2OTUA

Crystal structure of fv polyglutamine complex
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
115
structure length
115
Chain Sequence
MQLVLTQSSSASFSLGASAKLTCTLSSQHSTYTIEWYQQQPLKPPKYVMELKKDGSHSTGDGIPDRFSGSSSGADRYLSISNIQPEDEAIYICGVGDTIKEQFVYVFGGGTKVTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Implications of the structure of a poly-Gln/anti-poly-Gln complex for disease progression and therapy
rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords Fv light chain variable domain
total genus 28
structure length 115
sequence length 115
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2007-02-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2otuA00
4LHUG 3Q1SL 4Z7NE 4JKPH 1T2QH 3MLUH 5CZVH 1I9JH 3DX8B 4CW1A 4ACPA 2OJZL 1IC5H 3GMOA 4MQXC 4CVZB 4X7SH 1S8DB 1I3RA 2Z35B 1AGFB 2LU7A 4WI6A 5ITBL 3CD4A 3NZHH 5IHBA 5C0CD 1GZPA 3ES6A 5DHYB 1U8JA 4YXKH 4G9FE 3RQ3A 4PGCA 1WCBB 2VDRL 4GLRI 2C1OB 5HPMB 5J13C 2DLEA 1KYOK 1KEGL 4J1UA 4MWFA 3EBAA 3CCHA 4EN3A 4M3JA 4S2SA 4LHQB 4WHTA 3W11D 3RPIB 1WCQA 5I75C 2VLLA 3F7RA 1ORQB 2IBZY 5F7NC 3C60A 3P0VH 2H32A 2OZ4A 4HWEH 3BKML 3IF1B 4KMLB 4XNYH 3H7BB 3V4VH 5I1HH 4PG2A 5I1LA 1MUJA 2VDRH 2R23A 3BN9D 3VMNA 4RNRA 2K1MA 1H3UA 1T83A 4PJGB 5FDWB 5GJTH 3OWEA 2Y4SA 3IDGA 2PO6C 1BECA 1RULH 3D2UA 5GRXG 3WKML 4A6YH 3J8F7 4YHPB 1OQOA 5DMGC 3MC0A 3HI5H 4UUJA 1IAMA 4IOFC 1H8SA 3ZKXB 1N6UA 4P3DB 4YFDB 3S37H 3QXAB 1DQMH 1XT5A 1KCUH 2VDKH 4QOKA 3N1MC 1TVHB 4ZMAT 2H3NB 1CR9L 2NY4C 5DEFA 3WEXB 1KIRB 3WS3A 3SGKC 5T3XH 1HWGB 3MBED 1T83C 1WWCA 5J11B 4I3SL 4X8JA 4OM1L 4JGUA 3I02A 3ARBC 1FVDB 4JRYE 4XNYL 3PWPB 3ARSA 4MAYA 3DMMB 4GKSB 5L9DH 2A6JA 2G9HA 1CBVH 1RHFA 3NA9H 5KG9B 2X1WL 3CLEL 3ZSSA 4NUJB 2HLFD 4GAGL 3FKUS 4I0KA 4XRCB 4FQIL 2XQBL 1PLGH 4QCIB 2A6DA 1LP9F 5T3XL 3SJVA 3LDBC 3FQTB 1DJSA 4L8SB 2BNUB 2CKBH 3MRLA 2UWEB 3CU7A 4OF6A 3FOMB 3GMMB 5C8JB 2PUQT 2ICWJ 1T04B 2Y6SD 2ZCHL 4CADA 2FGWH 1WZMA 1E27A 2OXGA 2CDFB 1XGUB 1JWMB 1CGWA 4IJ3C 2V17L 4HUUB 2C7UA 4IDLA 4XP5L 4NO0D 2AS5M 3IDNB 1QLRB 2OTPA 5EFIB 2HT2C 5CKGA 2E7HA 3LH2L 2CUIA 4OAWB 1YECL 2HN7B 2AJUH 4L5FL 2YD4A 4N1CA 4QRRB 4UI2A 3G5XA 4F7EB 5DR5L 3BPCA 2AK4E 4EBQL 4F7PA 4K9EL 2C3HA 2NY2B 3MFFA 4H8WH 1UT9A 1T7YA 5CP7A 3SDAC 5KVEH 3N1PC 3ARTA 5I30H 4GS7B 3OPZL 1A02N 4ISVA 2AK4B 1BFVL 1CGVA 4KZEL 3OB8A 3QWRD 4GQPH 3MROB 4K23L 1AD0B 4D9RD 4X80L 1YNLL 1RUML 4Q7DA 4XWGL 4ZUVB 1F4AA 3BWAB 3MFGB 4HFWA 3WLWD 3ISWA 3ZDYE 1UEMA 1S9XA 5D96C 4YLQT 3IU4L 5E00B 2BOBB 2D31B 1MJ8H 4FQ1L 5EZLA 3BZ4B 5BV7C 1OP5K 5E56A 2OX5A 1U58B 3KGRA 3RVTC 3S4SG 1XR9A 4W6WB 3C08H 3WFBL 1C7SA 3GBML 4N5UA 1AHWA 3V6OA 4KTDL 2YSSB 4GXUN 1CLZL 5L8LB 3MJ7B 2YBRA 2ZUQB 2XQYG 1A7RH 5CEZD 3QIBC 4RGOH 1II4E 43C9B 3FOLA 3PWPE 1MFEH 5E1AA 2BVQB 3V6OC 4WI7A 3L1OH 2DLFH 5M95B 3DRQB 4XPTH 1CD1B 4JDTH 4NQCD 1KCVL 4KRLB 2YA0A 3A6BL 3QUMH 1CFTB 4ELME 1B90A 2LV4A 1R5WB 1TZIA 1AXSB 2VDMH 2XI9A 3MGTB 3UBXG 5ELIA 1CWVA 3I75A 1YMME 3T8XA 1KPUB 1Y18B 2EEDA 3BP5B 4HWBA 2IQAA 4LF3B 4NN7B 3TBSB 2E6QA 3O8XC 1NCTA 3QYCA 5C0EB 5CAYB 3QEQB 2P5ED 5T1KB 2DICA 1NUGA 3T09A 4M7LL 2C26A 1X9QA 3MRHB 1EEZB 1UJ3A 3KWWA 1U8HA 3FL7A 3NN8A 4OLZH 4BM7A 5KJRH 3PF2A 2FATL 3E6HA 4YBLB 4YEEA 4PJXF 1UB6A 1I8KA 3IFOA 4HC1H 3W5MA 3T77A 4M1GH 2Z93B 4WCYH 5EUOB 3V0VB 1CE1H 3TF7C 1B3JA 1PDKA 2ITDA 4S1QL 4PJ8D 2ADGA 3EOTH 4CL7A 2F53E 3D3VD 3IDXL 1SYSA 3WFEL 1FPTH 4P4RB 4HKBB 4M6NH 1KJ3L 4JDZB 5I1JL 3AC0A 3DBXA 4HDIB 3N06B 3BDBA 3ZYZA 3RGVA 1RJCA 5KSUA 1VPOH 1XR8A 4PBWD 5JHLL 1P2CB 4JGJA 3ARFC 5GRYA 1PZUB 2DYPD 2V7HA 3BP4A 2BSSB 4LFHD 3AS0A 1WFNA 3O45A 1CDYA 2AXHA 4PB9L 5E8NB 2QHRL 5LWYL 1X44A 5I18L 3TBWB 1DLFL 1OAYH 1G7QB 1IGYB 3QQ4B 5FO8A 2BOCB 3I84A 1WFTA 1BAFL 1QSVA 5FK9B 5SX4H 1JN6A 4NRZA 1A2YA 3MR9B 2Z8RA 2AK1L 3HRZA 1KNOA 4LLAA 2BHYA 5K9OB 1FCGA 5KW9L 2AEIT 5K93A 3TIDA 3MACH 2YK1L 5D7JC 1C16B 2AAVA 4P9HC 5INCB 1XIWA 4JAMB 5FXCH 3VWJA 2H2SD 3BP7A 3KPNB 3SE4A 3C6SA 3PWJA 1U42A 3PHSA 5E8DL 3VFOA 3BD4A 1DN0A 1DVFC 1OTSD 4OZFB 3U7YH 5I1IH 3MLPA 5DK0B 5DJAB 4CVXA 1Y6NR 2IANA 4QXUL 4LSUL 4BUGA 5DQDH 1TJHL 4JR9H 3U4EB 3VFMB 4TSBH 2OK0L 1NLDH 4AIZA 3DYOA 3V2AR 2GJZB 3SDAB 3PABA 4KY1L 3ZE1F 2Y5EA 1WT5A 4E5XB 3F58L 1CL7I 1UGNA 4RX4A 1T3FA 5IBLD 4GW4B 3MRNA 3O6MH 5DJ0B 5JPNA 4ZAKC 1G9MH 4UZGA 4XWOD 3GSXA 5B39A 1XR8B 2H8PB 2GW5A 1JPST 1QG3A 2VDPL 1RUKH 2BRRL 3KPRD 4NKDB 3KYOA 1T1YB 5FYLE 4CMMB 4RGNC 5KZCB 3GM8A 2ZUXA 5CJBA 1DTUA 4PIRF 3ZTJG 4Q9CA 4GAGH 2UWEE 2W9EL 4YFLF 3BD3A 2X4RB 2YS4A 4LNRB 4L4JA 4YJZL 5JW3L 1I8IA 2HWZL 4PJHB 2AP2A 2UUDK 5DMYA 3NA4A 4HPOH 3KWWB 4WFFD 4DGIH 1IKNA 4EKXA 4XI5D 3U0WL 1YUHB 2NY1B 4IDJH 2W91A 3PV6B 3MLWL 2OL3H 3ZL4H 4N0UB 3WJLA 1UXWB 1HIML 3P4OA 1HQ4B 3P9LA 4HIIB 1IGTA 3ZZ1A 3ULVH 3RX5A 1HNFA 2VLME 2EYSB 4IHOB 1J1OL 2QLVB 5KVDH 2FWOA 2B0SH 3WFDL 2E27L 4YR6A 3PP3K 1J10A 5MERA 43C9A 1BWMA 3QWOB 1FAIL 4XNMB 3SGDH 4YK4C 5GRZA 5D7SH 2CIKB 1OD9A 1PG7W 4UU9B 4ZSOA 4V1DA 1U8KA 2B4CH 4TRPH 1DBKH 4LVHC 2J5LB 2KZWA 2HAZA 3BIKB 1P1ZB 4PB0L 3QZWA 3UZEA 4K23H 1FO0L 1JPTL 4P46A 1QFWM 4AEEA 4M9OA 1U58A 2WM0A 4JFZL 2H1PL 5I16B 1CT8A 1WUNT 1NDMA 3ARXA 3MBXH 4EDXB 5E9DB 4XTRD 1FVEA 1HCVA 4HIEA 4NJAL 4QRRD 2BOBA 2AEWA 5B38B 4FXLA 5HPOA 5E00A 2EO9A 4C54A 1OP3K 1V3LA 1WBYB 4YHOH 2DD8L 3AUVA 4LLVB 3LRSB 4XP4H 2CJUL 3RWDA 3WUZA 5FDYA 4U1KB 4NQCB 3SY0A 1ADQA 3CFBA 4R4BB 3CPLA 3OG6B 5J6GB 4RZCB 1HDMA 3HZYB 4OCXH 4R0LA 3X13A 3G5VA 3LMJH 3BDXA 4ZG1A 1KJMA 2ARJQ 4LSRH 3K2MC 1FV1B 2ARJB 4ODTL 4LP5A 2CSPA 4U6XB 3QXUA 4QRRA 3NTCH 2HN7A 2XTJE 4LPUA 5CGYD 1S3KL 3GUTB 4CNIB 4PGEA 2HKFH 1QSEB 4DKAA 5IF0B 3V0WH 3VH8B 1E4XL 4QTIH 2JELH 5GS2D 1ZWIA 1AR2A 3RI5F 1AP2A 2IPKB 1XZ0A 1U2CA 4R6UA 3JUZA 4NQDA 3F7YB 4NT6A 2B2XL 2ORBL 5F96L 4MNHB 2A73B 4PJAE 3T0WA 5IW1A 1QLEL 4GAYA 5DS8A 4XPBH 2UWEA 3MRLB 4L8SA 1OAQH 2HVJB 1TVBA 4ZUWB 1V7NL 3P4NB 2EYRA 2VDKL 3FONA 4WDIB 1YN6B 3UTTA 5D1XD 4XBPB 2ATPA 5DHVA 3VFSB 5I15H 4U1JB 4MVBD 3HUJB 3BAEL 2A1WL 1N8ZA 3H0TB 4L4VD 5E5MA 3I3EA 2P5WE 1BD2E 1YEGL 1DBBH 1KB5B 3D3VE 2F15A 4J2XA 4QRPA 1IKFL 5D1ZD 4EOWL 2VSDA 4O58L 2XYCA 1C5DA 1I9IH 4JZJA 1KLFA 2I26N 5CHNB 5CSZA 5DEFB 2AJZB 5EU3A 4F57H 1HZHL 1LDSA 5J1SC 1YEKH 1EIBA 4KJWC 5KAQG 4XCYA 5TE6L 1SEQH 1CGUA 5D93C 4HJJL 4L3EB 3QNXA 4OBSA 3HLAB 5F1NB 3EJZD 2K3TA 3FONB 1LO0H 5SWZA 2EDFA 2DMBA 4DGYH 2DS4A 4HH9A 2B4CL 1MUJB 1LK2B 2VDNL 5I1LB 4JFQB 5IWLC 2YA2A 1GPOH 5D2NA 4M7ZC 4M00A 3ZKND 3QDGB 4DGVH 4GG6F 2PN5A 4Y16A 3UTZA 5EU6A 1B0RA 3SE8H 3PWPD 5FYKH 5BJTB 4LOUC 1CDBA 1P7KA 1HYSC 4X6DE 3LPWA 3HC4L 5TDOA 2VXSL 3ALPA 1YY8A 1LO5A 1CFSA 4RMQA 3BRDA 1L7IL 4ZFOA 3WNPA 1S7RB 2AXGB 5D7LB 2EICA 4FQXB 1RQ5A 5LXGL 4EI5B 3KR3L 2HWZH 3ZE0E 5DEGA 1I3UA 4D0CA 4G42A 3W82A 1NFDF 3HZYA 1DFBL 3WFZA 1YEDA 3P0VL 4HWEL 4AIOA 5F88B 4OCMC 1I7TB 3FFCB 4HUXB 3MCKA 4JRXE 4KHXH 2DOCA 1VFOA 4FMFA 4ZPTB 1YEEL 4NWTH 1GGIH 3FB8A 4HQQL 3VXUD 1X7QA 4LVOC 1M05A 1CDUA 4P3WA 1UM6L 1F11A 5JOFB 1U8IA 4JFXB 2FHCA 4X9IA 1BX2B 3S88H 4GT7A 5DK2A 4PJBF 4NO5A 2V2TB 1YYLH 3S37X 2VYRE 4LDOB 1J11A 4PV9B 1Q0YH 2MFNA 3CFDA 4PRBA 3KYKH 4P23C 1I9JL 3C5ZB 2G5BA 1A6TA 1RZGB 2B39A 3UDWC 4YDVB 2JIXB 5TQ0H 3ZDYF 1FNAA 3VFGL 4XNXH 5E70A 4P2QA 3T4YB 1A0QL 1UWXK 2HMID 2LU3A 3CH1B 4GMSL 5C9JB 3WIHL 3NA9L 1W72B 3RTQD 1NUNB 2DQJH 3ZTNH 3E3QC 2KZ1B 4MA7H 1F4WH 4MJ5B 4J6RL 3NAAH 4LASH 4HUNB 1AJ7L 2F58L 1D5ZB 3T2QA 1MCHA 3HE6A 4JVUA 3SJVD 3ZKNC 1MCNA 4FN0A 5E7BA 3L3IA 3LEYL 3U6RA 4HEME 2A9NL 4OIIL 4PD4K 1S78C 3BP6A 5GISL 5IVZA 3WLBB 4K7PY 2ZP0T 3TJEH 1IM9B 4XXDA 2EIEA 5JZ7D 4LNRA 3DUHA 5C2BL 4KKAD 1DUZA 4XMKH 1LVEA 4X4XA 3HI5L 2VITA 4ZTPL 1G9MC 4QXTA 5C1MB 2R0LL 5HI3C 4P3CH 3V5HA 5GS1C 4NJ9L 1MJJA 5B8CA 4PRNB 1HHGB 3HE7B 1CICB 1WZ1L 3MSPA 5DRWA 5E8OB 4LPVA 5EBWA 5LGKA 3OZ9L 4LDLB 5JOPE 3WDHA 4JRXB 4EXKA 5C0BE 4GW4A 3FQRA 3WYRA 4XPHH 3UX9B 2GCYA 4P5TA 2YD7A 4BFBD 5A2KH 1DBAH 3FHQA 3O6LH 3TCXA 3TFKC 3S96B 3VRJB 1NKOA 3THML 3BSZL 1KN4H 4LAQL 4XNZB 4LSSH 5J9PA 1EHAA 1NGXB 4OTXL 2WBWB 3DUUA 1IC4L 5BO1H 1ITCA 4ODSH 4FFZH 1B0WA 4LCUA 4OLVH 3IDUA 1GH7A 5KS9A 1J8KA 2ADFL 4UBDC 1JHTA 2CKBL 5I1CH 2KPNA 3GIVB 4OB5L 1A6WL 3O2DL 3EIFA 3HRPA 4QLRA 3RVWC 2ZUSA 5FYJD 1MLBB 4G8EB 4I0PC 2F54D 3HAEG 4JAMA 3JV4A 1X4ZA 2NQCA 1TJGH 4BSWA 4BZ1H 1G7JA 1MFEL 3AMKA 3E3QE 1AIFA 2VLJD 1MCKA 1S9VA 4APQA 3QIWB 5F7YC 1KGCE 3O3DA 4TSBL 2ZPKL 3UROR 2E6JA 4UOW1 1KB9K 2ADJB 3ULVD 4GW5B 4CMHB 1EBAA 5B4MC 1FBIL 4NCC2 3FQUA 5F1SA 1MCPH 5IMKA 3ZT6A 3IT8D 2VABA 4ETQA 2IPUK 5DSCA 5E8NA 3JWDL 5JTWA 2B5IB 3DO3A 3RI5K 1RJLB 4UB0H 1CDCA 5F7KC 4IJ3B 4H26B 4PJ5E 2F53D 4OZGA 5IJKA 4I1NB 4JFED 4OUUB 5T3XE 4S1SH 4LLQB 2OQJA 4I5BB 5IG7A 4OTXH 4YC2B 4LVOB 2W60B 4EDWL 1Z9LA 1W0WB 4BH8B 4P4RA 1CVSC 2Q7YB 2NY2C 4MA7L 4RMUA 3MV8A 4U7MA 5CUSL 4Y88A 1MNUH 1C8PA 4LGSB 4MHHI 5J3HD 2F58H 1YZZA 1A9EA 5DLMH 3ROLB 1X6LA 1D9KD 3RWHB 2KBGA 3VXRE 4JPWH 2NYYD 3GSOA 3RGVD 3C5ZC 4OD1H 1YEHH 5IGXH 1T4KB 4N0FB 3B5GA 4Y5VA 3M45A 3BVNA 5T1KA 3L5IA 4DCQA 3O3EB 4RWYL 3FT2A 2Q6WB 4P2OB 3CVHB 2XRAL 3LH2H 4HKXA 3WJJC 4A2LA 3NGBC 1M7IA 1K8IB 2IG2L 1AGCA 2PR4L 4DUWA 3E6FB 3FN3A 4NBZB 4TNWK 4UAOB 1VEMA 5C3TA 5T1KD 2AJVH 4JRXA 1YYLL 4JM2A 4LPXA 2CD0A 3UC0H 1SEBA 2IMMA 3GSNB 4KJQC 2VN7A 4FXKB 3W5NA 1NMAL 3V4UL 4HS8H 1ZS8B 1BGXL 2XNAB 4WEUD 2CMRH 4MB4A 3OKEA 1NBVL 3WO4B 1JF5A 2GFBB 2BFVH 2NZ9D 4EXPX 3W39A 4PTUA 5GGTH 1CS6A 4XVUC 2VITB 1DBAL 2IG2H 3HZMB 4OLXL 1KN4L 4LP4A 3BSZH 3L3OB 3C09C 4JFYA 1XR9B 5IP4A 4JO4L 3IJHA 3FAXA 5ESVA 2ZSWB 5I8EA 2WQRA 1NMBL 5E2TH 3HS0A 3ZDZF 3VFVB 1IL1A 4KK6D 4J3UA 1D5XA 2J4WH 3EFDL 2CK0L 2R56L 1PAMA 4MQSB 4M1CC 4L3CB 4IRJB 5DDHA 2VOTA 4NRYB 1J9CT 2XTJC 4CVUA 2Z91B 5SWQB 3MRPA 2FL5B 3EDEA 1A4KB 1LE5A 2PW2B 2MCPH 4P49A 1A6UH 3ARDB 3WFCH 1TZGL 1JF1A 4NZRH 1U92A 4ISVB 3CH1A 2IH3A 2Q86A 5CJOL 3EYFB 5HHVH 4XNZC 4NN5B 1R24B 2R2EB 4PG2C 1T2JA 3QDJB 4Y8DC 5J13B 1KIQA 5DA4A 4EIGB 5BVPL 1MWAL 5GGUA 4NGHH 5C0RL 5DMIH 4L29B 3FO2B 4WU7B 5MEPB 3LIZH 4KH2A 1UC6A 4R2GB 1KCKA 3G5YA 2GY5A 3IU3A 4OT1H 2IF7A 2X09A 4M4RA 2W0LA 4N0UE 3BFOA 4NQEE 5DRNB 5C6PB 5ISZD 3AS2A 3R06B 4EQ2A 2EYTB 1JWMA 2O26U 2FYYA 2X05A 4HKXB 1IGIH 2XWTA 3CVHA 4QT5A 4N90D 2M1KA 4KI1A 1D5IL 1NBYB 3L3DB 4WNQB 4F58H 1E6OL 2J6EL 1BOGA 1MWAH 4DZ8A 5C0RH 2UY6A 4H8WL 3QQ3B 3VA2C 4PRHB 2V2WA 4JRYD 2HYMA 1F90H 2P8PA 4Z0BL 4RX4D 3SE3A 1AGDA 2D9CA 3QIUD 3O9WC 1OT1A 1ZHBB 1VFUA 3BHBA 1U8NA 1XFPA 2ZUVA 1MVUB 4L3ED 2NY4B 3OKLA 3FT3B 1R5VB 3VMPA 1KSRA 2E9WA 5D70L 4PJXB 2LVEA 4I13B 5D7LA 4PJAF 5D6DC 1PYWB 2AXGA 3QUYA 1E4WH 2GT9A 1RIVH 3NZ8A 4UINL 1QNZH 1A1NB 5BS0A 2MPAL 4TQEH 5C3LD 2V9QA 3PQYE 3F12A 5ETUB 2YD8A 1QEWB 3CZJA 5D9SA 5CLWA 2DTML 2EO1A 2R69H 1CIUA 4QRSA 3BUYA 5EZJB 2VIRA 3OJDA 3RUGB 1N4XH 3VFWA 1J8HD 4KQ3L 5CEYB 3IXAB 5GHWH 3ALWA 1LEKA 1BJ1J 1NCWL 4KJYA 1NCBH 3QXVA 4U7SA 4ZFZA 2NXZC 3QIUC 4KMQA 3QI9D 5E5UB 1OTSC 1RK0A 4I3SH 3DYMA 4HEPG 1E6JL 3MRKA 3Q3GB 3QNZA 1E28A 3DECA 2YMXL 5HD8C 2CLVB 1S5IH 3IXAA 1MFCH 2ZZUT 2JKXA 4BUHA 3RL2B 4APQD 4ZFZB 4YGVA 3BUYB 3SBWC 2APTA 4GBXA 2H2SC 3HR6A 4OSUH 2F8OA 5IB1B 1MI5D 3LMJL 1HQRB 1HEZB 5D7JD 2VXTL 1BBJA 1DE4B 4X4ME 4M5YL 3NGBB 4M43H 4AENA 1A4JA 4RA0C 1T7VA 2R4RL 2C1OA 3RKPA 1WAAF 2ZCKL 2X9WA 3P0GB 2XTLA 3MRBA 3MV9A 4XCFH 1KB5A 2DI9A 5H94B 1FIGL 2P5EA 5SWZD 1R5VA 4GMTH 5LJYH 3JWDC 3D3VA 3VFSA 4GBXC 1RZJH 1QP1A 1U8NB 1EHLH 2DMKA 4Y16D 1RZ7H 5D96B 1WTGT 3PWVB 5JO5A 1WSST 3ZYOA 3MUHL 5DMJB 3PIQB 4Z7WA 3MV7B 2F53B 4ODVL 3D5OF 1FAKT 2V5MA 1IGCH 3Q5TA 4WFEE 2DQDH 2YPVH 5K9KB 2GYSA 1A1MA 3PGCB 4M1CD 2ED9A 2R9HC 4OFYD 3LQZA 4PLKC 1EAPA 4X80H 3G5YB 2FYYB 1XF4B 4MNQB 5EO0A 1ACYL 1WAAA 4K7PX 3D9AL 3IU3B 4MD4A 4U6XA 3ZL4L 3QIBB 4ZOEA 8FABA 4NYLB 2A9ML 4XHJC 4L29A 2UZXB 1OT2A 2X4PA 3UTSA 4YWGL 4Y5XB 5DJZB 4AT6A 3O4LA 4FQIH 1JRHI 2DBLH 1AFVH 3DSFL 1QYGH 3KPTA 4LVEA 4W4NA 3JV0A 4YFEA 1D5ZA 4AG4L 1A5FL 2B1HH 4PYGA 4ZUSA 1OPGH 4HAGA 3MO1B 4LSQL 2J6EA 3NCJL 2J8HA 4ZSOE 1JF1B 2W0FB 4K71B 2IPTL 3UPAA 3ZE0F 4O2FB 2NZIA 5HI3D 5SWQA 2H9GA 1CTOA 5DJZA 3QIBD 4OF7A 1OSPH 3SDYL 4JM4L 1FVEB 1WVZA 3HE6C 5D2NC 3MLSH 3RVUD 1DQJA 1I7ZA 1RVFL 1D5XB 2C9AA 2ZSWA 3TP4A 1IE5A 2DI7A 1BIIA 2AI0L 3KPRE 5ACZA 5JZ7C 3BESR 2MKWA 3QHFL 3O0RL 5AEAA 2EXWC 5T3XD 3LEVL 3PWNB 4Q97A 3F58H 3HZMA 4LSTH 3U9UA 5F93C 4P5MA 1D9KC 4PV9A 3S3JA 4HGWA 1NCDH 5DO2C 4QNPF 3RDTD 3C2AH 4WEBL 5E2VH 4CU7A 4XZUA 1L0YA 4JR9L 5J3HC 4S0TD 4NQEB 2XA8H 3BYTA 4HCRH 1IEHA 5B3NA 4ZTOL 4NZUL 4Y2DD 4LAJH 1I9IL 5HI5D 3PWVA 2F5AH 3GI8L 3VXUA 2A9MH 2N4IA 4N8CL 4WW1B 4NOBA 2XY1A 1G7IA 3QUZC 3LD8C 1SEQL 5BQ7B 4KKBD 2X1PA 3BZFB 2HJFB 4KMTH 4P2OA 4QHKJ 5F88A 4I48A 3WD5L 3ARZA 1M7IB 4N0YH 2XZQH 4FABH 4EQ3A 3I50H 5GGRA 4NPYB 3O3AB 2PO6D 5I9QC 4HJ0C 2A38A 1XCTB 3IDIA 3I2CH 5AD0B 3RWHA 5D7LD 3LEYH 2PW1B 3O6ML 4PGJA 5B4MD 1CLYL 3SGEH 1MI5B 4XCCH 3ZHKA 3AREC 4NKIH 4PB9H 1HWHB 3EO0A 3GHBH 3L5JA 3RWCA 3MV8B 1EA9C 5HYSB 2O5ZL 2IFFL 5C0CE 4MS8C 2WMPA 3OR6B 5ANME 3VU2A 3KYOB 4IDJL 4OD3H 2D7TH 3KHQA 1D5BB 2H8PA 1BPVA 3QNZB 3Q3GA 1J88A 3PGDB 3VD5A 3VXSD 4QRUB 4XP9L 5DEZA 4QRTB 2VMFA 3M1BB 3W0WD 4KI5D 2EE9A 5DJ0A 2FDBP 2HH0H 4LDEB 4JDVB 3NVQA 3AAZA 1T21A 3WO3B 4AL8H 1O7VA 5L2KE 3V0WL 2PF6A 4JCMA 5ETUA 3FQUB 4OIIH 5HGAA 1ZANH 1EO8L 2GTZA 5EN2B 3O3UN 2CPCA 3L3HA 5LGJA 3TH4T 4MZ2A 4J23A 2GT9B 4FFZL 1F6LL 5JIHA 1I85C 5I17B 3PGDA 1DANT 3FT4B 4BSWB 1ZTXH 3C87A 1JYVA 2JJTA 3PWJB 3G08A 2EIBA 4UDTB 2BVPA 3KPSA 5T5NG 4RAUB 4HKJA 2IWGA 4WDIA 5K9OA 2O61A 3QULB 2P8PB 4YHOL 1UA6H 1MQKL 5BZDA 1JFQH 5HHNA 1F58L 1KG0B 3H3PH 3QQ3A 1IGMH 1WC7A 3UO1H 4XPAH 1P4IL 5FV2A 5D72H 1A0QH 3MLZL 4J3SA 3IDIB 1FN4A 2ZOKA 3RPKA 1CL7H 4Y5XC 1NCDL 2VLRD 5GGRB 5IV2B 4OFKA 1ROWA 1HHJB 1UXSB 3ARVA 4L8DB 2V7HB 3VRJA 5DWUL 4G9FB 2I60H 2XQYK 3I3DA 2GCYB 4P5TB 4KRPB 1OTTD 2VRAA 4WU7A 5FM4A 5MEPA 4PJFB 5F8RC 3DSNA 4WGWB 1H3XA 2QL1A 2QTEA 4MVBC 4HIJA 3SDXF 3QZWG 3RGVB 3MLWH 4W6XB 2BSTB 1R24A 2R2EA 1MJJB 3H9SD 5FKAA 5TQ2H 2VXUH 3W9DB 4ELMA 1EO8H 2JJSA 1LE9B 2Y07L 1HDMB 1YEEH 4Q6IA 2ADGB 3V5HB 1NMBH 3WKNA 5D6DA 4JKMA 5GSVB 4QGYA 1GGTA 1I1AC 5I18H 4R4BA 4Z8FL 1NGZA 4XBGA 3GRWA 1TETL 1KCVH 2Q3AA 4P23D 3B6SB 1IM9A 2APXA 2RBLA 2W38A 3CC5B 1L9MA 5J12B 1S7UA 4KRPD 1E4XH 3B2UC 3ET9F 2V5RA 3S34H 1BF2A 3EFFB 3FB6A 5BS0D 3QEQA 4QXGL 1NFDE 1K4CA 1Z9SA 3NCEB 1FYTB 3QG6B 3KXFB 2YR3A 5BMFL 4R97B 5F97E 4WUUE 3N85H 1IM3B 5LXGH 3ULUH 3QUYD 1YDPB 2H9GB 3K4AA 5CBEB 4DW2L 1OTTC 3PHOB 4LLWA 1VACA 5DUPL 3Q5YA 4HH8A 3QSKB 3HKFA 4MJ5A 1U0QA 4HC1L 1RZIB 3VWJC 5IFJA 1QFUL 2FD6H 3OKMB 1PKOA 1MCCA 1P53A 2EDJA 1IC4H 3CSGA 5A43C 5BXFB 5FB8B 2OP4L 3UTSB 5EOCH 1CICC 4Q9QL 1SEBB 1NC4A 2EIDA 2FWOB 3RIAK 1A6TB 1RZGA 1VACB 3IRZA 3QUZD 5I2IB 4F7TB 4IHOA 4LLWB 3C5ZA 1NEZA 2RHEA 2FX9L 4OZHF 4F57L 4EN3C 1FIEA 4D0DB 1IT9H 1L7TH 3KPPB 3LRHA 2ID5A 3KNBA 4RFOL 5HI5C 1XF2B 3DI3B 3FT2B 3BKJL 3PGCA 1A1MB 3O3EA 2ZNXA 1JNNL 4K3JH 3VRLE 4PLJD 3VGGA 2F53A 1ZT1B 3MV7A 4YQXH 1INDH 3B6SA 1GJIA 1JYWA 3RDTC 4IOIB 3JVGC 1M1SA 1NGZB 3LEVH 1L6ZA 4XBGB 3NABH 4JFOB 4K94H 3FFCA 4HUXA 1X4XA 3TT1L 1DR9A 1NCAH 3IRPX 3DVNB 2VDOH 2X4TB 3TJEL 2MCPL 4LEXH 4X5WA 4I0PB 3VG0H 1JI2A 2DM2A 3LQAC 4IOSD 4L4VE 5HYJA 1MHPH 1UM5H 3KPLB 3ZT7A 1CFVL 4LLQA 2VL5A 3IETA 3VCLA 2CRZA 4F7EA 3S3PA 2HFEB 3TBVA 1P6FA 4R7NB 2R0WL 1AI1L 4YGAB 1FNFA 2I9TA 4H26A 4XB7A 3GI9H 4B5EA 3HUJF 4ZFOB 2EH7H 2LQRA 4Z77A 5CP3A 1UXSA 5BJTA 4E5XA 3L5WB 3HPJB 5KVFL 1AFVL 3DSFH 1WTLA 1B0RB 5TDOB 4K94C 4I2XE 4I4WB 2B5IC 1YYMH 1ORSB 3WSQH 2V5YA 5EU6B 3FMGL 2H2PC 2DJSA 3HZVA 4GW5A 3FQTA 5E6YA 4YUEL 3SJVB 1AI1H 2PYEA 3MRKB 1UZ6E 1S9VB 3T3MF 1MHHA 1WF5A 3CXHJ 3T2NH 4XP5H 3IDXH 4EVNA 4RAUA 4P46C 5F1NA 1ZEAL 4Y0GA 3UTTD 2FBJL 4Z7QE 3K3QA 3VW3H 3KPNA 3MXWL 2R9HD 3VI4F 3G08B 3HLAA 2WAHA 4K9EC 5CIPB 1YEFL 5IW6A 4U3CA 2HJKA 1K3ZA 1JGVL 4YUEH 1DZBA 3HRZB 1A6AB 3GMRA 1WFUA 2Z92A 2J8UB 4NFDA 4QXGH 3O2WH 3NH7L 4GFTB 3U36A 3NZ8B 1N2RA 5C86A 1BEYH 4RGOL 1FO0A 2EDTA 1UZ6F 3QUYB 4J4PA 5HGAB 4CJ0A 3HUJA 5KN5B 1AJ7H 3FTGA 1IGIL 1ZGLA 2MCG1 3QFJE 2EDYA 3H0TA 3H9SE 4GBXD 4RCAA 2EYRB 1MRFL 3VA6A 4YHLH 2WBKA 3RWJA 3QDMD 4RNRB 3STBA 3OXRA 1IC7H 5LQBH 4MJ4A 3MCG1 3ZDXF 1AO7E 5AZ2L 2CDEB 1JRHL 4PRNA 5EU5A 4TOYL 3IFNH 1DQLH 1BOGB 4GAYB 4WNQA 1C7TA 2A73A 1AE6L 2IADB 4MSWA 4GXVL 1NQBA 4F2MB 2IPKA 3EO0B 5TF1L 4EUPG 1G0DA 2ZJSH 3G6JF 4OLYL 1OGAD 5DRNA 2BMKA 3X11B 1H8OA 3E6HB 4PGCB 5EH1A 4JFFB 1U3HB 3U6RB 3RX8A 4F7CA 3P9WB 1JNLL 3O3AA 2D7TL 4KUZH 5EC1A 5A16A 5SX5H 4EBQH 2BY3A 1OGAA 3GMPB 3V4VL 2C3VB 4X6DF 3ZLQC 3G5VB 2XOTA 3BZFA 4R0LB 3I75B 4PJ5A 2CRMA 2CRYA 3DVNA 5TJWK 1QBAA 1AXSA 3LS4H 3RWDB 1CFTA 2FEEL 4UIMB 4YHKL 3CFBB 4LLVA 4QNPE 4IOIA 5D6CA 2Z91A 2FX8L 4M03A 5D1QB 2CK2A 5C0AA 3LKSA 4TVPH 2SEBB 5E99H 5EOQH 4L3CA 4JHZA 3TBYB 1ZLVH 4NN5C 3RL1B 4GRLD 2DM7A 5H2BA 4FZEH 5F6HI 3HCVA 4LFHG 1UKSA 2GSGB 2QQNL 3QP3A 4PRBB 5DUBB 3LS4L 4GG8B 1G7HA 2XY2A 5IB3A 1J5OH 5I2IA 1AO7B 3RHWF 5H2BB 4GG8A 4RRPA 3VWKA 1BX2A 3O8XD 5CBAB 4LGRB 1U8IB 3HG1A 3I6KA 1M05B 3NIDF 3OKEB 2BZDA 3D39E 3ROOB 4LLDB 2DB8A 5F3BA 5IFJB 3AY4A 5HVWA 2Y06H 3BI9X 4XVJL 4FQ2L 5D7KE 2A6IB 3FRUB 3ESVF 4ZAKD 2MQCA 4ZTPH 4OLWH 2ED8A 3SCMC 2GQHA 5CJ8A 1YDPA 3QUZA 4G42B 2OBGA 5IFAL 1UXWA 3MNZB 3KXFA 4BA8A 4APQC 4Z78A 1UKTA 4PG9A 4IMKC 4ERSL 1CGSH 3HMXH 5A16B 4JFFA 3GEWB 2BMKB 1WFOA 3ARRA 3OAYH 1BZQK 1YNLH 2X5PA 1XF4A 3TCLA 5J1TC 4P2CG 3S37L 1FE8H 5FUOL 3THMH 3MRQB 1DVFD 3LQZB 5HDQL 2HLAB 2X1OA 1KEML 2LTQB 2IAMD 3OBAA 1FP5A 4Y16B 3T0VA 3CSYA 3MJGX 2CDEA 5EU6E 1QYGL 1IAIM 1GHFL 5F9WC 5IG7B 1LK2A 4ZOAA 1GAFL 2P43B 2X89A 5HYJD 3RWJB 4FFWD 2XT1B 5L2JA 1T3FB 2D7MA 5FV1L 4LNVA 3VMOA 5L88H 2OXHA 4JO3H 3OXRB 3SGDI 1IM9D 4JO4H 3IKKA 4GLRH 1RZFL 1ZT4B 4OLYH 5FA4A 4BZ1L 3F7PC 3RRQA 1Y6MR 2CO6B 2A6JB 4MX7A 5IOPB 5IV2A 3DMMA 3U4EA 2E6PA 1J1PL 1N0LA 4ETQB 2VR5A 4IIQC 1FJ1B 2PCPA 2BFVL 3QUXD 4Y19E 1N2RB 4MJID 2E27H 3BJ91 5JR1H 1C5DB 1FO0B 1MCQA 5E9DD 1EFQA 2AJVL 3RFZC 1RSFA 1U8MA 3IU4H 5E8PA 4HPYH 2Z92B 3O3DB 1KB5L 2R0KH 3QULA 1AIFB 1BBJB 4UV4H 2HJKB 5CZVL 4LCIL 3VFOB 5D2LE 2XKSA 4GBXB 1RFDH 1JHKH 4YGVB 2DLFL 4EVNB 3QPQC 4XXCC 3ARFA 3ECBA 2DN7A 1MHHB 1RMFH 1U8MB 25C8L 2QHLA 4X7TB 2NYYC 4ENEC 1JHTB 1EBPA 4P2OC 3L3HB 4I4WA 4HUWA 1PW3A 4NQDB 1IJ9A 2RR3A 4RDQF 4ZNCD 1FFQA 3BISA 4UDUB 5CEZE 1G7QA 5I1GL 1JF6A 3BP4B 3F12B 2Q76B 3DJ9A 4G6AD 1P7HL 3MOAH 4OF0A 1EMTH 1AE6H 4O02H 5C2UB 3SDDB 3AAZB 4PGEB 4CNIA 2E8ZA 3EDJA 3TBVB 3INUH 3SCMD 4FQCL 5E2JA 4TVPE 3T04D 1FV1A 2ZNWA 4PJDF 3KPLA 3GRWL 3OKDA 2Z31B 1D5BA 3X13B 3IETB 3VCLB 1YN7B 5FYKE 1VFAB 4RZCA 1R0AH 1JVKA 4JDZA 3BHBB 5J6GA 4P46D 4KC3B 4JY4A 3GMOB 1CF8L 5EUOA 3V0VA 4K7PH 1SY6A 2CXKA 5JORB 1QBLL 4OLWL 4BH7B 3U7WL 4YE4H 2BVOA 1I8KB 3RWCB 4OGYH 4F9LA 2Z93A 3ULVC 2H2PD 2HH0L 1ZT1A 5FO9B 3LY6A 2Y5TB 5FM8A 2J5LC 4H0GA 4PJEE 3D0LB 1JZ8A 2NY5H 5ITBH 1KPUA 1E4JA 4KTDH 2R2BB 3HE6B 3TZVA 5C0EA 3TT3L 1F3DH 4I48B 1DL7H 2B4CC 3KNBB 2JJVA 2I5YL 6FABL 3ULVL 1EAJA 4V2CB 3FO2A 3DROB 3GIZL 4IEFB 4LPTA 4FTVD 4V1DB 4E9LA 4PJDA 4LLDA 3CAFA 4DOHB 4WTXA 4O9HL 1V7MH 2ZCHH 4OBRA 4P2QB 3T4YA 3U30C 4UILL 4MJ6A 4PJFF 3WCYA 2YSSA 4YHIA 3PGFH 4FA8A 3MLXL 1IEAB 4M7JL 1ONQB 2G5BB 2X2YA 4IIQA 1AHWB 1OTUC 3PWNA 2O5ZH 4NCC1 5DUBA 5DHXB 1R0AL 4Q9RH 3PHOA 4O4YH 1I3GL 2NTSP 1BIIB 2JIXD 3QR2A 3TNNB 4LRNL 3QEHA 4K2UH 4M61B 3O9WA 5D2LA 3TBYA 3RZCB 3P0YL 1F11B 1FYTD 1C5CL 4MJ2A 4E41A 3EFFA 3FB6B 4HZAA 3CU1A 5D6CB 4PJHA 1MFAL 1YEIH 4O2FA 4KK9C 3IJHB 1Q8MA 4HUVA 4M6OL 1X5AA 3TA3C 4X83A 2AK4A 1WEJL 3EDKA 4LCYA 4JGMA 4NRXA 3O11B 3QEQE 1AD0A 5JORA 5JXED 5CILH 2C3VA 1HXMB 1U3ZA 4HXBL 4Q6IB 3HNTL 2DF3A 3W9DA 4ELMB 4U6TA 4EI5A 4PJFA 2ZWLT 1T66D 1U3HA 2Y36L 3C2SA 4NYLA 4Y4FD 4JM2B 4HIJB 1QLRA 1XGPA 2C7UB 3E6FA 4WHCA 4HUUA 4PJIA 2FHBA 2VO5A 4U6YB 3SBWA 4MNQA 4K2UL 1AC6A 2VC2L 5L7XH 2AVGA 2BHZA 2Q76A 4GAJL 1T04A 5JMRA 3D1MC 2J88H 4PP1C 2GIYA 3QHZH 1JI1A 1RZKH 2ZOKB 4U1SB 5DC0A 3MBEB 1NBVH 4NNPL 5DFWH 5DYOB 1UWGH 4Y2DB 4TSCL 1RZJC 1CXKA 1K2DB 5KG9A 4G9FD 2O61B 2G9HB 3KLDA 4IRSC 4K94L 2XXCB 3DX7A 2HTKC 3QQ9D 4MLIA 2Q7YA 3LKNA 3MXVH 2W60A 1JNJA 2WIMA 3KPSB 1AXTH 1HKLL 3FTGB 1UYWL 4AG4H 4B0MM 3FT4A 4PYHA 5HI4C 1GSMA 1A2YB 3RY4A 4PREA 3SDDC 3TIEB 2J8UA 2GTZB 3MBXL 4KRNA 4MDIB 3EO9L 1A4JB 3D0VB 1EK3A 2FGZA 5EN2A 2YD6A 5FYKD 3T0EC 1WZKA 4QRRE 4S1QH 3R8QA 1HEZA 1YPZF 4MX7B 3QQ9C 5IOPA 3QXAA 3NCBB 4UUJB 4YHYB 2NR6C 3KPMB 5TF0A 2DQHH 1OM3L 1ZTXL 3EYUH 4QRTA 2V7NB 3TLRA 3IFPA 1P2CA 2PYEB 5E2UH 3HNVL 5KSUB 2C5DC 5BVPH 4O02L 2HVJA 2DIBA 4TPRH 5LG1A 5IFAH 1CXHA 3DLQR 4YPGB 2VZ3A 4ERSH 1WT5C 3BDYL 3JVGA 5EWIL 1OSPL 3CSYB 4ZS6D 2RCSL 3SDCD 3SE8L 4WHTB 5EZJA 4S2SB 3F8UB 4PJ9A 3QRFM 3C60B 4NBXB 1ORQA 2WUBL 3RVXD 1X6NA 2PTTB 3MRQA 5GRVL 2YUWA 5GRJL 4TUKL 5K9JH 5KSBA 5C09D 5HHXH 2O5XH 3QRGL 4NP4L 3GB7A 3OGOE 5EIIB 3MRDA 3VXSB 3DUUB 2IAND 2VL5B 2R15A 4RBPH 2NR6D 2DM4A 3TBSA 5FOJA 5J9PB 3O8XA 4PTTA 3NFSL 1BVKB 3CZFA 1A1OB 4R97C 1I3RB 1UADC 3ABZA 5F7LB 1G7PA 4JKLA 3T0ED 3QO1B 4ZYKB 4PJ7F 3VWJD 4U1KA 5TQ2L 2DIAA 1HZHH 2PXYC 4WFGD 5E1AB 4FP8L 1RIVL 4LQFH 1LO3H 3SDDD 5BO1L 1UCBH 5F9OH 1J1PH 5DJ8B 2GUOA 1MFBH 1EX0A 5DD6B 1XF2A 2A77L 1W72H 5CBAA 2XFXA 3CDFA 2HTKD 1AO7A 2B7DT 2NY7L 4UT7H 5KOMC 3S7GA 2EYTA 2EE2A 2EDWA 3R06A 5IB3B 5ACZB 5IUSA 4GKNB 1FRGL 3RBGA 1JBJA 1G7HB 1CN4A 1ND0A 3N85L 5HDOA 1SBSH 5EZLB 1KULA 3QG7L 1DQJB 1I7ZB 4UU9A 2CLZA 1BD2A 2I27N 3OKMA 4GKZB 3EYFA 3VDAA 5D1QA 3EYQC 1TCRB 4IRSA 3WUWB 2JELL 2HT4D 2W0FA 4LLUA 4WEBH 2PW2A 1LE5B 1LP9A 2FO4B 2FL5A 4U3XA 2DLIA 2W65B 4Z5RA 3P4OB 4XP1L 2VNCA 1A7PH 2XACC 1IM3A 4ZUSB 5FYKL 3TWCH 4GKZA 1FYTA 3QG6A 5F7EL 3ZYJA 5JW4M 1SM3L 4DK3A 3BPCB 3TO4C 5CFHA 2DDQH 1U6AH 4TVPL 5E99L 1ZANL 4CDHA 5CEXA 3INUL 1GPOL 2OMNA 3HMWL 3QIBA 2DYPB 8FABB 1Q9KA 2N56A 3RA7L 2X4RA 5C0AE 5I74B 5T5FL 3L3OA 5ISZA 4FABL 2QSTA 4JDTL 3TYGL 1NLDL 1U95A 1G0XA 5DURB 1HI6B 4V1DD 4PTUB 4MSWB 1TQCB 3SHSA 3S6CA 1T5WB 3FB5A 2GUOB 3QEGL 1PY9A 2BNUA 5IB2B 1YEKL 5EIQA 4U33A 3RUGE 2A6DB 5KANI 3MV7D 3GSXB 5DD3H 3CFCH 2OMBA 3PNWA 2IFFH 3EYOA 5HYSG 3HMXA 3ZHLA 1I85A 3QWQB 3SO3C 1BVKA 2P5EB 2CGRH 2Q6WA 3I02B 4HIXH 5A2LH 4DK6A 1RURL 3WIIL 1IKNC 2IFGA 4ODSL 2YN5A 5EIIA 1KIRA 2YXFA 2L0DA 5AZ2H 1KG0A 3GIZH 2ADFH 4J3VA 1A7PL 5IQ7H 5EZIH 3LB6D 3DPBA 4OZFA 1JPGA 5KSBB 2C4FT 4N9OB 3EOAB 3I6GB 2EEBA 2MQ3A 4S0SD 5HSFA 2DQEL 3G5ZA 2F19L 2OL3L 3EO9H 4XMLH 3VXPA 4P48A 5AWNL 4X4ZA 1ZLUK 2VXQH 4OQ1A 1FLRH 2LU4A 4X4MA 1CFVH 1BQLL 2O93L 2BNQA 4N5EC 1LEKB 1JNLH 5FK9A 5GXBB 4NBYB 5FCSH 3H7BA 3HG1E 3DHMA 3SDXE 3MRGB 2JLLA 3DV6B 2APFA 4IMKA 5J8OA 1FRGH 4PRIA 1CFBA 2VABB 1I4FB 3BDYH 3C8KB 3O45B 1JYNA 4ORGA 1PKQE 5CHNA 1H3TA 5F71A 3H42H 4W4OA 1PYWA 3CVHL 5BS0B 3U46B 5D72L 4PJXA 1P4IH 3TIEA 5DRZB 1RAMA 2AJXL 2QEJA 3U79A 4B53A 1AGFA 2FH6A 4J8RB 5I1KL 4OFPA 3U48A 4HLZG 1T7ZA 2ADIA 4I0PA 3UTTB 5E6IC 3RWGB 2NX5A 1MJUH 5DQDL 1BFVH 2X4TA 1MLBA 2NX5D 3N9GL 3NCMA 4G8EA 1MNUL 2UZYB 1FORH 3HNSH 2K7QA 1Z0MA 1BFTA 5MHSE 1Z5LA 4O58H 2R8SL 2PW1A 4Y2DA 2LABA 3D48R 1NBYA 3L3DA 4PRHA 4L4TB 5FGCB 3MBEA 1TDQA 5FHBL 3V52L 4C59B 4U1GC 5CZKA 1XIWC 3ZE2E 1IAKB 2PNDA 4GSDH 1HH9B 1AP2B 1FH5H 1KCSL 1T20A 4H1LH 3KPPA 3SOBH 3S96A 3VDBA 1QSFE 5E2WL 3MOBH 5C0BA 3A6CL 1VKXA 1QSEA 3MPCA 1RZKC 3SKNA 3S88L 5I73C 1T22B 3RX7A 3O2DH 3GUTA 1I9RL 1CD0A 3E2HC 1CU4L 4IRJC 4FHBD 1HILB 5AZEL 2ATKA 5J6HA 3FOLB 2IH3B 4NQEA 5FUZH 7FABH 1QFWH 4XXCA 4M6MH 1EXUB 1EVTC 1OAYL 4TTGA 4PRPD 5F7MC 1MIEH 3SY0B 1CD8A 1JPSH 2VZSA 1J0JA 1QPPA 3EDDA 2DTMH 1AD9B 5L9DL 4K3HA 3MUZ1 1A4KA 4FQHA 4AH2A 3VXMD 4IRJA 2VR4A 1ZHLA 3CFJB 4WU5B 5IROA 2J7LA 4NRYA 4BK5A 4EI6B 5EZIL 5EO9B 1X5ZA 1ZHLB 3CFJA 1DBBL 3ARGC 5IIEA 1F2XK 3WN5A 4L8BB 4M7ZB 3BQUC 4DUVA 1E4KA 3L3KA 4CAGA 4RISH 5KSVA 4IMLA 4P59L 1ZLWH 5DA0B 2LTQC 4FQLH 2YD1A 3W39B 1VERA 2GFBA 4JFHE 5DTFA 2FBOJ 3V6BR 3GSNA 5F9WB 2HG5B 4IRZL 5HGHA 2GJ6B 4MCYB 4NJAH 3N1FC 3NOIA 1AKJA 2AJSL 4QHNA 3X3FL 4OAWA 4EI5C 3SKNB 3GSNH 3HAEB 2XTJD 5B21A 1IGTB 3P9LB 5IK3A 1G6RB 4JFFE 2CIIA 4L8DA 1FL5A 3MYJB 2R0ZH 4N0UA 3EO1B 1TVDA 3RIAF 1P7QB 4W4OC 3TM6A 2VR9A 4LIQH 2IH1A 4N8VB 1FDLH 3ESUF 3BVNB 3RTQA 3CVHH 3QJHA 3D0LA 1T4KA 4M5ZL 5IQ9B 2ERJB 3AS3A 3UPRA 1HHIB 4KDTA 5CJXA 4I18C 3BPOC 3EUUA 5GGSY 2BC4A 4OLVL 5BZDB 1IC5L 4HKJB 4FOMA 3PXHA 4JY4B 3TJHC 4ONFL 2OL3A 2IEPA 4YDJA 1FBIH 4RGMC 3S34L 1FVDA 3E8UL 1RIUL 3VRIA 5BMFH 5AWNH 2HFGH 3TH2T 2VISA 1S7RA 4PGDA 1FLRL 4YHKH 3SDDA 1G6VK 1NGPH 4I3RL 4KK8D 1CFSB 2F5BH 2J4WL 3EFDH 5L6YH 4JANB 2J8UE 1YY8B 3SDAA 2F8VA 1S7WB 4YAQB 5CP3H 3W9EB 3GDBA 3DV6A 3MRGA 2B8OT 1O0VA 3UTZB 2VXVH 2PYFB 2VLKA 2ADJA 1KB5H 2R0KL 4HUWB 4XCCL 4JDVA 1QSFD 5MI0C 1RK0B 3BRFA 5FUZL 4BSJA 2VUYA 1SJEB 1F6FB 2JTDA 1G7JB 5LCVH 2EDHA 4XCNB 3C6SB 3O6LL 1XIWB 5GGVL 5EO1B 5JHDD 5IMMB 4X6FB 1A3RL 5HYSA 4C55A 1U3HC 1M7XA 1WGOA 3FN0L 2BY2A 4QGTA 5C08E 2PXYD 1A1NA 1TJHH 3O4OB 5JNYA 1RUAH 1UACH 3C9NA 1BQLH 4NN7C 3NFSH 4LCUB 1WCBA 1ADQH 5B38G 5DLML 4PFEA 4PJ7E 4QRPB 1GZPB 1MJ7L 1RMFL 2DI8A 1AH1A 4DVRH 4MAYC 1CLZH 4OD1L 4U0RC 5KOVC 4U1JA 4G8FB 3LEXB 2HTLD 2ATPB 1GIGL 4PJ7B 2HJFA 4XBPA 4LCIH 2QADC 5BQ7A 4JHAH 4L4VB 1YN6A 4OCWH 1OD7A 5ECJE 3KLSA 4MJIE 3HI6H 3FQRB 3FJTA 1AKJD 3BMVA 4X5XA 3PP3H 1BIHA 3JWNC 1I9RH 3WFHB 1T5WA 2BVYA 2UV3A 3EGSA 1G0YR 1CR9H 4Y4KD 5E8OA 3SDCC 3F65A 2O5YL 5IFHL 1MLCA 3U9PH 4IOFD 1NCWH 1XZ0B 5GPRA 4OZIA 3CUPA 1HSBB 2R0ZL 5DZOA 1T6WA 3T77B 5ISZB 1XEDA 2P42B 2YUVA 4P5MB 4MA1B 5IF0A 3U9UB 3IDMB 4XXDB 2DQTL 3HZKB 4Z76B 2F5AL 3ILPB 4LSVL 3QDJD 3PE9A 5J56B 4RDQG 4NN6B 1UM4L 3D6GA 5KVEL 1Q72H 4PG9B 4Z78B 1J0YA 1TJIL 3MNZA 1ZOXA 2Z31D 2NY3D 3W11C 4WY7H 1YECH 4K07A 2HT2D 1R5WA 3OMZA 3CPLB 4YH6A 4LLUB 3BOVA 3QXWA 4KKLD 5FA3B 1TNMA 3DRQA 5C9JA 1TCRA 1KBGH 3CFKB 5JXAH 4GG6A 4L4TD 4NKIL 1E0OB 2D7NA 4M7LH 3I6KB 3HG1B 3VFVA 2KL6A 2PETA 3B9VA 3EOYG 3KXFE 5SWSD 3LD8B 1CT8B 4GW1B 4ZS7H 4MD4B 2VE6A 4JE4B 5CJQH 5F1KC 2BNRD 5CEZH 1RPQA 1QBMH 3QEUA 3C5ZD 2WUCH 1UH4A 5I9QB 1P5UA 1I1AD 1EAPB 1F45A 4KRMB 3CVIL 1NEUA 2YN3A 3QI9B 2DD8H 5HXMA 2NXYB 4HPOL 1TMCB 2SEBA 3SE9H 2XNAA 3QG7H 4MD5A 2XA8L 1WICA 4FXKA 5IVXE 4R96B 3S35X 4AEHH 1ZLSL 3NFNA 5GZNC 1QHOA 5F89B 4ZPTA 3QO1A 5HDQH 4HF5L 4J3OC 2GKIA 3NPSC 5DZNA 5JPMB 2HMIC 4TYUA 1KELH 1A1OA 4ZFFA 3WHE1 3RUGF 3NACH 4TUOA 5CP7B 2P5EE 1WBXA 1XMWA 1OGAB 2FX7L 1MFBL 3D3VB 1YEDB 3GMPA 4M6OH 4DWHA 5JXEC 4L9DA 5A2FA 4U1LB 2OSLA 5F7EH 1PEZA 4F7CB 4JVWA 3KDMA 4K3EL 3PG2A 4KTEL 3MLRL 5MENE 5I1HL 3MV9B 1I8IB 5A2JH 3WHE0 5I19L 3BH9B 3ROLA 1IT9L 1L7TL 4RFOH 5GQBA 3WFCL 2PTTA 3TVMD 3C6LA 1XGUA 3LVEA 1GIGH 4XAKD 3MJ9A 4M1DL 2NY3B 3T0EB 1DE4A 1E27B 1IVLA 2FEDD 1HQRA 4CADB 5IB1A 1A5FH 2B1HL 5IHLB 4CMMA 1OAKL 3DOSA 4Y4FA 1OAUL 4HH9B 3QDGA 1J0ZA 1NGYA 3Q0HA 1H9VA 3O4OC 4XAWH 1GC1L 1RV6X 4XH2B 4QOKD 4R26H 1JHKL 4DQOL 5CEYA 4C56A 1NEZG 2XTJB 4PY8I 4MAYB 2VIRB 3OJDB 1A6WH 3RUGA 4KKCC 3UXFA 1NGWB 5J7CC 1U6AL 2ZUQC 5DRXB 3VFMA 5IMKB 3TZVD 1F97A 1TPXC 3B9DA 4E41D 3JUYA 4WUKL 4Z0XB 3RU8L 4N68A 3TFKD 3HC0A 4FP8H 1RZKL 2ZUUA 1RURH 1ZVSB 5A3IC 1H15A 4JZJB 3QIWA 3GMRB 2PYED 1N8ZB 3GKWL 4KZDL 2IAMA 1DN0B 3I50L 5HTSA 4R3SB 3LKNB 5CIPA 5MP6H 3BXNB 3FT3A 3DX7B 2AXJA 4YXHH 1ZHKA 4KHXL 4DKEL 1N5AB 5ID1A 1C16A 1YMHA 2FEDC 3IDGB 3O4LD 1ZHBA 1K2DA 4XCEA 2M2DA 4K3GA 1A7RL 4I8DA 4Q58C 1I9EA 2PXYB 5KS9B 3D25B 1MQ8A 1MI5E 3HZVB 3D18A 2WP3T 3UTTE 4U1SA 5IW3A 3IF1A 4JQVC 1ACYH 4HJ0D 4NN6C 1JGLL 1YEFH 4MNHA 4BFIB 1DCLA 2CGRL 4WWKA 5GGVH 4TNVF 4QT5B 3RPIA 2XWTB 5DVOA 5J12C 3OAZH 2EXYC 4JM2F 4OF3A 4Z77B 3OXSA 5KSAB 4XMPH 5IVOA 2EDXA 4KJPD 4CBPA 1U8OA 4MXWL 5EBWB 3EYUL 2HFEA 1MFCL 1K9TA 3RNQA 2YMXH 3QFJD 3MNWB 4G8IA 5DRWB 1U93A 4W70A 5ESAB 5B8CB 32C2A 1FNGB 5HYJB 3SDXB 1JZ6A 3G9VA 1AHWC 2DM3A 1VFBB 1G1YA 4P2OD 1U92B 4HJJH 1F4WL 4HUVB 1H3VA 3V7AE 3MMEA 1VESA 4O9HH 5JIKA 5IVZB 1KC5L 2X4NB 3WLBA 5J4MA 3KYAA 1FG9C 4WI5A 2AEQH 2R2HB 4OZIE 3LRGA 4KPHL 5E9DA 5DGQA 4OKVA 4PUBL 1J86A 1RZ8A 3BP5A 5DUMH 3HS0B 3VG0L 3UBXB 1HKLH 4NHUB 2Q8AL 3TPUA 5CKAA 3A6OA 5I8EB 3MGTA 1DLFH 3KS0H 5CGYC 3WN5C 3P2TA 5DK3A 3BIKA 4LCWB 1IEAA 3ARED 4F80A 3O6KH 5FEBA 2CO7B 2COQA 1UJ3C 4ZSOB 1J8HE 3QUXC 1CCZA 2CIKA 3DXAE 4NZTL 3D85B 5MERB 5FB8A 4DVBB 3S36L 5IR1A 4YR6B 4KVNH 5BXFA 2MOVA 4G5ZH 3MJ7A 3KJ6H 5F96H 5JHDA 1RZIA 3KXFD 5LAXB 4M7LT 2ICWA 5HGDB 4XPHL 2DQEH 4JO1L 1AGCB 2UY7A 4P5KB 1GVIA 5CBEA 5J1AB 3KPSE 4M48L 1OAZL 4MNQE 3E1F1 3DYPA 1WLHA 4J4PD 2C1PA 2D3VA 2X40A 2Y07H 3SO3B 3S36H 1K4CB 4Y2DC 5FGBA 3PV6A 5AYUH 4TSAH 2IAMC 1D6VH 3IXTA 3SKMB 4MAUH 1BFSA 5FKPB 4AJ0A 1VA9A 4ZUVA 3MV7E 3V8OA 1I7RB 1OGTB 4JREB 5ITFA 1IRAY 2J1KA 4NWUL 3MROA 3BE1H 5C6TH 2BVOB 3TH3T 4BH7A 3NABL 2EXWD 1NBZB 3NPZB 2DQCH 1A64A 1U3JA 4X4YA 1JE6A 3M8OH 1BOYA 2D9QB 5F7WC 3CSBA 1XF3B 5DEGB 1RULL 1ZHNA 2CJUH 5B39B 1YEJH 3UYRH 1H0DA 1E6JH 3JV6A 3LQAL 5JPNB 2QBWA 3DX9A 4KJWD 1OAZH 4OF8A 1LO4H 3C2AL 1MWAA 4NSKA 2FSEA 1IQDB 4UIKH 5GSRA 4OFYA 4JFDE 4UDUA 1REIA 4FTVE 5DSCB 1MJUL 2I24N 4C4KO 2VUOA 1MF2H 4CVXB 3FZUC 1W72L 5GGTL 4LQ1A 4JFQA 1F00I 1T0MA 1WC7B 3GSVB 5C0JA 1A9BA 4U1IB 1KBGL 5HHNB 3OF6A 5E4IA 2VLRE 5EUOE 5GIRB 1G1CA 1HYRC 4HIXL 4HS6B 3LAFA 3C60C 2XZAH 1XF1A 4RGND 4LCCC 1HHHA 3WD5H 5DMKA 3JV4B 3F7QA 4R4FH 4GKSA 2Z4QB 5INCA 2VZUA 2CH8A 5EU7E 3MLZH 5C08D 4YDKL 3V79C 3K4ZA 5I17A 4JG1L 3I6LD 1F4HA 5IBLC 1PFCA 3PQYB 3MR9A 4C56E 4YNYB 5LGJB 3MRFB 1MQKH 2NW3B 4HV8A 2JB5L 1JCKA 5FYLD 3S35H 5FCUL 1FO0H 1JPTH 4U1GB 4Z8FH 1GYAA 3EOBA 1ZAGA 4PJXE 5FA4B 4DN4H 3SE3C 1ZT4A 3MCLL 1U8QB 2AEPL 3TJHD 4ODHL 3TO2B 5EU7C 3V9FA 5DC9B 4NKMB 5I76A 2AJXH 2VXUL 1IZKA 1MAMH 1T21B 2A74B 4N9GB 3AB0B 1TVBB 2A0LD 4WWID 2QQQA 3BGFB 3M1BA 1KXVC 2FLBT 4HDIA 3FQWB 2FX7H 3G6JE 3AGVA 4ODBD 1C08B 4EIZC 3F7YA 4NT6B 3DBXB 2EC8A 5JXEA 2H32B 1B6UA 1T1XB 2R1WB 2VLLB 2IQ9H 3I6LE 4X4XB 1DUZB 5D1QC 2XN9A 5TE6H 5HD8D 4BQBA 2D0FA 2ZG3A 2A0LC 1TITA 2FO1A 4LKXA 4EI5D 3OG4B 2P24A 1BFOA 5AD0A 1UJ3B 1KJMB 1XCTA 4M8QA 1BM3L 1UG9A 5LBSH 4YDKH 1BJMA 1CQKA 4CVZA 4HK0A 1Y18A 4B7IA 4D9LH 5E08L 2VH5H 4M7KL 2EZ0C 2OTWA 3NCYS 1MCIA 2A6IA 3FRUA 4BZYA 3VJ6B 1KJ2H 3IS0X 4UOJA 15C8L 2VN4A 1CXLA 3LRSA 1T0NB 1MPAL 1MVFA 3RIFK 2FX8H 2MKLC 3FO0H 1XGTA 1CGYA 3OF6D 1QD0A 4YO0B 2DKMA 4NQDE 1F02I 4YHML 2JIXA 2R4SL 4FFYH 3B5TA 4M62L 3ULVE 3C60D 4M7KH 5MEND 2OI9B 2C3GA 2E7MA 3CFDB 5D71L 5CGMA 1X5YA 1INQA 1XH3A 3QZWB 5GGSA 1KPVA 2AQ3A 3QH3B 1J1XH 4A6YA 3HCVB 5CJ5A 4NO5B 4P57A 1HINL 3L9RB 2G75B 3CFEB 2J6EH 2B20A 3V6OE 3QWOA 4XNMA 5CINH 4LMQE 1YEHL 3VFNB 5IGXL 3BWAA 5GGRY 2XN9E 2XXMB 3P3YA 5IT2L 5JW5B 4I18B 1RK1B 4NQVB 4NHCH 4U4BA 1KJ3H 1P4BH 1PQZA 4XWOC 4LBEA 1OARH 1KPRA 5J06A 4XC1H 1A6PA 1MH5A 3MCKB 1I7TA 3P4LA 2Y7QA 4MB5A 4M62H 4N90E 4AT6B 2VDNH 5F70A 1KCRL 5D7KD 1OLLA 5B22A 3U83A 4F7PB 3JTSA 1WJ3A 3EYSL 4MQ7A 3NAAL 5EFIA 5IJKC 3G5XB 2PTUA 3RGVC 1S9YB 2VQTA 1EHLL 2BSED 3V0AC 5JOPD 1C12A 2YUXA 4HWBH 3QCTH 5EO0B 3MCLH 4FZ8L 1LO5B 3RKDD 1ZVYA 4F2MA 3VXRB 4RMSA 5HDBE 4JN2B 2X1QA 1BF8A 2N1KA 2EDQA 1NJ9A 1OB1B 1I7UA 2BX5A 2OYPA 3X3FH 2CDFA 3B9KB 1QPXA 2D2OA 1T1YA 1JWUB 3NH7H 4KI5F 4X99A 4KTYA 5EOCL 4Q0XH 5C8JA 2OP4H 3LQMA 1RUAL 1UACL 5HDLA 1TQBB 3U7AA 1VEOA 3HC3L 4WV1C 1UZ8B 5I1AB 3MV9D 1D9KA 5SWZB 4WUUD 1S7TB 4M3KB 3ARWA 1QSED 5IVNA 1N6QH 4IS6A 4PJBA 3VXUE 5EWIH 2OJZH 1DEEB 2NZ9C 2QQNH 3C5JB 4G6JH 4XCYB 2IANB 2FECI 1JRHH 3QXDA 3V95A 3WEXA 2DLHA 5DJAA 3OKOA 1KTKE 3A0OA 4M5ZH 2RJMA 3MRBB 4G6KL 4WO4A 4QOKB 5CLTA 5IM7B 1JWSB 1M6OB 2IPTH 3CDYA 5E6IB 3K81A 3TYFB 4MNGB 4OD2B 4P23A 3HI1A 3GGWA 4KU1A 5DHVB 4TVPD 2GK0B 5CIPH 2X70B 1YJDH 5FDWA 1EEUA 1NC4D 1J7VR 1FZMB 2FZ3A 4PJ8C 2RFXB 2X7LA 1JN6B 3RGHA 2C3XA 3U4AA 2E7CA 4KJYB 1IGYA 4NQSB 1ZKAA 1OVZA 5BZWA 4PJ8A 5D71H 1XAUA 3U0PA 3ALXA 3PL6C 3L5WA 1QKZH 5FGSA 4X9GA 4I9WD 3CCHB 1QEWA 2ESVA 5HPMA 1DN2A 1ES0B 3O4LE 3PXJA 3B2VH 3FB7A 4JO3L 1QVOB 4WI8A 3BEWA 1ZT7A 4YBLC 2D7OA 5K9QI 3R0NA 1S7QA 2X4SA 1U8JB 3ES6B 2Z35A 3KJ4C 3AXLA 4UB0L 5FYJH 1IGML 3L7FB 3OKLB 2L4OA 1K8DA 4Z7UE 1FDLL 3C6LC 4FRWA 1KF9B 2VDML 3LKOB 4JFOA 1MCPL 1AGDB 4NQCA 3VGFA 4KKAC 5C0NC 4K8RL 3DNKA 4EUPB 3O2WL 2V2WB 3NCYP 4H1LA 1EEZA 4NC2B 5B3JF 4MDJB 1TLKA 2V5SA 3WHXB 1RHHA 2RB8A 3TO4D 4OZHB 3P11L 2I07A 3H42L 4LF3A 3OB0H 4EDXA 2P48B 3AM8C 4Y4HA 4LEOB 2FB4L 1DQML 1F4XH 4Y4HD 3QQNA 2HRLA 4HZLB 4P46B 2WLZA 4PV8B 3RVWD 1N64L 2R29L 4PJCA 1QLFA 3DETD 1P1ZA 1T0PB 4Y19B 3IYLW 5DJDB 3RTQC 4Y4KA 2IBZX 4UBDD 4CMHC 1KIQB 4PJIE 3QDJA 3EYQD 2NXZB 2DWEA 5C0AD 4LLYA 4XWGH 1A6VL 4Y1AE 3QIUB 2R8SH 4RA3A 4D0BA 1OCWH 1OAXL 1F8TL 2WBJA 3WIFB 1UENA 5EG6C 3HHRB 5MEOB 3LN4A 2XPGA 2EYSA 5EC2A 4F7MB 1DVFB 2AERT 3MRPB 4HIIA 3RHWK 2F5BL 4XVTL 4UINH 3BKCH 2VDPH 2RGSA 5GS0D 3BZ4A 4JFDD 1ZSDB 2OR9H 2VZTA 3S8WA 4WJ5A 3BW9A 2D31A 2YPKA 3UZQA 3HTLX 4C83B 3I2CL 1LO2L 3U4BL 1MCJA 1QQDB 1FAIH 3ILQD 4X7FC 1IL1B 3UZVB 1NCCH 1AY1L 1GL4B 2Y6SC 4HFWB 5AZEH 4JKPL 3CC5A 5GGQL 3Q1SH 1U91B 1UKQA 1TZGH 1D5MA 2WWMC 4HWZA 3N1QC 4ZAKB 5ICXB 1FGVL 4AYFA 4DKFH 3DX6A 1Q9WA 3SQBA 4BK4A 4NUGL 2HLFC 1I3VA 4L9LA 1LNUA 3IFLH 5FKAB 4ELMF 1JZ2A 4P2QD 1KFAH 4XGZB 5T33L 4OCRL 2ZUTA 1G7MA 4KDTC 2XQBH 2YPLE 2X4QA 4NM4H 2XN9D 1DLHA 3A6BH 4YEFA 1RD6A 5IEKB 1HHJA 5MP6L 1CF8H 4OI7A 5DJCA 2ZKHH 3CNKA 1V3JA 4HG4J 3PABB 1RUPH 3I85A 4HD9A 3O6FA 4WO4D 1FN4B 5EZOH 4AIZB 2D0HA 3DV4B 3VG9B 2WIIA 3IKCB 3MRRB 3CLFH 3WO4C 4KGLA 2EKJA 4I2XA 4RQQB 3JWOL 1FZJB 2LE9A 4Z95H 4JN1H 1XGYH 3ZMRA 4OZHE 3IVKA 3O6FD 4XVSL 1R5IA 4U31A 1ETZA 4HIHB 4UMGA 3VXNA 4JZJC 1CXEA 5TFSH 4JG0H 1K6QH 1AGBA 1KCUL 1MRFH 3G04B 4LAQH 1E4XI 3GM0A 2GITB 3BP7B 2DKUA 2VKWA 2BVPB 3V6ZB 4JPKH 1X5IA 2ICWI 4PGBA 3OPZH 1MCSA 3TIDB 2ICES 2CDGA 1PD6A 3MJ8B 2AQ1A 3P40A 4I5BA 3ULUL 4ALAH 3T2OA 2GTWB 3X3GH 1GCFA 4OUUA 5DD1H 4UV7H 3ZTJH 1KTLA 1A7OL 4Z7UB 3WS3B 1JMXA 1OW0A 2KKQA 4OZGB 4KXZH 1W0YT 5SX5K 1EGJA 2H3NA 25C8H 4Q9BA 1QBML 5HYEA 3UTSE 2LAGB 1EFXD 3ARGA 3L3GA 3MLXH 2H26A 3U1SL 1UWEL 3EDFA 3UAJC 4WFGE 2YK1H 3D2UB 3GMLA 4Y1AA 4PJGA 1RIHL 4HAFA 2UYLB 4ZNEE 3BPLB 3DWTA 2D0GA 1G84A 4JQIL 3LSOB 2WLYA 4APQB 5D70H 2FCBA 3CLFL 1KYOJ 5B8CC 1NFDB 1NLBL 4OCSL 1ED3A 4U6VL 4LOUD 3G6JA 2EDLA 4OCWL 5C0FB 2W9DH 4LSUH 3VXRD 3MLTA 3BPNC 2X4OA 3EJYC 3QUKB 5D1XA 5HHOB 5ILTH 2OK0H 4XVJH 1KIPA 2VLJE 1MI5A 1UB6B 4YQXL 3GIVA 3PUCA 5BW7A 5C0GA 2Q87A 3RZCD 2AJYL 5DHYA 1DBJH 4Y16C 3CXDH 5DT1H 1QSEE 5IJVB 3JBG7 3X14A 3SGJA 2O5XL 3QRGH 2QADD 4QOKE 4P4KD 2W9EH 3HG1D 4M43L 3M17B 4M6NL 1OHQA 3CDGB 4GH7B 5IHZA 3T8XB 4OKDA 5I8CB 1J5OL 3AREB 3NFPB 2DKSA 4P9MH 3HB3D 4RAHA 3T0XA 4WW1A 3EW3B 3AMLA 1TZIB 3MLRH 3VXUB 5L0QC 5DD0L 2L7UA 4PJGF 4ZFGL 4OSUL 2GEEA 4F9PA 2W59A 2GJJA 3MLVL 1CD1A 1ZLWK 1YC7A 5DGRA 3VXOA 1U3HD 1UCBL 5ESQA 3SDYH 1HHGA 3HE7A 5E7FA 1L4IA 4XMPL 1K85A 2P8LA 3OKNA 2YBRB 2B1AL 1LO0L 2E8YA 3BEVA 4PJEA 4P9ML 4JZNB 3G6DH 2LAAA 5TH2A 3QFDB 5E9DE 4E42B 1T6VN 3QI9C 4ODXB 1MCOL 2XKNB 3DURA 1HIMH 1XGRA 4WHYG 3QCUL 3LSOA 1CFQA 1LEGB 1IEBB 3QJFA 3NBNA 1A7NH 3WDIA 3QEQD 2AGJH 4OFVA 1SBSL 4HCRL 4NDMB 4DGIL 4U0QB 3S9DB 3K2UH 5EU4A 3PP4L 5I74C 3UJTH 3NPSB 4HWUA 4M8VA 2LVCA 3L95B 4NO0A 4QYOA 2FJGB 3D69A 1YJDC 2NY6D 3SQOL 1T7WA 3LS5L 5IFHH 1JP5A 2MMXA 5C0DA 2DMCA 1KCRH 1HHKA 2ZUYA 1W72A 5I8KL 5CMAB 1R3LA 4HUMB 4MD0B 2P47B 2X4UB 4Z7UA 3TWCL 2FATH 4JPVL 3KLAA 2WINA 5L8KB 4YDVA 5T1MB 3MRIB 1D5IH 4ZUTA 4F58L 1F4YH 3O9WD 4GAJH 1RZFH 3QHZL 3V6ZA 4HLJA 1JGDA 4HXAL 1LK3L 1BREA 4HJGB 1N5YH 1GOFA 2XA3A 2CXGA 2QR0B 3K8LA 4WW2C 1T1ZA 4NQXB 2V2TA 5ANMB 5K9KA 1R5IB 5EUKA 3GJFH 2FECL 2I9LA 3PP4H 4JFXA 4ZTOH 4LHUA 1S5HA 5JOFA 5JHLH 3FAWA 3MNVA 3MV8E 2X44D 5CSGA 5HHXL 5DMIL 3P77A 3TBTA 1X7QB 5DD5L 2WIIB 1G9NH 3IKCA 5JO5B 8CGTA 4YDLC 5HBBA 1AXTL 3B8YA 1OSZB 4RIRA 4P59H 4M1DH 2PTVA 5IBUB 3SDCA 4WVRA 3LKRB 2UUDH 1UH2A 3RY6C 1RJYA 4LCCB 2JK5A 5JDSA 4G6AC 2EECA 3B4NA 2JCCA 2P49B 4DZBB 3PWPA 2NY5C 2P8MA 5DQJB 5H94A 3P0YH 4ODVH 5DD5H 3AU1B 3ELAT 4FQXA 1EUTA 4X6CE 4QEGA 1F3JB 4NNXB 4ZQKA 2BNRE 2ZCLH 5C7XL 3FO9A 4YBHA 1M71A 4ENED 4MHHG 3Q6FA 1QLEH 2R56H 4AM0B 4WWKC 2DQHL 4FXGB 1CVRA 2GHWB 3W2DH 4P3DA 1P84J 5D5MF 3RVXC 2HT3C 2NY0D 4HX1A 1ZA3B 3EJYD 4YHPA 1DBKL 2XWJB 2OTUB 4QTHA 2CLVA 4LLMB 4WI3A 4ZDHA 2ENSA 5D2NB 3F5WB 1TTGA 4XI5C 3H9HA 4C83A 2YPKB 4YWGH 1BVLB 2APBA 4BSVA 1ZA6A 4M02A 1F2QA 2R4RH 1DUYB 4BYHA 3L3JA 5DR5H 4KV5F 4OFIA 5D7IB 1WAAE 3CFIC 3MUGB 4JM2D 3EAKA 4QRSB 3S4SA 2DWDB 2YWYA 1NCAL 2ESVD 3MRMB 4PUBH 2J3SA 5D7JB 5F7DA 5D9SB 1N6QL 2XZAL 1W0VA 3TV3L 4EN3B 1GXEA 2JJTC 1FLTX 3TC9A 2AJZA 5EU3B 5CSZB 4HKZA 2MWCA 4N0CC 4I9WE 3K8KA 4QHMA 5DJYB 3DGCR 4Y4KB 4ZXBC 5ICZA 1MHEB 1E6OH 5INDB 4NKOA 2HFFA 2BVTA 4MLSA 5SWZE 4LSSL 3LKQB 1LP9E 3MODL 1MVUA 4HT1L 4U2YA 4KROB 2GK2A 1SJHA 1UWEH 3RDTB 5T3ZH 4HHAB 3DX8A 1H5BA 4CW1B 3OL2A 4AK1A 2R1XB 1HSAA 2GI7A 4RAVB 3NTCL 4JQXC 5JQHC 3P4NA 1I75A 2ITCA 4IRSD 3ZHDA 4G3YH 1UVQB 1MRDH 1N0XH 4N1HB 1EVUA 4HBQA 4ZUWA 1PSKL 5FECA 5DS8B 1SY6H 5IBTH 2EEAA 5IW1B 3O6FC 2IALA 4DKDC 5TF1H 3VGBA 4WUKH 3OKKB 3QUXA 1ZLUH 3M8OL 4OZ4B 2W0PA 1DANU 1FH5L 2C3WA 4M93C 4PP2A 5KVDL 2NPLX 3RDTA 4NO2A 4Q2ZB 1KOAA 1WBZB 4E0RB 1K8DB 1N3NB 5BVJB 4FTVB 3AXLB 5DJXB 1ERNA 1XF5B 5LBSL 1BZ9A 5GGUB 1KB9J 1IILE 2KUTA 4TPRL 1G6RH 3F6LA 5FGBC 1KIUA 1ZT7B 2ARJA 4PRHD 2YHGA 1U8LB 4P2RA 1MY7A 2B2XH 2ORBH 3S36X 5L2KB 3MA7B 1MRCH 2EE6A 3BO8B 1TNNA 5C71A 3DRTA 4MAYD 3S4SB 3ARDA 1LDPH 3MV8D 3MGAA 1T5XB 4EZMA 4YBQC 5DVMA 4YXKL 4CRPA 3L3JB 5D2LF 3MTRA 3TA3D 1A6ZA 3RU8H 4PRAB 4AQ1B 4FZEL 2MHAA 3DI2B 1WBYA 1INEL 5A2IH 2XICA 4U1HB 4KVNL 5BOZG 5B38A 4JFFD 4XAKE 1ITBB 4LSPL 5I1CL 1UYWH 1NDMB 4YK4B 4ELKA 5IESL 1JUFB 4OCYL 5ESVB 1H8NA 2UVFA 5DUPH 5H37G 1LQSR 2DAVA 4ODHH 1MEXH 4JFYB 3Q2CA 3FQXB 4LPWA 4Y2OA 1ZGLP 2ARWA 1S7VB 2K9UA 1OTUD 5E03A 1UH3A 2BVUA 1TJIH 2NY0B 3H3KA 4I0CC 4WO4B 1U8KB 2IGFL 3SKOB 2BCKA 3VFUB 1OY3B 1UWGL 5LGHL 1Z3GH 1GHFH 2XWBB 1UB5A 3VD9A 4S1DC 1W8NA 4N8PA 1NAKL 2L7JA 1J1XL 2NW2B 4PJIF 1PJ9A 2F19H 1RJYB 4LCCA 1KLUA 2YXMA 5ID0B 4XMLL 2M8XA 5I66A 3DXAB 1K8IA 2AKRA 1J8HB 5E2VL 2OCFD 3GK8H 4R4NC 3ZKMC 2D7PA 4XNQA 3REWB 5C09B 1QFWL 3NIDE 3KPSD 3O41A 3GSQB 5F6IC 3LQAH 3HR5A 2A83A 1YUHA 5HHVL 1I1CA 3DVFA 2QQKL 3BUTA 4G7VL 5DD0H 1NPUA 1L7IH 3HNTH 3ULSB 5T1DL 2A9NH 2FR4A 5EUKB 4G43B 3ZO0A 4Y1AD 1N64H 3KPRB 3MGOA 1FFNB 4PRHE 2VJXA 2Y72A 1FFOA 2MSPA 1KCSH 1S78D 4HJGA 1I8MB 2FJHB 5FIEA 4JY6B 1CIDA 1W0WA 4BH8A 3UCRA 1MJ7H 1QFPA 4OGXL 3RAJL 3OSKA 3STLA 4DVRL 1MCLA 5BRZA 3Q5OA 4JRYB 3UTQB 4D3CL 1GZQA 3QPXL 4H20L 4KQ4L 3TA3A 1UWXH 4LU5H 3O2VH 1HHKB 3WNMA 4TUJA 1X5HA 3BT2H 3O3BB 3KHOA 4O5LH 4DN3L 1YPZA 4KK5C 1RJLA 3ARUA 3S98A 1P69B 1O7SA 3TNMB 1T80A 4FG6D 1IFHL 4QHUA 5ICYA 4PGZA 4KAQH 4OI8A 4I18A 4RFEA 5I6XC 3PL6B 1PX4A 5JA8B 4DAGH 4K9EH 2EKSB 3HPLA 2MJWA 2XKUA 5LKNA 1Q9OB 2O5YH 4PJHF 4UQ2B 5JXAL 5DK0A 4WENB 4U0RB 4JRXD 2YC1B 3CH8A 1J0KA 3L9RA 1BGXH 3E0GA 3DMMD 4G80A 3ARDC 3LPGA 2DIJA 2QADB 1RUMH 2HVKA 3Q48A 4L9LC 2VLRB 4PRPA 4KHTH 4P2YA 3VFRA 3QFDA 3GMQA 4WUUA 3QPQD 1CDGA 2BSRA 3WE6A 1FG2B 3ZKXC 2EH7L 2RAMA 4CN6A 3O2VL 3NMEA 3CIQA 4YO0A 1GC1H 2YRZA 4LVNC 3TN0C 3OZ9H 5TE7L 4NRZB 2BY1A 3RIFF 1FYHB 5A40E 2BOCA 3VFPB 43CAA 5FO8B 1GAFH 1ADQL 1T0NA 2H6PA 1I1AA 3QQ4A 3GBNL 1NGXA 4F37K 3N1GC 3WNKA 4MXVF 1B0GB 3ARBB 2NLJB 1DQQB 3RWFA 4X7CC 1FL3A 1Y0LA 2BSSA 2DL9A 3V6FB 3D2UD 5SV4A 4ZODA 3DUSA 1BBDL 4XVSH 1PGRB 1A7QL 1FSKB 4MA3B 4LKCA 3VXTA 3GJEB 2XIDA 4TOYH 5M94B 5CSBA 1L6XA 4HUKB 4OI9A 3WUWG 5K33A 4UT9L 1QFHA 1FGNL 1V3KA 4HKBA 4HBCH 4W68A 1Z0NA 4QXTB 1Q94A 2VH5L 2CKBA 2X10A 5FHAL 3GK8L 1KJ2L 5CD5C 3SGEI 3ZE2F 3DTXA 2QSQA 1MY5A 4ZUUA 5I1EL 1JNHB 4RWYH 3T3ME 4EN3D 1Q38A 4WWKD 2Y06L 4WTWA 3HC3H 4XNXL 3B5HA 4X5LA 1ZLSH 1U8HB 3NN8B 4CGTA 5CD3B 3MRHA 3IFLL 3DUSB 1P4LB 2DQUL 5T33H 1QRNA 4KGJA 3MV9E 1QFUH 2IQAB 1OP3H 4G8GA 5FYJU 4YHZL 5D4QA 2HRPH 3VGAB 3D39A 1HXYA 3OGCA 4OLUH 3T1FA 3WFBH 2A77H 3QNYA 2BNQD 5E8EA 5TDNB 1G7LB 4OCYH 4PJ9C 2EH8H 4GAFB 5FYLL 3OAUL 5JLZB 1Q0XH 2BVQA 5EOQL 1EHNA 1BQHB 5HJ3A 2KH2B 3PWLA 3QUYC 1U9KA 5F44A 4NQED 1LD9A 1QSZA 5A1AA 4U1NB 3WS6C 5D1XC 1FG2A 4Q74A 1N59A 1MCRA 5C0IA 5BV7B 4ZNEA 1AQDA 3EHBD 1IFHH 4XC1L 4DN4L 5IEHA 1XCQB 3IAGC 3M07A 1O5DT 1NAMA 3QUML 2VC2H 5L7XL 2R1YB 3VE0B 4X6EB 5DK2B 5D2NE 1NGQH 3IGAA 2DBJA 4D94A 5H35A 1OWWA 5F72S 2HFGL 3GSVA 4UQ2A 3KR3H 1T0MB 5TGBB 4PP1D 4ALAL 1IQWL 4M6ML 3MRJB 1H5BC 4S1RL 4P4KB 3FB8B 1A7OH 2W9LA 4WGVB 3GKZA 3P9MB 2G60H 4KHTL 1OP9A 3BGMA 3B9AA 5CILL 1LWRA 3D9AH 4X0KA 4TVSa 1DBML 4YHMH 2BNRB 1DL7L 3QDJE 3SQOH 1CE1L 3DXAD 4MXQC 1T2XA 3U9PL 4YHZH 1T7XA 1QACA 3GHEH 3MFFB 4D0CB 5HHQB 3K74B 4PJBE 3SEPA 4H0IA 3LV3B 1H0DB 3HAEH 3IFNL 5HY9A 1T89C 3HE7C 2EH8L 4DTGH 4NOFA 1FZKA 1LILA 5IHUL 4NQDD 1FZOB 4D9LL 5E08H 5ICXA 2A2QT 2VDLH 5F1OB 12E8L 1JPFA 2CLRA 3WXWL 1P7KB 3VGHA 5KS9E 3BGMB 1OP5H 5LVEA 1NGPL 4I3RH 1RZJL 5EPMA 1K3IA 5D1QD 3GMNA 4NM4L 3PWUB 3MX0A 4OZFH 3FOMA 1J18A 3GMMA 3VFGH 3TPKA 4DTGL 2YWZA 2AJYH 3U2SB 1JGVH 4QCIA 1DQDL 3BPLC 4XRCA 3T08A 3OJVC 2BXZA 1YY9D 3WIHA 3MXVL 2DLTA 4NIKB 1NMAH 5FHAH 3KG5A 4U2ZA 2OR8A 1I1RA 5MEOA 3QNXB 4L3EA 3OKYA 3DVGB 5IESH 4AEFA 3BIAX 3C08L 1LEIA 4MJIB 3GFUA 2FH8A 2E9JA 3JXAA 3VFUA 2ILLA 2ESVE 5IR1B 1NCCL 2PO6B 3V5KA 1Q9LA 3RZCC 5IKCA 3T1WA 2VLKE 5E2TL 2VXQL 4JHAL 4KI5C 1KXTB 1TVHA 4POZD 5E5MB 4ZOCA 1NANH 2NY6C 4MXVE 1X5LA 3BZDA 1OPGL 5KSAC 3BZEA 5BOPA 1K4DA 4G3YL 1HXYB 1MCWM 4LSQH 4LEOA 1CG9A 2Q3ZA 1B4JL 1QR1B 5SWSA 4JJ5B 4BFEA 1RZ8B 1OAXH 3SPVA 1CLYH 1P4LA 2YA1A 4FFVD 3BH8B 2R23B 1DDHB 1IGFH 1ULVA 4ONHB <