2OTUA

Crystal structure of fv polyglutamine complex
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
115
structure length
115
Chain Sequence
MQLVLTQSSSASFSLGASAKLTCTLSSQHSTYTIEWYQQQPLKPPKYVMELKKDGSHSTGDGIPDRFSGSSSGADRYLSISNIQPEDEAIYICGVGDTIKEQFVYVFGGGTKVTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Fv light chain variable domain
publication title Implications of the structure of a poly-Gln/anti-poly-Gln complex for disease progression and therapy
rcsb
source organism Mus musculus
total genus 28
structure length 115
sequence length 115
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2007-02-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2otuA00
4GKNB 4MMXC 4OLYL 4ZFZA 2DIJA 2LU4A 2Y6SC 4IJ3C 4S11A 4KUZL 1NAKH 2Z9TA 1XF3A 3EJYD 1P1ZB 1BGXH 4PGEB 4K07A 3OAYK 4J3OC 1LEKA 4NNPH 3QJHA 1NFDE 4P5KB 3ZDYF 1HDMB 1MCHA 1D7FA 3K74B 1JF5A 2DQHH 4XI5C 1JTTA 4LKXA 4KK5D 4Y88A 4WI5A 3TBTA 4L4VA 1CCZA 3OKMB 4PJ7F 2OP4L 4OV6F 3UPRA 2B8OT 4Y5XA 4FXKB 5F7WC 3MNZA 1G9EA 1YMMB 1NCCL 5EDXA 4NC0B 4JPKL 5D2LB 3MXWH 5JQ6H 4JGMA 3VXMD 1GGUA 2ARJA 1D9KD 1RZFH 4NKDB 5HGDA 1MJ8L 4YR6A 3DOSA 3KXFA 2VL5A 3O2DA 5JOEA 2Y9RT 2F19H 1S9XA 2GAZA 3JV6A 3D6GA 1FVDB 2R29L 4U6YA 4R7NA 1O5DT 3U7YH 5HD8C 2W9DH 3ARBD 4PRBB 1N64L 4Z0BH 1QKZH 4W6XB 3RUGA 5GGSA 2DQEL 1YJDH 3ESUF 4PTUB 4H8WL 4Y4KD 1HWHB 3T0EA 5FO7B 3K2UL 1F90H 1M71A 4I3RL 4NJAL 1NGZA 2EDTA 4P5MB 1ACZA 2IEPA 1CBVL 5FYLD 5D1XC 4IEFB 3IJSA 4KKLC 4HS6A 4JKWA 5DQ9A 3D85B 3TVMA 4AENA 1MFCL 4UDUB 5IW3A 2CK0H 5IJKA 5F9DC 3GDBA 3KPRD 5DVKA 3ULVH 3ZHDA 2NLJB 1MJJA 2X89D 5HHQB 1X9QA 4MNGE 2X41A 3JTSA 4ONHB 1MUJB 5FM5O 5T1DH 3MYZA 4DGVL 3LQAL 1QRNB 3BGMB 4G8EB 2H9GB 3EDJA 1VESA 3L7FA 4QHUB 5AYUH 3QQ4B 3MV8A 1KENH 4GSDL 1MF2H 1N6QH 3PJSA 5FO9B 4QHKJ 4YC2B 1IEBA 5I18H 2H41A 4N90E 4QRRA 2ICCA 5H37G 2D3VA 5T5NG 5GS0H 4F7MB 2UYLB 1P4IL 5DK0A 4MAUH 2YEZA 4N8VA 5EUKA 1IT9L 2BK8A 2BOCA 1BEYL 1UVQB 1I8MA 4HUXB 4Y4HD 4NO0A 3GSNB 4ZO9A 1T1ZB 4JFDB 4OF3A 1TVHB 1OAZH 1UB5A 2DI8A 3G04A 4F33A 3GI8H 4NIKB 3VWJB 3K4DA 4O51A 2ZP0T 4ZMAT 5CHNA 3W39A 5FIEA 3MRKB 3QXAA 1YY8A 4JAMA 1BAFH 4PP2A 5ESVA 4P23B 2J6EL 1OGAA 3U0TB 5DVMA 3C8KA 5D7JD 4OUUA 1ZVYA 4X7DC 4JFEA 4TTDD 1J1OL 1NBYA 2XACC 4BKLB 4NHUA 4KMTL 4OFPA 2BCKB 1KOAA 5FK9B 3LCYA 3C60C 4P46B 1KTLA 4GLRI 4YPJA 2NCMA 3BWUC 2YWZA 2EC8A 1A4JB 5IEKA 5EIQA 2HT3D 1KB5H 4PUBL 4GW1B 4MJ6A 1BGXL 1YUHB 2XA3A 2V9QA 4ZPTA 3GMPB 2BXYA 4G8FB 1JPFA 3ILQD 4PS4H 5ACMA 4YHPA 1VDGA 4WDIA 4F37F 4Y5YB 3I9GL 5BW7C 2YPKA 3Q5YA 3QA3A 5SWZE 1G7QA 3VFPB 3TLRA 1YEDB 4YIQA 5D7IA 2PTUA 3H9SE 1VGKB 1KIPA 3O0RH 2PW2B 4JRYD 5IVXE 4RZCA 2YZ1A 3EJZC 4P9MH 3MRHB 3W5MA 3RBSA 4EDWL 1H0DB 5F1IB 4LPYA 1JPST 4OIIL 2F58H 2PF6A 4OF6A 3S88H 3T0XA 3GMRB 4WUKL 4IDLA 1KPRB 3MGOA 5F9OH 2Z92A 5GRUH 4ZAKD 5F3BB 5E6IB 1BQSA 1A3RH 1FYTB 4DCQB 5KS9E 2LQRA 1U8HA 3HZVB 4HIEB 3O6LH 4ENED 1KIRB 1A6ZB 3IAGC 2EH7H 2JELL 1F4YH 3S9DB 4PRIE 4D0DA 5I73C 1XF2A 4JGUA 3C6SA 4C57C 1UWXK 3FB8A 3LKOA 5JOFA 2BOBB 4TUJA 3LN9A 1OL0A 1RHHA 3VRLF 1ZHNB 3BQUD 4JM2F 4PRPB 5BV7C 4OLEA 1MWAL 2BVEA 1BREA 1B0RB 4KWUA 1QBAA 5D71H 2A74B 4DN4L 1W0WB 4P3CL 2P8MA 5BRZE 5DZNA 1KJMB 1RUMH 4NFDA 3UYPA 5ETUA 1A64A 3GHBL 5IBLD 4NKIL 1WSST 3G9VA 4Z7NF 1DDHA 4ZFOA 3WS6A 3ARGA 3RL2A 4XVTL 5AYUL 4X7CC 3VD3A 1LK3H 3QXDA 5CD3A 1YC8A 3WUZA 1KCLA 2VYRE 2E27L 1MF2L 3ZTNL 1NC2B 1HXMA 3PWPA 2F74B 3EYUH 1FO0A 3EDEA 4ODBD 1OW0C 1KIQB 2PO6C 4F58H 5E0QA 1L7TL 1NGWB 3TJHD 4EUPG 5JHDB 1CIUA 1MRCH 3NTCL 2BFVL 1L0QA 4PJXB 3PDOA 4JZOB 1RJYA 3MV7A 3MRJB 3OKYA 3D0VB 2RFXA 5C0ND 4OD1L 3CCHA 5IUSA 4XP9L 5EBLA 1I85A 2AQ3A 4LLQA 3GI8L 2HJKA 3EYSH 3FQNB 3W0WD 3PIQB 4HF5H 1A2YB 1QFHA 1BAFL 4R4FH 2P5WB 1SM3L 4FFYH 4I18B 3SDDB 1OT2A 2WQ8A 4U1IA 4DJMA 1G9NC 1LNUB 1NUDA 5HVHB 4M7KL 4UT7H 1U3YA 2A1WL 3RX8A 1P53A 4QNPE 3D39D 3BKCH 5D1XB 4LCYA 5DEFA 3SKJH 1JPSL 2V2WA 3RY5A 5C09E 3BVNB 1G6RA 3TPUB 4EN3D 2Z35A 3S4SA 1RJZA 4TUOB 2VWEE 5J9PA 3LB6C 4MA3B 1QBML 2GK2A 4JFFA 3RY4A 4TSCL 3L5WB 4PS4L 2ICEA 1P7QA 1LVEA 1TJGL 4J4PA 5GZOC 5GZNC 5CCKH 4AH2B 5INDA 4PJAA 3RWEB 5HJ3B 2AV7B 2NXYC 5I1HH 2L7JA 4ZUUB 4YXHH 2IFFH 1HHGA 1BD2A 2CLZA 4UMGA 1LK2A 1Z9SA 3V4UL 2GI7A 3QEQA 4PGZA 2J8UA 4XP1L 1KCUL 3O0RL 5DQJB 1VADB 4K7PL 1HNGA 4HK3N 7FABH 4M6ML 1HHHB 4O58H 3QWRD 4R3SB 1RMFL 4FQLH 3SGEH 3OXRB 1CGXA 1KPVB 1I1YB 1H3UA 1CD9B 4ZTOL 5DMKA 5FOJA 2F58L 4Z0XB 4UU9A 3R8BB 4LLDB 4APQC 4Y8AA 1V8HA 1WZ1L 4XP6L 4ISVA 3GB7A 1HINH 3FL7A 3QG7L 5DMJB 3VFSB 1RZ8B 2Z31C 3VDAA 1IC4H 5K9JH 2HT4D 3O41A 2ZSWA 4JPVH 1AKJB 1JGEB 4HDIB 1FVCB 1J1XH 4QHLB 3S3PA 5H94A 3OR7A 2IWGA 4MQXC 4U3HA 1E4JA 4JN1H 1X6LA 3MLTA 1F4YL 4R2GD 5D7LD 2AJUL 1PX3A 4Q97A 4LARH 5KSUA 5TPWL 2DQTH 4WWKC 2A6JA 2KPNA 3VXRA 3CDGB 4HBCH 5BS0A 4X8JA 3PXJA 4MQ7B 3U4EB 4BQ6A 4KMQA 2PUQT 3QFJB 5D71L 5T3ZH 3Q6FA 1T1YB 4HPYL 3TESA 2VLKA 5JIHA 2R1WA 3C09B 4JFYB 1RUML 1U58B 3UTTB 1XZ0B 2VXQH 2D7QA 1AD9A 3L3DA 3UZEA 1TVBB 4U1JA 3KR3L 5DJAA 1MQ8A 1BOGB 1AXTL 4X99B 5BMFH 2C3XA 3MRDB 5HYSB 3DNKA 4PJ9C 3QZWG 1D5MB 3VWKB 4WV1A 4BUGA 1CGVA 3ZLQC 4LPCA 1XH3B 4OZFG 1EAPA 3TT3H 3ARFD 3AS3A 4HIIB 4XPGH 4N0UA 1IC5H 2EH8L 3FB5B 4KJPC 1CT8B 3QDAA 1GGCH 1KFAH 2WIMA 5GSRB 2ESVD 2H26A 4XXCA 5HPMB 1EAJA 3MLWL 2B39A 4KJWC 1BIIB 4GW4A 1P84K 3VXTA 2ATPA 4X6DA 2XTLA 4XRCA 3IU3B 1J0IA 4XMLL 2APVA 3D3VE 5KSAA 4D0CB 1FGNH 1KB5B 3CLFH 4U33A 1AQKH 5IBUG 5C0CD 3RU8H 4A6YL 1N3NB 2GK0B 3NA9H 1OB1B 4X0KB 4LPXA 3C5JB 1QVOB 1UZ8B 4NN6C 3SE8L 3HAEA 4XWOD 3HI1B 4FFYL 1FDLH 1WBXA 5FF6A 4XTRD 5I1JL 2BNRA 3IDNB 1A1OA 1BHGA 5FYKH 1CE6A 5IHUL 4GXUM 4XX1G 1YEIL 5I30H 1NGPH 1P7KA 1KNOB 3Q5TA 3CPLB 3UBXB 2A83A 4FQPA 1J87A 2HTKC 4PJGA 1JWUA 5E24E 2Q76B 2X1XR 1EVTC 3RWCB 3F58L 5ISZB 1ETZA 1I3UA 5GGUA 4MJ5A 4YBLC 4JLRA 4QHMB 2IAMC 4HUUA 4U2YA 2XZCL 1HHIA 5D8JL 1BFOA 5J1TC 3V0VA 4GW5B 3B5TA 2NY1B 3RKDC 1ZSDB 2VXSL 3E8UL 5IMMB 1AGFA 5CZXC 1XEDA 1T03H 5DMYA 1PG7X 1JNNL 1NDGB 1YZZA 3U82B 2NW3B 1RULH 3R0NA 1PSKL 3GBMH 2IPTH 3LIZL 1HHJB 5EZOL 4NQSA 4L4VD 3MMEA 3INUH 7FABL 4L8BB 1HHKA 4NO5B 3U83A 4OKVA 1TJIH 3MLUH 3GHEL 3QQ9D 4HLZH 3KYMA 3QCVH 3LKPB 2FGWH 1NEZA 3B3IA 5DJDB 5ID1B 4GKNA 5ICYB 2NY7H 2C4XA 4NNYB 4LSRH 2IF7A 5AZEH 3EOAB 1P1ZA 3B4NA 2J1KA 3UAJD 1N4XL 2AK4B 4RX4A 4PGEA 3KXFD 1IC4L 4P5KA 2Y72A 4L5FH 5IHBA 1HDMA 4OGYL 3TIEA 4PJEB 3ZKNC 4QTIL 1T2JA 3NIFE 1F13A 5DUBB 1T21B 3O3DB 1QEWB 1S78C 3OKMA 3MRNB 3BUYB 2ZUYA 3DUUB 1JF1A 3UZVB 2BX5A 4FQ1H 4FXKA 4LARL 5CEYB 1YMMA 4U6HB 3T0ED 3QDJE 3ARVA 5DA4A 1R3HB 3RHWF 3RA7L 5HYJE 4ZXBD 3I50H 4NKDA 4YBQC 2QSVA 3QQ3A 2P43B 3TVMD 1OTSD 4FQXD 3HE7D 2J88H 3OQ3B 1F4XH 1LO2L 1AR1D 3O81A 2VXQL 1N0XH 2E7HA 2IH1B 4UQ3B 1CGSH 4FNLL 4K8RH 4UIMB 2NXYB 1II4E 4PRBA 1A7RH 2Y06L 1P69B 4Z7VE 1FBIL 4UNTA 4QGYA 1DSFH 5GJTH 1RJLB 2EEBA 5IFAL 4KKBD 3LZFL 4HWNA 2FEEI 4KQ4L 3S98A 2AVGA 5FO7A 4I0PD 5F9WC 1VFUA 12E8H 4Q0XL 4P5MA 5IWLA 5F7HA 1IC5L 3I2CL 2NY6C 1MY7A 2RIKA 3VU2A 1NH6A 4QRRD 3ELAT 1MCIA 2X05A 1XIWC 1U8LB 2OJEB 3KYNA 3D85A 2BNQB 2NY4B 3L3IB 1R24B 4CW1B 1VEPA 1TZGH 4LSUH 1FZOB 2DKUA 1RUPH 3O9WD 5E4IA 4ODTL 1ZVHA 5DD1H 5IROC 1U92B 1QNZH 5LGJB 3CU1A 1FGNL 2FHFA 1BQUA 2DLEA 4IRJB 5HHQA 5BVJA 1KEML 1KBGH 4ONHA 1MUJA 4H88H 5AAMA 3EYFB 3KJ4B 1QRNA 4G8EA 3DSFH 5DHVB 2H9GA 5KVGH 3FZUD 4AEEA 3G5ZA 5KSBE 3KPOB 2HVJA 4PBWD 4ZS6D 1MAKA 1IC7H 3IDYB 4ZSOB 4KRLB 3QQ4A 4ODVH 3GMNB 5FYKL 1EMTH 5EOQL 4PLJD 5FO9A 3CZJA 2R2EB 3W9DB 1FNEA 2WUBH 4H25B 2XY1A 3MV9B 3EO0B 2QKIB 1CDCA 2HFFB 2LV4A 4HXBL 3ZKSD 1GH7A 5A43C 4F7MA 2UYLA 4KI5C 4Y2DB 3R06B 4YDLC 4FFZH 1BF2A 1LP9F 3HCVB 1REIA 5BO1H 1UVQA 4I13B 3P2TA 3H3KA 4HUXA 3U30B 1L0YA 2CR6A 3RTQB 1FH5H 1T1ZA 5T1MB 3PABB 4PJFE 4HKBB 1TVHA 2OTWB 4ELME 1FNFA 3RWFB 4LU5H 4GBXD 4E42B 3VWJA 5J56B 2XFXA 4P23A 3U0TA 5F6HJ 5FM4A 4BQ9A 1RULL 1A7QL 1HSBB 4X6CB 3P30H 5IJVB 1UJ3C 1NKRA 3LPGA 1JUFB 3VGAB 3ZTJH 1QZ1A 1NFKA 1IFHH 4AY0A 5FK9A 4Q2ZB 1CTOA 1RU9L 1RV6X 1G9MH 3MLUL 5CJQH 2FGWL 1RUKL 2KZWA 4CVUA 5IMLA 1JRHL 3TH2T 5E94B 1A4JA 4JVWA 4RIRB 4LSRL 2VDPH 5L7XL 4O4YH 1AD0A 4GW1A 4ZOEA 3TH4T 1HCFX 4E0RA 3GMPA 4G8FA 4IS6B 4L5FL 5IIEA 5ILTL 1U6AL 2NW2B 4LLMA 4YHLL 1EUTA 3LKRB 5IFJB 2Z4QB 4DGYL 3ZKQD 1T89A 5DVLA 5B8CB 4PJBB 1KLFA 4Y5VC 5I1GH 2QQLH 1Q72L 4WI6A 5E2TL 5C2BL 1YEDA 3FCTB 3RPKA 3WLBB 3HI6H 1JZ6A 3IXTB 5I71C 3EOYG 3MRHA 3ARUA 5AWNH 1H0DA 1T0PB 4BELD 4IRSD 2HMIC 1T5XB 3DVNB 1FP5A 4M03A 2P8PB 4C4KT 5CEZD 3GMRA 2PYEA 3TN0A 1UZ6E 4N9OB 1CTNA 1BQLL 3MOAH 4HWBH 1EPFA 3MOQA 3PNWA 1F4XL 5F3BA 1AGDB 5E6IA 2CR3A 1FYTA 1JP5A 2QJDA 4EKXA 1MAMH 3HZVA 4HIEA 2IBGA 1J05B 1KIRA 3CZFB 4FRWA 5D2LF 1J8HE 2LTQB 3HS0B 3BE1L 4ELKB 5F7EH 4D8PB 3CMOH 3V4PH 3MX0A 1TVDA 2W92A 5IBTH 2CLRB 4TSBH 12E8L 5C7XL 1ZHNA 4PRPA 4Y19D 1A6WL 1B0RA 5AZ2L 2A74A 4ORZC 2AK1L 3U2SB 3RIFF 1W0WA 1RUPL 4F9PC 1KJMA 5DD1L 3MV7D 3IDIB 3X12B 2Z8WC 4RDQF 4EIZC 5EU3B 5C0BD 4XPTH 1KBGL 3L3JB 3NFPA 2ADFH 1YMHB 4AEIL 5F97E 1EEZB 4KC3B 1ZTXH 4S1QL 2Y5TB 1NC2A 1MREH 4PJHB 2F74A 5JIPA 2J6EA 1NCWH 2WUBL 4H0GA 2CDEB 1RFDL 4KI1A 4FQCH 2I26N 1KIQA 2I9LB 1RURL 1NGWA 3TWCH 4L4TB 5I66B 4G6JL 5I15H 1KYOJ 4PJXA 4XNXL 4JZOA 5LQBL 3MRJA 3D0VA 5E56A 1FH5L 2OMNA 1OP5H 3JBG7 5IESH 5MERB 1NBQA 4JVUA 3S35X 2VABB 4JFFD 2W0LA 4LU5L 4BH7B 5E99L 3WSQL 1T7VA 4JDVA 4KJQC 4U6VH 3FQNA 3LQZB 3IU4L 1XF5B 4NZUH 2K7QA 4Z78B 2P5WA 4I18A 1QQDB 3SDDA 4FG6C 4JG1H 1LNUA 1P9MA 3ARWA 2VQUA 2R2HB 5JXEA 2AJZA 2FZ3B 4XVJH 1N5YH 5AUMB 3Q1SH 3O3EB 2JF1A 1IFHL 3QEQD 4OI8A 2DICA 4JKMA 5F88B 1NFDB 1G9ML 1P6FA 5KOMC 4Y4FB 5CJQL 3O4LE 4QXUH 5TE7L 4JPWL 3BVNA 4XBEH 3TPUA 2JIXB 4WU7B 2VDPL 1GPOH 4O4YL 4P2RB 4Y16B 3TPKA 2MKWA 3TH3T 4J3UA 4MA3A 2XN9E 3F62A 2E7LC 1XGYH 3L5WA 3WJLC 2HFEB 1Q9KB 5ENWB 5HJ3A 5GGRY 1A0QL 2AV7A 2DYPD 4AYFA 4ZUUA 4J1UB 1TXKA 1OAQL 4U05A 4X5XB 3MRBB 4OBRA 1OP3H 2DQJL 2V5SA 4GLRH 4L3EB 1VEOA 3NOIA 2NY3C 3G5XB 5HXMA 1JZ8A 1HHHA 1WBZB 4WI2A 2N56A 3HC3L 3LEXB 4MAYC 4R3SA 3TC9A 3GSRA 3C9NB 5AWNL 3OXRA 1KPVA 5I2IB 1I1YA 1EBAA 4GG6F 2ADGA 1A7PH 4BQCA 4OCNC 4PRHE 4CBPA 3VXRD 3HB3D 3PWJB 3QIWC 4YDLB 3BW9B 4ZNEA 1EV2E 2R9HD 4LLDA 2R2CA 1JI2A 3UTOA 1IVLA 4JO1H 3MOAL 2EDFA 4WNQA 1U8MA 2EYSB 4KKCC 3BIKB 1BWWA 3VH8B 4P9HC 4XX1E 4HDIA 2V7NA 3TIDB 2UVFA 3L1OL 1YEFL 4QHLA 2JCCB 2BY0A 3ULSA 1XR8B 3UYRH 4Q9BA 4UB0H 5L2KE 1CFTB 3VI4E 1S5HB 4KTDH 4MA1C 2QHRH 2IQAB 4YHKL 3BDYH 3CVHH 3RZCB 3RVWD 4JQVC 4OI9A 5ADOL 1KLUB 2BDNL 1VFBB 1EHXA 4MQ7A 2X7LB 3W0WE 1ZKAA 3QFJA 1T1YA 4LGSB 4S1SL 3THMH 5DEZA 3VGDA 3BRFA 5KG9A 4U1GB 4JFYA 1U58A 3UTTA 1ZA6B 1XZ0A 2H8PB 1B4JH 3AM8A 4MLSA 3D39E 1LGVA 1TVBA 5IOPB 2I5YH 1OTTC 4JHAH 5CAYB 1ADQL 1U8NB 1BOGA 4X99A 2NXZD 3MRDA 2WBKA 5HYSA 3ARDC 2ADFL 3PV7A 3C8DA 5ADPH 4PY7A 3VWKA 1E4XI 2BVQA 3NABH 1D6VL 1ZTXL 4M00A 1MREL 3VA2C 1E4WL 2BNRD 4UINL 2HFTA 3H3PL 1NCWL 5JW4R 2VDRH 4HIIA 4DGIH 1U3HC 3FB5A 4ORGA 3GBNL 1CT8A 3VD7A 1A5FH 2OYPA 3GSVA 5EORH 1TQBB 5A3ID 5GSRA 1YNTB 1CFBA 3TWCL 4DZBB 5FGBC 4HX1B 2YD7A 3DSNA 3A0OA 5I76A 4EDXB 2WLZA 4HFUH 4HUMB 3IU3A 3KPTA 4TUKH 3FT2B 8FABA 4D0CA 5FGCE 1T04B 1SYSB 3DARA 1FG2B 1E6OL 1N3NA 1PQZB 2GK0A 2EDDA 4X0KA 3C5JA 1QVOA 1UZ8A 2N7AA 3KLHD 3HI1A 5FFLA 1I7UA 3IDNA 5BZDB 4OCYH 4LSQL 4KROD 1B6DA 4PG2A 4PJXF 4XVJL 1CQKA 1I1RA 3DX6B 4P48A 4LDLB 3WBDA 1KNOA 1MJ7L 2B0SH 2ORBL 4O5LH 4X9FA 3CPLA 3UBXA 4PBVC 5ESQB 4RMQA 1CLZL 1DVFC 1WUNT 3HMXL 5I16B 1VFAB 2JB5L 5J0BA 2AI0L 4HC1H 3PWVA 3TNMB 1MFAL 5F8QC 5ISZA 5KAQF 3OPZL 3D9AL 1CD1B 3JWDC 5SWZB 4CKVX 4RGNC 1MHPL 5D7LE 5SWSA 1GPOL 4QHMA 1XGYL 3OAYH 3VRJA 1ZSDA 5IVXB 5E4EC 4WHCA 3MLSL 5IMMA 2P42B 3QUYB 3NPSC 4OFYA 1L0XA 4ZG1A 1OPGH 1CL7I 5DO2D 4MCZA 1HHJA 1A3LL 4NZRH 2NTSP 4XCCL 1FIGH 5GISH 3LKPA 1FRGH 2EDWA 5DJDA 5BZWB 3PG2A 3TBWB 5ICYA 5J89A 2B4CH 3MRFB 3MBXH 3EOAA 4LNVA 2EDJA 1R5VA 3RGVB 3U0PB 4LHJB 2AK4A 2V9TA 1MFDL 3HE6B 4MCYB 3A6CH 4FQHB 5I9QC 3EBAA 4PJEA 4I3GA 3TO4D 2O61B 2BXZA 1DP0A 5DUBA 4E41D 1T21A 2EZ0C 4NSKB 1ZANL 4OZ4B 3O3DA 2HKFL 1QEWA 1S7VB 3MRNA 3DUUA 2JTDA 4N0CC 1KEGH 3QIUB 1EGJH 3LRSB 5CEYA 4FQ2H 2IALA 4U6HA 5EH1A 2KBGA 4JHWL 2EDLA 1HEZB 2ZG1A 3IXAB 2DQCL 1NCUA 2QBWA 3ROLB 3W9EB 4G6AD 1I1FB 3CVIH 3MUHL 1B4JL 5HBBA 2GJZB 2IH1A 4PJ5B 4UQ3A 5HSFA 1K6QL 4UIMA 5HHXL 2I5YL 3NZHL 1N8ZB 4JHAL 1HIMH 4LBEB 5ADPL 2WMPA 5IHZB 1RJLA 1FV1B 1DFBL 1A8JH 4A6YA 3BAEH 5K9QI 3SDXF 1EEQA 2FJHB 1FZKA 3QFDB 2YPLB 1J0JA 4C56B 2VDRL 3K1KC 5JR1H 5IHLB 3PGDA 2JJSA 4GAYB 2XWTB 2KDGA 3U9UB 2QADB 1U8LA 2OJEA 4NHCH 3PHOA 4I3SL 2BNQA 1WWAX 3L3IA 1R24A 3WHE0 2GY5A 3SDCB 2APTA 1FZOA 1U92A 3WJJC 5LGJA 4H20H 1XGUB 4ZQKA 4IRJA 3MLXH 4S1DC 2APFA 4G6FD 2R56H 3QNYB 4M6NL 1N59B 4M43H 3EYFA 2LE9A 3WIIL 2GJ6D 1J8KA 5GGTL 2V17L 4LHUG 2CRZA 3KPOA 2HVKB 4QRSB 4ZSOA 4I77H 1RQ5A 2QQKL 5C09B 3ILPB 5DJXB 2FBJL 4K9EC 5B39G 4JZJB 2B0SL 2R2EA 3QIBA 3W9DA 3VXPB 1HKFA 3EO0A 3MV9A 5HHME 2HFFA 4XP4H 3U36A 4XBGB 4HC1L 2FR4B 4Y2DA 3R06A 2EICA 4OZIF 3DETC 3HCVA 4FOMA 3TZVB 2YKLH 5HDBF 5JTWA 3RTQA 3OZ9L 5T1MA 4DEPC 1AQDB 1S5IL 1MRDH 2OTWA 5JHLH 4Q9CA 3LN4A 3RWFA 1XF4A 1UM5H 4HKZB 4E42A 3PP4H 1UACH 3B9KB 3K8KA 3ARDB 4HAFA 1WAAA 1A7OH 4NQCD 1F4AA 5EG6C 4HH9B 2VDNH 2VLMD 3U0WL 3KHQA 4X6CA 1H3TA 5IJVA 5I75C 1JUFA 4LCCB 4KZEL 1YY9D 3H9HB 4LIQE 1C5BH 4HV8B 1LO3H 3VW3L 1FIGL 1OSPH 2ICWI 2XPGB 5FUZH 3CVHB 5LJYH 1PG7H 1PLGH 1ZS8B 3LHPL 3QXVA 4RIRA 3S34H 4WI8A 5CZVH 1T7YA 3QUMH 3QB7C 2PYED 4LLYB 1DQQB 3TN0D 2HWZH 3FB6B 5DQDH 1GRWA 2AJXH 1Q1JL 4IS6A 5D1QC 1BOYA 2IH3B 3A6CL 2NTFB 2NW2A 5E6ID 3K80A 1QSEB 3LKRA 1KIUA 5IFJA 4LP4A 2Z4QA 1XGQB 5I0DA 3L5XH 1OOAA 5B8CA 3TV3H 1AGBA 2P7TB 3FCTA 5CILL 3WLBA 2X4PB 1D5ZB 3MR9A 5L0QC 4KK5C 1L4IA 1KEGL 1EGJL 5H35B 4DZ8B 1OARL 1SJVA 3IXTA 4U1MB 3LEVH 1UWXH 1HKLH 4U7MA 5CS7A 3NGBB 2EEDA 1CR9L 1T5XA 4U0RB 3DVNA 3BGFB 1L7IH 2P8PA 1KN2L 5D5ME 1JYVA 1I7RB 4N5UA 1QTYT 1Z3GH 3D0LB 1D9KC 5ANMB 1BJ1H 1AGDA 4WFGD 3BKYH 1J05A 3CZFA 2XQYK 3NPSB 1I9IH 3HZKB 3ZDXE 1VGEH 4XMKL 4XVSL 2Y1VA 4ELKA 3B9AA 1M05B 2Q8BL 1NBZB 3L3KB 4D8PA 4FFVD 5DR5H 2UZIL 3HHRB 4U1SB 5GS1C 2CLRA 1NC2D 4Y4KC 1K9TA 3D3VB 2VLJA 5E9DD 2P5EB 3L3GB 4HHAB 1RZKC 4KVNH 3M1BB 1T6WA 4UZGA 5A1AA 5CJBA 5B4MC 4FQIH 4W6WB 5CBEB 3ZE1F 3IDIA 3X12A 3AREB 3RWDB 5KVEL 1QYGH 4K94C 3MLXL 2GW5A 2VN4A 3L3JA 4R6UA 4WUUD 1YMHA 5C0AD 5C08E 2XQYG 3IDGA 3QHZH 4MD4B 4I77L 1RZ7L 4JFQB 4B7LA 2DS4A 3SDDD 2Y5TA 2B20A 2XNAB 3FQWB 4PJHA 5KANG 5BV7L 3T77B 3RWGB 1WC7B 4YEEA 4LAQH 2CDEA 3FQXB 5KTEH 4XNMA 2XY2A 2I9LA 4WW2B 3KPMA 3FO0H 1HI6B 4L4TA 5CP7B 3SBWA 1UYWH 2BRRL 2YUVA 3DHJA 5I1CL 4U31A 1QFWI 3G6JE 1NFIB 5FXCH 1ITBB 2VABA 3T3MF 1J1PL 4CMHC 4YH6A 3TCLB 5TJWK 4MX7B 1UACL 2R0ZH 4QRTA 2Z8SA 1E6JL 3LQZA 1XF5A 5L2JB 4Y89A 4Z5RB 5K59E 3FN3A 3IKKA 5EA0H 4Z78A 5CEZE 1QFOA 1H3PL 2R2HA 1FZMB 2FZ3A 5AUMA 3RVXD 1JZ5A 3KPPB 5HVWA 3IFNL 2CIKB 3Q0HA 1NFDA 2XQBH 3VI3F 3QHFL 5FUZL 4G9DA 1A14H 4NCC2 2GQHA 1DBBH 1PLGL 3D48R 2EKJA 4LOUD 3RWJB 1WAAF 4X9GA 5HHOB 4V1DD 4YQXH 2CQVA 5C6TH 5CZVL 2JIXA 4WU7A 3QUML 5E5MB 4P2RA 4HD9A 2DLFH 2HWZL 3LV3A 2MKLC 5DQDL 1R5IB 1JGLH 3WIHL 4KPHL 5L8LB 3JTTB 1Q9KA 2VDMH 5D70L 5ENWA 3SGKC 4Z18A 1FFNA 2WBJA 3I6LD 2D0GA 3PP3K 4LCWD 4Y19E 1G9NL 1B6UA 4CU7A 4OUOA 4G7VL 4JFOB 4J1UA 4RGNE 5HYJB 3L7EB 4X5XA 3MRBA 4XAWL 4HQQL 3CSPA 1UKTA 4HJ0D 3SO3C 4XNYH 1X5ZA 2HLFD 5HI3D 1Y0LB 4RA3A 4L3EA 4OZFH 4PGJA 3WUWB 4YK4C 4F2MB 3QI9D 4OJFL 1T20A 1WBZA 1N6VA 5ALBL 1UEMA 3LEXA 4XMPH 2OTUB 5C0BE 2BVOA 3C9NA 4FXLA 1EJ6A 3SCMC 4ZO7A 2I25N 1S7SA 3WFCL 1FSKB 4HPOH 3BZFA 2BNUB 1A1MB 4DTGL 3VG9B 3WLWD 5T33L 4KRPC 5F9JB 3HNSH 4PJBF 4CGTA 2EE3A 1PFCA 1T83C 1A9BB 3HI5H 1I1AB 3QH3B 2QL1A 3BKJH 4LLWB 1JFQH 4RFEB 1TMCB 3KPLB 3BIKA 3VH8A 2JE8A 1WICA 3TIDA 1MSPA 4ZAKC 3NMEA 1XR8A 2R23B 2C3WA 3QO0B 4R0LC 2H2PC 1CFTA 3HZYB 1S5HA 3GKWH 1CVRA 4JRXE 4LSVH 4XP5L 1BJ8A 4NQTA 4J3XA 2IQAA 4PJCB 2ZCLL 1ERNA 3RZCA 4OM0H 5D2NE 4Z7UE 1RZJH 2KKQA 4FHBD 4AT6A 1KLUA 2F54B 4AG4H 1CGTA 3X3FH 2X7LA 5FV1L 4MNGA 3F7YB 5LG1A 2C4FT 3I6KB 4LEXL 2WLYA 2DD8H 2K1MA 5C2UB 4XCNB 3H2WA 4PBXA 1PVHA 5DS8A 3U48A 4FQIL 5KSBB 5CSBA 5EUOE 1ZA6A 2HH0H 2H8PA 3KDMA 3WFBL 4JCLA 1KCKA 3SGJC 1WIUA 2HRLA 5IOPA 1FAIH 3H9ZA 1GCFA 1C5CH 1QUNA 1U8NA 1WFTA 2DRUA 2FEEL 5GSVB 4ODXA 5IBLC 4YWGH 3ZE0E 4D0BA 1QA9B 4JDTH 3BZEB 2CGRL 1YQVH 5J7CC 3V6OC 1T7ZA 2C1PA 1CDIA 1C5DB 4LK4A 2A9MH 4LAQL 2HP4A 2XZAL 1BPVA 1CWVA 4ELMB 4M6AA 2OZ4L 1QBBA 1YNTA 3P11L 2QLVB 4HX1A 4G43B 3KWWB 1OQOA 3VXMB 2DIAA 4EDXA 3EGSB 3TJHC 3QT2A 3U79A 4IHOA 5SWSD 4RMSA 3V5DA 4K23H 1T04A 3QDGD 3QUMB 1SYSA 3QUXB 2R0ZL 1FG2A 1PQZA 3O3BB 4HFWB 4OZGB 4TYUA 1T0NB 3E6HB 3DX8B 4JM2D 4KY1L 5EA0L 3ARBB 2D7TH 3E3QE 5DJ0B 4GRWF 1VCAA 4G6ML 4TTGA 4OFYD 4HWZB 3P0YL 5J3HC 4BYHA 4C55A 3OKKB 3DX6A 4PLNC 1CXFA 2H32H 5IR1B 1ZT4B 5ESQA 1VFAA 1S7QB 4HUWA 3TNMA 1CD1A 1FZJA 1BECA 5SWZA 2VDOH 4QOKD 4JKKA 3LRGA 4M4PA 2DLFL 3PQYD 1NAMH 1D5BB 3RIAF 2L7UA 1JGLL 9CGTA 3VE0A 3IKCB 5GGQH 2AK4D 2FJFB 2VXUL 1NJ9B 2V6HA 2VDML 4HWBA 3B9EA 2R0LL 3CFIC 4OLXH 5IVXA 4P5TD 2WP3T 3QUYA 2XIDA 2CPCA 1NMAL 1HH9A 2I27N 4ONGH 5DRNB 3DUHA 2OJZH 5FYKU 1NSNL 2PYFB 4OGAD 4LMQI 3U7WH 5D6DC 1NCBL 3VMOA 3VXUD 3PXHA 2YMXH 3JWOC 1KCSH 3G6DL 4S2SA 1GC1H 4F9LA 3KJ6L 5KS9A 1X5GA 4JQXA 2DDQL 4YLQT 5KANI 1KSRA 3K46A 1RUAH 5SWQB 1CDUA 5IGXH 1IGIL 2Z91A 3MRFA 4UTBL 3FQRB 4D9QD 3ZE2F 5BOPA 5JW3H 4YX2H 3U0PA 3RGVA 3OKEB 3BKJL 2P4AB 5ICXA 2E6QA 4Y4HB 3MBEC 3HE6A 4MCYA 2ZCHL 5F1SA 4FQHA 5FUCE 1N5AB 4OZ4A 4F7EB 1H3XA 1UH3A 4KI5F 4YHYC 5GS2H 5LGKA 3S8WA 3IT8D 4TOYH 1NANI 1S7VA 1BQHB 2O5YL 4N5ED 4XC3H 1ADQA 1U2HA 1JGDB 1WFUA 3LRSA 5D7JB 1CICD 5IM7B 5C8JA 5J06A 3MA9L 1RZJL 3S3SA 5BRZA 3BPNC 3ME0A 1EHLH 1IEAB 4NYLB 1HEZA 2X9WA 2AXHA 2B2XH 2JCCF 4K3EL 1GC1C 3ROLA 3QWOB 4X4ME 5FHAL 2A0LC 4DFIA 2CK2A 5MEQB 5HGHB 2M26A 4CVWA 2HH0L 4KKAD 2GHWB 3UC0L 2GJZA 4PJ5A 2IGFH 3ZDZF 3RY6A 5JQHC 1C5CL 1X5JA 4LBEA 4Q74A 4YWGL 5CBAA 1FLRH 1ACYH 1FV1A 3P4MB 4X7TB 4IRZH 5E5RB 3CXDL 2ZPKL 5H2BB 2FJHA 3SDAD 3QFDA 2VZTA 1F5WA 3RVVD 2PXYC 4C56A 1YDPB 2A9ML 2VZ3A 4N1EA 2VZOA 3QIBD 4GAYA 2XWTA 3ARFC 1VB9A 5D6CB 3GJFK 5CP3H 4MDIB 3U9UA 2F9BT 3I6GA 1FL5B 1U91B 3HC4L 5DUML 3LRHA 3FN9A 3SDCA 4OF8A 3T3PF 5LGHH 35C8H 5K93A 2AEPH 3OKDA 1XGUA 2C5DC 3NCEB 4WCYL 2J8HA 4ZODA 3REWA 1UG9A 1PGRB 4ZAKB 5C0EB 1EVUA 1N59A 4M61B 3IETB 1E4XH 5DF0A 4NM4H 5I74C 2OK0H 5FOBB 1YQ2A 2G9HB 3GNMH 2HVKA 3NPZB 3R0MA 4QRSA 5DWUL 3CFDB 4KQ3H 5C09A 5I1EL 1AXSA 4LSPH 4XWOC 2O5ZL 4P2YA 5DJXA 2Q87A 4LRIA 1OHQA 4AEHL 3S35L 3VXPA 2HLAB 4BA8A 2HTLC 4Z7WE 5TGBB 2F15A 5IEHB 3VGHA 2YPVH 2YUXA 3C6LC 5F7LB 3UTSD 4OZFB 2CKBL 4XBGA 4E41E 2FR4A 3BQUB 5CIPH 5FHBH 5JIKA 1R3JB 2F8OA 4WI9A 1TZIB 4MXVE 3TZVA 4YUEH 2GIYA 2WAHA 4P57B 4YE4H 3MNVA 3MUJA 3DGGB 4OCRL 1QFUH 3D87B 5EOTB 5JMRA 2WUCL 3ULUE 4NKMB 4OLXL 3B9KA 3DUSB 4PV8B 2EDKA 5DHYB 1X4XA 3B6SB 3VG0H 5CEXB 5E8DH 4HH9A 2Q3ZA 3BWAB 3GBLA 4WHYH 2RCSH 4LCCA 4HV8A 1JN6B 1EEYA 3ZKMD 3L5JA 3R8QA 2XPGA 5ALCH 1E28A 1RUAL 3CVHA 4KZDL 4JJ5B 1ZS8A 4UOJA 4QY8B 2NR6C 1U93B 3OJDB 2EDXA 3QQ9C 1AC0A 5JW3L 2XG5A 3NCCB 4YX2L 5JNYA 4LLYA 1DQQA 5JZ7D 1NGXB 3FB6A 5EWIL 1QO3B 3QXUA 1YN7B 5GRVK 2IC2A 2VZSA 4LQ1A 3PGCB 4LLVB 5IB4B 2IH3A 2NTFA 4JZNB 3UAJC 1CL7H 2BY3A 5CD5C 3VDBA 1XGQA 4HJGA 5EO1A 4TOYL 4NZDA 3KG5A 4PB0H 2P7TA 3W0WB 2NY0C 2X4PA 1D5ZA 3ARTA 4QHNB 5H35A 2Y7QB 4U1MA 1MY5A 3QNXB 4GO6B 4PJDE 4P2QD 2KL6A 1DLFL 1M7IB 4RCAA 5D1ZD 3WXVL 5E08L 4JO3L 3D39B 3FAWA 3T0EC 5FYKD 2VLJD 4C4KO 1I7RA 2GJ6E 1FNHA 5KOVC 1CFVL 1KTDB 2E5EA 2DTML 4PJIE 4WEBH 1DQTA 2VXVH 3X11B 4EN3B 1TZHA 4U1HB 1I7TB 3MRPB 2IGFL 2VQ1B 3MRRA 3TVMC 3OR6A 2WK2A 4GRLD 4KK8C 5E00B 4QXGH 5IJKC 4PTTB 4P4KA 1IGYA 3O3UN 3LS4H 4H26B 2VQTA 1ACYL 1T6VN 1MCPL 2BERA 2EDOA 3MC0A 4RWYH 1M05A 4IRZL 1NBZA 3L3KA 2IFGA 4MQTB 3MJ7B 3RNQB 1T5WB 4NRZB 5CGYC 5MEPB 4KKBC 1PKOA 2W9EL 5LWYH 3A67L 3LD8C 3D3VA 3EZJB 2MQCA 3L3GA 4HHAA 1EXUB 2IQ9L 4M1GL 5EZIH 2VAAB 2H32B 2LU7A 4ZUSA 3M1BA 5GJSH 1F2QA 4NWUL 2FX9H 1IAOB 5CBEA 35C8L 4HC1A 4K7FB 2OR9L 2Z8RA 3AREA 3RWDA 4X4YB 4HJJL 4G8GD 1NAMB 5C0IB 1H8OA 3IF1B 4JREC 1EO5A 2I9TB 5IK3B 3QISA 4LSDA 1YEKL 3GNML 3EIFA 5E2UL 4MD4A 4JFQA 3QBTB 4X80L 2HT2D 1LO4L 4PB9H 3ZYZA 4HGWA 3FZUC 4R2GB 4HXAH 5D7LB 3FQWA 2XNAA 3DMMD 5C6PB 5D72L 3RWGA 3IDMB 3FQXA 4GAGL 4WW2A 2B1HL 5IB1B 5F1KC 3EOTL 3BESR 5T5FH 5FHBL 1CU4H 5CP7A 2AJVL 4EI5D 4GQ9H 2BC4B 4YUEL 5ERWB 1NLBH 4B5EA 1F4HA 4OFDA 2JIXD 1QFUL 4YO0B 3QSKB 1NFIA 1SEBB 4AIZA 2VRAA 3GRWL 1FFOA 5L2JA 3BD4A 4Z5RA 4HT1H 2WBJD 5EPMB 1Q8MA 4MQSB 1OGTB 2X70B 1UXWB 2FDBP 5J6GA 1LEIB 1FZMA 5B3JF 4OLWL 3X3GL 3V52H 4GRMA 4RMWA 3MZGB 4O2CA 3V6ZB 3KPPA 2MHAB 4LF3B 5FM5M 2CIKA 2Q1EA 4PJ8D 3C2AH 4CVZB 3LOWA 1F4WH 5TF1H 5CEZH 1EGJA 5ALCL 3K81A 4RGOH 2DQDH 3NA4A 4NQDE 3RWJA 5HHOA 2ESVB 4LIQL 5E5MA 1TENA 3VFGL 4PP1D 1D3CA 1Y18B 3M8OH 1S7TB 5E9DE 2VERN 3VFWB 4FP8L 3QDJA 4PGCB 5BW7A 3ZDYE 2JKXA 4HGMA 3NH7H 4JFOA 5CSGA 5HYJA 3L7EA 4PB0L 4X5WB 2D7NA 2Y4SA 4IIQB 4LCIL 1SY6H 1Y0LA 3AC0A 3WUWA 4F2MA 1HXYB 5E7FA 4PJ7E 5AD0A 5JLZB 1JI1A 1XFPA 2OTUA 4OV5B 5JORB 2APXA 4I4WB 3RDTD 1SEQL 4WUUE 3ARRA 5C0AE 4J3VA 5E8OB 1A1MA 1MCRA 4NQVB 5F9JA 4Z7VA 4LSSH 1YYLL 1Z0NA 4GAJL 1I1AA 3QH3A 2F8XC 4LLWA 4Q6YA 4ZFZB 3W2DH 3STLB 4H1LG 2O5XL 3QR2A 1MCNA 3DLQR 2B1AH 4V2BA 1T0MB 4DAGH 3AXLB 4UILH 1Q0YH 1UFUA 1LEKB 2XTJE 3JVGA 3QO0A 4OGXH 1EFQA 5DD3H 4J12A 4F7PA 1RSFA 4MGXA 2FSEB 3RWHB 4ODWB 3MCG1 4DVBB 3SPVB 4ZTPH 3DHMA 4PJCA 15C8H 3WS6C 3GMLB 2PW1B 1AJ7H 3ARGC 3HNVL 2F54A 1YEGL 4M8VA 2DM2A 1UB6B 4FMFA 2GFBB 3UPRB 4Y5XB 4QHKI 3IJYB 3F7YA 3EO1B 3I6KA 4D3CL 4XPBH 4XCNA 3RGHA 5GJSL 2X4SB 1G6RH 2WV3A 4UNVA 5F70A 5FECB 3U6RB 3CMGA 4POZC 3C5SB 4P9HL 5KSBA 5D9SB 1DBKH 2F5BH 5CIPB 3S4SG 4P99A 3K4AA 5HGDB 2C3HA 1OTUD 3RHWK 3KXFB 1MH5B 4QXWA 5C9JA 5TF0A 4OIBA 2UWEB 3UO1H 1QA9A 4U6YB 5DFVD 4V1DE 2MPAH 3BZEA 1QLRB 1I85C 5I8OL 4N0RA 4M8QB 4Z7QF 2K7PA 2WINB 4IMKA 4F57H 1C5DA 5GGSB 1G7IB 2VLRD 2VTFA 2X1OA 1KCRL 4PJFA 4FZEL 3T0EB 4ELMA 3I6LE 3MXVL 4LCWE 4X4ZA 5T5FL 4PGBB 1CU4L 4DN3H 3CX2A 4G43A 4ZXBB 3KWWA 1JMZA 3EGSA 3SE3A 1GHFH 3VCLB 1G1YA 4B7IA 3D5OF 2VZUA 3RJDA 5EIIA 5F71A 3LKNB 3TVMB 1DBMH 4FQXB 3DTXB 3HE7B 3QUMA 1INQB 4KGLA 3QUXA 3H9SD 4AJ0A 4HFWA 1T0NA 4LQFH 3BP6B 3E6HA 3WIHA 4HT1L 3ARBA 3QPXH 5DJ0A 4Z95H 4J4PC 1PG7W 1AHWB 1XT5A 3DGCR 4YNYB 1WFNA 2AEQL 5CINH 4HWZA 3ARQA 4KTEH 1TETH 3A6BH 3MLRH 3V52L 1B4RA 1JBJA 2GT9A 3L7FB 3HR5B 4X7FC 2IG2H 5I6XB 5IR1A 4I0PB 5DC0A 3OJMB 3EDKA 1IGML 5TF1L 1QBLH 4I0CC 3PJSB 4YXLL 1DN2A 1IEBB 2VSCA 3BH8A 4G9FE 4JO4H 2XKSA 5ECJE 5LXGH 3X13B 4DKFH 4PLKD 4NJ9L 1D5BA 4EUPA 1ZVSA 3IKCA 3M8OL 3O9WB 2FJFA 2P44B 4PRID 1NJ9A 3SY0B 4M48L 4MNQD 5DMGC 4KDVA 3NH7L 5DRNA 4FQQB 4KHTH 1UB5B 3QDMD 1X5YA 3G04B 2PYFA 5D5MB 1SY6L 4O51B 3W39B 4CL7A 4U1KB 4JAMB 5C0RH 4RAVB 3C8KB 5KVFH 3X14B 3JWDL 5BRZD 4LDOB 3G5VB 2HN7B 1CFSB 2HKHH 5SWQA 4YDIH 2DTSA 4NHUB 5DD0H 3FQRA 1O0VA 4NC1C 1IAIL 1IGFL 1IGTA 1KTLB 1R0AL 4YHML 2HG5B 1J8HA 2VR5A 5D96C 1RZGB 1NKOA 3DJ9A 3DO3A 5IEKB 3TBSB 4Y4HA 2Z31A 4J6RH 2HRPH 2FO4A 5IQ9B 1OY3B 1ED3B 1Q0YL 4GKSB 1FORH 3MRCA 1OT1A 3MPCA 4GBXB 4OGXL 5DD3L 1TTGA 3HAEH 1HCVA 4WDIB 1BQHA 1CFQB 1BJ1J 1FG9C 1JGDA 1F3DH 1HN1A 5IM7A 1G7QB 3UJIL 1AJ7L 4IDJH 1C08B 4WWKA 3QDGE 1ITCA 4WV1C 5D7IB 1WTLA 1J0ZA 1IEAA 1L9NA 2GSIB 4X7EC 1I3VA 3VRLE 4ZFGH 3CX5J 4RZCB 1SVCP 4GS7B 1NMCB 4LASL 1RY7B 4ONFH 1U8QB 1Q94B 5MEQA 4NT6B 2DJ4A 2XZQL 3SDCD 1JYNA 4PJCF 3SDYL 1TPXB 2CDFB 3RAJL 1ZLVK 1PEZA 2V7HB 2G60H 2UV3A 5DURB 5GQBA 3BGAA 5KSAC 4Z7NE 1MCSA 3P4MA 4PJ9A 4X7TA 4QOKE 3TJEH 2EE2A 3NCMA 2NXZC 3SJVD 3UXFA 2A77H 3CSBA 3PQYE 5H2BA 1C12B 3K3QA 5K9OB 2QV2A 1YDPA 1DR9A 3ARZA 3KHOA 3F7VB 1XF2B 3BSZL 4MDIA 3TA3D 1JF6A 1FL5A 1U91A 2EDBA 1RHHB 2Y36L 3H8NA 2D0FA 2X4TA 4IRSB 4JQIH 4BFBD 2X4UB 2OXGA 4LVNC 2P49B 1EHNA 1R6VA 4JB9L 3TBVB 3TZVD 4OSUH 2FD6L 4U6TA 1T66C 4CJ1A 3V0WH 4FABH 5C0EA 4X9BA 1VFMA 4M61A 3IETA 1SYVB 4OCXL 2N4IA 5FOBA 3QPXL 4NZTH 3RIFK 2G9HA 3CFDA 3ROOB 4WHDA 2I07B 1TETL 4X98B 3MLRL 5D7KE 4EBQL 1SMAA 3CH1A 1E4KA 3K0WA 1F8TL 2OCFD 2HLAA 5HYFA 1WT5A 2XN9A 5TGBA 5IEHA 3QEHA 1DJSA 4OZFA 1WK0A 3BQUA 3PL6A 4WO4D 5TE6L 4OZGF 4XWGH 5FA4B 1R3JA 4Y19B 1TZIA 4JO4L 2FB4L 1QFWL 3MTRA 3V9FA 4P57A 3MOBL 4ZD3H 1VSCA 1OAYH 3DGGA 4L8SA 4RRPG 2ZUQC 4LVEA 2Y6SD 3EO9H 1CK0L 2VC2L 1ZT7B 1XAUA 5EOTA 5IB2B 4NKMA 1FNLA 4WU5B 3C08H 3MV7B 2R15A 4TQEL 2RFXB 3DUSA 4PV8A 4BM7A 3L6FB 2FX7H 3OSKA 5DHYA 5C0BB 4NUJB 3B6SA 3CCHB 5EBLB 5CEXA 4K9EL 4PRHA 2MQ3A 4KHTL 1KC5H 3BWAA 1JGVH 4NCDA 4XI5D 3EFDL 2YZ8A 3ULUH 5C0RL 4P2CG 3GIZH 1NCNA 1HYRC 4RDQG 1JN6A 3FT3B 4PREB 5F96L 4X4XB 4JJ5A 2XZZA 3HN3A 5HDLA 4KV5F 1HYSC 4QY8A 3OJDA 1U93A 1B3JA 3IRPX 1OWWA 5KBNC 2D9CA 5DEFB 5DA0B 4Y8DC 3T08A 1NGXA 5EOCJ 3ZL4H 5LBSH 1QO3A 4F15B 3KPQA 1M7DA 4POUB 2EIZA 3DIFB 1G6RB 3PGCA 5DT1H 5CWSA 5IB4A 4R8WL 3MO1B 4JZNA 5D2NB 4Z7UB 4LSTH 2DKMA 1JRHI 1IBGL 3WXWH 5T3XL 1FORL 4H0IA 4PD4J 1IKFH 7CGTA 5EBMB 4AIXA 4AMKL 2F5AL 3W0WA 5DEGB 5INDB 3FMGH 4P4KD 4QHNA 4WGVB 1Q9WB 1XR9B 2DQGH 5C6WH 1GGBL 5EUOB 3OF6D 2CLZB 3WDIA 4DKEH 3QEQB 3PWNA 5L6YL 3QNZA 3HNTH 4NKOA 5MEND 3D39A 2DLIA 1MFEH 4ETQA 3V4VH 3BN9C 5IWLC 4HS3A 2EDEA 4S0TD 1AC6A 4LLUB 4ONFL 1TTUA 3RVTD 5FV2A 3X11A 4EN3A 3T4AB 1FL3B 3RVUC 2W59A 2XV6B 3MRPA 4KUZH 2VQ1A 4LGRB 1KV3A 1NANH 2OQJB 1NDMA 4M3KB 4OCWL 2ZUWA 3DROB 4Z8FL 5E00A 3OTTA 4GKZB 4PTTA 1Z0MA 3MODH 3GI9L 2ZSWB 4H26A 5GRYA 2V5MA 2DYPB 3QULB 4LPUA 4M7ZC 4IOFD 1LD9B 3RNQA 3MJ7A 1T5WA 1RIVL 3GO1L 3OR7B 5MEPA 5DLML 3MLTB 4ACPA 5C0GB 3NCYS 2UUDK 1RJCA 1J7VR 4M9OA 1X5XA 1JZ2A 1EXUA 2VAAA 2VLLA 3B5HA 2H32A 1X4YA 4RAUB 4YC2C 4BQ8A 3VXRB 1A3QA 1A9EB 3K2MC 4JPKH 3FTGB 2VZ1A 4KDWA 1IAOA 4M5ZL 1PKQE 3B83A 3ECBB 4OLZL 2R4SL 1MLCB 5IROA 1IAIM 3Q6FB 3B2UC 5CSZA 1GJIA 3QRGL 3QWQB 1MIMH 1ZHLA 1NAMA 4XB8A 1F11B 5LKNA 3IF1A 2I9TA 5IK3A 4NZTL 4JFPB 3U46B 3WDJA 4QKXB 4X5LA 5DJAB 3T2NL 2MCPL 5DI8A 3T04D 3N1GC 3VWJC 3VXOB 5D7LA 1B90A 1TIUA 2DQEH 3IDMA 1CQYA 2YD5A 1Y6NR 4P23C 4H8WH 1EAPB 5F6IB 2FO1A 1U8IB 1KYOK 5IB1A 2WWMD 4I3RH 1EBPA 4JY4A 4NJAH 4XWGL 3C60D 4X8XA 1CBVH 2BC4A 5ERWA 4P46C 4YO0A 2H26B 1X5IA 4KJYB 4U3CA 5DRXB 2DM4A 5HY9B 4HZLB 1KXTB 5HDQL 1UH2A 2OS7A 1SEBA 4GW4B 3VXTB 4L29B 4I9WD 3F6IA 1WGOA 1UM6L 5EPMA 3QDJD 3OMZA 2NXZB 1OGTA 2X70A 1IAKB 1I3GH 1UXWA 3S96B 4DGVH 5HYJD 3GK8H 3QQNA 3BZ4B 3LQAH 3ULUL 2UZYB 5TDOB 1T89C 3HAEB 4N8PA 3GIZL 3V6ZA 1KT2B 2MHAA 4LF3A 5ESAB 2BNRB 1YY9C 4CVZA 2YK1H 4OFKA 1K2DB 1CE6B 1A6UL 2AERT 4PLOB 4HW6A 1OLLA 1P4LB 4JKLA 1X44A 2DLTA 5CJOL 2A83B 3S37X 1INEL 2ESVA 2RB8A 4I48A 1JTOA 3FONB 4LFHD 1IM9B 3T2OA 1Y18A 4HWEL 1ETZB 4OAWB 3MV01 1QOKA 1IT9H 2EO1A 1BEYH 2E6JA 3BPOB 2CDGB 1S7TA 3FFCE 3TN0C 5I19L 1T7WA 1OAXL 2ADIB 3VFWA 1GL4B 4PGCA 4PYGA 3HUJF 2PCPB 3BYTA 1K3ZA 5GGSY 3P4OB 5TE4L 5C3TA 3V0VB 5E6IC 3KVQA 4LEOB 3OG6B 4HMEA 4IIQA 4MB4A 1NLDH 1Q0XL 4F8TA 5IB5B 2MFNA 5I8CB 1HXYA 4ZFFB 4KROB 2J6EH 5JLZA 3OJVC 4BK4A 4DKEL 4OV5A 5JORA 4G8GE 4I4WA 1J1OH 3MMEB 3LQAC 4KMTH 1EH9A 4XNZB 4I5BA 5E8OA 1HHKB 3H6JA 3NAAL 1A7BA 4NQVA 2AXJA 3MJ9L 2DBLL 2C9AA 1NEZB 5CP3A 1I9EA 3VFVB 4N8CL 4I2XB 4LPWA 3QUKB 4M4RA 5DK2B 1MQKH 1MVUB 3STLA 1QFWM 4TVPE 4J3WA 1MFNA 1EDQA 1FL6B 2YRZA 4NCC1 4PUBH 1T0MA 3AXLA 5ICZB 1LDPL 1MCDA 3MODL 5KAQG 3LS5L 4AQ1B 1WWWX 1RK1B 1CYGA 2FSEA 3TIEB 3I9GH 3WO3B 3RWHA 4ODWA 4DVBA 1CXKA 1GGIH 3SPVA 4ZUVA 4ZUWB 3GMLA 2PW1A 2DWDA 3SE4A 3DYOA 2A73B 1EZVY 1UB6A 2GFBA 1JF1B 3IJYA 1RIHH 3I84A 4BK5A 3EO1A 2VSDA 5CLWA 2YUWA 4OLUL 2X4SA 3U6RA 5FECA 1MCOL 4EDWH 1U8JB 4XXDB 2PO6D 3L95A 3C5SA 5D9SA 4OIIH 5CIPA 4OF7A 1D6EB 3FT4B 4NKQB 3QXTA 4YEFA 4WUKH 3GIVB 1QSZA 1KELH 1JHTA 2XG4A 3UJJL 1MIML 1MH5A 3QQ3B 2WIIB 4NM8L 5J6HB 3QUXD 3TO4B 1BFVL 2UWEA 4E41B 5T1KD 1YEHH 1QLRA 4M8QA 4S1RL 2WINA 5F6HI 2JELH 4MSWB 1G7IA 1FJ1B 4I18C 3SDDC 1P9MC 4M7LT 5EOCL 5HVHC 5JXEC 4DVRL 2VAJA 4PGBA 1IE5A 2WBWB 4ZXBA 3JZ7A 1MWAH 3LPWA 4L3AA 3VCLA 2B5IC 3O6FB 1LP9E 3DURB 3KYNB 2DLHA 1T22B 3LKNA 4FQXA 3DTXA 3HE7A 3N85L 1INQA 4DN4H 3LB6D 4P3CH 4L3CB 3BP6A 5GZOD 4YGVB 4V2CB 1QSVA 3HLAA 1B2WH 4WW1B 3GHBH 4M7ZB 5BVJB 4NKIH 1AHWA 4YNYA 1I3GL 2MCG1 1PX4A 3GK8L 3T1FB 1X3DA 1PBYA 3MCLL 3HR5A 4XVTH 3G5ZB 4I0PA 2HVJB 2EE6A 3MLZH 3FO1B 5JXAL 1IILE 2YK1L 1FGVL 2E27H 3ZTNH 1K4CB 2F53D 4TULL 2P8LB 2O26U 2D7OA 3O8XB 2CJUL 4KVCL 1FNEB 4RSVA 1KGCD 1YJDC 4R97B 3X13A 2FGZA 2YXFA 2VNCA 1L7TH 4BH8B 1I9RL 4APQD 1J8HD 1F42A 4WY7H 5FGRA 3O9WA 3NTCH 2BFVH 1I1CA 1IGJB 3SY0A 2WP3O 4PJDB 1Z5LB 2Z31D 1ES0B 4ZYKB 4OD1H 4U0QB 1FLTX 4G6FB 4XP9H 5ELIA 2MSPA 3CFEB 3TYGL 3Q5OA 4FQQA 1LWRA 4JY5L 5DGRA 4DW2L 5HYSG 5D5MA 5C0DA 2GJ6B 1NLDL 3GUTA 4MQXD 2VH5H 3EZ8A 4L1DA 4PJIB 1EJOL 4G3YL 1DUZB 4U1KA 4NQED 4RAVA 2XFXB 3ULVC 1SM3H 4NP4L 4XVUD 3SQOH 3X14A 3G5VA 4M7KH 4WWKD 2HN7A 1CFSA 1BVLB 2A1WH 1QPPA 1QRKA 2VN7A 2RGSA 4NN5B 5EZLA 1X5KA 2YD9A 3LKQB 4LFHG 4WTZA 3MLPA 1RK0B 2HG5A 4QEGA 1JPSH 4PRNB 1ZV5A 3HFMH 5IMLB 1RZGA 3QCUH 5ACZA 3VXSD 3WLWC 3TBSA 1UKQA 1MQKL 2CRMA 5FYJE 1V7NL 5IQ9A 2VLRE 4YHZL 2AABH 1AD0B 1ED3A 4GKSA 3C09C 3FO2B 1QBMH 5GS0C 4E0RB 4TSCH 4GBXA 1JZ7A 2YD8A 4LP5A 1GZQB 1TJGH 1YMME 5IIEB 1CFQA 3AM8C 4LLMB 4NQCB 5DC9B 3H42L 5D2LE 4MJID 1GGIL 2GCYB 4PJ9D 1T2QH 4P59L 3C2SA 2ZWLT 1C08A 3MUY1 3V4UH 2R0KL 3VWKC 4XP1H 4M7LL 2GSIA 3LMJL 4YDKL 3UBXG 1KCUH 1RIHL 3BYYA 4QXTB 4JEGB 4K7PH 4YHIB 2PR4H 2YD1A 4M6MH 3GJFH 1S9YB 2NY2D 1FFRA 1RMFH 4FQJH 5C08A 4S0SD 2VE6B 1U8QA 1Q94A 4ZTOH 4NT6A 4JPIB 4M5YL 5L88L 3S36X 3QPQD 4KJWD 2PYEB 3TN0B 1WZ1H 1KELL 2CDFA 4XP6H 4HZAA 4MJ4A 4Z76B 3PNWB 2FBOJ 3U4BH 2V7HA 3QG7H 4HSQA 1F6FB 5CGTA 1YEHL 3UTQA 2R1XB 2ZNWA 3O4LD 3P0VH 1KJ2H 1V05A 1C12A 1JWMA 1FNSL 5K9OA 1VEMA 5HHPB 5BQ7B 2AJUH 1OAUH 3F7VA 5IQ7H 3G6JA 4MNQE 2XN9D 5HGBB 5TPWH 3FO9B 2HTKD 4IRSA 2X4UA 3QDME 4OD3H 3PL6D 2UWEF 1OM3H 4OQTL 1O7SA 4NN7B 4PY8J 3TBVA 3G5YB 1GZPB 2E9IA 2AJYL 4HPYH 3RUGF 1MPAL 1KG0B 1GGYA 3D18B 4OIAA 1SYVA 2AXGB 4GAFB 3RKDD 1B2WL 2G75B 5DSCB 5TH2A 5I1DB 4NQDB 2NY1C 3KR3H 3ROOA 5CZXD 4PRHD 4YHNB 3EHBC 2I07A 4PG9B 1AXTH 3NFPB 4X98A 1P2CA 5I1IL 2ZNXA 2G5RA 2W0FB 4OCSL 3BN3B 3F5WA 4R4BB 3MLZL 1SY6A 2L0DA 4Z77B 3TO2B 3N1QC 4JFDE 2ICWA 5E9DB 1L6ZA 5FA4A 3EYVA 4Y19A 2EH8H 4LVOB 2KUTA 5EU7C 2VDLL 3QEGL 5L2KD 4YFLI 1ZT7A 4WY7L 1WQVT 3MLWH 4O00A 1YC7A 3LSOA 4MXWL 2ENYA 4TRPH 2DB8A 4BSJA 1I3RB 5EU5B 3HG1D 5IB2A 4WU5A 2DQUL 4K3DH 2ZOKB 2GTZB 4JFHE 3L6FA 5C0BA 4XMLH 1A7NL 4NUJA 1NL0L 3ZKND 4WUUB 5C0AB 4JDVB 3BEWB 4A6YH 3MYJB 2VH5L 1NBVH 5GGVL 3SE8H 1S78D 1ND0B 1S8DB 4HG4J 3FT3A 4PREA 3SQOL 5I1JH 4Q9QH 1ROWA 4U2ZA 1MEXL 3RNKA 2AJZB 5IHUH 1YEIH 3N0PB 4X4XA 1TQCB 4NOFA 5IVOA 2C3VB 5IVNA 4GG6E 5E95B 2B5IB 3SJVE 2BVPB 3F58H 3HFML 4JRXA 3QCUL 2BMKA 2CSPA 1KLGA 4ZOCA 3DIFA 5DGQA 2YD6A 3MO1A 5EC2B 4JR9L 2AABL 5D2NA 4Z7UA 5E2WL 1FCGA 2XZCH 2JB6B 5D8JH 3REVB 3TYFB 3T0VA 5EBMA 3SHSA 4N1CA 3P77A 5DEGA 3IDJA 1N7ML 2VXSH 3E8UH 2IAND 1Q9WA 5M7QA 1T2QL 1XR9A 3ALPA 1JNNH 4M1CC 2DJSA 5EUOA 1PSKH 1ZMYA 2DBJA 3LIZH 5EZOH 2RR3A 3T1WA 1U9KA 4ZDHB 1A47A 4RWHA 1AIFB 2PR4L 5ITBH 1ZHBB 3V6BR 2P24B 3GSRB 4FQJL 1PYWB 3GHEH 3PWUB 2XXMB 3BDXA 2E7MA 2ADGB 4LLUA 1XIWD 2JJSC 1JNHB 2A38A 4V1DB 4PFEA 3T4AA 1FL3A 4YFDB 3O2DL 4UDTB 4I8DA 2NY4C 4MXQD 4WNQB 1MWAB 2OQJA 1U8MB 5H8DA 3U4BL 1N4XH 2SEBB 2ZG3A 2EIDA 3DROA 4GKZA 5D7IF 3UP1A 4FS0A 4UOW0 2FEDD 4BJLA 4HULB 2DYPA 3QULA 4LCWB 4OGYH 2V7NB 4IRJC 4QTIH 3P0VL 1LD9A 1KJ2L 3ULSB 5E2JA 3KJ4C 4RFOL 1A22B 5C0GA 2VZVA 1MCBA 3G08A 2NY5L 1OAUL 5F7DB 3WNMA 3QI9B 5IQ7L 3IDYC 4G7YL 1WISA 5HHVH 3RVVC 2C7UB 3IFLL 4RAUA 3ZT5A 3WNOA 1NUGA 1R5WB 4HK3J 5FB8B 4OD3L 1OM3L 1A9EA 1K8IB 3RA7H 3KLAB 3FTGA 4KI5D 5JA9A 3ECBA 1MLCA 4Y2DC 2B7DT 2LABA 1ZLWK 3I3DA 5KG9B 5JPMB 1F11A 1GIGL 3U30C 3RTQC 1LO2H 1H15B 4JFPA 3U46A 1CG9A 3AY4A 2CIIA 4FNLH 2JJWA 2BHYA 2Y06H 1DBJL 3KPSE 3VXOA 1FBIH 3L3HB 4UV7L 5JHDE 5IFAH 4PY7B 4YAQB 5F44A 4KTYA 4XHJD 4PJXE 3LZFH 5GS2D 2BVQB 4KQ4H 2ATKB 3OAZK 4U3XA 3EYOB 1U8IA 1MCJA 4KMLB 3BEVB 3MLYH 3VGAC 1WITA 4Q0XH 3I2CH 5CJXA 4ORGB 4OBSA 3GSVB 3BHBB 4KJYA 2YD4A 5DRXA 5HY9A 4HZLA 4CN4A 4TRPL 3P9MB 5GRVL 3WFEH 3OG4B 5I76B 4K3DL 4L29A 4ODTH 4L9LB 5MENE 1UA6L 8FABB 1EA9C 4RGMB 1UEYA 1KEMH 1QR4A 1IAKA 3S96A 2W0KA 5C9KA 3BZ4A 1NBVL 1NUNB 5TDOA 5FUOH 1AY1L 5B8CC 3B8YA 4FZ8L 1KT2A 4UT9L 1DQLL 4Q9QL 1I7UB 5ESAA 3MJ6A 4M1DH 5DRZB 1K2DA 2EE9A 5EOQH 4L8CB 5B39A 2CLVA 1P4LA 2EKSB 2FRGP 4WHTB 2XA8L 3WO4B 3V7MA 3ZKMC 1I75A 3DX7A 4HXBH 2HMID 3ARPA 3FONA 5J11B 1G0XA 1IM9A 3PWVB 3ZSTA 2GYSA 1N2RB 4ZS7L 3GJFB 4OAWA 4R4NC 1ZOXA 4QWWC 2A6DA 1KJVB 2CDGA 5SWSB 2ADIA 3QDGB 2PCPA 2H1PL 1A6VL 3P4OA 4XNUH 3VRJB 1ZLUK 5IB3B 2YSSB 4LEOA 3CUPB 1NEUA 4JM2B 5GIRB 3BKML 1FQ9C 3RIAK 1MAJA 5IB5A 5I8CA 4D9RE 2OR7A 5IT2H 4X4MA 2NX5D 4ZFFA 1A7QH 2LTQC 4UV4L 4MCZB 3OGCB 3VXQB 1KJ2B 2HJFB 3CC5A 5ITBL 4UAOC 4CADB 1IQWL 2M2DA 1RU9H 4NZJA 1BM3H 3OHXB 1ORQA 1YNKH 4PJAF 1NCDL 1RUKH 3IB4A 5GPRA 3VFVA 4HLZG 1MFBL 3E6FB 4QOKB 1JRHH 2I60L 4EZMA 2LVCA 4I2XA 3QUKA 5LAXB 5DK2A 1MVUA 3D1MC 3PQYB 1OCWL 3BXNB 5L9DL 5KVDL 5L7XH 1FL6A 1R5VB 2D4FA 5ICZA 1F6AB 2J8UF 2Q6WB 4P5TB 4KRNA 5ILTH 1RK1A 1U6AH 5HHMD 4M93B 5A16A 1X5FA 4YHLH 5DVOA 4DGYH 4ZUWA 4YPGA 1Q72H 5E2TH 5C2BH 3SDXE 5HHNB 3VXUB 2A73A 2YOCA 4X6FA 1PZUB 5HHVL 5IF0A 4I9WE 5C1MB 3DRTA 3MROB 2IALB 3DYPA 5F7NC 1U8JA 4XXDA 1P7HL 1WLHA 5JMOC 2X4QB 1V3MA 3P9LB 1D6EA 1KUMA 3FT4A 1XCTB 2NYYD 4N0FB 3GIVA 5B21A 1BQLH 1J88A 1PJ9A 5E1AA 2WIIA 2HA1A 5J6HA 2ZSVB 3TO4A 3N1PC 4ZFOL 4E41A 4KJQD 1F2XK 2ZUSA 2J7LA 2VKWA 4PRDA 4ERSH 1JGUH 4MSWA 3BE1H 3ZZ1A 2HT2C 1FJ1A 3O2WH 1CICB 4A6YB 1FO0L 4EEEA 2OBGA 2BY2A 4OB5L 1FZKB 2OM5A 3MLYL 3K8LA 3DXAD 5DJZB 5C7XH 1H8SA 1UENA 2DMKA 3PGDB 2IPUG 4YZFE 4FXGB 4Y4FC 4OZIE 1A6WH 3KS0H 3O6FA 5L8KB 4ODSH 3DURA 2RAMA 4G80B 3PHOB 1T22A 5AZ2H 3K7UA 2AK1H 4CJ0A 5HDBE 3WFEL 1A21A 3FB7B 4Y16C 4L3CA 4YGVA 4ZQKB 4WW1A 1P5UA 5TDPB 4ZPVA 3SE9H 3VGFA 3SO5A 3T1FA 2R2BB 2WBJC 4WGWB 1JWSA 5FUOL 3MCKB 1FVEA 1NUFA 4AEIH 1VHPA 3SDAB 1BFSA 3E2HB 5IVZA 4M1DL 4K8RC 3FO1A 4S1QH 3KAAA 2NY3D 1K4CA 4DK3A 1MLBB 1YNLL 5HYIA 4J2XA 2P8LA 3O8XA 3QIBB 2BSSA 4X6DF 4MAYD 5E1HB 5C07D 1RFDH 3LY6A 3MNWB 3QIWD 3U36B 1RURH 1BLNB 4BH8A 2Y5EA 2H6PB 3HKFA 3VJ6B 3O6ML 1XF1A 4G6JH 1IGJA 4XNXH 3MJ9A 5KN5B 4QRQB 5LQBH 2PTVA 4PJDA 1Z5LA 4OI7A 4KKCD 1ES0A 4ZYKA 1JZ4A 4QRPD 2QHLA 3CFEA 4XNUL 5GRXG 5DC4B 1WWCA 3LN4B 4HK0B 1XF4B 3MFFB 4FFWC 4U4BA 5E99H 5EU7E 2XKUA 2GJ6A 3WSQH 5CLTA 5GXBB 3MQIA 4PJGF 4PJIA 3IU4H 3NCBB 1DUZA 5IT2L 1LE5B 3CIQA 2EDRA 3OWEA 3GSOB 1KXVC 1BVLA 4UBDC 3RZCC 3UTSB 4U7KA 3LKQA 3ZTJG 5J1AB 3C5ZB 1BM3L 1RK0A 1YNKL 1UCBL 2VISB 4PRNA 5F3HA 5DDHB 4MA7H 5TE7H 2QTEA 4NOBA 5C08D 4JPWH 5K9KA 2EDQA 2G2RB 1KCVH 4GKOA 2GSGA 1ZEAL 3ZHLA 4PR5B 3ABZA 3FO2A 4U1GC 1ZLVH 5C71A 2X6MA 3FJTA 1GZQA 1OTTD 5DURD 2FECL 3FOMA 1X5HA 1JJUA 2JJTC 4NQCA 3DECA 1A0QH 3JXAA 3T8XA 4TVPL 5FYJH 5DMIH 2GCYA 4JN2B 2BY1A 3BIBX 1OAQH 1AGBB 2OR8A 2Y07L 4BZ2L 1S7XB 2DQJH 2YHGA 3MR9B 1J5OL 2EC9U 2Z93B 3E1F1 2YS4A 4KDTA 4QXTA 4YHIA 2Y25A 3AFLA 1U3HD 3Q2CA 1S9YA 2EXWC 3HC3H 3NN8B 3ZKXB 2VE6A 32C2B 5BVPL 4JPIA 3O11B 2QSCH 1TQBC 5BXFB 3E0GA 2AQ1A 3W11C 5FCUH 3ZE1E 4JM4H 4Z76A 1G9MC 4BFGA 5LCVL 3NCJL 2F53E 5B22A 3MLVL 4NDMB 5E6YA 1KGCE 5FKPA 2R1XA 3UEZA 4P4RB 3L1OH 1BBDL 1YEFH 4Y2OA 4ERSL 4UT6L 1DANU 2NZ9C 3CFCH 1JGUL 5CFHA 5EFIB 3O2WL 5BQ7A 5HHPA 5ID0A 1FFPA 3NFSH 4IOSD 4P2QB 2C3GA 2HFGL 5EULV 2W1NA 1LO5B 4JCMA 1NC4B 4YHKH 5HGBA 4UAOB 3RX7A 3FO9A 2DOCA 1IZKA 5D1ZB 5ADOH 5HVFB 2OL3L 4F7CB 5MI0B 3WNNA 4BQBA 2BDNH 4RMTA 1JYWA 2VLJB 2VIRB 5F7UA 1HH6B 4LVHB 3G5YA 1JV5A 1GZPA 2X4OB 4ODSL 3QP3A 4RGND 4NQEE 2ED8A 3KLDA 4S1SH 4BUHA 1T4KB 1KG0A 1QSFE 3D18A 1J86A 4OD2B 1D5XB 2AXGA 3T3ME 5DSCA 2G75A 4MZ3A 4GRLB 3WE6B 2ZCKH 3SE9L 2OTPA 5I1DA 4NQDA 1BVKB 2NMSA 4YHNA 4PG9A 1ADQH 4QF1B 4XPHL 3QUYC 3VXSE 3OXSB 2W0FA 3IDGB 5FGSA 4JDZA 4R4BA 1D6VH 3C8HA 4Z77A 3TO2A 1E4WH 4UINH 5E9DA 1K8DB 3H3PH 4Z9KB 3HPJA 3VI3E 3GBNH 4XNMB 4F9LC 4UIKL 4WVRA 1KXQE 4QGTA 4MJIE 3ZMRA 1WAAE 4GG8A 3KPMB 4JQXC 2A6IB 3DRQB 4HCRH 1WEJH 3NVQA 4JRXD 1JHKH 1I3RA 4PLKC 5EU5A 5EC1B 3QAZB 4PJ7A 5F7MC 5EU6E 2ZOKA 2GTZA 3RGVC 3PUCA 43C9A 4G8GB 3OKNB 3S37L 2ZOLA 3HE6C 3MJ8A 4B0MM 1SJHB 4WUUA 4YHOH 2EZ0D 5C0AA 2AS5M 3BEWA 4QRTB 1E6OH 3MYJA 5FDWB 1PW3A 2RQ8A 1ND0A 1S8DA 4KK6C 4N0CD 3DMMB 4MA8L 4EI6B 4LSQH 2BSTB 4TSAH 3FN0L 1MELA 4UTAL 3QIUC 1XCQB 1MJ7H 2ORBH 2C3VA 1CLZH 4NRYA 5JDSB 3HMXH 8CGTA 2ITCB 2JB5H 2CXGA 1TLKA 1I8KA 2AI0H 2BVPA 4G9DB 4MA7L 4EI5B 1MFAH 3HZMB 2D31B 3OPZH 4PJBE 3D9AH 1WIOA 4MMZC 2Y23A 1KCVL 3O4OB 1MHPH 3D2UA 2D4DA 5EC2A 1JHLL 2JB6A 3LV3B 3REVA 5KJRL 5DD5H 5B3NA 3TYFA 1I9JL 4KH2A 5BJTB 2KQNA 3MLSH 1A6AB 1FFNB 2WBJB 3RY6C 5A2FA 5FYJL 5DMIL 4EXKA 2EDYA 3UYOD 3P40A 2H2SC 1SBSL 4HS8H 2V9RA 4NRXA 4LKCA 1Z9MA 1A3LH 4NQUA 4XC1L 2UUDH 3OKOB 4ZDHA 4NQXB 4NWTL 4OLVL 4PJ8B 2CH8A 1AIFA 1T20B 4XCCH 3OGOE 1ZHBA 4GXUN 2P24A 2BVOB 1PYWA 3PWUA 1JNHA 2VXTH 2ID5A 2Q7NA 4V1DA 1S7SB 4W4OA 4ONOA 2QSCL 2WW8A 4OCMC 2X5PA 1IARB 2QADC 3BZFB 4H5SB 3LDBB 1G7LB 4UDTA 3UJTH 5FCUL 3FFDB 4JM4L 3W82A 1MWAA 3ISWA 4W6YB 3SDCC 2SEBA 4NC2B 3T4YB 2EXYC 4JG0L 3MA7B 1DQDL 1MFDH 1C16A 5J13B 4LCWA 3BUTA 3EYQD 1ZA3A 1YN6A 3VD9A 1BF8A 1ZANH 1M1SA 2A6KA 1UWGL 3CFCL 2HKFH 5C70A 5K33A 1J11A 1LP9B 1HSAB 5AG8A 3MFGB 5F7DA 1PZ5B 3NFSL 3HG1E 3QI9A 4N68A 5A2LH 2O93L 4K3HA 3F8UB 1A6PA 2C7UA 3IDXL 4JZJC 3VFUB 5HI4D 2VWEC 2FH8A 1N0LA 1R5WA 3JV4A 4M6OL 4U49A 3RDTB 4AT6B 5FB8A 3T0BA 1K8IA 1HZHL 1QHOA 3KLAA 4JHWH 1WFOA 4MNGB 1T1WA 3DETD 2W60A 4OCLC 4OQ1A 2DQCH 1F02I 1YEJL 5EN2B 5DS8B 3TZVC 5JPMA 2I24N 2WWKT 3R1GH 1AI1H 1CD0A 2WSKA 1H15A 3KDMB 3NIGF 4RA0C 1OP9A 5E70A 2ZCKL 4G6KH 1K6QH 5HHXH 5E03A 3NZHH 1U8KB 1UCTA 3BDBA 4G9FA 3B9KC 2DI9A 4ODXB 3ET9F 3X17A 4GRWE 3L3HA 4O2EB 5T3XD 4D0BB 4YAQA 1DFBH 4WFED 2ZJSL 3D25B 4QYOA 4LHUD 2ATKA 3VFMB 3EYOA 3ES6A 1DZBA 4LCCC 2C1PB 3BEVA 4G8IB 3NACH 2E9BA 2XI9A 4M7JH 4P2OB 3I3EA 2YN5A 2IANE 3BHBA 4ZNCD 4U1NA 4HCRL 1U95B 4I3SH 3BP4A 1A6TB 1WEJL 1IM9D 3GSNL 3P9MA 1JHKL 3MZTA 1LEGB 1ZGLB 4IHOB 4L9LA 5D1QD 1DUYB 1NCAH 3PGFH 3V5DB 1WBYA 4YHOL 4M6NH 4NUGH 2ITDB 3OKLB 3WIIH 2FWOA 5GGTH 2V17H 3OB0K 1TNNA 2WM0A 1NGQL 2QQKH 2HYMA 5DRZA 5CJ5A 4P2RE 2WZPD 3VD4A 2FBJH 4KAQL 4TSAL 3VGBA 4L8CA 2VLRB 2YRPA 2EKSA 4WHTA 1FPTL 5B38B 1H5BB 5I0ZA 1UQSB 3NGBC 4RFNB 3S5LG 4HUWB 3QUZB 3P0GB 1N2RA 1MIEH 3GJFA 3ZE2E 4U0RC 1FZJB 3BGFC 1KJVA 4EIGB 1V3LA 4KUCD 1JNLL 3OZ9H 1S7UB 4L3EE 3QDGA 5DD5L 2FNBA 3VE0B 1S5IH 3H9SB 3SGDI 43CAB 2QQQA 3H7LA 4HUKB 4Q9RL 1C1EL 5IB3A 2YSSA 3CUPA 4JM2A 3DPBA 5GIRA 1FNGA 4KI5E 1UXSB 2BHZA 1HH9B 4BZ1L 3HRZB 5J57B 4HS8L 4P4KC 4F7TA 3U0WH 4L8DA 2FL5B 3OGCA 2BJMH 2IBZY 1KJ2A 2HJFA 3J8F7 3VGEA 3VXQA 4KZEH 1KN4L 3VDCA 2J8OA 1RIUL 1MJUL 1MNUL 3VW3H 3FRPG 4CADA 1R3KB 1IGCL 4S2SB 3OHXA 5KS9B 3QEUB 5A2KH 3MRIB 4C83B 2VXTL 2JCCE 3WN5B 3E6FA 4QOKA 4DOHE 3DVGB 2GJJA 5LAXA 3LHPH 2Z91B 1U3ZA 4K3JL 3UJTL 3PQYA 5B4MD 3BXNA 4KK9C 5JW5A 3RVTC 4LPVA 3BPLB 5ICXB 1F6AA 4PRIB 3VFNB 5JO5B 2Q6WA 4P5TA 1D5IL 1Q1JH 4MNQB 3ZDZE 3AREC 3D69A 2DQFB 1G84A 1WF5A 3CNKA 4CRPA 3S36L 3QDMB 3IJHA 2YD2A 3BH9B 5F21B 4IOFC 5DUPH 5HHNA 5CILH 3VXUA 1DL7H 2R39A 5BOZG 1OARH 5C8JB 3MROA 1CLOH 5BRZB 3ULUD 1EO8L 4AQOA 3AS2A 1INDL 5H37H 2DF3A 2X4QA 1CR9H 3P9LA 4WW2C 3STBA 3AROA 1KN2H 1XCTA 3F6LA 4N0FA 3I02B 3ULVF 3T3PE 3O6FD 4TNWF 3CXHJ 1ZGLM 5I1AA 1MCCA 1I7ZA 4JY6B 3R1GL 1AI1L 2ZSVA 2B4CC 5IW6B 4G6KL 4M3JA 4JE4B 2AJSH 4WFHE 4J23A 1LO0L 1NGYB 3GEWB 5CBAB 4XMKH 4XVSH 3HMWL 3WUWG 1CICA 4CUCA 2Q8BH 4GUPB 2UZIH 4M62L 4XGZB 3NACL 5DJZA 1J18A 1HILB 2OMBA 5E7BA 3CFBB 4M7JL 3O8XD 3F12B 4LNRA 1FCCA 1GOFA 4FXGA 3RI5F 2WWMC 3JWNC 3KYKL 3I6GB 4G80A 2M1KA 2NX5E 5MP6L 5CMAA 1RPQA 3FRUB 1AO7D 3FB7A 4JFZH 1NAKL 1NCAL 3OKDB 3L9RA 1MCEA 3PGFL 4Q6IB 5KVEH 5TDPA 4FMKA 3REWB 4NNPL 4Q58C 4NUGL 4GG6B 4WFFD 2R2BA 1TTFA 3SJVB 3MCKA 2DQHL 2D03H 1TFHA 3SDAA 3EDFA 1RZ7H 1OWRM 3DVFA 1AXSB 4QT5B 4QCIB 1MLBA 5BV7H 1VKXB 3AU1B 3NCYP 5LVEA 3SCMD 3TA3B 1Y6MR 3MNWA 1DN0B 3DX9B 1BLNA 3DYMA 2H6PA 1MIEL 3MXWL 4KRPD 1IZJA 4MS8D 3BJ91 1FSKC 3VJ6A 5JQ6L 2BRRH 5KN5A 3VG9C 4QRQA 1RZFL 3MNVB 5I1CH 3UPAA 1QD0A 1I1AC 4K71C 2F19L 1WCBB 3TT1H 1J1PH 4HK0A 3MFFA 3I85A 4MVBC 1E6JH 2H2PD 1BX2B 3PV6B 3JVGC 3U7YL 2W9DL 1LE5A 4Z0BL 3LAFA 1QKZL 1IC1A 3L5HA 1H3PH 2BJML 3GSOA 1QR1B 1YJDL 2XWBA 3TFKC 5F9AC 2L4OA 2JJVA 3FKUS 3UTSA 5J1AA 1ZT1B 1A1NB 4XAKD 2VITB 3IFNH 3IGAB 1F90L 3C5ZA 1EEYB 4WO4B 3SKUD 1HK6A 2VISA 3QHFH 2OI9B 5DDHA 1E28B 2OX5A 3RKPA 2G2RA 4IJ3B 1XGTB 1P6AB 5JNYB 1URLA 4PR5A 5TFSH 3WIHH 1IAII 2CK0L 4KPHH 3EJYC 1C7TA 3DXAE 5E5UB 5D70H 3ULVL 5I1LB 1H3VA 4JN2A 1G9NH 4HJGB 5EO1B 5T1DL 4MYWB 3BFOA 4G7VH 1PKQA 2MTPA 4Q7DA 1TCRB 4XAWH 4HQQH 5DUPL 1CN4A 1S7XA 1M7XA 1DL7L 3CX5K 2Z93A 4ODHH 1KENL 2ED7A 4OJFH 2AKRA 4IMKC 1CLOL 1N6QL 5ALBH 4PJ5E 3NN8A 1F97A 5I18L 5DHXB 32C2A 4PJEF 3O11A 4W81A 3WFCH 4EUPH 5BXFA 3KPSB 2IMNA 5GS0L 1S3KH 5T33H 4DTGH 4MAUL 1AH1A 1U2CA 3SE3C 1TZHB 2YPLE 1KTRL 3IYLW 4NDMA 4C56E 5C07E 4H1LA 3MRRB 5I8EA 3OR6B 4P4RA 2AJSL 1OAZL 1S7RA 3QUXC 2V2XB 4NQDD 4P4KB 1IGYB 4XBPB 4ZO8A 3MREA 2XYCA 5EFIA 2OLDA 3ARBC 5J3HD 1B0GA 4XP5H 1H9VA 4P2QA 1LO5A 2ZCLH 1NC4A 4QRPE 4RMVA 4RQQB 2XKNB 3TF7C 1YPZE 5D1ZA 4F7CA 1IM3B 5MENB 5ACLA 2WNGA 2VIRA 1HH6A 3V2AR 2X4OA 2E8ZA 4LEXH 3DV4B 1MCQA 4ZUSB 2DWEB 4MLIA 1T4KA 4JFZL 5F1N