2OTLQ

Girodazole bound to the large subunit of haloarcula marismortui
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
95
structure length
95
Chain Sequence
PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal RNA
publication title The Structures of Antibiotics Bound to the E Site Region of the 50 S Ribosomal Subunit of Haloarcula marismortui: 13-Deoxytedanolide and Girodazole.
pubmed doi rcsb
molecule tags Ribosome
total genus 19
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2007-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01157 Ribosomal_L21e Ribosomal protein L21e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 2otlQ00
1VQ9Q 1VQ4Q 3CCJQ 1NJIR 3CMAQ 2QEXQ 3CCRQ 1W2BP 1M1KR 3I55Q 1YITQ 3G6EQ 3G71Q 3CCSQ 3CC2Q 1Q86R 3CCLQ 1VQ5Q 1VQ8Q 3CCUQ 1YIJQ 1K8AR 3CCMQ 1KD1R 1YHQQ 3OW2P 1YJ9Q 1JJ2P 1VQ7Q 3CD6Q 3CCVQ 1KQSP 3CCEQ 1YJWQ 3CPWP 3CXCP 1K9MR 1YI2Q 1KC8R 1M90R 1Q82R 1VQKQ 2OTJQ 3CC4Q 3CC7Q 3CCQQ 1K73R 1QVGP 1S72Q 1Q81R 1YJNQ 1VQLQ 3I56Q 1QVFP 2QA4Q 1VQNQ 1Q7YR 1VQPQ 3CMEQ 2OTLQ 1VQMQ 1N8RR 1VQOQ 1VQ6Q 3G4SQ
chains in the Genus database with same CATH superfamily
2QEXT 2LQKA 3SFMA 3CMAQ 4XQ3A 8ATCB 1SHGA 1T0HA 4X9CA 1CSKA 3TU4K 4RTZA 2DTOA 4JJBA 1VQOA 4PJOD 1ZA2B 2R58A 1W6XA 3CC7Q 4FSXA 1WI7A 4XU1A 2I0NA 2VV5A 2LX9A 2RJCA 1QVGS 3QSUA 1FMWA 1KJWA 2W0ZA 2X4YA 1PSEA 1JXMA 1M9SA 3G71Q 2HQXA 2YRVA 4JUVA 4TVRA 5HK0A 3T9NA 8AT1B 2QK0A 5GANj 2JVVA 1JRIA 2LQ8A 2QA4Q 1MGQA 1AWXA 4ZN3A 4GLKA 1F1BB 4FYYB 4RG2A 3VS3A 2YSQA 3OBYA 3VYHB 4VUBA 4BUGA 2FZKB 1SPKA 2ESWA 3RR6A 2HZYA 5GANg 3CCJA 3CBMA 1AEYA 2WSEE 1ARKA 3I55A 1GXIE 2X3XD 3RESA 2DAQA 3TREA 2JMAA 5GMKh 3S3NA 1ABQA 3C94A 4C92D 4EPCA 2DD4A 1BI0A 2QEXQ 2XICA 1D1CA 4UC4A 3HTRA 1NLOC 2D0QB 2PNIA 4M78G 4RTYA 3V7SA 3CMEA 4LNPA 4DA4A 3MP6A 3NTKA 4OGEA 2QI2A 5LJ3d 4J7IA 3EAEA 4M75B 1KQSS 1K9MU 4BDZA 1X27A 4KH1B 2HNIA 1ACMB 1Z9QA 3UF4A 2IG0A 1PM3A 4JLGA 2VXFA 2EKHA 3X24B 2CP2A 1ZSZA 1B34B 2J05A 2F2XA 2ZPIB 4LDVA 4JRIA 1BB9A 1QVPA 2KQWA 1AWJA 2RK2A 1NZ9A 4MZMA 5D6WA 4M77A 2L8DA 4Q5WA 1Q7YC 1VYTA 2DVJA 1QLYA 2VGMA 4IUPA 1YHQT 2V1QA 1MMGA 1YWOA 3LWHA 3TQ7P 1PD0A 2KRSA 1RI9A 1AWOA 1B3QA 4A4EA 4NL3A 2QQ9A 1VQOT 1HK9A 2A3LA 3NHNA 2CUBA 4ELYC 3ZFJA 2XI9A 2JW4A 1S72A 2EBPA 2GGRA 3CCUQ 3JCMh 4B6MA 1N6AA 1IB8A 4FIBA 4BD3A 3M0TA 3GP8A 1TSFA 4C8QG 2E70A 4M75C 2LNHB 1WYXA 3L2UA 2ZZDA 1K0XA 3OBWA 1KQ2A 1M8VA 4Z89A 1YWPA 3QDFA 2FZGB 1NPPA 3E9FA 4F16A 2EYZA 4M7DD 4DOVA 3O8VA 3CPWA 1RACB 4DBFA 1UHFA 2DILA 4FYXB 3X20B 3CCJT 1OX8A 3JCMb 5GANe 3I55T 1M3BA 2KXCA 1G8XA 3AT1B 1YHQQ 2PU9B 3NPFA 3RNJA 3CXCP 2PVOB 4M77G 1Q82R 2LT1A 5GJWB 2F5TX 2DMOA 2E5KA 2RI2A 2M02A 1AOJA 2LCLA 3CMET 3NTIA 1VQOQ 4ZGEB 4J9BA 5CQYA 3BY7A 3FLGA 1OYXA 4RKUE 5HK3A 2FO0A 4BE1A 3VS5A 3OYEA 3L42A 3OW2P 2JXBA 4FCYA 1GCPA 5IHIA 2QQBA 4CRIA 2IVWA 1YCSB 3U23A 2L3QA 2K6DA 1YIJA 2X35A 2CH4A 3V8LA 1KFZA 5FRMA 5LJ5d 4A4FA 3LW5E 3CCRQ 2DL5A 2CGHA 5GMKl 1YN8A 2G6FX 4LDWA 2M1HA 2X51A 3MKDA 2DL8A 3FIFA 1KD1U 4PNOA 2O4XB 3M0SA 5HKCA 3I35A 2BZYA 1Q7YR 5CKEA 5GAMj 3X26B 1S1NA 4JLIA 4FT4A 3CCJQ 1QVFA 3VKIA 3I55Q 1N8RC 2MF2A 1BIAA 5LJ5h 1VQPA 2OTLA 4HA8A 1YNZA 3OS5A 2YXYA 4GY5A 1S72T 1JJ2A 1IO6A 2KDSA 3DKMA 4HVVA 1ZLMA 2RM4A 3JSCA 3X28B 1VQ9Q 4ESRA 2K7AA 4J9HA 4OB0B 3EG3A 4OB2B 2RHZA 1BIBA 5IXFA 2RK1A 4QQ6A 1UGQB 1XOVA 2XHCA 2P0PA 5LJ3f 3FEOA 5I22A 2MYSA 4FU6A 4JRQA 4KUIA 1RAEB 4PJOF 2H3EB 3A8OB 3JB9G 1X6GA 5A0LA 1LCKA 1VQ8A 2CYZB 1Q86C 1H3ZA 3EGXA 2NUTA 2DL7A 4RCCA 2FPEA 4MMKA 2DLPA 1BKBA 4FYVB 4M78E 2JUFA 3A98A 1ZA1B 3M9QA 1I1JA 1G3WA 1YJ9A 2ABLA 3REBB 4BE0A 2K5IA 3VRZA 2KYBA 1VQKA 1TS9A 3J81E 3CC4A 2DPPB 5C6SA 3PGGA 1TWBA 2K4YA 4L59A 1VQLA 1ZQ1A 4AFZC 2GTJA 2F5KA 1UECA 2MAMA 1ABOA 3CBPA 3M53A 4GLMA 2JJ9A 1VUBA 1S72Q 1XQHA 2HDAA 3LGFA 4XTXA 2A36A 4PLLA 4BB7A 2QQRA 2EFIA 2RH2A 2DIGA 2HQHA 4QVCA 4M78F 1YIJT 2JTMA 4NOYA 3AHUA 1M2OA 2LC4A 1Z9ZA 2DERA 3EGDB 3VV0A 4C92F 2V1RA 2BE7D 4J9FA 2RJDA 3ZEHA 5GAOn 3JCMg 2CP0A 2KXDA 1YJWA 1N9RA 1QVFS 4CC3A 1ZX6A 4C0ZA 1K0SA 4O6JA 2PZ1A 2AT1B 2FRYA 3I9QA 4HT8A 3VS0A 4EMHA 5CCAA 3BDUA 2G3RA 2DO3A 4QT7A 2GBQA 4IKFA 4PJJA 3HFNA 1VQPT 4OGCA 2OTLT 1UGVA 1N8RR 3I5RA 4C8QE 1LOJA 5GAMe 4K11A 3VUZA 3GF5A 2YDLA 3OMGA 1M1KU 4FSSA 3E2UA 3G1JA 4QKUA 2HBWA 2M9UA 2COYA 5DY9A 2QYZA 2QQSA 2C0IA 4EMKA 3H0HA 3CD6A 1Q95G 1FYNA 3UWNA 2KYMA 3D7SB 3TSWA 3EH2A 4DOWA 4M4ZA 1YJNA 1GBRA 3S6WA 1NJIU 2DEUA 2M51A 3R6NA 4EDUA 4M7AA 5D6YA 1VYUA 1I5OB 3RIRA 3OYFA 2DNUA 3FJ5A 4RG8A 1K9MC 4RUGA 2RD1A 5L8RE 2EYYA 3CCMA 1K73U 2A37A 2LT4A 4M78B 1VQ8T 4LN2A 2COWA 4M7DE 1I4K1 1M5Q1 2ZPGB 1O9SA 1IRXA 2DXTA 5FU6B 2MI6A 1PC0A 3BW1A 2DIQA 4EMGA 1YJ9T 3OQ5A 1Q86R 5KYWB 2E6NA 4ORZA 4PFZA 4C92B 3PNWC 5HY6A 1VQKT 2J6FA 4J6WA 1V76A 3CC4T 2LQWA 2PUKB 3M54A 2QGGA 4F7UE 3VYGA 4AG1C 4JS4A 3EH1A 4PJOA 5KYYA 1NM7A 2M0YA 1VQPQ 2OTLQ 1Q81U 1C0MA 4PLIA 1Y96B 2VGNA 1W70A 1K9AA 2AZVA 5A2QE 2CZ0B 4M7DF 4LUDA 4ANJA 3HP9A 1WHLA 2K57A 2CS7A 2GQIA 2OTJQ 5C0MA 3J7AF 2LVMA 3IQLA 2E64A 3QDRB 1VQ5A 1RABB 2KNBB 5I2MA 3GBQA 1MV0B 3ER0A 4F7UF 2O01E 2NUPB 1VIEA 3M59A 2FRWA 1G3YA 1NEGA 2EWNA 2M16A 2D1XA 2Z0WA 1SRMA 2XDPA 5IH2A 3QZ5B 1YJWT 3JCMe 4ME7A 2F69A 2DZ9A 5A0GA 5KE3A 5GMKm 3UA7A 2LNVA 3PVQA 2DJZA 1IZ6A 4E47A 3OYGA 1N5ZA 4OMFB 1N27A 2X4WA 4M7AG 2YUPA 4M78C 1MNDA 1QMCA 4LDXA 2XG8D 2XD0A 4FW1A 2ZAEA 4C8QB 4J9CA 2PTKA 5FU6C 1YJ9Q 2KI7A 1W2BS 2VKNA 2D0NA 3KUFA 1TUDA 2V8KA 5KYUA 4C92C 2BKDN 3CC4Q 2C0TA 5HCKA 1Y07A 1QVGP 3THKA 3P8HA 4NL2A 5GAMd 4QVDA 4OB3B 4PKCC 1T0JA 4KGZB 4BI4A 4E7HA 2K2MA 4IIMA 3A1PA 4C0FA 3CD6T 2EJ9A 4C5HA 4Z02A 2VXEA 4M78D 4IUUA 4RTWA 4J9DA 2NYSA 1YJNT 2DVEA 3EFOB 1QCNA 4XTUA 1FMKA 3L2VA 3JCMJ 4HT9A 3ULRB 1UUEA 4L5GA 4M7DB 3CCMT 2QTXA 2LJ3A 3I5SA 4XK8E 4BACA 4IUQA 1YJWQ 1K9MR 1K8AU 2A08A 3CEYA 3CCSA 5EC7A 5DLOA 3OS2A 3CXCA 1M27C 4F7UB 3P8BB 2HCKA 2NLUA 1UFFA 4KT0E 1JQQA 3MJXA 3QYGB 4KUDK 1UE9A 3VS6A 2JTFA 1NG2A 4AT1B 1X75C 4C8QC 4XU0A 1ZBXA 3VJPA 1KD1C 3JB9H 4J7FA 3RDVA 3OW2A 5FROA 2RQWA 1D0XA 2QG9B 1LNXA 3M4GA 2GQVA 3JRZA 1YI2A 2JOYA 5LJ3h 1IREB 1EIFA 2BIVA 4KRTA 4P5NA 1VQ5T 4J83A 1LVKA 2LCSA 2YLCA 1E7OA 4CC7A 3CD6Q 1E6HA 1IXDA 4A53A 4FYWB 2PUOB 1NE8A 2KSSA 3UT1A 3CPFA 4MDXA 2RHIA 3QKJA 1KHIA 3MO8A 1YJNQ 4C8QD 2W10A 3ZBDA 1U1SA 3L2QA 1M2VB 1WNLA 4LD6A 1VOMA 4M7DC 2RF0A 4M75A 3O5ZA 4E2FB 3A8HB 4C5IA 2E1HA 4HCCA 1PKTA 4II1A 4RTXA 1WHJA 2VB6A 3QIIA 2J06A 4WF2A 2O9SA 2KR3A 2CP7A 1T3LA 3CCQA 1U06A 3M5AA 2QDLA 1B34A 4XAXB 3I56A 4PFPA 5CK9A 3PT9A 2P4TA 2QTVA 2H3JA 3MHXA 1VQ6A 1QWFA 1G3TA 3VRYA 4Y28E 3QHSA 4V2SA 4JS5A 1R77A 5GJVB 1TH7A 3EG1A 3V7CA 4LDYA 2I2LA 2CUDA 1BU1A 1OPLA 4JRPA 2EQMA 3HRSA 1K4US 3EFSA 1VQ5Q 1BI1A 4OMOA 3OB9A 3QPHA 1OQKA 3EG9B 2KK4A 3LWIA 1X69A 1G5VA 1DJ7B 4FW2A 1QP3A 1UG1A 3CBOA 4E7JA 1K76A 1KC8U 3OYAA 3V8KA 3OYCA 2HL5C 2LJ0A 3EGUA 2GNCA 2RPNA 2QDYB 2LQNA 1KG1A 2GCXA 2GTOA 2VYTA 3CCST 1AZGB 4E7SA 1SKUB 3MCAB 4F04B 5GAN7 2P84A 1KIKA 5KYNA 2E3IA 2EYQA 1Q82U 2KE9A 1MMDA 4HVUA 3VS1A 2WSFE 2BTTA 4R56A 1NLPC 4M75G 1WXBA 1PKSA 2XDBA 3EHQA 3PVLA 5DM7R 1B07A 1X6OA 1PHTA 2E10A 1RAGB 4RTUA 2CT4A 2RNAA 3LLRA 2DF6A 1KD1R 3HL8A 1YI2T 3NGPA 1UGRB 3JV3A 2D6FA 2K2VA 2ED0A 3MP1A 3SDZA 4L6V5 3LH0A 4RTVA 3WXMB 1OPKA 1VIFA 1UJYA 5GAMf 4OMQA 2KT8A 1D3BB 3QXEB 1K1ZA 2GF7A 1RAAB 2F2VA 2B8AA 1M1KC 1CKAA 2L0AA 2HKNA 2F2WA 5GMKj 1MHNA 2RHXA 3G6EA 1RAHB 1Y0MA 4B9WA 2FPFA 2PVDB 1W4SA 3HHTB 3CMEQ 1I07A 1OV3A 2DL4A 2LMJA 2ED1A 3OYLA 1NJIC 4X34A 1YBYA 3JB9D 1O75A 2JTEA 3Q1JA 5IHKA 3CCQT 1KQ1A 3JCMV 3MEAA 1AT1B 5GMKi 6AT1B 1PRMC 3I56T 2DBKA 1RL2A 2CP3A 3CPWS 4YTLA 1K73C 4OMNA 1VQ6T 2J7IA 3C0CA 3M0QA 3LGLA 4LD9K 2L3SA 2XK0A 3DLMA 2O4XA 1ZHIA 3REAB 3RERA 5FU7B 1YI2Q 1BI2A 5CKBA 2ZPBB 5GANd 1X6BA 2CDTA 2KEAA 2AKLA 1Q81C 5FWBA 1HD3A 2ECZA 1GCQC 2DX1A 3PMIA 2XKOC 4DBRA 1UEBA 3M4YA 2EJFA 4OMLA 3SB2A 3TVTA 4AMCA 5LJ3g 2KRMA 1WHHA 1UGPB 2VWFA 4BE2A 4HXJA 5KCOA 3V7RA 1AD5A 2BUDA 5GANh 3DB3A 1NEBA 1OZ2A 4QVZA 4D8DA 3QWYA 4HCZA 1WDXA 4N0AC 4BY6B 4JJNK 1H92A 1OX9A 3CCQQ 1RAFB 3OS0A 3UPUA 1WQWA 1KHCA 3I56Q 5M9OA 1VQ7A 1SHFA 3MPUB 2KT1A 3RKYA 3N5BB 1VQ6Q 1MNEA 1T3SA 5KH6A 1QCOA 3KBGA 1FX7A 1OZ3A 1EX4A 3H0FA 4OVAA 9ATCB 3G4SA 1VQ4A 4QQGA 1WXTA 3GNGA 5KYXB 3OYDA 2RJFA 3PTAA 1JJ2S 5FU7C 1YITA 3EG2A 2VC8A 4KGXB 1LPLA 4RCBA 2JM8A 2HQEA 3JB9I 3C12A 2DL3A 1YP5A 2CP5A 4OMMA 2OI3A 3G6ET 2DTHA 1ZSGA 1M1KR 2YUNA 4ZGDB 2EVRA 1RADB 1X2QA 3BDLA 1WJQA 2LZ6B 4MZTA 5GAN3 2HD0A 1M8MA 2P0QA 1ZUKA 2GFAA 5J26A 3JCMP 1IGUA 2RQUA 3OYIA 1MUZA 2ENMA 5GMKe 2Y4YA 1BCOA 1SSFA 3CCEA 1QVGA 1TG0A 1LJOA 3SWNB 3QJ6A 1NJIR 2A28A 3HSBA 5CKFA 3R6OA 1NBEB 5L23A 2DYIA 3EGDA 1YIJQ 3OA6A 2L3PA 4C8QF 2PQWA 1WXUA 1K8AC 4J6YA 1GBQA 4BY6C 1U5SA 1K73R 4KH0B 4N4HA 3HKSA 2FPDA 4PJMA 3VUBA 1M90U 3CC2A 4ZN1A 5KE2A 1I81A 5I21A 3C4SA 3FDRA 1IGQA 2MPXC 2DKGA 4M77E 2DYBA 3ASKA 3M0UA 1VQNA 2FHDA 2JT4A 1TU0B 1WIEA 5J39A 1M1GA 2OX7A 2O88A 3MEVA 2CSQA 5IN1A 1VQLT 4A4GA 1Q81R 1JB0E 1PSFA 3CCUA 2M0OA 4J5YA 3GPLA 1QKWA 2HBPA 2X4JA 5J3BA 5LJ5j 2YRDA 2BZXA 4JZ4A 4M77F 1I5LA 2X9HA 4F14A 1X01A 3WVEB 1RAIB 5CKDA 3M58A 2E12A 2LP5A 4JJCA 1N9SA 5CO7A 5LJ5g 1ZUUA 1EZZB 3MEUA 2L5QA 1WX6A 3M0RA 1R0CB 1UJ0A 2EQJA 3SWNC 4IUTA 1VQ7T 4AFQC 4X9DA 3RMSA 1AZEA 2NWMA 3OYHA 3QJYA 4QW2A 4M78A 1NYFA 3GNFB 3JB9J 4B9XA 2L89A 3OYJA 1FXXA 1A0NB 2EQIA 1R0BG 5IHNA 3RKXA 1Y57A 1TTHB 1C6VX 1G83A 2OAWA 3G4ST 3S3MA 1VQ4T 4BDYA 1VQ8Q 3J80E 3KFVA 5KYWA 2EIFA 1YITT 2COZA 1ZBJA 4C92A 5FWCA 2FYKA 2NUZA 4MZPA 4ZTJA 3M57A 2C0OA 2LRQA 3HFOA 1OU8A 2D8HA 1VQKQ 1FWZA 1XNIA 3BE3A 3FRNA 3JCMW 4PJLA 2AZSA 1VQLQ 5GANf 1TUCA 1Y96A 1J3TA 3OSVA 2EGAA 3UATA 2AK5A 1W2BP 3F70A 2MMPA 2DXUA 4JJDA 4J9EA 3TEEA 3CQTA 3CCET 4PJOG 1VQMA 3UDCA 3CCRA 2V26A 5CIUA 3M56A 2ROTA 1ZSZB 1KC8C 2DETA 2NUPA 2YWWA 1OI1A 2EKOA 5CAIA 2O9VA 1UDLA 2Y4XA 2VASA 2LJ1A 4WCIA 4M77B 5GAMh 3CC2T 5D7UA 2C06A 1C1AA 4CC4B 2DA9A 2CP6A 1K8AR 1VQ7Q 1PRLC 1HYOA 1I0CA 4GBQA 4R55A 2EPDA 2V8JA 1Q82C 2R5MA 1VQNT 2YRCA 4ELZC 1QCFA 2ZPFB 2LDMA 4C8QA 3QUIA 3G4SQ 1VQ4Q 2QASA 3JB9F 2YUOA 1PG5B 3CCUT 3RBBB 1YITQ 2HAXA 3M0PA 2FEIA 1G3SA 1JEGA 2X4XA 2KY9A 3RKWA 5I2SA 5A0DA 3EHRA 4RMOA 1KQSP 1Y7XA 1VQ9A 1WPYA 2YUQA 3C95A 2K3BA 2DRKA 4HCBA 2RN8A 3M55A 4DEXA 4C92G 4E7KA 1VYVA 2FL7A 2A7YA 2D9TA 2MWPA 2K5LA 2OAUA 4XU3A 2LTOA 4JDSA 2CT3A 2E4HA 1IHVA 5LJ5e 3FC3A 4J9IA 3CCEQ 2E5QA 3EFOA 1QQJA 3H41A 4Y92A 1ZSZC 4M7DA 1H641 2K3XA 1BK2A 4PK4A 2HEQA 2JMCA 4DQ2A 3JCMd 3PE0A 2HKQB 5GAOl 1OOTA 2XDDA 2EGEA 2K9GA 5AYFA 2FB7A 3CC2Q 4M77C 3CCMQ 3PIPA 1PD1A 5GAOq 4E7IA 2LX7A 2L2PA 4F7UA 2AKKA 2EW3A 4BI8B 4DEYA 3QBYA 3LX7A 3L2WA 1VQNQ 2JM9A 3JCMc 3RMQA 1TXQA 1UB4A 2DRMA 1I8FA 5GAOp 1YCYA 2O31A 3JAME 5IAYA 3A8MB 2X3WD 5GAN6 2EAYA 4J8OA 3QWXX 1PNJA 2J6KA 4HVWA 2K5FA 4WTOB 4M77D 2ZCFB 4IURA 5GAN4 2WACA 3FJPA 4DBQA 4ZTFA 1VQMT 2IPOB 1CKBA 3CCRT 4KGVB 2L3RA 5CVIA 3L2RA 5KCHA 2F1LA 4EIKA 3A5ZB 1OEBA 2ZPHB 2RHUA 1KC8R 3X25B 1HJDA 2JS2A 3H0IA 4Z8AA 5CKHA 2KVQG 5CR2A 4N4GA 3CXCS 3CCLA 4CC2A 5GAOr 2JZ2A 1M2VA 1KSWA 4MMLA 4XTYA 1M3CA 4JPBW 2J6OA 4M75D 1UHCA 1D1BA 2DTIA 4M7DG 2RA2A 1WZOA 1NYGA 1M4ZA 1X2KA 2ATCB 3URGA 1HXDA 2VUBA 3OW2S 3OYKA 1MV3A 1BBZA 3V8JA 2B86A 1NPRA 1VQ9T 4C0DB 2CZ1B 5GAN8 2DE0X 4F17A 4F7UG 5FRNA 1P92A 3OS1A 4A63B 2AHJB 2MWOA 1RLQC 2RQVA 3BFMA 2RI5A 1AVZC 2MK5A 1WHGA 1IHWA 4E7LA 1SRLA 3E1SA 1WQ7A 1VQMQ 2YT6A 2EQKA 1PWTA 1WHMA 3EG9A 2QGFB 3H6ZA 3SD4A 1GL5A 2RO0A 3VS7A 5ECAA 4E6RA 3DB4A 3OY9A 1B7TA 2RQTA 4M7AE 3OYMA 2DBMA 3EG0A 1SEMA 4J9GA 1SSHA 5D6XA 1Y71A 2NUTB 3EGXB 3SHWA 3DLLA 3H9NA 1GFCA 3QZ9B 4FT2A 1Q7YU 2WSCE 4LE9A 5DLQE 2EQUA 1WA7A 3CCSQ 2A0FB 1JBMA 1GRIA 2ROLA 4N4IA 3QO3A 2OJ2A 1G2BA 3MP8A 4FM4B 4OF1A 2KGTA 1VA7A 1QW1A 5GAMg 1M90C 4PJNA 4A4KA 4PJOE 4M7AF 1XJWB 1W1FA 3CCVA 1SF9A 1D0ZA 2OTJA 3OYNA 2SRCA 4C0DC 2SEMA 1M30A 3INZA 3OYYA 2E6ZA 3CPWP 2DZCA 3HPWA 4KBMB 3CMAA 1GCQA 1RI0A 4OB1B 2MIOA 2DEQA 5LJ3j 4KULA 1D3BA 3PMTA 3VU3C 4OP0A 1U8RA 2MOXA 4IUVA 4JRKA 3TSZA 2MCNA 2YHTA 3CC7A 1QWEA 1M3AA 2HSPA 3ZL7C 1AWWA 2CZ7B 1D0YA 3CCLT 4XTZA 1U1TA 4ZGJB 2RQRA 3E9GA 1H3HA 4JZ3A 2KMTA 2BZ8A 3SEMA 3G71A 1FMVA 2XIDA 4RTTA 1BI3A 4DBHA 2XU8A 4N0AA 3QYHB 2DFUA 3HRTA 2R5AA 4FL6A 1MMAA 2HMAA 4R0KA 3NMZC 3JCMf 4C92E 2AIRB 4CI0C 2JNGA 5EG2A 2QA4A 3GIBA 4D6WA 1AHJB 1D1AA 2R57A 3GOXA 2DXCA 4LDUA 2DXBA 1D09B 2RMOA 4D8KA 3RUXA 2D8JA 2QAZA 1JU5C 2KRNA 4EMKB 3VS2A 2H8HA 4C5EA 4C0GA 3NTHA 2CKKA 3KXTA 2EYWA 4Z88A 4PL6A 2DK3A 4M7AB 5GAN5 2QEXA 1WHKA 2CREA 3MEWA 3LYIA 5IXBA 1QVFP 2EJGA 4X1VA 3LH5A 3EFRA 2E65A 1UGSB 3OMCA 1TOVA 5FLXE 4C5GA 3OYBA 2KBTA 1HSQA 3CCLQ 3FB9A 5GAOm 1JJ2P 1EFNA 1WLPB 4J6XA 3WVDB 3L2ZA 2LCCA 1RUWA 3JCMX 1V29B 2XMFA 4ZNXA 4BI3A 2EYXA 4PJOB 5KYYB 3H8ZA 3UA6A 5LL6S 1XTDA 1WJSA 3VS4A 3P8DA 1BYMA 1E6GA 1N8RU 2CSIA 3PIOA 1MMNA 2VVKA 1QKXA 3CCVT 2RI3A 2EGCA 1W2BA 2OTJT 4Y91A 1M1FA 1U3OA 1R8OB 1V1CA 2Y90A 1M90R 4XTWA 2DD5A 3GLXA 1UTIA 4LXCA 4A4HA 4XTVA 2DM1A 2KROA 3PFSA 5GAN2 2GFUA 2IIMA 2JS0A 2RB6A 5AT1B 3CMAT 1BCMA 1RLPC 4EMKC 4AG2C 4HKEA 1YFNA 1SG5A 5KYXA 2RHYA 2K79A 4E7ZA 1GFDA 4MDWA 4NS5A 3CC7T 4LUEA 2FZCB 2JN0A 3G7ZA 3TCJA 1WJRA 3META 1JO8A 2V8IA 3A8GB 4HCKA 4M7AC 1JXOA 2FG0A 2YLBA 2KAFA 4QQDA 2P0KA 2PVGB 4OMPA 1PCXA 5LJ3e 4A54A 2DJQA 1WGSA 3G71T 1QP2A 3QG1A 2QQAA 5LJ5f 3G6EQ 2ZPEB 2HL3A 2FVUA 1OULA 2BE9B 3E19A 4M75E 1Q86U 4IIOA 4PFOA 2QXFA 1KQSA 3ME9A 2QA4T 1WFWA 2CZ6B 5KYUB 1X43A 2P4RA 3OSSC 2CH4W 3SWNA 3S3OA 2O2OA 5FW9A 3NFCA 4O5VA 1OU9A 4PJOC 1KK7A 4M7AD 5I11A 4AFSC 3A8LB 3L1AA 4AFUC 3JCMQ 5IT9E 1TUGB 3CCVQ 1H8KA 3HRUA 4ATOA 2ZGWA 2HSEB 2K3YA 5CQXA 2E3HA 1ZUYA 4XU2A 2RJEA 4M75F 1YHQA 2E41A 7AT1B
chains in the Genus database with same CATH topology
1VQ9Q 1VQ4Q 3CCJQ 1NJIR 3CMAQ 2QEXQ 3CCRQ 1W2BP 1M1KR 3I55Q 1YITQ 3G6EQ 3G71Q 3CCSQ 3CC2Q 1Q86R 3CCLQ 1VQ5Q 1VQ8Q 3CCUQ 1YIJQ 1K8AR 3CCMQ 1KD1R 1YHQQ 3OW2P 1YJ9Q 1JJ2P 1VQ7Q 3CD6Q 3CCVQ 1KQSP 3CCEQ 1YJWQ 3CPWP 3CXCP 1K9MR 1YI2Q 1KC8R 1M90R 1Q82R 1VQKQ 2OTJQ 3CC4Q 3CC7Q 3CCQQ 1K73R 1QVGP 1S72Q 1Q81R 1YJNQ 1VQLQ 3I56Q 1QVFP 2QA4Q 1VQNQ 1Q7YR 1VQPQ 3CMEQ 2OTLQ 1VQMQ 1N8RR 1VQOQ 1VQ6Q 3G4SQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQ9 Q;  1VQ4 Q;  3CCJ Q;  1NJI R;  3CMA Q;  2QEX Q;  3CCR Q;  1W2B P;  1M1K R;  3I55 Q;  1YIT Q;  3G6E Q;  3G71 Q;  3CCS Q;  3CC2 Q;  1Q86 R;  3CCL Q;  1VQ5 Q;  1VQ8 Q;  3CCU Q;  1YIJ Q;  1K8A R;  3CCM Q;  1KD1 R;  1YHQ Q;  3OW2 P;  1YJ9 Q;  1JJ2 P;  1VQ7 Q;  3CD6 Q;  3CCV Q;  1KQS P;  3CCE Q;  1YJW Q;  3CPW P;  3CXC P;  1K9M R;  1YI2 Q;  1KC8 R;  1M90 R;  1Q82 R;  1VQK Q;  2OTJ Q;  3CC4 Q;  3CC7 Q;  3CCQ Q;  1K73 R;  1QVG P;  1S72 Q;  1Q81 R;  1YJN Q;  1VQL Q;  3I56 Q;  1QVF P;  2QA4 Q;  1VQN Q;  1Q7Y R;  1VQP Q;  3CME Q;  2OTL Q;  1VQM Q;  1N8R R;  1VQO Q;  1VQ6 Q;  3G4S Q; 
#chains in the Genus database with same CATH topology
 2QEX T;  2LQK A;  3SFM A;  3CMA Q;  4XQ3 A;  8ATC B;  1SHG A;  1T0H A;  4X9C A;  1CSK A;  3TU4 K;  4RTZ A;  2DTO A;  4JJB A;  1VQO A;  4PJO D;  1ZA2 B;  2R58 A;  1W6X A;  3CC7 Q;  4FSX A;  1WI7 A;  4XU1 A;  2I0N A;  2VV5 A;  2LX9 A;  2RJC A;  1QVG S;  3QSU A;  1FMW A;  1KJW A;  2W0Z A;  2X4Y A;  1PSE A;  1JXM A;  1M9S A;  3G71 Q;  2HQX A;  2YRV A;  4JUV A;  4TVR A;  5HK0 A;  3T9N A;  8AT1 B;  2QK0 A;  5GAN j;  2JVV A;  1JRI A;  2LQ8 A;  2QA4 Q;  1MGQ A;  1AWX A;  4ZN3 A;  4GLK A;  1F1B B;  4FYY B;  4RG2 A;  3VS3 A;  2YSQ A;  3OBY A;  3VYH B;  4VUB A;  4BUG A;  2FZK B;  1SPK A;  2ESW A;  3RR6 A;  2HZY A;  5GAN g;  3CCJ A;  3CBM A;  1AEY A;  2WSE E;  1ARK A;  3I55 A;  1GXI E;  2X3X D;  3RES A;  2DAQ A;  3TRE A;  2JMA A;  5GMK h;  3S3N A;  1ABQ A;  3C94 A;  4C92 D;  4EPC A;  2DD4 A;  1BI0 A;  2QEX Q;  2XIC A;  1D1C A;  4UC4 A;  3HTR A;  1NLO C;  2D0Q B;  2PNI A;  4M78 G;  4RTY A;  3V7S A;  3CME A;  4LNP A;  4DA4 A;  3MP6 A;  3NTK A;  4OGE A;  2QI2 A;  5LJ3 d;  4J7I A;  3EAE A;  4M75 B;  1KQS S;  1K9M U;  4BDZ A;  1X27 A;  4KH1 B;  2HNI A;  1ACM B;  1Z9Q A;  3UF4 A;  2IG0 A;  1PM3 A;  4JLG A;  2VXF A;  2EKH A;  3X24 B;  2CP2 A;  1ZSZ A;  1B34 B;  2J05 A;  2F2X A;  2ZPI B;  4LDV A;  4JRI A;  1BB9 A;  1QVP A;  2KQW A;  1AWJ A;  2RK2 A;  1NZ9 A;  4MZM A;  5D6W A;  4M77 A;  2L8D A;  4Q5W A;  1Q7Y C;  1VYT A;  2DVJ A;  1QLY A;  2VGM A;  4IUP A;  1YHQ T;  2V1Q A;  1MMG A;  1YWO A;  3LWH A;  3TQ7 P;  1PD0 A;  2KRS A;  1RI9 A;  1AWO A;  1B3Q A;  4A4E A;  4NL3 A;  2QQ9 A;  1VQO T;  1HK9 A;  2A3L A;  3NHN A;  2CUB A;  4ELY C;  3ZFJ A;  2XI9 A;  2JW4 A;  1S72 A;  2EBP A;  2GGR A;  3CCU Q;  3JCM h;  4B6M A;  1N6A A;  1IB8 A;  4FIB A;  4BD3 A;  3M0T A;  3GP8 A;  1TSF A;  4C8Q G;  2E70 A;  4M75 C;  2LNH B;  1WYX A;  3L2U A;  2ZZD A;  1K0X A;  3OBW A;  1KQ2 A;  1M8V A;  4Z89 A;  1YWP A;  3QDF A;  2FZG B;  1NPP A;  3E9F A;  4F16 A;  2EYZ A;  4M7D D;  4DOV A;  3O8V A;  3CPW A;  1RAC B;  4DBF A;  1UHF A;  2DIL A;  4FYX B;  3X20 B;  3CCJ T;  1OX8 A;  3JCM b;  5GAN e;  3I55 T;  1M3B A;  2KXC A;  1G8X A;  3AT1 B;  1YHQ Q;  2PU9 B;  3NPF A;  3RNJ A;  3CXC P;  2PVO B;  4M77 G;  1Q82 R;  2LT1 A;  5GJW B;  2F5T X;  2DMO A;  2E5K A;  2RI2 A;  2M02 A;  1AOJ A;  2LCL A;  3CME T;  3NTI A;  1VQO Q;  4ZGE B;  4J9B A;  5CQY A;  3BY7 A;  3FLG A;  1OYX A;  4RKU E;  5HK3 A;  2FO0 A;  4BE1 A;  3VS5 A;  3OYE A;  3L42 A;  3OW2 P;  2JXB A;  4FCY A;  1GCP A;  5IHI A;  2QQB A;  4CRI A;  2IVW A;  1YCS B;  3U23 A;  2L3Q A;  2K6D A;  1YIJ A;  2X35 A;  2CH4 A;  3V8L A;  1KFZ A;  5FRM A;  5LJ5 d;  4A4F A;  3LW5 E;  3CCR Q;  2DL5 A;  2CGH A;  5GMK l;  1YN8 A;  2G6F X;  4LDW A;  2M1H A;  2X51 A;  3MKD A;  2DL8 A;  3FIF A;  1KD1 U;  4PNO A;  2O4X B;  3M0S A;  5HKC A;  3I35 A;  2BZY A;  1Q7Y R;  5CKE A;  5GAM j;  3X26 B;  1S1N A;  4JLI A;  4FT4 A;  3CCJ Q;  1QVF A;  3VKI A;  3I55 Q;  1N8R C;  2MF2 A;  1BIA A;  5LJ5 h;  1VQP A;  2OTL A;  4HA8 A;  1YNZ A;  3OS5 A;  2YXY A;  4GY5 A;  1S72 T;  1JJ2 A;  1IO6 A;  2KDS A;  3DKM A;  4HVV A;  1ZLM A;  2RM4 A;  3JSC A;  3X28 B;  1VQ9 Q;  4ESR A;  2K7A A;  4J9H A;  4OB0 B;  3EG3 A;  4OB2 B;  2RHZ A;  1BIB A;  5IXF A;  2RK1 A;  4QQ6 A;  1UGQ B;  1XOV A;  2XHC A;  2P0P A;  5LJ3 f;  3FEO A;  5I22 A;  2MYS A;  4FU6 A;  4JRQ A;  4KUI A;  1RAE B;  4PJO F;  2H3E B;  3A8O B;  3JB9 G;  1X6G A;  5A0L A;  1LCK A;  1VQ8 A;  2CYZ B;  1Q86 C;  1H3Z A;  3EGX A;  2NUT A;  2DL7 A;  4RCC A;  2FPE A;  4MMK A;  2DLP A;  1BKB A;  4FYV B;  4M78 E;  2JUF A;  3A98 A;  1ZA1 B;  3M9Q A;  1I1J A;  1G3W A;  1YJ9 A;  2ABL A;  3REB B;  4BE0 A;  2K5I A;  3VRZ A;  2KYB A;  1VQK A;  1TS9 A;  3J81 E;  3CC4 A;  2DPP B;  5C6S A;  3PGG A;  1TWB A;  2K4Y A;  4L59 A;  1VQL A;  1ZQ1 A;  4AFZ C;  2GTJ A;  2F5K A;  1UEC A;  2MAM A;  1ABO A;  3CBP A;  3M53 A;  4GLM A;  2JJ9 A;  1VUB A;  1S72 Q;  1XQH A;  2HDA A;  3LGF A;  4XTX A;  2A36 A;  4PLL A;  4BB7 A;  2QQR A;  2EFI A;  2RH2 A;  2DIG A;  2HQH A;  4QVC A;  4M78 F;  1YIJ T;  2JTM A;  4NOY A;  3AHU A;  1M2O A;  2LC4 A;  1Z9Z A;  2DER A;  3EGD B;  3VV0 A;  4C92 F;  2V1R A;  2BE7 D;  4J9F A;  2RJD A;  3ZEH A;  5GAO n;  3JCM g;  2CP0 A;  2KXD A;  1YJW A;  1N9R A;  1QVF S;  4CC3 A;  1ZX6 A;  4C0Z A;  1K0S A;  4O6J A;  2PZ1 A;  2AT1 B;  2FRY A;  3I9Q A;  4HT8 A;  3VS0 A;  4EMH A;  5CCA A;  3BDU A;  2G3R A;  2DO3 A;  4QT7 A;  2GBQ A;  4IKF A;  4PJJ A;  3HFN A;  1VQP T;  4OGC A;  2OTL T;  1UGV A;  1N8R R;  3I5R A;  4C8Q E;  1LOJ A;  5GAM e;  4K11 A;  3VUZ A;  3GF5 A;  2YDL A;  3OMG A;  1M1K U;  4FSS A;  3E2U A;  3G1J A;  4QKU A;  2HBW A;  2M9U A;  2COY A;  5DY9 A;  2QYZ A;  2QQS A;  2C0I A;  4EMK A;  3H0H A;  3CD6 A;  1Q95 G;  1FYN A;  3UWN A;  2KYM A;  3D7S B;  3TSW A;  3EH2 A;  4DOW A;  4M4Z A;  1YJN A;  1GBR A;  3S6W A;  1NJI U;  2DEU A;  2M51 A;  3R6N A;  4EDU A;  4M7A A;  5D6Y A;  1VYU A;  1I5O B;  3RIR A;  3OYF A;  2DNU A;  3FJ5 A;  4RG8 A;  1K9M C;  4RUG A;  2RD1 A;  5L8R E;  2EYY A;  3CCM A;  1K73 U;  2A37 A;  2LT4 A;  4M78 B;  1VQ8 T;  4LN2 A;  2COW A;  4M7D E;  1I4K 1;  1M5Q 1;  2ZPG B;  1O9S A;  1IRX A;  2DXT A;  5FU6 B;  2MI6 A;  1PC0 A;  3BW1 A;  2DIQ A;  4EMG A;  1YJ9 T;  3OQ5 A;  1Q86 R;  5KYW B;  2E6N A;  4ORZ A;  4PFZ A;  4C92 B;  3PNW C;  5HY6 A;  1VQK T;  2J6F A;  4J6W A;  1V76 A;  3CC4 T;  2LQW A;  2PUK B;  3M54 A;  2QGG A;  4F7U E;  3VYG A;  4AG1 C;  4JS4 A;  3EH1 A;  4PJO A;  5KYY A;  1NM7 A;  2M0Y A;  1VQP Q;  2OTL Q;  1Q81 U;  1C0M A;  4PLI A;  1Y96 B;  2VGN A;  1W70 A;  1K9A A;  2AZV A;  5A2Q E;  2CZ0 B;  4M7D F;  4LUD A;  4ANJ A;  3HP9 A;  1WHL A;  2K57 A;  2CS7 A;  2GQI A;  2OTJ Q;  5C0M A;  3J7A F;  2LVM A;  3IQL A;  2E64 A;  3QDR B;  1VQ5 A;  1RAB B;  2KNB B;  5I2M A;  3GBQ A;  1MV0 B;  3ER0 A;  4F7U F;  2O01 E;  2NUP B;  1VIE A;  3M59 A;  2FRW A;  1G3Y A;  1NEG A;  2EWN A;  2M16 A;  2D1X A;  2Z0W A;  1SRM A;  2XDP A;  5IH2 A;  3QZ5 B;  1YJW T;  3JCM e;  4ME7 A;  2F69 A;  2DZ9 A;  5A0G A;  5KE3 A;  5GMK m;  3UA7 A;  2LNV A;  3PVQ A;  2DJZ A;  1IZ6 A;  4E47 A;  3OYG A;  1N5Z A;  4OMF B;  1N27 A;  2X4W A;  4M7A G;  2YUP A;  4M78 C;  1MND A;  1QMC A;  4LDX A;  2XG8 D;  2XD0 A;  4FW1 A;  2ZAE A;  4C8Q B;  4J9C A;  2PTK A;  5FU6 C;  1YJ9 Q;  2KI7 A;  1W2B S;  2VKN A;  2D0N A;  3KUF A;  1TUD A;  2V8K A;  5KYU A;  4C92 C;  2BKD N;  3CC4 Q;  2C0T A;  5HCK A;  1Y07 A;  1QVG P;  3THK A;  3P8H A;  4NL2 A;  5GAM d;  4QVD A;  4OB3 B;  4PKC C;  1T0J A;  4KGZ B;  4BI4 A;  4E7H A;  2K2M A;  4IIM A;  3A1P A;  4C0F A;  3CD6 T;  2EJ9 A;  4C5H A;  4Z02 A;  2VXE A;  4M78 D;  4IUU A;  4RTW A;  4J9D A;  2NYS A;  1YJN T;  2DVE A;  3EFO B;  1QCN A;  4XTU A;  1FMK A;  3L2V A;  3JCM J;  4HT9 A;  3ULR B;  1UUE A;  4L5G A;  4M7D B;  3CCM T;  2QTX A;  2LJ3 A;  3I5S A;  4XK8 E;  4BAC A;  4IUQ A;  1YJW Q;  1K9M R;  1K8A U;  2A08 A;  3CEY A;  3CCS A;  5EC7 A;  5DLO A;  3OS2 A;  3CXC A;  1M27 C;  4F7U B;  3P8B B;  2HCK A;  2NLU A;  1UFF A;  4KT0 E;  1JQQ A;  3MJX A;  3QYG B;  4KUD K;  1UE9 A;  3VS6 A;  2JTF A;  1NG2 A;  4AT1 B;  1X75 C;  4C8Q C;  4XU0 A;  1ZBX A;  3VJP A;  1KD1 C;  3JB9 H;  4J7F A;  3RDV A;  3OW2 A;  5FRO A;  2RQW A;  1D0X A;  2QG9 B;  1LNX A;  3M4G A;  2GQV A;  3JRZ A;  1YI2 A;  2JOY A;  5LJ3 h;  1IRE B;  1EIF A;  2BIV A;  4KRT A;  4P5N A;  1VQ5 T;  4J83 A;  1LVK A;  2LCS A;  2YLC A;  1E7O A;  4CC7 A;  3CD6 Q;  1E6H A;  1IXD A;  4A53 A;  4FYW B;  2PUO B;  1NE8 A;  2KSS A;  3UT1 A;  3CPF A;  4MDX A;  2RHI A;  3QKJ A;  1KHI A;  3MO8 A;  1YJN Q;  4C8Q D;  2W10 A;  3ZBD A;  1U1S A;  3L2Q A;  1M2V B;  1WNL A;  4LD6 A;  1VOM A;  4M7D C;  2RF0 A;  4M75 A;  3O5Z A;  4E2F B;  3A8H B;  4C5I A;  2E1H A;  4HCC A;  1PKT A;  4II1 A;  4RTX A;  1WHJ A;  2VB6 A;  3QII A;  2J06 A;  4WF2 A;  2O9S A;  2KR3 A;  2CP7 A;  1T3L A;  3CCQ A;  1U06 A;  3M5A A;  2QDL A;  1B34 A;  4XAX B;  3I56 A;  4PFP A;  5CK9 A;  3PT9 A;  2P4T A;  2QTV A;  2H3J A;  3MHX A;  1VQ6 A;  1QWF A;  1G3T A;  3VRY A;  4Y28 E;  3QHS A;  4V2S A;  4JS5 A;  1R77 A;  5GJV B;  1TH7 A;  3EG1 A;  3V7C A;  4LDY A;  2I2L A;  2CUD A;  1BU1 A;  1OPL A;  4JRP A;  2EQM A;  3HRS A;  1K4U S;  3EFS A;  1VQ5 Q;  1BI1 A;  4OMO A;  3OB9 A;  3QPH A;  1OQK A;  3EG9 B;  2KK4 A;  3LWI A;  1X69 A;  1G5V A;  1DJ7 B;  4FW2 A;  1QP3 A;  1UG1 A;  3CBO A;  4E7J A;  1K76 A;  1KC8 U;  3OYA A;  3V8K A;  3OYC A;  2HL5 C;  2LJ0 A;  3EGU A;  2GNC A;  2RPN A;  2QDY B;  2LQN A;  1KG1 A;  2GCX A;  2GTO A;  2VYT A;  3CCS T;  1AZG B;  4E7S A;  1SKU B;  3MCA B;  4F04 B;  5GAN 7;  2P84 A;  1KIK A;  5KYN A;  2E3I A;  2EYQ A;  1Q82 U;  2KE9 A;  1MMD A;  4HVU A;  3VS1 A;  2WSF E;  2BTT A;  4R56 A;  1NLP C;  4M75 G;  1WXB A;  1PKS A;  2XDB A;  3EHQ A;  3PVL A;  5DM7 R;  1B07 A;  1X6O A;  1PHT A;  2E10 A;  1RAG B;  4RTU A;  2CT4 A;  2RNA A;  3LLR A;  2DF6 A;  1KD1 R;  3HL8 A;  1YI2 T;  3NGP A;  1UGR B;  3JV3 A;  2D6F A;  2K2V A;  2ED0 A;  3MP1 A;  3SDZ A;  4L6V 5;  3LH0 A;  4RTV A;  3WXM B;  1OPK A;  1VIF A;  1UJY A;  5GAM f;  4OMQ A;  2KT8 A;  1D3B B;  3QXE B;  1K1Z A;  2GF7 A;  1RAA B;  2F2V A;  2B8A A;  1M1K C;  1CKA A;  2L0A A;  2HKN A;  2F2W A;  5GMK j;  1MHN A;  2RHX A;  3G6E A;  1RAH B;  1Y0M A;  4B9W A;  2FPF A;  2PVD B;  1W4S A;  3HHT B;  3CME Q;  1I07 A;  1OV3 A;  2DL4 A;  2LMJ A;  2ED1 A;  3OYL A;  1NJI C;  4X34 A;  1YBY A;  3JB9 D;  1O75 A;  2JTE A;  3Q1J A;  5IHK A;  3CCQ T;  1KQ1 A;  3JCM V;  3MEA A;  1AT1 B;  5GMK i;  6AT1 B;  1PRM C;  3I56 T;  2DBK A;  1RL2 A;  2CP3 A;  3CPW S;  4YTL A;  1K73 C;  4OMN A;  1VQ6 T;  2J7I A;  3C0C A;  3M0Q A;  3LGL A;  4LD9 K;  2L3S A;  2XK0 A;  3DLM A;  2O4X A;  1ZHI A;  3REA B;  3RER A;  5FU7 B;  1YI2 Q;  1BI2 A;  5CKB A;  2ZPB B;  5GAN d;  1X6B A;  2CDT A;  2KEA A;  2AKL A;  1Q81 C;  5FWB A;  1HD3 A;  2ECZ A;  1GCQ C;  2DX1 A;  3PMI A;  2XKO C;  4DBR A;  1UEB A;  3M4Y A;  2EJF A;  4OML A;  3SB2 A;  3TVT A;  4AMC A;  5LJ3 g;  2KRM A;  1WHH A;  1UGP B;  2VWF A;  4BE2 A;  4HXJ A;  5KCO A;  3V7R A;  1AD5 A;  2BUD A;  5GAN h;  3DB3 A;  1NEB A;  1OZ2 A;  4QVZ A;  4D8D A;  3QWY A;  4HCZ A;  1WDX A;  4N0A C;  4BY6 B;  4JJN K;  1H92 A;  1OX9 A;  3CCQ Q;  1RAF B;  3OS0 A;  3UPU A;  1WQW A;  1KHC A;  3I56 Q;  5M9O A;  1VQ7 A;  1SHF A;  3MPU B;  2KT1 A;  3RKY A;  3N5B B;  1VQ6 Q;  1MNE A;  1T3S A;  5KH6 A;  1QCO A;  3KBG A;  1FX7 A;  1OZ3 A;  1EX4 A;  3H0F A;  4OVA A;  9ATC B;  3G4S A;  1VQ4 A;  4QQG A;  1WXT A;  3GNG A;  5KYX B;  3OYD A;  2RJF A;  3PTA A;  1JJ2 S;  5FU7 C;  1YIT A;  3EG2 A;  2VC8 A;  4KGX B;  1LPL A;  4RCB A;  2JM8 A;  2HQE A;  3JB9 I;  3C12 A;  2DL3 A;  1YP5 A;  2CP5 A;  4OMM A;  2OI3 A;  3G6E T;  2DTH A;  1ZSG A;  1M1K R;  2YUN A;  4ZGD B;  2EVR A;  1RAD B;  1X2Q A;  3BDL A;  1WJQ A;  2LZ6 B;  4MZT A;  5GAN 3;  2HD0 A;  1M8M A;  2P0Q A;  1ZUK A;  2GFA A;  5J26 A;  3JCM P;  1IGU A;  2RQU A;  3OYI A;  1MUZ A;  2ENM A;  5GMK e;  2Y4Y A;  1BCO A;  1SSF A;  3CCE A;  1QVG A;  1TG0 A;  1LJO A;  3SWN B;  3QJ6 A;  1NJI R;  2A28 A;  3HSB A;  5CKF A;  3R6O A;  1NBE B;  5L23 A;  2DYI A;  3EGD A;  1YIJ Q;  3OA6 A;  2L3P A;  4C8Q F;  2PQW A;  1WXU A;  1K8A C;  4J6Y A;  1GBQ A;  4BY6 C;  1U5S A;  1K73 R;  4KH0 B;  4N4H A;  3HKS A;  2FPD A;  4PJM A;  3VUB A;  1M90 U;  3CC2 A;  4ZN1 A;  5KE2 A;  1I81 A;  5I21 A;  3C4S A;  3FDR A;  1IGQ A;  2MPX C;  2DKG A;  4M77 E;  2DYB A;  3ASK A;  3M0U A;  1VQN A;  2FHD A;  2JT4 A;  1TU0 B;  1WIE A;  5J39 A;  1M1G A;  2OX7 A;  2O88 A;  3MEV A;  2CSQ A;  5IN1 A;  1VQL T;  4A4G A;  1Q81 R;  1JB0 E;  1PSF A;  3CCU A;  2M0O A;  4J5Y A;  3GPL A;  1QKW A;  2HBP A;  2X4J A;  5J3B A;  5LJ5 j;  2YRD A;  2BZX A;  4JZ4 A;  4M77 F;  1I5L A;  2X9H A;  4F14 A;  1X01 A;  3WVE B;  1RAI B;  5CKD A;  3M58 A;  2E12 A;  2LP5 A;  4JJC A;  1N9S A;  5CO7 A;  5LJ5 g;  1ZUU A;  1EZZ B;  3MEU A;  2L5Q A;  1WX6 A;  3M0R A;  1R0C B;  1UJ0 A;  2EQJ A;  3SWN C;  4IUT A;  1VQ7 T;  4AFQ C;  4X9D A;  3RMS A;  1AZE A;  2NWM A;  3OYH A;  3QJY A;  4QW2 A;  4M78 A;  1NYF A;  3GNF B;  3JB9 J;  4B9X A;  2L89 A;  3OYJ A;  1FXX A;  1A0N B;  2EQI A;  1R0B G;  5IHN A;  3RKX A;  1Y57 A;  1TTH B;  1C6V X;  1G83 A;  2OAW A;  3G4S T;  3S3M A;  1VQ4 T;  4BDY A;  1VQ8 Q;  3J80 E;  3KFV A;  5KYW A;  2EIF A;  1YIT T;  2COZ A;  1ZBJ A;  4C92 A;  5FWC A;  2FYK A;  2NUZ A;  4MZP A;  4ZTJ A;  3M57 A;  2C0O A;  2LRQ A;  3HFO A;  1OU8 A;  2D8H A;  1VQK Q;  1FWZ A;  1XNI A;  3BE3 A;  3FRN A;  3JCM W;  4PJL A;  2AZS A;  1VQL Q;  5GAN f;  1TUC A;  1Y96 A;  1J3T A;  3OSV A;  2EGA A;  3UAT A;  2AK5 A;  1W2B P;  3F70 A;  2MMP A;  2DXU A;  4JJD A;  4J9E A;  3TEE A;  3CQT A;  3CCE T;  4PJO G;  1VQM A;  3UDC A;  3CCR A;  2V26 A;  5CIU A;  3M56 A;  2ROT A;  1ZSZ B;  1KC8 C;  2DET A;  2NUP A;  2YWW A;  1OI1 A;  2EKO A;  5CAI A;  2O9V A;  1UDL A;  2Y4X A;  2VAS A;  2LJ1 A;  4WCI A;  4M77 B;  5GAM h;  3CC2 T;  5D7U A;  2C06 A;  1C1A A;  4CC4 B;  2DA9 A;  2CP6 A;  1K8A R;  1VQ7 Q;  1PRL C;  1HYO A;  1I0C A;  4GBQ A;  4R55 A;  2EPD A;  2V8J A;  1Q82 C;  2R5M A;  1VQN T;  2YRC A;  4ELZ C;  1QCF A;  2ZPF B;  2LDM A;  4C8Q A;  3QUI A;  3G4S Q;  1VQ4 Q;  2QAS A;  3JB9 F;  2YUO A;  1PG5 B;  3CCU T;  3RBB B;  1YIT Q;  2HAX A;  3M0P A;  2FEI A;  1G3S A;  1JEG A;  2X4X A;  2KY9 A;  3RKW A;  5I2S A;  5A0D A;  3EHR A;  4RMO A;  1KQS P;  1Y7X A;  1VQ9 A;  1WPY A;  2YUQ A;  3C95 A;  2K3B A;  2DRK A;  4HCB A;  2RN8 A;  3M55 A;  4DEX A;  4C92 G;  4E7K A;  1VYV A;  2FL7 A;  2A7Y A;  2D9T A;  2MWP A;  2K5L A;  2OAU A;  4XU3 A;  2LTO A;  4JDS A;  2CT3 A;  2E4H A;  1IHV A;  5LJ5 e;  3FC3 A;  4J9I A;  3CCE Q;  2E5Q A;  3EFO A;  1QQJ A;  3H41 A;  4Y92 A;  1ZSZ C;  4M7D A;  1H64 1;  2K3X A;  1BK2 A;  4PK4 A;  2HEQ A;  2JMC A;  4DQ2 A;  3JCM d;  3PE0 A;  2HKQ B;  5GAO l;  1OOT A;  2XDD A;  2EGE A;  2K9G A;  5AYF A;  2FB7 A;  3CC2 Q;  4M77 C;  3CCM Q;  3PIP A;  1PD1 A;  5GAO q;  4E7I A;  2LX7 A;  2L2P A;  4F7U A;  2AKK A;  2EW3 A;  4BI8 B;  4DEY A;  3QBY A;  3LX7 A;  3L2W A;  1VQN Q;  2JM9 A;  3JCM c;  3RMQ A;  1TXQ A;  1UB4 A;  2DRM A;  1I8F A;  5GAO p;  1YCY A;  2O31 A;  3JAM E;  5IAY A;  3A8M B;  2X3W D;  5GAN 6;  2EAY A;  4J8O A;  3QWX X;  1PNJ A;  2J6K A;  4HVW A;  2K5F A;  4WTO B;  4M77 D;  2ZCF B;  4IUR A;  5GAN 4;  2WAC A;  3FJP A;  4DBQ A;  4ZTF A;  1VQM T;  2IPO B;  1CKB A;  3CCR T;  4KGV B;  2L3R A;  5CVI A;  3L2R A;  5KCH A;  2F1L A;  4EIK A;  3A5Z B;  1OEB A;  2ZPH B;  2RHU A;  1KC8 R;  3X25 B;  1HJD A;  2JS2 A;  3H0I A;  4Z8A A;  5CKH A;  2KVQ G;  5CR2 A;  4N4G A;  3CXC S;  3CCL A;  4CC2 A;  5GAO r;  2JZ2 A;  1M2V A;  1KSW A;  4MML A;  4XTY A;  1M3C A;  4JPB W;  2J6O A;  4M75 D;  1UHC A;  1D1B A;  2DTI A;  4M7D G;  2RA2 A;  1WZO A;  1NYG A;  1M4Z A;  1X2K A;  2ATC B;  3URG A;  1HXD A;  2VUB A;  3OW2 S;  3OYK A;  1MV3 A;  1BBZ A;  3V8J A;  2B86 A;  1NPR A;  1VQ9 T;  4C0D B;  2CZ1 B;  5GAN 8;  2DE0 X;  4F17 A;  4F7U G;  5FRN A;  1P92 A;  3OS1 A;  4A63 B;  2AHJ B;  2MWO A;  1RLQ C;  2RQV A;  3BFM A;  2RI5 A;  1AVZ C;  2MK5 A;  1WHG A;  1IHW A;  4E7L A;  1SRL A;  3E1S A;  1WQ7 A;  1VQM Q;  2YT6 A;  2EQK A;  1PWT A;  1WHM A;  3EG9 A;  2QGF B;  3H6Z A;  3SD4 A;  1GL5 A;  2RO0 A;  3VS7 A;  5ECA A;  4E6R A;  3DB4 A;  3OY9 A;  1B7T A;  2RQT A;  4M7A E;  3OYM A;  2DBM A;  3EG0 A;  1SEM A;  4J9G A;  1SSH A;  5D6X A;  1Y71 A;  2NUT B;  3EGX B;  3SHW A;  3DLL A;  3H9N A;  1GFC A;  3QZ9 B;  4FT2 A;  1Q7Y U;  2WSC E;  4LE9 A;  5DLQ E;  2EQU A;  1WA7 A;  3CCS Q;  2A0F B;  1JBM A;  1GRI A;  2ROL A;  4N4I A;  3QO3 A;  2OJ2 A;  1G2B A;  3MP8 A;  4FM4 B;  4OF1 A;  2KGT A;  1VA7 A;  1QW1 A;  5GAM g;  1M90 C;  4PJN A;  4A4K A;  4PJO E;  4M7A F;  1XJW B;  1W1F A;  3CCV A;  1SF9 A;  1D0Z A;  2OTJ A;  3OYN A;  2SRC A;  4C0D C;  2SEM A;  1M30 A;  3INZ A;  3OYY A;  2E6Z A;  3CPW P;  2DZC A;  3HPW A;  4KBM B;  3CMA A;  1GCQ A;  1RI0 A;  4OB1 B;  2MIO A;  2DEQ A;  5LJ3 j;  4KUL A;  1D3B A;  3PMT A;  3VU3 C;  4OP0 A;  1U8R A;  2MOX A;  4IUV A;  4JRK A;  3TSZ A;  2MCN A;  2YHT A;  3CC7 A;  1QWE A;  1M3A A;  2HSP A;  3ZL7 C;  1AWW A;  2CZ7 B;  1D0Y A;  3CCL T;  4XTZ A;  1U1T A;  4ZGJ B;  2RQR A;  3E9G A;  1H3H A;  4JZ3 A;  2KMT A;  2BZ8 A;  3SEM A;  3G71 A;  1FMV A;  2XID A;  4RTT A;  1BI3 A;  4DBH A;  2XU8 A;  4N0A A;  3QYH B;  2DFU A;  3HRT A;  2R5A A;  4FL6 A;  1MMA A;  2HMA A;  4R0K A;  3NMZ C;  3JCM f;  4C92 E;  2AIR B;  4CI0 C;  2JNG A;  5EG2 A;  2QA4 A;  3GIB A;  4D6W A;  1AHJ B;  1D1A A;  2R57 A;  3GOX A;  2DXC A;  4LDU A;  2DXB A;  1D09 B;  2RMO A;  4D8K A;  3RUX A;  2D8J A;  2QAZ A;  1JU5 C;  2KRN A;  4EMK B;  3VS2 A;  2H8H A;  4C5E A;  4C0G A;  3NTH A;  2CKK A;  3KXT A;  2EYW A;  4Z88 A;  4PL6 A;  2DK3 A;  4M7A B;  5GAN 5;  2QEX A;  1WHK A;  2CRE A;  3MEW A;  3LYI A;  5IXB A;  1QVF P;  2EJG A;  4X1V A;  3LH5 A;  3EFR A;  2E65 A;  1UGS B;  3OMC A;  1TOV A;  5FLX E;  4C5G A;  3OYB A;  2KBT A;  1HSQ A;  3CCL Q;  3FB9 A;  5GAO m;  1JJ2 P;  1EFN A;  1WLP B;  4J6X A;  3WVD B;  3L2Z A;  2LCC A;  1RUW A;  3JCM X;  1V29 B;  2XMF A;  4ZNX A;  4BI3 A;  2EYX A;  4PJO B;  5KYY B;  3H8Z A;  3UA6 A;  5LL6 S;  1XTD A;  1WJS A;  3VS4 A;  3P8D A;  1BYM A;  1E6G A;  1N8R U;  2CSI A;  3PIO A;  1MMN A;  2VVK A;  1QKX A;  3CCV T;  2RI3 A;  2EGC A;  1W2B A;  2OTJ T;  4Y91 A;  1M1F A;  1U3O A;  1R8O B;  1V1C A;  2Y90 A;  1M90 R;  4XTW A;  2DD5 A;  3GLX A;  1UTI A;  4LXC A;  4A4H A;  4XTV A;  2DM1 A;  2KRO A;  3PFS A;  5GAN 2;  2GFU A;  2IIM A;  2JS0 A;  2RB6 A;  5AT1 B;  3CMA T;  1BCM A;  1RLP C;  4EMK C;  4AG2 C;  4HKE A;  1YFN A;  1SG5 A;  5KYX A;  2RHY A;  2K79 A;  4E7Z A;  1GFD A;  4MDW A;  4NS5 A;  3CC7 T;  4LUE A;  2FZC B;  2JN0 A;  3G7Z A;  3TCJ A;  1WJR A;  3MET A;  1JO8 A;  2V8I A;  3A8G B;  4HCK A;  4M7A C;  1JXO A;  2FG0 A;  2YLB A;  2KAF A;  4QQD A;  2P0K A;  2PVG B;  4OMP A;  1PCX A;  5LJ3 e;  4A54 A;  2DJQ A;  1WGS A;  3G71 T;  1QP2 A;  3QG1 A;  2QQA A;  5LJ5 f;  3G6E Q;  2ZPE B;  2HL3 A;  2FVU A;  1OUL A;  2BE9 B;  3E19 A;  4M75 E;  1Q86 U;  4IIO A;  4PFO A;  2QXF A;  1KQS A;  3ME9 A;  2QA4 T;  1WFW A;  2CZ6 B;  5KYU B;  1X43 A;  2P4R A;  3OSS C;  2CH4 W;  3SWN A;  3S3O A;  2O2O A;  5FW9 A;  3NFC A;  4O5V A;  1OU9 A;  4PJO C;  1KK7 A;  4M7A D;  5I11 A;  4AFS C;  3A8L B;  3L1A A;  4AFU C;  3JCM Q;  5IT9 E;  1TUG B;  3CCV Q;  1H8K A;  3HRU A;  4ATO A;  2ZGW A;  2HSE B;  2K3Y A;  5CQX A;  2E3H A;  1ZUY A;  4XU2 A;  2RJE A;  4M75 F;  1YHQ A;  2E41 A;  7AT1 B; 
#chains in the Genus database with same CATH homology
 1VQ9 Q;  1VQ4 Q;  3CCJ Q;  1NJI R;  3CMA Q;  2QEX Q;  3CCR Q;  1W2B P;  1M1K R;  3I55 Q;  1YIT Q;  3G6E Q;  3G71 Q;  3CCS Q;  3CC2 Q;  1Q86 R;  3CCL Q;  1VQ5 Q;  1VQ8 Q;  3CCU Q;  1YIJ Q;  1K8A R;  3CCM Q;  1KD1 R;  1YHQ Q;  3OW2 P;  1YJ9 Q;  1JJ2 P;  1VQ7 Q;  3CD6 Q;  3CCV Q;  1KQS P;  3CCE Q;  1YJW Q;  3CPW P;  3CXC P;  1K9M R;  1YI2 Q;  1KC8 R;  1M90 R;  1Q82 R;  1VQK Q;  2OTJ Q;  3CC4 Q;  3CC7 Q;  3CCQ Q;  1K73 R;  1QVG P;  1S72 Q;  1Q81 R;  1YJN Q;  1VQL Q;  3I56 Q;  1QVF P;  2QA4 Q;  1VQN Q;  1Q7Y R;  1VQP Q;  3CME Q;  2OTL Q;  1VQM Q;  1N8R R;  1VQO Q;  1VQ6 Q;  3G4S Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...