2VKNA 4XQ3A 2DJQA 4FW1A 1N5ZA 1YJWT 3RBBB 2XDDA 4ZGDB 2RK1A 3LWHA 2X4YA 2HBPA 2J06A 4QT7A 1FMVA 3HRUA 5KCHA 2FPFA 3CCUA 1I81A 4R0KA 4ESRA 3JCMW 1YHQQ 1YI2T 1H3ZA 1D0XA 3LGLA 1KJWA 2DIGA 5L23A 3KFVA 5EG2A 3PE0A 4IUQA 2Y4YA 2DXBA 3BE3A 1VQ9A 4PJOA 2A08A 3TSWA 3NGPA 4PFZA 2JN0A 1ZSZC 5L8RE 3CD6T 4XAXB 1M1KU 4MMKA 4LXCA 2Z0WA 4FT4A 1OOTA 4Y91A 3I55A 4FW2A 1M2VA 2PUKB 4JJCA 4QQGA
chains in the Genus database with same CATH topology
3CCLQ 1KC8R 1KD1R 1M1KR 3CC7Q 2OTLQ 3I56Q 3CCJQ 3G4SQ 1VQMQ 1VQ5Q 1VQKQ 3CCVQ 1QVFP 1JJ2P 3CD6Q 1VQ7Q 3CCRQ 1K8AR 3CC2Q 2QEXQ 1YJ9Q 1QVGP 3G6EQ 2OTJQ 3OW2P 1Q81R 3CC4Q 1YITQ 1YJNQ 3CCQQ 1YIJQ 3CCSQ 1VQNQ 3CXCP 1Q86R 1M90R 1S72Q 2QA4Q 1YI2Q 1VQ6Q 3CCUQ 3CCMQ 1K9MR 1KQSP 3I55Q 1NJIR 1VQLQ 3CCEQ 1W2BP 1Q7YR 1YJWQ 1VQ8Q 1VQPQ 1VQOQ 3CPWP 3G71Q 1K73R 3CMAQ 1YHQQ 1VQ4Q 3CMEQ 1N8RR 1Q82R 1VQ9Q
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCL Q;  1KC8 R;  1KD1 R;  1M1K R;  3CC7 Q;  2OTL Q;  3I56 Q;  3CCJ Q;  3G4S Q;  1VQM Q;  1VQ5 Q;  1VQK Q;  3CCV Q;  1QVF P;  1JJ2 P;  3CD6 Q;  1VQ7 Q;  3CCR Q;  1K8A R;  3CC2 Q;  2QEX Q;  1YJ9 Q;  1QVG P;  3G6E Q;  2OTJ Q;  3OW2 P;  1Q81 R;  3CC4 Q;  1YIT Q;  1YJN Q;  3CCQ Q;  1YIJ Q;  3CCS Q;  1VQN Q;  3CXC P;  1Q86 R;  1M90 R;  1S72 Q;  2QA4 Q;  1YI2 Q;  1VQ6 Q;  3CCU Q;  3CCM Q;  1K9M R;  1KQS P;  3I55 Q;  1NJI R;  1VQL Q;  3CCE Q;  1W2B P;  1Q7Y R;  1YJW Q;  1VQ8 Q;  1VQP Q;  1VQO Q;  3CPW P;  3G71 Q;  1K73 R;  3CMA Q;  1YHQ Q;  1VQ4 Q;  3CME Q;  1N8R R;  1Q82 R;  1VQ9 Q; 
#chains in the Genus database with same CATH topology
 3EG9 B;  4QQ6 A;  4ANJ A;  3PIP A;  3X20 B;  4J6X A;  1LPL A;  4EMK A;  3G71 T;  4M7A C;  1SHG A;  2QEX Q;  1NLP C;  1XQH A;  5HK3 A;  1YIJ Q;  1TWB A;  2LC4 A;  5FLX E;  4ZN3 A;  2MMP A;  3EFO A;  4CI0 C;  3EHQ A;  1W2B A;  1S72 T;  2H8H A;  1OPK A;  2M1H A;  5GAM e;  3OYY A;  2EYZ A;  2HD0 A;  4MDX A;  4IUT A;  2JJ9 A;  2RQW A;  1KQ1 A;  2HDA A;  1TOV A;  5DY9 A;  1ZUY A;  2ED1 A;  1JEG A;  3GPL A;  4ZGE B;  4C8Q B;  2HAX A;  3CC4 A;  4WF2 A;  3QYG B;  2HSE B;  2RN8 A;  1KK7 A;  2V1Q A;  5GMK h;  2OJ2 A;  1Q82 R;  4BB7 A;  3I35 A;  3J81 E;  1KD1 R;  2DX1 A;  3M0T A;  4LNP A;  1ACM B;  2DJZ A;  3CME A;  1VQO T;  2EIF A;  4QVD A;  3GOX A;  2GFU A;  2NUT A;  1WIE A;  2LT4 A;  3JRZ A;  3QO3 A;  4LUE A;  1BBZ A;  2E4H A;  1K9A A;  1BCO A;  4KRT A;  2OTL T;  3UF4 A;  2JW4 A;  2YLB A;  4PFO A;  3R6N A;  3G6E A;  1AZE A;  4FM4 B;  4RG2 A;  4PJO G;  1K73 R;  1WJR A;  2IIM A;  4JPB W;  1KC8 R;  1M1F A;  2AK5 A;  5LJ5 d;  4IUP A;  2VYT A;  1IHV A;  4M7A E;  3VS3 A;  2DE0 X;  2BIV A;  1VQ5 A;  3QWX X;  1YWO A;  1CSK A;  1UGR B;  2XMF A;  1U1T A;  4OB1 B;  2DYI A;  3OYH A;  4N4G A;  3SB2 A;  1WYX A;  2O88 A;  4LE9 A;  5IT9 E;  1EFN A;  1VYT A;  2V26 A;  2CP5 A;  2CZ0 B;  5GAM j;  1G8X A;  4JRI A;  3EG0 A;  1T0H A;  1WHK A;  3QZ9 B;  2WSE E;  4RKU E;  3CCQ Q;  5D6X A;  1YI2 Q;  1RAA B;  1RAC B;  2DL4 A;  5D6W A;  1J3T A;  2OAW A;  1YJN T;  1O9S A;  2CP3 A;  3LW5 E;  4TVR A;  2DER A;  1Q95 G;  3CD6 Q;  3M56 A;  4Z89 A;  2DF6 A;  5FU6 C;  4PJO B;  2DLP A;  2M51 A;  4M78 C;  2XDB A;  1M8V A;  4D8K A;  2E41 A;  4GLM A;  1SRM A;  4MML A;  2X4J A;  3LH5 A;  3VJP A;  1D0Z A;  3G71 Q;  1O75 A;  1M2V B;  2DAQ A;  4OB0 B;  2V8K A;  3M0P A;  2EGC A;  3ME9 A;  1VYU A;  4D6W A;  4E7I A;  4DOV A;  3CC7 A;  4J9D A;  4IUR A;  5GMK m;  1M1K C;  3D7S B;  5I21 A;  3E9G A;  4M75 B;  4C0G A;  2ZAE A;  4JZ3 A;  3JB9 G;  1UGQ B;  2PVG B;  3EFO B;  4HT9 A;  2CT4 A;  2ROL A;  2FO0 A;  2YWW A;  2COW A;  1M4Z A;  3M0Q A;  1M1K R;  4J83 A;  3BW1 A;  2P4T A;  5FWC A;  4C0D C;  1ZHI A;  2D1X A;  5CO7 A;  1X6B A;  3EHR A;  2RM4 A;  3MET A;  3OYE A;  5GAM d;  1RUW A;  4FIB A;  2HBW A;  2M0O A;  2JS0 A;  1D09 B;  1GBQ A;  4OMN A;  1VQO Q;  1MMD A;  1WHL A;  1FYN A;  2E3I A;  3A98 A;  3P8H A;  4AT1 B;  1M90 U;  2OTL Q;  3PT9 A;  1C1A A;  5GAN 6;  4C92 E;  3OS0 A;  1UGS B;  1OZ2 A;  4FYW B;  1H3H A;  4M78 E;  3A1P A;  3RKX A;  5IN1 A;  3T9N A;  4ELY C;  4KUD K;  3AHU A;  4K11 A;  3I5S A;  2D8H A;  2MYS A;  3KUF A;  2LVM A;  2O2O A;  2YXY A;  4OMQ A;  4A4E A;  4N0A A;  1B3Q A;  3CCM T;  1VQP T;  2KRS A;  7AT1 B;  4RUG A;  4XU0 A;  2DET A;  1RL2 A;  2HQH A;  3SFM A;  1VQM A;  5KYU A;  2OTJ T;  3OW2 A;  4HVW A;  3MKD A;  3RKW A;  3G1J A;  3UA6 A;  1NEB A;  1QP3 A;  1AWJ A;  3INZ A;  1WXU A;  3HL8 A;  5J3B A;  1RAE B;  2LCL A;  2DK3 A;  5IXF A;  2FZG B;  4XU1 A;  2ROT A;  2NUZ A;  1UUE A;  5A2Q E;  1VQK Q;  1MV0 B;  2RQU A;  4A4F A;  3LH0 A;  4QKU A;  1YJN Q;  1YJ9 A;  1HK9 A;  4N4I A;  5LJ3 e;  3CXC A;  1WLP B;  5IH2 A;  2H3J A;  4DBH A;  1IXD A;  3OMC A;  2KAF A;  5KE2 A;  5CKD A;  1I4K 1;  3CCU T;  3QJ6 A;  3S6W A;  1HSQ A;  3UT1 A;  3RMQ A;  2DBK A;  2L3P A;  1VQ9 T;  1TUD A;  4ZNX A;  1EIF A;  1ZQ1 A;  4F7U E;  1AWX A;  3QWY A;  2ZPB B;  4M7D E;  4A53 A;  1W2B P;  3M9Q A;  1WNL A;  1Q86 C;  4KUL A;  3AT1 B;  1UJ0 A;  1YCY A;  3I55 T;  4XTX A;  1WA7 A;  1VOM A;  3VS1 A;  1SSH A;  2QTX A;  2M0Y A;  4OF1 A;  1WXT A;  4E7S A;  1OZ3 A;  2EGE A;  2MWO A;  2RJC A;  5CAI A;  1KQS A;  2E65 A;  1OU8 A;  4FYV B;  1N9S A;  1PC0 A;  1RAG B;  1Y0M A;  2EJG A;  3SD4 A;  5D6Y A;  3OYN A;  3CMA A;  4KGX B;  2OAU A;  4PNO A;  4M7A D;  2Y90 A;  1PKT A;  4LN2 A;  4LD9 K;  3TEE A;  2LJ3 A;  4AG2 C;  1QVG A;  3GLX A;  2FRY A;  2RJF A;  1N8R U;  2GQI A;  2K9G A;  3CCR A;  5D7U A;  1NYF A;  2MWP A;  1JB0 E;  3CC4 T;  1PD1 A;  1WHG A;  3JCM b;  3F70 A;  1W2B S;  2O4X A;  2XG8 D;  1GCQ C;  1GCP A;  3UA7 A;  3CCL Q;  2P4R A;  2KK4 A;  3JCM J;  2VGM A;  2PTK A;  1E6H A;  1K1Z A;  5I11 A;  3M58 A;  1NZ9 A;  3CME T;  4C8Q C;  3X26 B;  3JCM g;  3J7A F;  4PK4 A;  4DQ2 A;  2JMA A;  4E7K A;  3G6E T;  2EFI A;  4RTZ A;  1M90 C;  2DEU A;  3M0R A;  2JMC A;  2LCS A;  5GAN e;  2LMJ A;  2OTJ Q;  1JBM A;  2NUP A;  1QCF A;  1BK2 A;  4KBM B;  3CBP A;  2E10 A;  3JCM c;  2MK5 A;  2LP5 A;  1WJS A;  3E19 A;  3ULR B;  1ZUK A;  3MP1 A;  1M90 R;  1NBE B;  1VQ5 T;  2K79 A;  1AD5 A;  3FEO A;  3R6O A;  3UDC A;  2KMT A;  2EQK A;  4J6Y A;  4L59 A;  4HXJ A;  3CCE A;  2F2V A;  2EGA A;  3H41 A;  2EQJ A;  5CKH A;  2HMA A;  4LD6 A;  1C0M A;  1YWP A;  2V8J A;  1BI3 A;  1WI7 A;  2FYK A;  1UB4 A;  4PLL A;  4B9W A;  3VYG A;  4NS5 A;  1BCM A;  2DIQ A;  2HQE A;  4HA8 A;  3CCS A;  1K8A U;  4BE1 A;  2QQA A;  3EG1 A;  4AG1 C;  2EYW A;  3M4Y A;  2A28 A;  4P5N A;  5LJ3 d;  1TXQ A;  3O8V A;  1I5L A;  2KE9 A;  3FJP A;  4M7A F;  4C8Q E;  3OYM A;  3E2U A;  5GAO l;  1JU5 C;  1KHI A;  5KH6 A;  4CC7 A;  1V29 B;  5HKC A;  5KYW A;  2EKO A;  3MP8 A;  3MP6 A;  2VXE A;  1K4U S;  2LQ8 A;  2EQI A;  3UWN A;  1OX8 A;  1VQP A;  5IXB A;  1GXI E;  4C92 D;  4J9I A;  2LNV A;  3CCJ Q;  1G3Y A;  4M78 D;  3C95 A;  4AFZ C;  4X9D A;  2VUB A;  2L3Q A;  2V8I A;  4EIK A;  1Y7X A;  3I9Q A;  3M57 A;  2H3E B;  3CC7 T;  1ZX6 A;  5DLO A;  3RES A;  3CQT A;  2JT4 A;  1H8K A;  2VB6 A;  1QCO A;  4KH0 B;  4BY6 B;  4FYY B;  1R0C B;  1ZLM A;  4M75 C;  3OYB A;  1RAI B;  2K7A A;  4IKF A;  2J6K A;  1SG5 A;  3OSS C;  1VYV A;  2Y4X A;  1RAD B;  1CKB A;  3MHX A;  2XI9 A;  5CKE A;  3OYJ A;  2O4X B;  1UHC A;  3CME Q;  2ZPH B;  3JCM P;  2RNA A;  2LRQ A;  1VQ8 T;  2LCC A;  1E7O A;  5ECA A;  2DD5 A;  1BI2 A;  2J7I A;  3G6E Q;  3OW2 P;  4M77 A;  3V7S A;  1JO8 A;  4C5I A;  4RMO A;  2DTH A;  2O31 A;  3H9N A;  4RTX A;  3SHW A;  3VS5 A;  1M5Q 1;  1UEB A;  1VQN A;  2AKK A;  3UPU A;  3J80 E;  1N8R R;  2AIR B;  2I2L A;  4O5V A;  4HVV A;  3ZFJ A;  3OS2 A;  3NHN A;  1VQ5 Q;  4LDW A;  2O01 E;  1WQ7 A;  3SWN A;  1RI0 A;  1LNX A;  2RI3 A;  1GFD A;  3OB9 A;  3TQ7 P;  1AHJ B;  5GAN d;  1OQK A;  1VQM T;  4JZ4 A;  3CXC P;  2PU9 B;  4JRP A;  4FT2 A;  2A37 A;  1YFN A;  1YIT A;  1N6A A;  1QMC A;  2BTT A;  4C0F A;  5C6S A;  1PKS A;  1IGU A;  2CUB A;  2AHJ B;  2C0T A;  4E2F B;  1X2K A;  4MZM A;  2ZPI B;  2J6F A;  2RI5 A;  1Q82 C;  1H64 1;  2RA2 A;  4M75 E;  4M78 F;  1KD1 C;  3OW2 S;  2GCX A;  1V1C A;  3A8G B;  1YJ9 T;  4BDZ A;  3REA B;  4MZP A;  1UEC A;  3RIR A;  4Z8A A;  2PZ1 A;  4IIO A;  3BDL A;  1A0N B;  2LT1 A;  1YNZ A;  2QXF A;  5A0L A;  1Z9Z A;  3Q1J A;  4GBQ A;  2DXU A;  1K73 C;  2BE9 B;  2DRK A;  2RJD A;  4BE2 A;  2RHI A;  2KQW A;  1KC8 C;  1Y57 A;  2EWN A;  2ZZD A;  1ZSZ A;  3NFC A;  1FMK A;  3OYL A;  3SDZ A;  3CXC S;  3WXM B;  5KYW B;  4M77 G;  3EH1 A;  1QQJ A;  4Y92 A;  1MND A;  1NPR A;  4OGC A;  2WSC E;  3KXT A;  1D1B A;  1YHQ A;  4GY5 A;  3CC7 Q;  1M3B A;  1D3B A;  3JCM e;  1K8A R;  2LX7 A;  1Q7Y U;  1QVG P;  4M7A A;  1ABQ A;  3OS5 A;  4FYX B;  1SHF A;  2ZPE B;  4JJB A;  1YJW Q;  4NOY A;  5EC7 A;  3OYC A;  5KYX A;  1T3L A;  2DPP B;  1WFW A;  3CMA T;  2HL3 A;  2L5Q A;  3GIB A;  2KXD A;  2XK0 A;  1UFF A;  3BFM A;  4F7U F;  3CCR T;  1K9M R;  2AT1 B;  3DB4 A;  2YDL A;  2QGG A;  1TUC A;  3QYH B;  2OI3 A;  2CDT A;  2EBP A;  5GAN 7;  3A5Z B;  2XKO C;  2YUO A;  4DBF A;  4HKE A;  5LJ3 h;  3VYH B;  4C92 C;  2CP7 A;  4F17 A;  1IRE B;  1QVG S;  4M77 B;  2A3L A;  1VQ7 A;  1ZBX A;  4KH1 B;  1H92 A;  2QGF B;  2L8D A;  4BDY A;  2MAM A;  3EGD A;  2R5M A;  3CEY A;  1VQ6 A;  4X34 A;  3JCM Q;  5GMK i;  3ZBD A;  4IUU A;  4JJD A;  2WAC A;  4XK8 E;  4C8Q D;  1OI1 A;  1YP5 A;  4EMK B;  1RLP C;  2D9T A;  2QAS A;  1HD3 A;  3U23 A;  1X01 A;  3VRZ A;  1JXM A;  3OBW A;  3UAT A;  1S72 Q;  4J9F A;  1UJY A;  1X6O A;  2EYY A;  3H8Z A;  2E5K A;  4AFU C;  1MNE A;  4M7A G;  4NL2 A;  4OMP A;  2DD4 A;  5A0G A;  4II1 A;  1OV3 A;  3QKJ A;  5IAY A;  3CCE T;  1R77 A;  1SPK A;  3CBM A;  4J7I A;  1AWO A;  9ATC B;  1PSE A;  4PJN A;  4PLI A;  4V2S A;  3I56 A;  2LQK A;  2X51 A;  5GAO m;  3VS6 A;  1OPL A;  2RB6 A;  5FRO A;  4FSS A;  4C0Z A;  3CCS T;  1CKA A;  4BUG A;  4DOW A;  1G5V A;  3L2V A;  3L1A A;  1VQ8 A;  4MZT A;  1BYM A;  3M59 A;  3KBG A;  2CZ6 B;  2VV5 A;  2E64 A;  1QVF A;  1LVK A;  2NUT B;  3JB9 J;  4M78 A;  4J9C A;  5GJW B;  5I2M A;  4X1V A;  2EYX A;  1ZSZ B;  5CK9 A;  2ZPG B;  3CCQ A;  4M7D C;  2KBT A;  2M02 A;  1W6X A;  5LJ5 g;  2M9U A;  3V8L A;  3H0I A;  2CYZ B;  1PWT A;  2JXB A;  3MJX A;  3VS7 A;  2RHY A;  1X43 A;  2SRC A;  2LTO A;  1W1F A;  2ZGW A;  1SF9 A;  1I0C A;  5GAN h;  2KSS A;  3NMZ C;  3LYI A;  2EPD A;  2VVK A;  2CT3 A;  3JCM d;  3H0H A;  5LJ5 f;  1R0B G;  2RHZ A;  4PL6 A;  3OYF A;  1VQL A;  2DEQ A;  1ZA2 B;  1MV3 A;  3M54 A;  3CCR Q;  1AVZ C;  2M16 A;  4C8Q F;  3CC2 A;  2HL5 C;  3TRE A;  4B9X A;  5I22 A;  2BZ8 A;  3OYG A;  2L89 A;  1Q7Y R;  1SRL A;  3H6Z A;  4XTW A;  3PIO A;  2K5F A;  1PRM C;  4BY6 C;  4E7Z A;  2IG0 A;  2KR3 A;  4M75 D;  2K2M A;  2KT8 A;  1XOV A;  5GAN 3;  3OA6 A;  5GMK j;  2FZC B;  2L0A A;  4DBR A;  4F7U A;  4QQD A;  2DYB A;  2EJF A;  2RQV A;  4NL3 A;  3RNJ A;  1VQN T;  4M78 G;  2EAY A;  2PQW A;  1TUG B;  4ELZ C;  2DRM A;  1NPP A;  4KUI A;  1UG1 A;  2DO3 A;  3QBY A;  4XTY A;  2QQS A;  5LJ5 h;  1PNJ A;  2NWM A;  3QSU A;  4XU3 A;  2R57 A;  4AMC A;  2CZ1 B;  2KYB A;  3EAE A;  1UGV A;  2E6Z A;  3WVD B;  4X9C A;  1UHF A;  3CCE Q;  3OYI A;  5KE3 A;  3TU4 K;  1YIT T;  1HXD A;  3PNW C;  3EG3 A;  3CPW A;  4C5E A;  2FPE A;  2R58 A;  2AZS A;  3EG2 A;  3NTK A;  3WVE B;  4IUV A;  5GAN 2;  3FIF A;  5KCO A;  3REB B;  2DTI A;  2ATC B;  8AT1 B;  4Z88 A;  3JSC A;  3CCS Q;  4J9E A;  1GRI A;  1T3S A;  1PG5 B;  1B34 A;  4J6W A;  1D0Y A;  2AZV A;  4A63 B;  3HRS A;  3E9F A;  4AFQ C;  1WX6 A;  2QK0 A;  2JTM A;  5GAM f;  3I5R A;  5FWB A;  1N27 A;  2BZX A;  3L42 A;  1VQK A;  3C94 A;  3HP9 A;  4R56 A;  2D0Q B;  1M3A A;  2C0I A;  1B7T A;  1JQQ A;  1X69 A;  1M8M A;  3CCM Q;  1QKX A;  3V7R A;  4BI3 A;  2G3R A;  3EGX A;  2F1L A;  1VQP Q;  2JS2 A;  4RTW A;  2YRV A;  3HFO A;  4F7U G;  1OEB A;  2D8J A;  4R55 A;  4EMH A;  2L3S A;  1YHQ T;  2I0N A;  3M55 A;  4ORZ A;  3QUI A;  3M0S A;  4M75 F;  5KYU B;  2X9H A;  1LCK A;  2CSQ A;  4B6M A;  1SEM A;  2HZY A;  2QA4 A;  1X75 C;  2E12 A;  4WTO B;  4JJN K;  3VS4 A;  5CCA A;  3EG9 A;  4CC3 A;  1Z9Q A;  3GBQ A;  2GTJ A;  1Y71 A;  2ZCF B;  5IHN A;  4C0D B;  3OS1 A;  1UGP B;  3G4S A;  5J26 A;  2FHD A;  4OVA A;  1PHT A;  2KY9 A;  2X35 A;  3ASK A;  3CCU Q;  4L5G A;  5GAM h;  3DKM A;  4E6R A;  3L2Q A;  5CKF A;  3VUZ A;  4F16 A;  1YCS B;  3GP8 A;  3NPF A;  2VC8 A;  2X3W D;  2YHT A;  1VQ9 Q;  1GCQ A;  2MPX C;  2CH4 A;  5C0M A;  3VS2 A;  2EQM A;  5GMK l;  3QHS A;  5CVI A;  1VQN Q;  1GFC A;  4C8Q A;  1N9R A;  1VQ7 T;  1FXX A;  3I55 Q;  2HSP A;  4IIM A;  1M2O A;  1Q81 U;  1VQ6 T;  4JLI A;  2RK2 A;  1T0J A;  1PD0 A;  5J39 A;  4JRQ A;  1LJO A;  3HTR A;  4PJJ A;  1IRX A;  4PJO C;  4E47 A;  1K9M U;  1UTI A;  3CCL A;  2E70 A;  4ZGJ B;  5AT1 B;  3CCV A;  1U5S A;  1YIT Q;  3P8D A;  2QYZ A;  1BIA A;  2DL5 A;  1WHJ A;  4A4H A;  1U8R A;  2FL7 A;  1OX9 A;  2GBQ A;  2PVO B;  3QII A;  3M53 A;  3L2Z A;  4EMK C;  1I8F A;  1NYG A;  1TU0 B;  1QVF P;  2RH2 A;  1M30 A;  2KRN A;  1U06 A;  3QDF A;  1KHC A;  4C5G A;  2J05 A;  3CC4 Q;  2K3Y A;  3RDV A;  3I56 T;  2VAS A;  1K76 A;  1VIF A;  4J9H A;  1B34 B;  3L2U A;  1AZG B;  3EFR A;  4OGE A;  1NLO C;  4KT0 E;  3TCJ A;  4JS4 A;  1KFZ A;  2DVE A;  2RQT A;  3PFS A;  4J7F A;  4BE0 A;  2G6F X;  2RF0 A;  1X2Q A;  4O6J A;  3VUB A;  4ZTF A;  2LJ1 A;  3ZEH A;  3H0F A;  1N8R C;  2JNG A;  2CGH A;  2JZ2 A;  3PMI A;  2E5Q A;  3HPW A;  2KDS A;  2FVU A;  4E7J A;  1PCX A;  1QLY A;  4VUB A;  2DL3 A;  2RI2 A;  3EGX B;  2QQB A;  3CCQ T;  2K6D A;  1BIB A;  3FJ5 A;  4C8Q G;  2C06 A;  3N5B B;  4M4Z A;  2NUP B;  3TSZ A;  3JB9 H;  4PJO E;  3OQ5 A;  1NJI U;  1OYX A;  1I1J A;  1QVF S;  4M77 E;  1WJQ A;  2EKH A;  2HKQ B;  2DL8 A;  1QWE A;  2QI2 A;  4PJM A;  3FB9 A;  4M7D D;  1WDX A;  2QQR A;  2YT6 A;  3PMT A;  3VKI A;  3X25 B;  2BZY A;  2JTF A;  3JCM X;  2DM1 A;  5LJ5 j;  2B8A A;  1D1C A;  2RMO A;  3LLR A;  3THK A;  3HKS A;  3FDR A;  2EYQ A;  4OB2 B;  2PNI A;  2A0F B;  2HQX A;  1VQL T;  2CS7 A;  1VQ4 A;  2DXC A;  1IHW A;  4RCB A;  4FL6 A;  3CCJ A;  3QG1 A;  2KYM A;  4C92 F;  4M75 A;  1SKU B;  1G83 A;  2EW3 A;  1M3C A;  2JUF A;  2JTE A;  1KSW A;  3CC2 T;  3HSB A;  1QCN A;  1I5O B;  2KXC A;  1BKB A;  5CKB A;  5LJ3 g;  3OYD A;  2DL7 A;  5FW9 A;  2QDY B;  1AEY A;  4ATO A;  4XTV A;  2RPN A;  1G3W A;  5CIU A;  3RUX A;  1VQ7 Q;  1MHN A;  3G7Z A;  4JDS A;  3MEW A;  3OBY A;  2YUN A;  2VGN A;  1UE9 A;  1PSF A;  3HHT B;  4BAC A;  1G3T A;  4EDU A;  1WHH A;  2A36 A;  3FRN A;  1VQ6 Q;  4LDX A;  1K8A C;  1KQS P;  2FB7 A;  5LJ3 f;  2HNI A;  3OMG A;  2DFU A;  3CPW P;  5CR2 A;  3MEU A;  1F1B B;  2JM9 A;  4FU6 A;  4HCC A;  4RTV A;  2F2W A;  3RMS A;  2JM8 A;  2F5K A;  2XDP A;  4EMG A;  2CZ7 B;  3VRY A;  2X4X A;  1M1G A;  4OMF B;  4AFS C;  4Z02 A;  3PTA A;  3A8H B;  3A8O B;  2GFA A;  1Q81 C;  2GGR A;  1WHM A;  1I07 A;  2K3X A;  1FWZ A;  1ARK A;  4Q5W A;  1K9M C;  1W4S A;  4A4G A;  3X24 B;  1OU9 A;  4A4K A;  3I56 Q;  1D1A A;  4OMM A;  2A7Y A;  2DVJ A;  2K5I A;  2RQR A;  4DEY A;  3HRT A;  1IO6 A;  1WXB A;  1IB8 A;  1Q81 R;  4DEX A;  4EPC A;  2QTV A;  2K2V A;  3VS0 A;  2QEX A;  2VXF A;  2D6F A;  1YIJ A;  4RTT A;  1KQS S;  1VQ8 Q;  4M7D F;  5GAN 5;  2MIO A;  4M75 G;  2MCN A;  1MUZ A;  1RLQ C;  3CPW S;  2YUP A;  1PM3 A;  4J5Y A;  2O9V A;  5M9O A;  5KYN A;  5CQY A;  1IGQ A;  2COY A;  2P0P A;  1WZO A;  5FRM A;  2NLU A;  3URG A;  1JJ2 A;  2XHC A;  2JVV A;  2QG9 B;  1VQK T;  2K57 A;  2COZ A;  1WGS A;  2DA9 A;  4GLK A;  2SEM A;  2JOY A;  2GQV A;  3LX7 A;  2LQW A;  2LNH B;  1FX7 A;  4J9B A;  3VU3 C;  5GJV B;  1HYO A;  2C0O A;  1Q86 U;  4PKC C;  2GF7 A;  1QP2 A;  2RHU A;  5GAN g;  1VQM Q;  1PRL C;  2AKL A;  2K4Y A;  4XU2 A;  4JUV A;  4LDY A;  3SWN B;  2FEI A;  2YUQ A;  2BE7 D;  2DMO A;  2CRE A;  3CPF A;  1MMN A;  2GNC A;  1Y07 A;  1VQL Q;  2K5L A;  4HCK A;  2K3B A;  1LOJ A;  4N0A C;  5FU7 B;  2HEQ A;  4C5H A;  1BU1 A;  2QA4 T;  3QXE B;  2KNB B;  2CH4 W;  1NJI C;  2LX9 A;  4ZN1 A;  3S3M A;  2EVR A;  5GAN f;  4HT8 A;  4JLG A;  2CP2 A;  3LGF A;  1YJ9 Q;  3CC2 Q;  5GAO r;  4OB3 B;  2XID A;  4DA4 A;  1G2B A;  3G4S T;  1SSF A;  3L2R A;  4MDW A;  4BI4 A;  1NJI R;  4XTU A;  1Y96 A;  3O5Z A;  4RTY A;  4ZTJ A;  2P0Q A;  3A8M B;  3IQL A;  1YJW A;  1X27 A;  2ZPF B;  3C4S A;  2KEA A;  3L2W A;  2FRW A;  3C12 A;  5GMK e;  3RER A;  2R5A A;  2OX7 A;  4C92 A;  4CC2 A;  1YBY A;  3S3N A;  2DZ9 A;  2WSF E;  3CBO A;  3FC3 A;  4WCI A;  4ME7 A;  3S3O A;  4BI8 B;  1B07 A;  2DTO A;  1YI2 A;  5KYY A;  3SEM A;  1VA7 A;  1U1S A;  3EH2 A;  4KGZ B;  2L2P A;  2BKD N;  1TS9 A;  2E3H A;  3GNF B;  1JRI A;  1D3B B;  2KGT A;  1DJ7 B;  2FPD A;  2J6O A;  3CCL T;  1MGQ A;  4M7A B;  3CD6 A;  3VV0 A;  2EQU A;  3CCV T;  2DXT A;  2ECZ A;  1VUB A;  3NTI A;  1XTD A;  1S1N A;  3X28 B;  3CMA Q;  5KYX B;  2W10 A;  3PVQ A;  4PJO D;  2HCK A;  4QVZ A;  2RHX A;  2KT1 A;  1Q7Y C;  2L3R A;  3G71 A;  4M77 D;  2QDL A;  3GNG A;  8ATC B;  2B86 A;  2X4W A;  4RTU A;  3M4G A;  1ZSG A;  1EX4 A;  4LDV A;  5GAN 8;  1KQ2 A;  2LDM A;  1X6G A;  4LUD A;  2RD1 A;  1NE8 A;  1E6G A;  1S72 A;  4J8O A;  4JRK A;  1RAH B;  4Y28 E;  4F04 B;  4F14 A;  3A8L B;  3BY7 A;  1WPY A;  4HCZ A;  3EFS A;  3PGG A;  4PJL A;  1VIE A;  2FG0 A;  1P92 A;  4RG8 A;  1G3S A;  2ED0 A;  4PFP A;  4E7L A;  4KGV B;  2RO0 A;  1MMA A;  4JS5 A;  5HK0 A;  4QW2 A;  1YN8 A;  4UC4 A;  1OUL A;  3TVT A;  1FMW A;  4M7D A;  3MCA B;  4C92 G;  3EGD B;  2XIC A;  3FLG A;  1GBR A;  3MEV A;  1VQO A;  3MPU B;  2D0N A;  4OP0 A;  2O9S A;  2X3X D;  5CQX A;  1XNI A;  1RI9 A;  2OTL A;  1MMG A;  1TSF A;  2QA4 Q;  2E6N A;  1BI1 A;  1W70 A;  2CP6 A;  5GAO q;  1NM7 A;  4J9G A;  2KRM A;  4DBQ A;  1HJD A;  3C0C A;  1WQW A;  4QVC A;  2ABL A;  3QDR B;  1ZA1 B;  3G4S Q;  2LQN A;  1BB9 A;  5GAM g;  1VQ4 T;  2F2X A;  3GF5 A;  3CCJ T;  1Q86 R;  3RR6 A;  1V76 A;  5HCK A;  1Y96 B;  2LZ6 B;  3NTH A;  3JV3 A;  3JCM V;  1IZ6 A;  1RAF B;  3JB9 D;  2E1H A;  3QJY A;  1RAB B;  4BD3 A;  5GAO p;  4PJO F;  3OYK A;  2P84 A;  4C92 B;  4M77 F;  2V1R A;  2VWF A;  2YLC A;  5FU6 B;  2F69 A;  4XTZ A;  4M78 B;  2GTO A;  2XU8 A;  1YJN A;  5LJ3 j;  1NG2 A;  2KVQ G;  6AT1 B;  5I2S A;  2FZK B;  2XD0 A;  4OML A;  5KYY B;  4HCB A;  2KI7 A;  4HVU A;  5LL6 S;  2CSI A;  2EJ9 A;  3OYA A;  4CRI A;  4M7D G;  3CCV Q;  2CP0 A;  2DBM A;  3QZ5 B;  1M27 C;  1QWF A;  2ENM A;  2YRC A;  3OY9 A;  2YRD A;  1C6V X;  4L6V 5;  2CKK A;  1NEG A;  4FSX A;  4RCC A;  2IVW A;  1QVP A;  1TTH B;  3V7C A;  1AOJ A;  5IHK A;  2DZC A;  3DB3 A;  5DM7 R;  1JJ2 P;  1BI0 A;  3JCM f;  1KG1 A;  1EZZ B;  5FRN A;  1Q82 U;  2NYS A;  4OMO A;  1KD1 U;  2QEX T;  1ZUU A;  3V8J A;  3HFN A;  4FCY A;  3MEA A;  1YIJ T;  5AYF A;  3JB9 I;  1KIK A;  1UDL A;  2P0K A;  4N4H A;  3PVL A;  3ER0 A;  1M9S A;  1QKW A;  2HKN A;  1ABO A;  2PUO B;  2IPO B;  1K73 U;  4E7H A;  3EGU A;  1QW1 A;  3DLM A;  1GL5 A;  1KC8 U;  2MI6 A;  4F7U B;  4LDU A;  5HY6 A;  4M7D B;  2KRO A;  1JXO A;  4A54 A;  2DNU A;  1TH7 A;  1U3O A;  3QPH A;  2W0Z A;  3DLL A;  2BUD A;  2PVD B;  3OSV A;  3LWI A;  3JB9 F;  4M77 C;  5IHI A;  3M5A A;  1JJ2 S;  4D8D A;  1ZBJ A;  3ZL7 C;  3MO8 A;  5DLQ E;  2F5T X;  2RJE A;  4CC4 B;  1AT1 B;  2DIL A;  2DKG A;  2QQ9 A;  5LJ5 e;  2ESW A;  2LJ0 A;  3CCM A;  2YSQ A;  3BDU A;  3JCM h;  1VQ4 Q;  3P8B B;  3JAM E;  3E1S A;  5A0D A;  1XJW B;  2QAZ A;  3V8K A;  5GAO n;  1AWW A;  5GAN j;  1R8O B;  3SWN C;  4YTL A;  1TG0 A;  5GAN 4;  2OTJ A;  1K0S A;  3RKY A;  5FU7 C;  3M0U A;  1K0X A;  2MF2 A;  2MOX A;  2CUD A;  2VKN A;  4XQ3 A;  2DJQ A;  4FW1 A;  1N5Z A;  1YJW T;  3RBB B;  2XDD A;  4ZGD B;  2RK1 A;  3LWH A;  2X4Y A;  2HBP A;  2J06 A;  4QT7 A;  1FMV A;  3HRU A;  5KCH A;  2FPF A;  3CCU A;  1I81 A;  4R0K A;  4ESR A;  3JCM W;  1YHQ Q;  1YI2 T;  1H3Z A;  1D0X A;  3LGL A;  1KJW A;  2DIG A;  5L23 A;  3KFV A;  5EG2 A;  3PE0 A;  4IUQ A;  2Y4Y A;  2DXB A;  3BE3 A;  1VQ9 A;  4PJO A;  2A08 A;  3TSW A;  3NGP A;  4PFZ A;  2JN0 A;  1ZSZ C;  5L8R E;  3CD6 T;  4XAX B;  1M1K U;  4MMK A;  4LXC A;  2Z0W A;  4FT4 A;  1OOT A;  4Y91 A;  3I55 A;  4FW2 A;  1M2V A;  2PUK B;  4JJC A;  4QQG A; 
#chains in the Genus database with same CATH homology
 3CCL Q;  1KC8 R;  1KD1 R;  1M1K R;  3CC7 Q;  2OTL Q;  3I56 Q;  3CCJ Q;  3G4S Q;  1VQM Q;  1VQ5 Q;  1VQK Q;  3CCV Q;  1QVF P;  1JJ2 P;  3CD6 Q;  1VQ7 Q;  3CCR Q;  1K8A R;  3CC2 Q;  2QEX Q;  1YJ9 Q;  1QVG P;  3G6E Q;  2OTJ Q;  3OW2 P;  1Q81 R;  3CC4 Q;  1YIT Q;  1YJN Q;  3CCQ Q;  1YIJ Q;  3CCS Q;  1VQN Q;  3CXC P;  1Q86 R;  1M90 R;  1S72 Q;  2QA4 Q;  1YI2 Q;  1VQ6 Q;  3CCU Q;  3CCM Q;  1K9M R;  1KQS P;  3I55 Q;  1NJI R;  1VQL Q;  3CCE Q;  1W2B P;  1Q7Y R;  1YJW Q;  1VQ8 Q;  1VQP Q;  1VQO Q;  3CPW P;  3G71 Q;  1K73 R;  3CMA Q;  1YHQ Q;  1VQ4 Q;  3CME Q;  1N8R R;  1Q82 R;  1VQ9 Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...