2OTUB

Crystal structure of fv polyglutamine complex
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
118
structure length
118
Chain Sequence
QVQLQESGGGLVQPGGSLKLSCAASGFTFRDYYMYWVRQTPEKRLEWVAFISNGGGSTYYPDTVKGRFTISRDNAKNTLYLQMSRLKSEDTAMYYCARGRGYVWFAYWGQGTTVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fv light chain variable domain
publication title Implications of the structure of a poly-Gln/anti-poly-Gln complex for disease progression and therapy
rcsb
source organism Mus musculus
molecule tags Immune system
total genus 28
structure length 118
sequence length 118
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2007-02-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2otuB00
1CFNB 3ZHDA 5L7XH 3PWUA 4KKAD 4MQXD 3OKDB 1MJ7L 4N8VG 3BRGC 5I15L 2Z0BA 5FYJE 3V0AC 1D9KA 1YECL 2DDQL 4ACPA 4AM0A 4P2QB 3RJQB 3MA9L 2OTWB 3DX7B 1AR2A 3DNKA 1ZHLA 1TJHH 3I6LE 4M1GL 1NGZA 2WM0A 3JXAA 1T20A 4PGEB 5EBLA 4M7LT 4QRPD 1I75A 2FYYA 1BJ1J 3LS5L 1FNSL 5EOTB 3RNKA 1W0YT 1LEGA 5D7LB 2XFXA 1HH6A 2C5DC 2FL5A 1IAKA 1JGEA 3IDYC 5JHLL 1IQWL 3TBYA 4O9HH 1TTUA 3AS0A 3BH9B 3RGVC 3WNPA 5BV7L 5L2JB 2Z8VC 2DI7A 4QT5B 1GGBL 2NY0C 2DF3A 4JVPA 3G6JB 4UAOC 4PLKC 2FO1A 1BBJB 5MERA 4XCEA 2XPGA 1YMHA 5J4MA 1A6UH 4OSUL 2EIEA 4JY6A 4UZGA 4G9DB 5MEOB 2A9ML 4NQUA 3MBEC 1EEZA 1K8IB 4NQDB 1BQUA 4K3DL 2VTFA 4MJ2A 3MV9E 2EC8A 3RAJH 4S11A 3AXLB 4LK4A 5AZEL 1ZLSH 3WN5A 2HT3C 3MCLH 5DHVH 1U93A 1MCOL 5DVOA 5IR1B 4KRNA 4HPOL 3IYLW 3GMRA 3HZKA 3R1GL 1V5JA 3C87A 4PJ8B 1REIA 1XF1A 1YEEL 5GS1B 1I7UB 5CIPA 4ZFOL 4JFPB 3WXWL 5K93A 3SQOH 1JNHB 4YPGA 5I9QB 3GSUA 1MVUB 3AREA 3O45A 3WFCH 3VXPA 3C09B 1NAKL 3UBXI 4OCSH 3VFPB 2F54D 5DDHB 1KXQE 4NT6A 3IFNL 3VD9A 1OP5H 1CDHA 4HXAL 4MQ7A 1JPSH 2FIKA 2X4NA 4WHYG 3PNWB 1O5DT 2WV3A 3MV7E 2IG2H 1QP1A 1VSCA 4JLRA 5IB2A 2RFXB 3OKOB 4WI5A 4KJQD 4NYLA 4Q6IC 4KY1L 2UYLA 5T3ZD 1D6VL 3N85L 5E6YA 4ALAL 4QY8A 3QUYA 2VXSL 3C08H 2DL9A 2VKXA 5C0JB 1LWRA 1XH3A 4D9LH 4FQ1L 3RGHA 3BSZL 5DEGB 3VA6A 2J7LA 4FQXD 1AC6A 2BY0A 1HSBB 1QFHA 5FB8A 2AJ3B 3GSNB 3HE7C 4JHAL 5E2VH 1LO2H 2WWMD 3DIFB 1LP9E 3FB7B 1NDMA 1CL7H 4W4OA 4JN2A 4M5ZH 1JHLL 3CFCH 4R7DB 2J1KA 3O4OC 1ZWIA 2C9AA 4GW1A 1WEJH 1NCAH 3PWNA 4KROC 4M1DL 4QRSB 3U0PA 4PLJC 3C8KB 4ZSOE 3C5SB 3WUWG 5IOPB 1AGDB 5DMIL 3GJEA 3SE8H 2DIBA 1MPAL 3X14A 1U3JA 5KSAA 1U8LB 3OXRB 5KSBB 1L9MA 5TFSL 1NGPH 3G5XA 1CDCA 5J3HD 3CVIH 4CN6A 1G7PA 2VDPH 2QHLA 3S36H 2F19H 4U1LB 3OQ3B 3WKML 4PJFB 3C8DA 1CXEA 1INQA 2H9GA 3OAZH 4HK0B 3UTZA 3WEXA 5DSCA 3F5WB 1RMFL 3GHBH 2ZKHH 2N7AA 2XA8H 3ES6A 2GT9B 4Y2DC 5SWSB 5MI0C 2WUBL 1QBMH 3FT4A 2CDFB 3VRIB 1KBGH 1SM3H 4NQVB 2EKSB 3WD5H 3FO0L 1O7VA 3MACL 1LEIA 4WTWA 2BHUA 2RAMA 1FYTA 3RGVD 1UM5L 4ETQA 1CK0H 2NY0D 1LNUA 3W81A 3BW9A 3EO9H 3QCUH 5DJ8B 4M00A 5I8EB 1VCAA 1WWWX 3TWCL 1GZQB 3L7FA 5K9QI 2IH1A 1HHJA 1YJDC 2JE8A 5HHOE 3LPWA 1NL0H 1K4CA 3F7RA 2R0ZH 4NKMB 1I3UA 2ZUWA 1GYAA 3MLVL 1GGTA 1YC8A 5BRZB 4LKXB 3GSQA 5I1JL 4YXKH 5L2KA 5DT1H 5AG8A 1Q9WB 2BNUA 2P5WE 2QLVB 1QRKA 4DUVA 2QSTA 1MFDL 2NPLX 3DVFA 2FJFA 4JO1H 5CJXC 1CLYH 1XGTA 1ZEAL 2CUIA 5DR5L 4C4KT 4CN4A 2OR9H 1L7IH 5C0RL 5IB1B 5EIQA 1U8IA 2VXVL 1KJ2A 4AIOA 1ZHKA 2W59A 4LU5H 5TF1L 1I1AD 3ZYIA 1QR4A 3DMMA 4XMLL 5JHDE 3REVB 2YUWA 5C3TA 2CKNA 1BWMA 3QIBB 4JCMA 5C0IA 3EFDL 2W0FB 2EE3A 2CIKB 5FYKD 2AJUH 2GTWA 5EA0L 4K3HA 1EGJH 1F5WA 3LKQA 1X5AA 5E5MB 4G9FA 4JFXA 1GAFL 5EO1B 2FHFA 2R29L 4I4WB 5LGHL 3FZUC 3ARSA 1A7PL 5DYOB 2P8PB 3H9ZA 4PJBE 5IHZA 2W9DL 1DANT 3N1MC 4ODUB 3HE7D 4M48L 2H3NA 2WK2A 5KTEL 1ZS8B 2OBGA 3RZCC 2MTPA 2A6IA 5CLTA 1HI6A 2EYTA 2ITCA 3LHPL 5JOPE 3AM8C 1S9VB 2NW3B 3O4LB 4G5ZH 1OOAA 15C8L 4MNQA 5J6HA 4NSKB 5C7XH 4DZBA 1NAMB 4QCIA 1UZ8B 4JDZB 1T4KA 2FBJH 4ELMB 1RQ5A 3MRJB 1MIEL 2YPLB 4H0GA 2DI9A 3MC0A 2R23B 5T3XD 1A4KA 5DK3A 3VCLA 3ARZA 4OD1H 3DI3B 3BE1L 4FXGB 1CN4A 1NC2A 1U2HA 4PJCB 4YHPB 1X5IA 3V0WL 4EOWL 3O8XB 2WWKT 2XWTA 3EYFA 2D4FA 3LN5B 4YWGH 2HFGH 2Z91A 4XC1L 3BI9X 1TLKA 2P44B 1Y0LB 5LKNA 1C16B 2JKXA 2X9YA 3MGAA 2F5BL 5F9JA 3STLA 5IG7A 3WDIA 1B4RA 2B4CL 3DXAA 5SX4H 1SMOA 5IEKB 1WCBB 2NXYC 2CO7B 2BSRB 4JFEA 5IB5B 5JXEA 4XP5L 3HS0A 4OIIH 1WF5A 1QFWH 1FZKA 5DK0B 4TVPE 5ID1B 2V5TA 4CVUA 5C2BL 5GSRB 4ONOA 5IFHH 5IMLA 1DQTA 1NBYB 2Z4QB 5LWYL 1MFBH 3MLTA 4KZDH 3LS4L 1RZKH 2EDHA 1EDQA 5B3JF 3TA3B 5E00A 5F6IB 2OX5A 2CUHA 3NPZB 1KTLB 4S1SH 3UTSA 5IWLC 3U79A 4BA8A 3EDDA 4JANA 4XH2A 1KXTB 5L0QB 3KLAB 1MCEA 4GG8A 4PGDA 5A40E 1PYWA 5DD0H 1KJ3H 1TNMA 5ELIA 1FL5A 1RUPL 3LKNA 3MX0A 3T1FB 3I9GH 4NHUA 4R90L 5F6HI 3UMTA 4I8DA 2QV2A 5ICZA 5KVGL 2Y23A 5T1LB 3WJLC 1VESA 4YDJB 1D5BB 4G8IA 3HNTH 1SJEA 4M03A 4YBLB 4U6HB 4BSVA 5ID0B 5IW3A 4PY8J 3WBDA 4H1LH 2BRRL 1JN6B 1D5XB 3DX8B 1JGVH 3HMXH 3FQWA 3CLEH 1TXKA 4Y8AA 4PY7A 1IEAA 2NTFA 4U6VL 3IDIB 3WHXA 1T83C 4XVSH 4NBZB 1YEIH 3IDMA 4N8CH 3IDNB 3PG2A 1WZ1H 3KJ6H 3PUCA 4NJ9L 5EBGA 5BV7C 4KUZL 4MNHA 1JTOA 2FBOJ 3O11A 2KBGA 2GI7A 4ZTOL 5D1ZC 1SJHA 4HIHA 4J3VA 2PO6A 3DX9A 3TBWA 1YEHL 2COQA 2KKQA 4DK3A 3BZEB 4O51B 1Z2KA 2R56L 1KIPA 5TE6L 5GS0L 5JW3L 2X5PA 4IRSB 5AWNL 2FH6A 4O58L 3FN0H 1HWGB 4XWGL 3LD8C 3UTQB 3MRBB 4IIQA 3MV9A 3Q6FA 4A6YA 1KCRL 4K7FA 5LXGL 5E8PB 1DE4B 2A6KB 3K8MA 2DYPB 3HC0B 5DLML 4POZC 5TQ0H 4D0BB 5F1IA 2R4SH 5EFIB 2APTA 1O0VA 3L5HA 3L9RB 4NO0A 4RWYH 2QJDA 3BKMH 1T04B 4MMZC 5AAMA 3P4OA 1FZOA 3UPCA 4FOMA 3QIUC 5EU4B 4GQ9H 1SY6L 5E8NB 2D7MA 3DROA 4U1HB 4MCYB 5T1KD 1FGVL 4DWHA 4PP1C 3MODL 2BY1A 4WI3A 4F9PA 1P4LB 1A9EB 1B3JA 4Z0XB 4Y19E 3PDGA 2EE2A 4F7MB 2EICA 2EE9A 3MV7A 5AEAA 4H88H 4MAYB 3TBVB 4HIEA 3KJ4C 2RHEA 4OLYL 3H8NA 3ZTJH 2C3HA 1OAYH 1AHWB 4Y5XC 4ZUSA 3WNLA 3DBXA 1Y6MR 5C0EB 1JBJA 2NXYD 3D48R 4G6FB 4OGXH 1CLCA 3MLRH 2OYPA 2OLDA 2B2XH 5D71H 2YD3A 1DEDA 2V2TB 3C5ZA 2Q3AA 5DJZA 2HRPH 5EZJB 3C5JA 2WMPA 3SE9L 1GH7A 3PWLA 4EN3A 1LP9A 1NCCL 4P48A 5J1SC 4GRMB 2MSPA 1HQRA 2AI0H 1BIHA 4Z77B 5CGYC 1IT9H 1YY9C 5GGQL 1T7XA 3MOBL 2NX5B 4ZSOA 2X4OA 3SDDA 2P5EE 5GGTL 2DQJH 4KRMB 3O0RH 1AXSA 2MKWA 4Q9CA 4R26L 5INCA 5KVFL 4KKLC 2X9XA 3B5TA 1Z0MA 4KPHL 1TQCC 2GJJA 4CMMA 1UGNA 2OL3B 4Y4KA 5AYUH 4M93C 2ADJA 1KULA 1T5XA 4U1GB 3SO5A 1QLEH 4CRPA 1OP5K 4PGZA 2IADB 1OPGL 4CDHA 1SEQH 4JKLA 3DSFL 1YN7B 4EI6A 1T1ZB 3NGBB 3RDTC 4N0UB 1XF2B 4LVHB 2C1PB 4S1RL 1DL7L 4I0PA 4AT6A 4DW2L 1F4WH 1TENA 4LBEA 5C0CB 4WI7A 2JJTA 5BS0E 4QRUA 3ZKNC 1WZMA 1FNHA 2QR0B 3QEUB 4FFVC 1I8IB 3BHBB 3MLPA 3S35X 3GRWA 4YDLC 2ZCHH 2CPCA 1VDGA 3KPPA 4KJWC 1IGIL 1MJJB 3QG6A 3KDMA 4Z5RB 3BP4B 1AO7D 1S9WA 4JO4L 5ANMB 1EIBA 2JB6B 3EAKA 4YLQT 4CNIA 1MWAH 3DHJA 4BELD 4JGMA 4ZXBA 5D1ZD 2EYSB 2PKDA 2E27L 5JIIA 4FZEH 2BSTA 1SBSL 3FT3A 4NO5A 2G75B 3T0DA 2V2WA 5DZOA 3PWPB 4Y5VB 5HHOA 1I1RA 1UXSB 3CXHJ 2OP4L 1QSED 5KANI 1N5YL 5DFWH 2BNRB 3BPNC 2NW2B 2HJLA 4M4RA 3T0ED 1F4HA 4PG2C 4ODXA 4QXTB 2J8OA 4HUWB 4X7EC 1KIUA 1R3KA 4FFWC 4CN1A 2E7LC 1KENH 3ZYZA 2R1YB 5LVEA 3OAZK 4POZD 4EEEA 1MCLA 1WQVT 1OTSD 4RGND 4V1DE 3T09A 1QRND 2AVGA 2P5WA 2WINB 3QEQD 3MLYL 1S7VA 2VZUA 3FCTA 1I9JL 1CTNA 1MAJA 1G7IA 4OGYL 4EJ1C 3F6IA 3ZO0A 3HNSH 5CSZA 4GAYA 3MJ9H 5ITBH 3HR6A 5L8LB 2VITA 3QIUD 3R0NA 3WDHA 5DA4A 5I1LA 4Z6AT 3OXSA 3BIKA 3VMPA 2EDDA 5ICYA 5DMGC 4PP1D 3NCMA 2I9TB 3VGEA 3WJJC 3W5NA 3IDGB 5J11B 2BVPB 3PL6B 2A1WL 3MPCA 1BFOB 5JHDA 2I24N 3LSOA 4KQ3H 1JV5B 3QB7C 4W81A 4MD0A 1N0XL 2C7UA 2DLIA 4ONFL 4HT1H 2MPAH 5L9DL 5B21A 2A6JB 5DZNA 5A2LH 3IAGC 2PTTA 4RISL 3S7GA 2R9HC 4CDGC 5I1GL 1PD6A 5JDJA 2YMXL 5TH2A 3U0TA 5J13C 4O5LH 1JGUL 2PXYC 1QBLL 3GMPB 3D2UB 4UOW0 4PJBA 2R2EB 5TJWK 1T0NA 1IGJB 2YA1A 3NACH 3S3PA 1BFVH 1K9TA 1MHPH 4K3EL 4D9QD 2UWEE 3L3GA 5FGCB 5FF6B 3TYGH 1IM9B 2YBRB 4K23L 5E6IB 5GJTH 2XTJC 4KMLB 4UIKH 5DURB 3ULUC 1T21B 1A1MB 5CGYD 4LEXH 4PJ7B 4XMPL 1YY9D 4XPAH 4D0DA 4NQTA 3RWIA 3FO1A 5JPNB 1IGML 3RPIA 3V6BR 4FTVD 6CGTA 4M6OH 3HZMA 3NCJH 1IEBA 1B6UA 5HJ3A 3I85A 1KCUL 3VI3F 3E3QE 1H3VA 2AEQH 1A21A 1Q9KB 2H6PB 4DKDC 3I2CH 1T03L 2KUTA 3HN3A 4X6DF 4NUGH 1AI1L 1A7NL 1CFVH 1K3ZA 4LQFL 3RDTD 3BKJH 3SGEI 4F7PA 3G08B 1YPZE 3SY0A 4XVUD 1MIML 3OKMA 1CLZH 3FQNB 3VXME 4EVNB 2NQCA 5DD1H 4YO0A 3ZKND 1NGWA 5C0BD 1YEKH 1BQLH 4FN0A 4LSVL 3SJVB 4YHOL 1CGVA 3UTOA 1FFNA 3P9MA 3TZVB 1ZGLM 1IAOB 5DTFA 3FONB 1GZPB 5I1HL 2I5YL 4NN5C 5KZCB 1GXEA 3CPLA 1SYSB 4BZ2H 3ARGC 5BXFA 2YD5A 1EJ6A 3IGAB 5F3HB 3TJEH 4N0CC 2FNBA 4LQ1A 4LSTL 4GRLA 5ITFB 2A0LC 4NN6C 4DK6A 4WUUE 5GJSL 3K46A 3VXSB 4I18B 3O3AA 2AABL 2VDML 1S9XA 4JFQB 4I5BA 5HDBF 2WUCL 4UI2A 1JP5A 5IT2H 4NFCA 3ZE1F 5JR1H 1ED3B 5FO7B 2XQBH 3RKDC 4TNWF 5C1MB 3H42L 4FFWD 3GBNH 5I8KL 5M95B 2VZOA 3QEHA 3V5DB 1IGYA 3GUTA 1MLCA 3VGDA 5D96C 4BKLA 3S3JA 1MRFL 2BVEA 1I8LC 5D7JB 4NM4H 1KTDB 4PJEF 2FZ3B 3OPZL 4ELKA 5IMOA 4W6WB 1IILE 4FQHB 3OG4B 3Q48A 2P24B 2AJSH 2AK1L 1F8TL 4WI6A 2AV1A 4QNPE 2ARJQ 4U1MA 2CIIA 4LCCA 5DMGD 2Q1EA 2DDQH 4FG6D 4HF5H 4OBSA 4QRPE 5BMFL 2ATKB 3MA9H 1QBBA 3U48A 5C6TL 4Y5YB 1A2YB 1LO0L 2FH8A 4HMDA 3SCMC 5GS0C 5IVXB 2CDEA 3C6LC 1ES0B 1EH9A 2R9HD 5FXCH 5CSGA 1FNSH 4NJAL 4P2RD 1ZHBB 5GQBA 2WANA 4O2EB 4AMKL 3HZVB 5JHLH 1IQWH 4TYUA 3IJHB 5D6DC 3VRJA 4J3XA 2PXYD 2IAND 1S7XA 3L5WB 3OJVC 3QUMB 3EDJA 3QWRD 2JLLA 3ZTNL 5B4MC 2IAMC 4NQED 5A1AA 5J6GA 1GGBH 1S7SA 3E1F1 4RMTA 3VWJC 3RZWA 2EIZB 3OG6B 2JJSC 4RCAA 2XTJD 3PV7A 4JGUA 3RWGB 2V6HA 3C8HA 2QADD 3SKMB 4OSUH 3T65A 3HPLA 4GBXA 2OCFD 2A9MH 3GB7A 4M7KL 2BY3A 4RAUA 4Y1AD 4K3DH 1AJ7L 1C12A 2P45B 1X7QB 1ZVSB 3V8CA 3VW3H 1UYWL 5B8CA 3LRSA 3IJSB 4PV9B 2FECL 4Y19A 1A6AA 4I77H 3CK0H 3R1GH 1G7MA 1PQZA 4LLVA 4HH9B 3QH3A 2V17L 1F13A 4Z7WF 5D70L 1U3HC 4LHUA 1RIVL 5FCUL 4RFEB 4G7YL 5D2NB 5FV2A 4HBQA 2DWEA 3K0WA 1VKXA 4OCLC 4KI1A 4JZOA 5C9JB 1AQKL 5C8JA 3ARWA 4QOKE 2Y6SC 1ETZB 1NAKH 1PG7L 5K9JL 2IQAB 4NKQB 4CVZB 5GS2H 1L0YA 2Z35B 1DR9A 1YEJH 3IFNH 1S3KL 3F7YB 1LK2B 1P7QB 3CLFL 4HXAH 5C0AB 4PRID 4K7PH 3ARGD 1M7IB 4X6DB 4XCYB 5D1XB 5CKGA 3WFHA 2IALA 1WFTA 4QTIL 2EEDA 2XNAB 4OZIF 4KY1H 1D6VH 4N0CD 4ALAH 5AZ2H 1PX4A 3X13A 2VXSH 2P5EA 1EO8L 2A9NL 2NTSP 3GMLA 4FQ1H 1CGSL 2B5IC 1GPOL 3BSZH 4IHOA 3OR7B 1YEFH 1JZ3A 1IJ9A 3LKOB 1DSFL 1K6QL 4TRPL 4JHAH 4LRIC 3FQTB 1A47A 1CXIA 3B9KA 4TSCL 5JW5A 3RKDD 4P4RA 4JPVL 5FO8A 1E4JA 3QHTC 1U92A 3QXTA 1FVEA 4KUCD 4LLMB 2GTZA 4X6EB 1UM4L 1P84K 1HSAB 5F9OH 1Q72L 5K9OA 2HKHL 4QHMB 1JJUA 1MPAH 1U8QB 2J4WL 3WCYA 3V52L 2CUMA 3N50A 1AY1L 3IFOB 1DQJB 1H3TA 1MFNA 2FGWL 3V4UL 1VGEH 4UMGA 1WGOA 2JF1A 4X9FA 2ICCA 1KB9K 1MFAH 3QFDB 2ZOLB 3WKMH 5A43C 1FH5L 4MDIB 2EDTA 4LSRL 4HKZA 4OFPA 5BZWA 2F53B 5J7CC 1FO0L 4E0RB 4YPJA 3FMGL 1HK6A 1MCPH 2DMCA 3LV3B 1RZFL 3SCMD 5I16B 3KWWA 2HN7B 1RMFH 4P49A 1NCNA 5GS0D 3KYKH 5DHVA 3C6LD 1MF2L 4JM4L 4MSWB 2CK0H 1J88A 2A38A 1UEMA 1J5OL 2X7LA 4ZUWA 4M6MH 2Y7QB 3B3IB 4ZO9A 3FO0H 2VLME 1N64H 5C08B 4QHUA 1B2WL 3U0WL 1UM5H 3CVHB 5B4MD 3OBAA 3ZYJA 2IAMD 1HI6B 3IXAB 3MRFA 1NMBL 3VWJD 5E2JA 4ZUVB 3DRTA 3H7LA 2YPKB 4JY4B 4V1DA 2RQ8A 3TCLA 4OCRH 2ESVE 4LPWA 4C58B 2PW2A 2ILLA 4IMKC 1KJMB 2K7PA 4OZGF 3QZWB 4N5EC 5T5FL 1BZ7B 3MLVH 3KPQA 3BVNB 3BP5B 4BK5A 3OGCA 1H15A 3BGFB 3RRQA 3NN8B 4P3WA 4UU9A 4C56B 7FABL 1NGYB 5I1JH 3E8UL 5A2KH 2J88H 1RZJL 2VABA 4FZ8L 4GAGL 3TBSB 4WFGD 1OCWL 2MQ0A 3BMWA 3OR6B 1WC7B 1MAMH 1XGQA 2W38A 1MFDH 3UBXG 3KYAA 1QYGL 5TPWL 4S1DC 3GNML 5CWSA 4BZYA 4IRZL 2FX9L 1JWSA 2O26U 4BSJA 3D3VE 5DR5H 2ORBH 1JUFA 3D0VA 5C0RH 1I7ZA 1UM6L 5E94A 2VE6B 2Y6SD 3O9WB 4PRDB 1A3RH 1M7XA 2VLLB 5I1AA 2VL5B 3H9HA 5MHSE 2YD2A 1IQDB 4F9LA 4JKMA 3UO1H 5DD6B 2UWEA 2X89A 3U30B 4GJTB 1X9QA 2PYFA 1AGFB 5EA0H 3GEWB 1BD2A 1KGCD 5FK9B 3LKRB 3OHXA 1ND0A 1YZZA 1PLGL 1CT8A 4JRXD 5HYIA 2X4TA 3WLBA 2R29H 4R8WL 5GSVB 5LGHH 5K9KA 1A7PH 4LCYB 4DN3L 4PPTA 2W9DH 4KMQA 5ICZB 3VFWB 1I1AB 3S4SG 3M17A 3MRQA 1I7TA 3IKCA 1MOEA 3FTGB 3O2DH 2QQKL 3SKJH 4DVBB 2HVJA 1I1FA 3VRLF 2BVTA 1P4IL 4XC3L 1QSFB 2YZ8A 4XVTH 3K3QA 5T1MA 4FQCL 1P7KA 4OCXL 4OZIB 3ULUH 5DJ0A 3S37L 3VXMA 1T0PB 3V6FB 5EPMA 1F90L 1MIEH 1R3JA 2YN5A 4HFWB 3LEYL 5F70A 4OFVA 4ZO8A 2FX7H 1MCCA 2V7HB 2X70B 4XCNB 1RK0A 4YHIB 2RCSL 3V0WH 3MXVL 4HGWA 4EOWH 2DQDL 3VXOA 3E6FA 4PD4K 4XC1H 3VA2C 4KK9C 3SOBL 5J8OA 1EFXD 4NPYA 3TIEA 3VJ6B 2F5BH 1MCIA 1GRWA 4H25A 5DMYA 4JKKA 5C07D 2CDGB 2HWZL 2XXMB 1UT9A 1LEKA 1WUNT 1FN4B 5LAXB 3RUGF 4EDXA 1XF5B 3MNVA 4WUUA 3ARBA 4A6YB 5MEND 1FJ1A 1F3JB 1U58B 3MRCB 3L7EB 3MLXH 1DLHA 2Z93A 5C2BH 4RMQA 3BGMB 2J8UF 3LS4H 4U1NB 5CBAA 5IQ9B 2GITA 4ZQKB 4P5KB 3H9SB 2SEBA 1BFTA 4NQCB 3STZA 3ARFC 3NTCH 3VDAA 1JGLL 1VFOA 1M71A 4KRLB 4Y89A 2AXGB 3L95A 1NCDL 1VFBB 4RDQF 1S9KC 2CKBH 1I7RA 1KCLA 4R90H 1F11B 2ZUQB 1BX2A 1F45A 4H0HB 4KK6D 3QQNA 1EGJA 4XTRC 4OV5B 1HINL 4TPRL 4KK8C 3MUGB 5FUZH 2VQUA 4G6MH 4ZG1A 1HYSC 1G1YA 1KJVA 3SDAD 4LP4A 4QRPA 5F3BA 1KB5B 3IXTA 1A3LH 2MQ3A 4ODVL 3STBA 4HUNB 3L6FB 4R97C 4HV8B 4PTTA 3FKUS 3EHBC 4F57L 3CH1A 3KXFD 3B9AA 5D1QC 2BFVH 5B38A 2FSEA 3BZFB 4OZGB 1I8MA 1V3LA 4PRPB 5DVMA 4MXVF 3SGKC 3WYRA 2IBBA 4NJ9H 2APWA 3G6AB 4KUZH 1QQDA 5F96H 3U9UB 4XNYL 4JPKL 3OKKA 3HUJE 1B0RA 4KVNL 12E8H 2VQ1B 4X4YB 4Z78B 3WL9A 4GRWF 5CBEB 2R56H 3MRDA 4GXVL 5TE6H 1QEWB 4KJPC 5GS0H 2GAZA 5JW3H 5T33L 4BJLA 4NNXB 2BOCA 4O58H 3ZL4H 4XWGH 2DOCA 4AENB 3H6JA 3MBXH 1M6OB 1ZAGA 1BVKA 1NLBH 3FB8A 3GJFB 1KCRH 3PHQA 3UAJC 4F33B 1T5XB 3T3PE 1PJ9A 2GK0B 3JV4B 2DWDB 1A14L 4KC3B 3PWJB 2WSKA 5DLMH 3L3KA 3LEVL 3MNWB 2VLRB 3EO1B 4JPIB 1NUDA 1KTKE 1N0LA 1VADA 4Y16C 1TPXB 3A6CH 4RA0C 4UQ3A 1OAQH 2KDGA 2UV3A 4GUPB 3G5ZB 3JTSB 3QXAB 4QOKA 1SY6H 3CXHK 3EJZC 5EU6D 4JM2A 4XVJL 1FGVH 4X5LA 5IBTH 5D4QA 3RIAF 1ZHNA 3CSGA 2H26B 2DTML 4JQVA 4DKEL 3QWOA 5DQ9B 1J0YA 1RPQA 2W60A 1WZLA 1ZTXL 5SX5H 2Q8AL 2XN9D 3KR3L 4XP9H 1Q94B 3UDWA 2EDBA 2UUDH 4FQXA 4U6YA 4M6NH 1KF9B 4KK9D 4OLYH 5FA3A 4HIXH 1CFQA 3TBTA 4JZJC 5JXAH 1ZGLP 4HKJA 1E6OL 3RVTD 4Y4FC 4LOUC 5F9WC 2P49B 4G8GD 4UNTA 2J8UE 3LKPB 3U36B 1Q9LA 1CTOA 4HHAB 4QRTA 4XZUB 3MLUL 3CSYB 2HJLB 1ZSDB 4G8EB 1JVKA 1N6UA 5CEYA 3QG7L 4HIJA 3HMXA 4ODXB 1BBDL 1X5XA 4KGJA 4RMVA 2W65B 2B1HL 3VDCA 2BXZA 3MUZ1 2A73B 1TVBA 1XT5A 2D7QA 5DC9B 4PJEA 5F7NC 4CMHB 3BRFA 3RTQC 3VFUB 1WBZA 4YIQA 2D3VA 5FOBA 2XKNA 3H2WA 1UXWB 1YUHA 4PJIE 4WHTB 2XWJB 1S7VB 4KDWA 5GGQH 3MOBH 4JE4B 1NEUA 43C9B 3UYPA 5KVFH 4R26H 5DS8A 4KPHH 1NCUA 3HE6C 5ESAA 4YBHA 1CBVH 1T2JA 4Z7VF 3QO1A 1OPGH 5MEQA 3WIHL 4XB7A 4MJ4A 4YHKH 3ZSTA 1CFSA 1OAXH 1EAPB 5I30H 3DSFH 1Z9OA 4LLWB 1WT5C 1I3RA 2WBWB 1UVQB 3CUPA 4RIRA 3D39B 1Q0XL 1WFUA 1DL7H 3KLSA 4DW2H 2CR3A 3V5KB 1Q0YH 3F6LA 3M8OH 1NDGB 2XZCL 4TOYH 1F6AA 2NY4B 1AO7E 1C5DB 3RGVA 4GS7B 2ICWB 4U31A 3RWDB 5JO5A 3T77A 1IGIH 3QDMB 3VWKC 3AB0C 4EUPB 1MLBB 3QJHB 4U7SA 1H3UA 5IVZB 3QUXC 4IS6A 4OJFL 2VDQL 3RVUD 4Z8FL 4ODHL 1QSEE 4GT7A 3MBEA 2ESVA 5F88B 4HUUA 4P5TC 5GHWL 4ZNEE 1TZHA 2M2DA 5DRNA 3UJIL 3QSKB 3PP4L 1N5YH 1IM3A 1OQOA 1DUZB 2KZ1B 3HZMB 4UILH 1RZGA 4YGVB 3FQRA 4JQXC 1NKOA 4Z7WA 5I17B 3DX6A 3UAJD 2WBJC 2BNQE 3QEQE 4P57B 1FYHB 1TITA 2OMNA 3QT2A 5TDNA 4PJ5D 2FB4H 4ZAKD 4NC1C 3N06B 4RAVA 3HAEH 4CL7A 2LU7A 4L9LC 2FEDC 2LQRA 4NN7B 4F7PB 4GRWB 1XGPB 3LY6A 4PRHB 1I9JH 4JFOA 4OGYH 4Y16D 3H0TB 1U8MB 5DJAA 2GJZA 3D3VA 4XI5C 5JW4R 5HGAA 1WBYA 4M61B 3PF2A 2OJZL 3F62A 1ITBB 1AD0B 4ONHA 3GI9H 3T0EB 1H0DA 1P2CA 2A1WH 4Q6IA 1ROWA 1XF4A 2CLRA 5EB9A 3CPLB 2Q6WB 1JHKL 1MHHA 4AZ8A 3JV6B 5I1KL 3TM6A 1TQBB 4ONFH 4RNRA 4Z95L 1MHEB 2XV6B 4RGNB 4E9LA 1QRNB 3RY6C 4RISH 4OCWH 3ZDYF 1OD9A 3GMNB 2AXFB 3HE7A 3AS2A 4WY7H 3ZDZE 5EOQL 1J12A 5I8CA 3MGTB 4Y4FD 1XIWC 2YMXH 4D9QE 4NC0B 3KLDA 1FSKC 4HZAA 4HS6A 5K59F 1JYVA 4EIGB 4KTDH 5HHMD 5D72H 5IB3B 3GSOB 1NC4B 1BVZA 1G7HA 4G42A 1T22A 5HDLA 4ZD3L 1CQKA 1NCBH 1AR1C 1KCVL 1TCRA 3PHSA 4FTVE 5DMKB 1ZVYA 3GSRA 5E2TH 3RTQD 3O6FB 4XPFL 5IESL 1K4DB 4QXGH 1LHZA 3ZHLA 3GSWB 5DUML 1K8DB 2YSSA 2NY2C 4MJIE 1XGYL 2IFFH 1T66C 5HYJE 1VGKA 1ZA3A 4JJ5B 1MWAA 2YEZB 5EIVA 1HXYA 3CFEA 3HE6D 1KCUH 4JFDE 3BEWB 4GKZA 4X4XA 5E2WL 1U91B 1GIGL 4BFGA 1BOGA 4YK4C 4MDJA 1FLTX 4LMQE 1AI1H 1JHTA 1A7NH 5C0BE 4AEFA 1K2DA 4TUJA 4LQFH 1G9ML 1R3IL 4Y2DA 1BF8A 3CAFA 5F1NB 2R0WH 1TVDA 3O41A 3KAAA 1I9IL 2X4UB 4PJHF 3RIFK 4HUVA 1X5HA 3KPMB 1TVHB 1UKTA 4P2OC 1RHHA 2L0DA 3WUWA 1BQHG 5LBSL 3O81A 3AU1A 4YHOH 1EBAA 4HWBL 4NKOB 4XNXH 3SGDH 5HHPB 3VWKD 4FQQB 4Z7VB 1A7QL 1WIOA 5I1HH 4XGZB 3QUXD 3MJ9A 2QSCH 1NJ9A 5EULV 3D18A 1NFDF 4E42A 2IWGA 4X6CB 4NRZB 1WAAF 1OF2A 4KKBC 4P5TD 3TO2B 1YDPB 4L8CA 2X4QB 5GJSH 4POYA 4OIAA 4PG9A 1HCFX 3A6BL 4YXLL 2AABH 2VDMH 4OB5L 5IW6A 4WV1C 5GRUL 5E03A 1JPFA 5SX4I 2WUCH 5EOCH 4D9RD 4K71C 5CEXB 1NAML 2WBJD 3IU3A 3EFFA 5KBNC 4HKBA 3UYOD 3JWOL 3BZDA 4GW5B 1TZIB 3GI8H 5I8KH 5CJXA 1T7ZA 1HOCB 3OJMB 2X1XR 2D4DA 1FC1A 4KUCF 4H26A 2C4FU 2FEDD 4JFYA 3EDFA 2ATPB 4Q58C 4JZNA 1H5BC 5CILL 1VPOL 3PQYD 1RK1A 3OPZH 5C8JB 3CDGB 4OF3A 4XI5D 3QBTB 4QGTA 4J6RL 2AK1H 5CMAB 5HVGB 4IMLB 2FJGB 4L5FL 3S36X 3DV4A 3ZDYE 4NM8L 3UJJL 1SYVB 1CLOL 2VDRL 1VA9A 3LN9A 2ZNWA 3HUJA 5C6TH 4WNQA 1YNLH 2VRAA 2E7CA 3IF1A 1WK0A 4P4KC 4JO2L 2IANE 2O5YL 4DAGH 4LNRA 5E4IA 3LN4B 4Z7OF 1P9MC 4BH8B 5HYSA 4NJAH 4UB0H 4RBPK 2DRUA 3RZCA 1XIWD 4L3CB 1E27B 3BKCH 5LGJB 2QHRL 5I1IL 5AD0A 3VFSB 4WGVB 3AM8A 5F21B 2G5BA 2XTJE 1R6VA 2C26A 3ULUE 5I8OL 1JYWA 4OM0L 1QACA 3U7WH 3QNYB 1F3RB 3OJDB 1FNGB 1AR1D 4F8QA 3QULB 3V0VA 1F3DH 4Y1AE 4ZO6A 3TV3L 3L3JB 1CU4L 5T1KA 3UTTD 1JZ7A 3MJGX 4I9WD 5BS0B 4OD2A 1V7MH 4M7KH 2E7HA 2A74A 5DQJB 4P2RB 1T66D 1AJ7H 1U2CA 2YD9A 2ITDB 5DJCA 5IK3B 3H3PL 4MWFA 5F72S 4LCWD 3D6GA 4PJHE 1VACA 4Y8DC 3VXRE 3OB0H 4UTBH 4MJ5B 3RUGA 3T2QA 3B4NA 4NQEB 3UPAA 4HKZB 4NO2B 1FFOA 3U4EB 4HAGA 3LKSB 5D70H 3DVNB 1A1OB 5FCUH 3H3KA 3EYOA 4I2XE 1RZ7L 4QYOB 1A7OL 2QADB 5I66B 3T4AA 2J8UA 3PGDB 5FHBL 1NEZB 1KTRL 1IRAY 2ZSWB 5DD3L 1PG7H 2JELL 1ZKAA 1F58L 4WFHD 1CD0A 1RJLA 5TDOA 2ZWLT 3S5LA 3FB5B 1W0WB 1PVHA 1UCBH 3GSVB 3MREA 4CJ0A 1F2XK 3IAQA 4UOW1 5IWLA 3ARDB 2DKUA 5GGUA 3BUTA 2YZ1A 3WE6B 4PJIA 1G9NL 4C54A 5DFVD 2M1KA 2IFGA 5ALCL 3RVWC 4KFZC 3NH7L 4KKBD 2ZZUT 1PKOA 1EO8H 2A9NH 5DJDB 3UYRL 4PJ8C 1B0GA 1EEYA 4I0KA 4L4TD 3WJLA 1XCQA 4YFEA 5GXBB 5JLZA 2C1OB 1U8OA 4X7DC 3K4ZA 4TRPH 2FGZA 3F7QA 1I4FA 2NY3C 5SX5K 3S9DB 5I9QC 3V4PL 3NABH 5DUBA 3V6ZA 3HI5L 1T83A 3C09C 2V2XA 3D9AL 1QKZL 2DBJA 5ETUA 4PRIB 1UM4H 4I13B 1LVEA 3I6GA 4MD4A 1CE6B 4DOHE 1NFDB 3VI4F 5HGDB 3GMMB 3MRNB 2FLRT 1AO7A 2YD8A 5JIKA 4KTEH 4Z76A 1L4IA 3FFDA 1J1PH 3BZ4B 1BVLA 2HFEA 5CFHA 3BISA 5E94B 1QD0A 5D1ZA 4XRCA 4ONGL 3WXVL 1KNOB 3NIGF 3K8LA 1MCKA 3V4UH 5SWQB 1XFPA 3HFML 3ROOB 5DRXA 5C09D 3R8QA 3P2TA 3QFJD 3HI1A 4WDIB 1QSEA 4LSRH 2XZAL 4I48A 3RU8L 1FO0H 4N1HB 32C2A 5ERWA 1H3WM 4ZFFB 3B9DA 1CF8L 4P4KD 2LABA 3CGTA 4ZNEA 4J8RB 1MF2H 5DJXB 3MRPA 3U1SL 4U1KB 2DLFL 4GLRH 3PIQB 4JHWH 1J1XH 1Q1JL 4UQ2B 1HHGA 1MRCL 4MCZB 3IT8D 5HGHB 1T6WA 1QR1A 3KGRA 4YE4L 4ZFOA 2BNQA 3QEQA 1S5IL 4J3UA 1QHOA 5FM8A 2N7BA 3CDYA 3NFPA 4L29B 1NMBH 5C0GB 1TNNA 3QIUA 2OL3L 4PFEA 1OSPL 3BYYA 4WWKB 2GY7B 4PJAE 4UT9L 2CJUL 1OGAD 5H37H 1YPZB 1I8KA 1QUNA 1V05A 1ZA6B 5GGRA 5GIRA 4P2QD 2A83B 1CQYA 3P77A 1D5ZA 2OTUB 2LAAA 1N5AA 4LARH 1AGEA 3RVVC 3QUKB 4WFGE 1RK0B 4WTXA 4WU7A 1YEDB 1LGVA 4HGWB 2VXUL 5D7LD 4P99A 4Y5XA 4PB0L 7FABH 5BVJA 5CEZL 1FP5A 1W72B 4HX1B 4GAGH 4FFYL 3LQZB 2JIXB 2VL4A 4F37K 3KYNB 3EYSL 5TPWH 3RHWK 4IRZH 1OP3H 3GZKA 3G9VA 5IF0A 5IHBA 3CFBA 4L4VD 5D6CA 3K1DA 4G8FA 4PY8I 1HNGA 1J0HA 2R1XA 3C6SA 1T1XA 2OJEA 1A6WL 1IC5L 5J9PB 1V7NL 2LVEA 5FKAB 5HPMB 1CG9B 2HFTA 3NFNA 4AL8L 1J7VR 3VGAB 4NBXB 1HE7A 4JRXE 3S34H 1AD9B 5CD3B 4FTVA 5KN5B 1QLFB 1QA9A 1FAIL 1JPGB 2G9HA 5J12B 3HPJB 3MRHA 4YEEA 2DQIH 1OQXA 4NWTH 1G7JA 3HMWH 3AY4C 4MJIA 4PJ8D 1CE1L 4WJ5A 4F7CA 5HYJA 5E9DE 4X98A 4ODWA 2VUYA 2OXGA 3FO2A 2VLKD 2GSIA 3RDTA 2X1PA 3MR9B 1L7TH 4LLDA 4JFDA 4KVCL 4U6XA 5IW1A 5EU5A 1DBJL 5IV2A 4DGIL 5CUSL 1PW3A 2MMXA 4TQEL 1P4IH 1MFEH 1XGUB 1YNTA 4Q9BA 5C0BA 3EJJX 4XC3H 4R3SA 3RI5K 4FQCH 25C8L 4MQTB 2CGRL 1KN4H 1UH2A 1NBVL 4N0FB 1NMCB 1MJ8H 2XICA 3CH1B 1XZ0A 2FWOA 4OKDA 1UZ6F 4NZTL 4TUKL 1MQKL 1RURL 1AP2B 1PEWA 3L3HB 1C1EL 5KS9F 2ZUVA 5HGBB 4F3FB 4ODTL 4YDVA 5CZXC 3SKOB 3SOBH 5C6PB 1Z5LB 3TVMB 3SDYL 2I9LB 5CJQL 5IQ7L 4PG2A 3QI9B 9CGTA 4J1UA 4N90D 3OAUH 4NC2B 4DTGL 7CGTA 1A7RL 4ZPTB 1MH5B 2QKIA 4LCIH 4ETYA 2VR5A 2E7LA 5FKPA 2X4PA 1DEEB 3INUL 2FJHB 3F12A 2CLVA 3JWOC 4GMTL 2ZCLH 4PRNA 4TUOA 4PRAB 5DVLA 3QUZD 2BJMH 4J23A 1RUKL 3QQ3A 3FO9A 2FO4B 3WFEL 1CFTA 4QRRE 4UTAL 4GQPH 4M7JH 3O8XC 4JGJA 4ISVB 1JGLH 4Z7UE 1BREA 5C07B 3AROA 3WJJA 2X2YA 4NOBA 4P23B 1NCDH 4QOKB 2V7NA 4JM2B 1NGQL 3RQ3A 5F89A 4NKIL 3RVVD 2NNAA 3OX8B 5MENB 3VXUB 5FDYA 4TPRH 5J57B 2VAJA 1A9BB 3T4YB 1M05B 3LQAL 5TGBA 1BEYL 4P0DA 2YC1B 3QDJD 2VDLH 3IKKA 2PXYA 4H8WC 2IANA 4M43L 3MLSL 1X5JA 5E5RB 2XOTA 3Q5OA 3DYOA 3QWRA 1Q9LB 3O2DA 4MNGE 4HS3B 4HWEL 4P59H 5F6IC 2VR4A 4H1LB 4X7TA 3TA3C 3ZE2E 5IBUG 3ZSSA 1T3FA 2F58L 2ERJB 4HLJA 3S35L 2BX5A 4NBYB 2ZUUA 1S8DB 1AE6L 5GRVL 5L0QC 3HG1D 3RWEA 3NZHH 4XNYH 2E8ZA 1LDPL 5ESVA 3UROR 4KVNH 3SDAB 4Q2ZB 5KVDL 4N9GB 4XNZB 5LQBL 3MJ8A 1MEXL 5D93B 2Y9RT 4Y1AA 4XBEL 4YUEL 2YRLA 4DKFL 3B6SA 5INDB 3PXJA 4YBLC 5T33H 2X1OA 4PR5B 2OR8A 5E2UH 5BRZD 2DQHL 4JAMA 1WIUA 4APQB 4YNYA 3TYFB 2Y72A 2DS4A 4GKOA 3OKEB 1AIFB 3KXFB 3OTTA 1UG9A 4L3EB 4HG4K 2IPKA 1EJOL 4GW4A 1FVDA 1FRGH 3GIZL 4R7NB 5MEQB 4PJHA 3MLZH 3VXRA 5HVHB 2B1AH 1UZ6E 4G6JL 3LEVH 2B20A 3O3BA 2I07A 3P0YL 5DJ6B 5IJKC 1TJGH 4RIRB 2ADIA 4XBGB 4ODSL 5EU6E 2P8MA 1J05A 5LCVL 3G04B 1ORSB 4BZ1H 2ADGB 4I2XA 3TPUB 1A6TA 1DQQA 4M8QB 2GW5A 3QIBD 4G6AC 1S7RA 3L5IA 4CUCA 4MB4A 4AQOA 4NNPH 3QIWB 5TE7H 2IEPA 3ARGA 1I1YA 4OFYA 4BH7B 1XR8B 4IRSC 1T5WB 5I1DB 4K8RL 4UAOB 4DKEH 2VERN 4MJ6B 4WW1B 3QCTL 3LEXB 3FFCD 3LPFA 3X12A 4N8VB 2Q8AH 3KR3H 1C5BH 2G2RB 3T1WA 5CZVH 1FL3B 3NBNA 2Z92B 5IMMB 1UEYA 4MXWL 1QBAA 1G9NC 3OZ9L 5CZXD 1P5VA 4DQOL 4RZCA 3ROLB 2CKBA 1BIIA 3QUML 4NWUL 1IAMA 4M4PA 5DF0A 5D2LF 5E7BA 2JTDA 3BX7C 1F6FB 2C3WA 4NO3A 1S7QA 2GFBB 5ILTL 1WCQA 2IPUG 3O4LD 2RIKA 3CFJA 3FQRB 2BZDA 3KYMB 1BBDH 2UZYB 2PUQT 3TO4D 5KS9B 1FC2D 4LPUA 4QRQB 2YPLD 3L3OA 1I8LA 3TH4T 4RSVA 3BO8B 4RGOH 1IC7H 4UDTB 4BM7A 3DO7A 5IFJA 3O8XD 3O6LH 4MAYC 3MRMA 3D3VB 4AIXA 4X80L 2EH8L 3MFFA 3PHOB 4G8GB 4LHUG 5JORA 3EOAB 1AHWC 3AC0A 4K7PY 1E28B 5EUKA 1PSKL 5C0FA 3MJ6A 3BPCB 3WIHH 3SCMA 4JB9L 4ZFZA 1XF4B 2HG5B 1XGRA 3C6LA 3PP3K 1I1CA 5C0DB 5DJ2A 4PB9L 3WFDL 4DZ8B 1LD9B 2ZG1A 1Q0XH 1FL6B 2PYEE 3U2SA 4AQ1B 4GG6F 2XZCH 4AEEA 5D6DA 3MOAL 5F7WC 2AK4D 1JWUB 3EYVA 4HWZA 3SN6N 4OF7A 1FIGL 2BY2A 3NPSB 4GFTB 2IAMA 1FVCA 2D9QB 3VWJA 3ARQA 3O4OB 4NGHL 1JMZA 1GHFL 2JJSA 3DRQA 4OZHF 4BQ6A 1S5HA 1TJIL 5LG1A 3VDBA 1QFUH 1KPRB 4W6YB 4LP5A 2IH3B 3EW3B 2V9RA 2O5ZL 1UB6B 1TMCB 3HCVB 2P42B 1A0QH 3W9DA 4X8JB 4U1GC 1SY6A 5F8RC 3GSNH 3U46B 4PJAA 4QF1B 3TN0B 5T1LD 5JZ7C 1RVFL 5IB4A 3P40A 3H7BB 2CXKA 1XF3B 4YHNB 3MRLA 3WIFA 2CLZB 3NGBC 3UJIH 4LVHC 1OB1B 4PJ5E 2BCKB 4NP4H 4KXZH 4R4BB 5LJYH 1TETL 2R1WA 5TQ2H 5HYFA 2EKJA 1U3HA 1HEZB 1CDGA 2HT2C 2NY6D 2Y1VA 3FAWA 5BZDB 3TNMA 4L8BA 4LL9A 4ZNCD 1WWCA 2JB5L 1J18A 5ENWA 1FDLL 1H3PL 1S9YB 1ZT4A 4OKVA 3ULVL 2DQFB 3BP6B 5D7KD 5KW9L 2EEBA 5IIEA 1R3LA 3IDJB 4ZUTA 3DV6A 1KIQB 4IRSD 3BEVB 3I75A 1C7SA 5J06A 1DN0A 4YDIL 2X10A 3HLAB 1JK8A 1JHKH 3KPRE 4JRXA 4ZAKB 1CXLA 3P4NB 1PKQE 4WEUD 4Z95H 5IEHB 5E5UB 1VEMA 4HKXA 4KQ4L 3D1MC 5J1AB 2Q76A 5HHME 1WTGT 4WI2A 3DUUB 3CVHL 3VE0A 1D5IL 2I25N 2VC2L 3E2HB 4HUXA 1U8JA 4LRIA 5GRJH 2BC4B 2ZP0T 4YQXH 3K2MC 3CFKA 4GAJH 1SEBA 2WIIB 4YH6A 4KHXL 3WO4B 4D3CL 3BPOB 4TTDD 2O61B 1BGXL 1KCVH 1JCKA 4WFEE 3X17A 2Q86A 1IZJA 4XPFH 3QXDB 5IESH 5J11C 3PL6C 5CCKL 5KSUB 3H3BC 1OP3K 1A4JB 4PP2A 4LSUL 1ACYL 1N6QL 5GGSA 2Y07L 5D2LB 2D9CA 4OGAC 5JTWA 2JK5A 1LE9A 2AQ3A 2YOCA 1EFXA 4U4BA 1BMGA 1CD1B 4M9OA 4ZDHA 3VXNB 1RUQL 4B50A 3T2OA 3CZFA 4G6FD 3IRPX 1QO3A 5DRWB 4UOJA 1X5YA 1RIUL 2DIAA 2VDNL 1R3IH 4HFUL 3V7AE 3PV6B 3EYUL 4BSWB 4N68A 5E99L 1Q9OB 3IVKB 3KYOA 3D87B 3RX5A 1I9RH 3G6DL 3CZJA 1CGYA 3QNZB 3ZE0E 5ISZB 3BQUD 3SDXF 5E6IC 4P46D 5LBSH 4HC1H 2FD6L 4R2GB 5CGTA 3G5VA 3MV11 4HWBH 3HAEA 3QHZH 4EXKA 43CAB 5IHUH 1TCMA 1A7QH 3D25A 4K7PX 5JMRA 5E8EB 3DUSB 4BFIB 2EC9T 1HHHB 4FMFA 4IMKA 3MRIA 2Z31D 2K7QA 1C5CL 2R2BB 2H32A 1CFBA 4QRRA 4D9RE 2ZSVA 4PGBB 3BIBX 3F58L 4FABH 2KQNA 2WNGA 4NUJA 5FYJL 3TPKA 4GG6B 3VG0L 4Z7UA 2X4RB 3CC5A 3GMQB 5FM5O 1ZT1B 3U9PL 5E6ZA 2OK0L 1L9NA 4XNQB 4U1JA 4U1SB 4NC1E 1N8ZA 4GXUN 5C0CD 1RJYB 5BVPL 3V4VL 1R3HB 1MHCB 2ICEB 2IQ9H 4OZHB 2H1PL 3A67H 4WO4D 1ZK9A 3GSXA 2AJYL 2HT2D 4GSDH 5FUOL 5EN2B 5CEZD 1HXMA 1CZ8L 5I2IA 1NKRA 3LQAC 3TZVC 2R39A 4WCYL 2AKRB 2DBLL 4OTXL 2CK2A 5DZLA 5CILH 1VPOH 3HRZB 4MNGA 1ODAA 3HNVL 1KIRB 2BOBA 4V2CB 4L5FH 3A0OA 3Q3GA 4MA3B 5I1CH 4OLVL 5ADPH 1JE6A 1CLOH 2VDRH 4I18C 2F5AH 2BNRD 1WFNA 4Y4HB 3O6KH 1FG9C 4A6YL 3ECBA 3ILPB 4JN1H 3I6KA 5CINL 2BXYA 3BWAA 4JO2H 3SGJC 1G6RB 4GMSH 3T8XB 2O5YH 4POUB 5JNYA 4H8WH 1U8HB 3PQYB 1KLGA 1PAMA 3VD3A 2YR3A 3MV8B 3C2AH 2QHRH 2L7JA 5I1IH 5BO1L 1LE5A 1JYXA 4WU5B 1ZGLB 3MGOA 3N1PC 4PJ9D 5D7JC 2D7NA 3L3IA 1R24A 3UTTE 2C3VA 2D2OA 3BPLC 1F6LL 4I9WE 5ESQA 1G7LA 4P3DB 4G6KL 4LHQB 1JGDA 2BSSA 1LMKA 5EU6A 1FNEB 4Z0BL 3BDYL 5DEFB 2VOTA 3PL6D 3MRKA 3QNXB 4KKCC 4LCWE 3VXTB 2DM2A 2BVQA 3KNBA 1KB5L 4Z76B 2EDEA 5IMKA 1RJCA 1G7QA 5D9SA 4Y5YC 1JFQH 3NIDF 4OGAD 4FP8H 3RP1A 1KPUA 1E0OB 4K8RC 2PCPB 3TNNB 1UWGL 2MJWA 3RA7L 3QDGE 2FEEI 4ZPVB 3ZT6A 5B38G 1J86A 3O3UN 4K9EH 4NZUH 3S4SA 3MYJB 5FECA 4U2ZA 3SPVB 1PY4A 1MUJA 2A6DB 4EDWH 3TH2T 3GHEL 4LLYB 2VN4A 4DCQA 1G84A 1Z6JT 3RNQA 1RZ7H 1HILA 4XWOD 3UC0H 4OFIA 1RIHH 3MRPB 3QXWA 2P7TB 1MSPA 3VXQA 1UH4A 2VDKL 2NLJA 5E6ID 4JFFE 4OUUB 2ZOKA 3G6JF 3BT2H 5DURD 3SE3C 4G7VL 5ACZA 2XYCA 4IOIA 1XCTA 4LF3A 2LFGA 1QSVA 3DGGB 2ARJB 5I75B 3RIFF 3ARFA 2FR4A 4AH2A 4L4TE 4NHCL 5ALBL 1V3JA 2XG5A 3DVGB 3QAZB 1U8NB 4S10A 5T5NF 1G9NH 3EDKA 3BH8A 3OJ2C 4TNVF 3FN9A 3UYRH 3W0WB 2BHZA 3SDXB 4MA8L 4M7LL 4NKDA 5FEBA 2EDQA 3OKLB 4S1QL 2FRGP 5D2NC 5JW4Q 4YHLH 4PTUA 2JJWA 4NFBA 1XR9B 4QHLB 4LKCB 2WLYA 1OM3L 4O2FA 4OGZA 1QKZH 4M6AA 1MCRA 3GRWL 1J0KA 5D1QA 3J7HA 1DDHB 4O2CA 4N0RA 3TZVD 3UTPD 5A2IH 3SGKA 3TJHC 5BJTB 1AGBA 4ORGB 5JUEL 4FNLL 5C09E 1T0MB 5D1XC 4PJXE 4D0CA 5D5MF 3UPRB 3QFJE 4M8VA 5IM7A 1J8HE 2AV7A 4ONGH 3WXVH 1J1OL 1H8SA 3HFMH 5HHNA 4NRYA 4ZS7H 4YDKL 5HYQA 4P2YA 4FMKA 3VXSD 4UT7H 3TT3L 1ONQB 1G0XA 2XZAH 1FBIH 4QXUH 3RU8H 3SDCB 2EH7L 1S7UA 5B3NA 3THMH 1YY8B 1DQML 5DHYA 5I18L 2RGSA 1U6AH 3WS6C 1AQDA 3PDOB 2DLFH 4X0KB 1Q1JH 1R5IB 4PJ5A 2VKWA 3VFOA 4LRNH 1MRCH 4XP6H 4YHML 4KDTC 2GSIB 4YE4H 4JFDB 1OY3B 3P4MA 4I3SH 1YYML 1S5IH 2AJZB 4S0TD 4Y16A 1BZ9B 4P2QE 2KZWA 2BMKA 4PREB 5E8OB 5IKCA 3ZLQC 4LPYA 3MYZA 2OL3H 2EDLA 1JF1B 5IUSA 5KSBF 5L88H 5EBWB 5F6HJ 2BP3A 2O93L 1E6JL 3ULVC 5JPMA 4P5MA 2MCPL 5IVOA 1JTPA 5DD5H 3MO1B 3ALXA 2DD8H 1ZANL 3L3DB 3M45A 4FXKB 4KKCD 4OQ1A 4X5WB 1QLRA 5D7LE 4E5XA 5E4EB 2JCCF 1VEPA 4UINL 4ZS6D 1ACZA 1R5VA 2W91A 2XG4A 3VD7A 1LK3L 3HR5A 2VXQL 4K8RD 5GRWA 2EE6A 1U8PB 3ZKSD 3WHE1 4PB0H 4JZJA 3KPRA 2R0LL 5CEZH 4Y4FA 4FFYH 3EOBB 2OR7A 1PKQA 3G6JE 2Y5TA 4U2YA 1QZ1A 3ME0A 3MLWL 4P9ML 4H5SA 5J3HC 1OGAB 4TULL 4LCUA 3CCHA 2GHWB 2CRMA 1FFRA 5GISL 3RL2B 3T2NL 4NQDE 3BD4A 1SVZA 4U33A 3KPNA 2HKFH 4IRJB 3RTQA 1V7NH 4QHNA 5AUMB 1GGIL 3CX5K 4Q9RL 1FV1B 2IBZY 1X6NA 5EU3A 5EWIH 5KSAD 1NANH 4NCDA 4WEBL 4C59B 3ZTJG 5HY9A 5MEPA 1Y18A 1FAIH 3W2DL 1J87A 1JPTL 1ZT7A 3HE6A 1LO3L 4U0RB 1EK3A 4NQXB 3N1QC 1GGYA 4QWWC 1CE1H 4OCYL 3QO0A 4P9HC 5KSVA 1P4BL 1WT5A 3O2VL 4L4VB 3W9EB 2HP4A 5ICXB 1WFOA 1FO0A 5IJVB 5L8KB 2R4RL 3O3EA 3O9WC 4TQEH 1IMHC 1FPTH 1GOFA 2YK1L 4TVPL 4EIZC 3FOMB 4PS4L 3RL1B 1NBVH 5FO9B 1P7QD 3MXWH 3VWKA 1O7SA 1C08B 3TJHD 3U30C 2EDWA 2F74B 1DUYB 5C0AD 4NZTH 1X4YA 2OSLA 3QUXA 5D1XD 1X5FA 3P4LA 4XPHL 1M7DA 4XCCH 2Q3ZA 3Q5TA 1C1EH 3JSSA 2VLKB 3MUJA 1DLFL 2OZ4L 5JMOC 1KT2A 4P5TA 4JQIL 4HJGA 4JHBA 5GGVL 4N90E 3WS3B 4LLQB 3NA9L 2VAAB 1HHIA 4QO1A 5ACLA 1I1AC 1FG2B 1NBZB 1F97A 5H2BA 4JQXA 5IQ7H 8FABA 1IAIL 1NUGA 4YHYB 1WSST 1NCWH 4F7EB 5L2KD 2Y4SA 3QDHA 5I73B 5D5MB 3L1OH 1N2RA 4FQIH 5KSBE 1IZKA 4HJJH 4YZFF 4WW2F 2VIRB 3SKNA 5JOEA 3V6OC 5TDPB 3B2VL 4L9LA 5DRZA 4GMTH 1RZIA 1TFHA 4R0LB 4S2SB 3U6RA 3SGDI 4ELMF 4PJFE 1RUKH 1JZ4A 3KPSB 2ADIB 3P0VL 3NFSL 1RULL 1BLNB 4IJ3B 4NNYA 4UTAH 2PW1B 2EXYC 3ULVD 3ETBF 3PWVA 5DWUH 3VH8A 4PJCF 2C3GA 3JV5A 3LPGA 1FAKT 1UWXK 1A5FH 3D0LA 5SWSE 3TP4A 1MNUL 2F53D 2HFFB 5HHXL 4JKPL 4NKIH 1I1YB 3CFIC 1P1ZB 4JFZL 5F7LB 5JDSB 4G9FD 5C3LD 3KPLB 3RWFA 3RY6A 4HZLB 2D31B 3V5HA 3QUZB 4HDIB 3LQAH 1XIWA 3BDXA 4OZFB 3DURB 5C08D 2FLBT 3WNMA 1KYOK 4M43H 4XPBL 3REWA 2P8LA 2H8PA 3VGFA 2Y06L 5FYLH 2JCCB 4HWEH 4LFHD 5CJOH 4OLUL 3UX9B 4MNQD 3HTLX 1HQ4A 3G5YB 2DLHA 4TVSa 1AE6H 5KJRH 1RZ8A 3VFVB 5BOPA 4F37F 4XNMA 3UTTA 4KJYB 2HVKB 3X3GL 5BRZE 3Q6GH 3VD5A 1CDJA 2M26A 1HN1A 2W9EL 2ZUQC 3VFGL 4MVBC 1G6VK 3VU2A 2FX8H 5EUOF 4DKFH 4DOHB 3M1BB 4EQ2A 3DTXB 2DN7A 2DQTH 4C56D 3I84A 3QDJB 2DQHH 3BN3B 4LCWA 1U36A 3RVXD 1KG0B 1QVOB 2PTVA 4QWWD 1UA6L 4X6BB 1LO5B 5DI8A 1ERNA 1VENA 1CICB 1W0VA 2XKSA 1CR9H 3GIZH 3DXAD 4MD5B 3QDGA 4X5XB 4RFOL 1D5MB 3HG1B 1KXVC 1ADQH 4G6JH 4E41B 3P0YH 3O9WD 5JOFB 3MJ7A 4P2OA 2IBZX 5I76B 3NA4A 4ODSH 1MVFA 5FDWB 4X99A 4AIZA 2CRYA 4RFNB 1VFMA 5FA4B 5EC1B 4G43B 4MZ3A 3PABB 4LGSB 3V2AR 2MHAB 4JFFA 3RX8A 4KMTH 3QRGH 4H20H 1YQVH 3D85B 4K8RH 5GPRA 5HYSG 3I02B 4K94L 5CJ5A 1JF6A 1JZ8A 2F8XC 3FT2B 2HJFB 3S8WA 5EC2A 1B6DA 4EBQL 3TIDB 3FRUB 1KLUB 4L4TA 4GKNB 4MXWH 4DQOH 4LEOA 1BJ1H 1TJHL 3O4LE 3Q1SH 3QUMH 4WV1A 2I26N 5EBMB 4NWUH 4ZOEA 5FYJD 5IB4B 2ZUSA 3EGSA 2DB8A 5I19H 3EOYG 3RWHB 1QSFD 1YN6B 2YPLE 4AG4L 1JTTA 2AS5M 3NIFF 1UB5A 1TPXC 1BQHA 3GIVB 1NH6A 1QFWM 2IGFH 3AAZA 4PBXA 1D6EA 1OSZA 3DLQR 4PJCE 3FFCB 3CFDA 1H5BA 3NZ8B 2JJVA 1MCNA 1NGXA 5C2UB 4IOFD 4GKSA 3JUZA 3Q0HA 1FZMB 2R2HB 4MXQD 1NFIB 3MUY1 1T1YA 5BCAA 4YAQB 2EXYD 4ZUUA 1A6UL 1UQSA 2HA1A 3DUHA 3VFTA 1GGUA 2EYRA 3FQXB 2PO6D 4GAFB 4OLXL 5C09A 4PJXA 4F7TB 1BQSA 4LVNB 4PV8B 3QFJA 3S96B 2GUOB 1J8HA 1JWMA 4PJDB 3RAJL 1R3LB 1ZLSL 4I3RH 1PSKH 4WW2B 3QCVH 3MNZB 5J89A 5H35A 4RQQA 5FM5M 4JB9H 4P4KA 5EO9A 1U8KB 2N4IA 1J9CT 3MRGA 1HH9A 3TO4B 5B39A 3PJSA 4PB9H 3WFDH 2BSED 1P9MA 2VISA 4ZYKB 3W39B 4PJGF 4OZ4A 3S5LG 2X1WL 3IETA 3JWDC 4DGVH 4HIIA 4MX7A 1FFPB 1FHGA 3ALPA 2Z8SA 4CMHC 4RDQG 3ULSA 3F7VA 5E9DB 3VFNA 4NDMA 4PIRF 2UZIH 5CP7A 1HHKB 4NO0D 5J0BA 5I74B 3H9SD 1CFNA 1F4XL 3CU1A 2G60H 4NQCD 1KOAA 3FQUB 1VFAB 4OCSL 1BZQK 5CHNB 1U95B 4WFFE 3OKDA 2PN5A 1TJIH 2AEPH 4FQPA 3QA3B 1JPSL 4PRBB 4P2QA 2XZQL 2WP3O 2EDJA 2OTWA 3DX7A 1YMMB 3ZKXB 3K1KC 1KPVB 4MVBD 4JCLA 4PGEA 1RVFH 4U3CA 1AFVL 3W11D 3C08L 5C86A 2Q8BL 3MV7D 5EOTA 3HZYB 4D9LL 2P43B 1DCLA 3P30H 2AK4B 5D7LA 5CKAA 2B8OT 5D7IF 4JR9L 4MAUL 3U4AA 4Y7MA 3MSPA 4RX4D 5EZOL 2NY4C 4XBPB 1NPUA 4GLRI 1TETH 4L1DA 3GMOB 5T3ZH 1GC1L 3BH9A 1LO2L 1IVLA 1ZE3C 5L2JA 4GS7C 5HHQB 5ACMA 4QT5A 5D7KE 4JG0L 1Z9LA 4PRPD 5EIIB 3T08A 2DTSA 5I1EL 5JQ6L 2IPUK 5DK2A 4JDVB 3CFCL 1R5WB 5TF0A 3G6JA 1NCAL 5EUOB 1H3PH 1RFDL 1RJZB 4D2NA 1JI1A 2IMNA 4EN3D 3SE8L 5KW9H 4HS8L 5KG9B 4G9DA 5MEOA 1K8IA 3FB6B 4NQDA 4U7MA 4M62L 4OV6F 4YFDB 4LHJB 4ESKA 4R4FL 1CIDA 1YYLL 3C60B 3AXLA 2Q7YB 4KWUA 1NGPL 1EHXA 3VFMB 1HKLH 3RFZC 5IR1A 4YDIH 3S36L 2F19L 3HHRB 2NY6B 1NMAH 4PJ8A 3NIFE 3UZQA 2P48B 1I7UA 5SWZB 1T7YA 4LASH 4JFPA 4YFLI 4Y2OA 3CVHH 3WIHA 2ZKHL 2VC2H 1JNHA 5BQ7A 4O02L 3I3DA 1MVUA 4NN7C 2VLRD 4I0PD 2MNUA 2ENYA 1KBGL 1SM3L 3VFPA 3WD5L 1FZJB 3HB3D 3EJYC 4R6UA 1A1NB 3ELAT 3B5GA 1BGXH 3GSXB 1X4XA 3FOLB 4UIMB 1UJ3B 3RWJB 1FFQA 2NMSA 5DGRA 3T0EC 1WBXB 3QCUL 4WI8A 2RFXA 3BJLA 3OKOA 2H2PC 4OT1H 1P5UA 4CADB 3ZHKA 1IL1B 4LSUH 1ACYH 1N6QH 5C0JA 4KAQH 4YHZH 4ZXBD 3VFRB 1NL0L 1W72L 1TQBC 1DVFB 5DEGA 2DKMA 2NY7H 4P9HH 4RGNC 1HSBA 1OTSC 3LB6C 2DLGA 4QEGA 2AJ3A 3GSNA 4D94A 4F2MB 1A6ZB 1X5LA 2LU3A 3DIFA 2J8HA 2VDNH 4R7DA 5DT1L 1ITCA 3EYUH 3K81A 4FFZL 3C8KA 4OLWL 2NX5E 3C5SA 5IOPA 4YR6B 1AGDA 3G6DH 2DAVA 2DM3A 2VLJB 3UBXB 1I85C 1CLYL 4JKWA 2AP2A 4TN9A 3O6FC 3KHOA 2ADFH 1L7IL 3IJYB 2OMBA 2FD6H 2AQ1A 3EO0B 3OXRA 5KSBA 4LU5L 2H41A 1J10A 4Q0XL 4PJ7F 2E9WA 5EO0B 4U1LA 2P46B 4PJFA 3ARUA 4KZEL 4PJGB 4XNUL 4M9PA 4U49A 4HK0A 2ZG3A 5B3JE 4X4ME 3F5WA 5C0CE 3QQ9C 1N59B 3VG0H 2YXMA 3GGWB 4QTHB 2ZJSH 3P9LB 2GT9A 3CSPA 3D39D 3BQUB 1MELA 5SWSA 1ZLWH 5CEZE 1MI5B 4P46B 2CDFA 4R96B 3VRIA 3MA7B 5FYKH 4NQVA 2EKSA 1JNJA 3QDAA 2NY4D 4RA3A 5F7DB 5EG6C 1EHLH 5ANME 1GGCH 2H1PH 3IFPB 4B5EA 2IBGA 1WVZA 3NAAH 2AJYH 5FUOH 3H9YA 3RBGA 2D03L 4ZFGH 3QDMD 4WCYH 2Z31B 1A02N 4H0IA 5DJ8A 5I8EA 4G5ZL 1GZQA 2NY1B 3NVQA 1S7TA 1BM3H 4W4NA 3PWPE 1EERB 1MCWM 5JOPD 3HNVH 4NKMA 5D7IB 2OQJB 5H94B 2FATL 4OD1L 2ICWJ 4XVUC 3O3DA 4NQSB 2XY2A 5BRZA 4LKXA 3KPTA 1Y6KR 4WO4B 2X4SB 1OGTB 3AY4A 5T3XH 3LH2H 4PGCB 1Q9WA 5CINH 5IFAH 1PZ5B 3C9NB 4I1NB 4Z9KB 1WTLA 4ZOAA 1OLLA 2AGJH 2ED7A 1CCZA 3PDDA 4OIIL 4LPXA 4L4JA 4PRHD 1K5NB 2VZ3A 2VMFA 4RGMB 1JI2A 2Z8RA 1AKJB 3EJYD 3FJTA 3REVA 5HSFA 4UDUB 3WNKA 1MFBL 3QR2A 2J3SA 4KZDL 2W0FA 35C8L 4TVPD 2CIKA 4HC1A 2PYEB 4HWBA 3FHQA 3LIZL 4QXWA 4CW1B 5F93C 2H2PD 5E5MA 4GOSA 1HYRC 2GJ6B 1EVUA 1FLRH 5EO1A 5DD0L 1KJ3L 5E0QA 3LB6D 3N0PB 2P8PA 5DYOA 5IVXF 1UWGH 4K94C 4CVXB 2KH2B 3BUYB 4NRYB 4ODUA 4PJ9B 3HNTL 1ZS8A 1R0AH 1YJDH 3LQMA 3CDCA 4EXPX 5F7KC 3WSQL 4FQJL 2BVOA 5KVEH 1S9VA 2NW3A 1JGVL 1S7UB 4HPYL 3HMXL 3O4LA 3CLEL 1NC4D 4NSKA 1S7WB 4FG6C 1NEZG 1N7MH 4M7ZB 3OKYA 1UZ8A 4XAWH 2VDKH 4JDZA 1YEIL 3VG9B 4ELMA 3O6FD 2YPLA 3MRRB 2R23A 3WNOA 3MMEB 2MWCA 1WZ1L 3KJ6L 3FAXA 4FXGA 4PJCA 4YHPA 5ABDE 3RY5A 3O8XA 3IFLL 1J0IA 5IKCB 3LN5A 3GJFH 4BFBD 4NHCH 2HJKB 5ALBH 4EI5B 3X11B 3DJ9A 1T1WB 1Y0LA 1C16A 4N5UA 4OFDA 1SQ2N 4YXHL 4HWUA 3QQ9D 4DN4L 5IEKA 4G80A 1WCBA 2XA3A 3PE9A 2E6PA 4X6FB 1MJUH 1OAKH 4MA8H 1BFSA 2BSRA 5IB5A 4S1QH 3SJVE 5EZLB 5DK0A 2ARWA 5ID1A 1LO4L 2G5RA 1ORQB 2QADC 1BD2E 5GSRA 1NBYA 2Z4QA 2W0PA 5FYLE 5CD5D 5TQ0L 3U7YL 2GSGB 2R4SL 4JRYB 1X44A 3TA3A 3BKML 3PWUB 4NZDA 3IDXL 1KTLA 4X83A 3ARDC 2GCYA 1V8HA 1D9KB 1H8NA 3KLAA 4FNLH 4AM0B 2VB5A 1IKFL 4OI7A 1ZHLB 2EIBA 1A6VH 4HCRH 3T1FA 1NGZB 1T20B 2NXZB 2VNCA 5BOZG 5A16A 1UKQA 2B4CC 5T1LA 1OWWA 5EBLB 4GBXD 4YDJA 1D5BA 2X6MA 2FYYB 3GK8L 4U6HA 1Z3GL 3RNKB 3TT3H 5ID0A 1LEGB 5HVFB 2XFXB 1HH6B 4N8PA 5CAYB 4H88L 2FL5B 1JN6A 1IAKB 1JGEB 3DX8A 4BYHA 2BRQA 3TBYB 3ZT7A 3JWDH 1DQMH 3CMOH 5JQHC 3IDIA 1OARH 1BPVA 4HXBL 1OTUC 3IDNA 3N9GH 3CSBA 4XPGL 4YHMH 5IJKA 2VH5H 1J11A 5DJYA 5MERB 4XCEB 2B2XL 1GC1C 2RR3A 2XPGB 1YMHB 1YYMH 2HRPL 3P11H 4JY6B 5EORL 1EEZB 4MB3A 2AI0L 1E6JH 3BZEA 4O51A 3QEGL 2MCPH 3WN5B 2YN3A 5IVXE 1E4XI 1U93B 3ULVF 5E56A 4IRSA 3I50H 3GMRB 2DQJL 1CXFA 2DQCL 2GIYA 3HZKB 2BK8A 1FNLA 2OI9B 3UTQA 1LK3H 3MRBA 3R8BB 1QNZH 3SBWC 5L6YL 1JIBA 3ZKQD 5AYUL 4X9IA 5CIPB 3CXDH 4JO3H 1BP3B 3S88L 5E8PA 1DE4A 2A6KA 3M07A 4HJGB 4YPGB 1JYNA 2DYPA 2DQEL 3GSUB 3HC0A 3JV0A 3AREB 3O45B 4D0BA 3GDBA 5EFIA 3VXPB 3ARYA 1U9KA 3L9RA 3MLWH 4EUPH 1F4WL 4OQTL 3B43A 1MJ7H 2RJMA 5I15H 4NT6B 1YECH 1P53A 3NMEA 4MQ7B 2IPTL 2FIKB 2X4NB 5EU4A 5GISH 3JZ7A 3T2NH 4WWKC 1T80A 5E8NA 3AUVA 4U1HA 4JLRB 5IB2B 4MCYA 2ZCHL 4M1GH 4NYLB 2UYLB 5BS0D 1P4LA 3QUYB 4QY8B 1A9EA 1WITA 4Z0XA 3UZVB 3EDEA 4F7MA 3LS5H 1XH3B 4DUWA 4RMSA 1BWWA 4MAYA 3TBVA 5FB8B 3W2DH 4KH2A 4TNWK 1B90A 1JPTH 5IVNA 1AHWA 5D2NE 4QHKJ 5BV7H 5T1DL 2O5XL 4OCYH 1NDMB 5C0EA 1P4BH 2M8XA 3O2VH 2CO6B 4JN2B 4MMXC 4AJ0A 1ZWIB 4GRWH 4GW1B 2CR6A 3PWNB 3U0PB 2V2TA 4L8SC 2A77L 4BUGA 3VI3E 1FCGA 5F7YC 3ZDXF 5EZJA 3GJEB 3X14B 2R4RH 1IC1A 5ADOL 1KENL 3AGVA 5C0AE 1EXUA 2YK1H 4GRMA 4X6DE 5KSAB 4WEMB 4WENB 2YD7A 5AZEH 4Z77A 3G5XB 3VGAC 1MCOH 2E7BA 2NX5A 3RWCA 1G7PB 4HPOH 3ARDD 3HNSL 3MJ9L 2RB8A 1YEEH 2OL3A 5J12C 1INQB 2H9GB 3UTZB 2YUXA 3WEXB 4KU1A 4PYGA 5DSCB 2VO5A 1IARB 2IADA 2F54E 3WXWH 4OLZL 2OZ4H 2I27N 1I3VA 4JQIH 3ES6B 1YN7A 1T1ZA 3NA9H 4N0UA 3FT4B 2XWBA 1XF2A 2C1PA 3MQIA 4HT1L 4X4MA 5C0CA 4PGJA 4G3YL 1LEIB 5T3ZE 1IAIH 1FYTB 2QR0A 1YEGL 2R2CA 1I8IA 3BHBA 3QEUA 4FS0A 4ETQB 1LNUB 1OTUD 3BW9B 2D0GA 5HDBE 1MJJA 4Z5RA 1NMCC 4IEFB 3L7FB 3ZE1E 3N85H 3QDGB 3ULVE 2IH1B 1HHJB 2HTKD 5ANMA 3NACL 2JB6A 1K4CB 2EYSA 3TYGL 3P0VH 3NFSH 5GJTL 2F53E 3WDJA 4LEXL 2G75A 3PWPA 2E6QA 2X89D 1UXSA 4PJEE 3GSQB 1MNUH 2BNRA 2NW2A 4ORZC 1JHLH 4JFFB 3TVMC 3LDBB 5L2KB 2P1YA 1RHFA 2BNUB 4M1DH 3QI9C 3ZMRA 4PUBL 4QXTA 4HUWA 5C08E 5DMIH 2FJFB 2K1MA 1MY7A 1XGTB 5HDOA 3HAEG 1CS6A 2R1YA 1KEML 4NUGL 1U8IB 1KJ2B 1CFVL 1ZHKB 4XP1L 4HUMB 3BKJL 2WINA 2EO9A 5TFSH 3MV01 3DMMB 4XPBH 1B4JL 1ZLWK 5C0IB 1YEKL 4NCC1 1BQLL 4WWKD 2CH8A 5IBLC 2DJSA 1RV6X 1FCCA 4AK1A 2GTWB 2I9TA 3RBSA 3LKQB 3IDGA 1WWAX 2BVPA 3PL6A 4P23C 5C92A 4G9FB 4C56E 1BFOA 2NR6D 2YA2A 4JFXB 1I3GL 1JV5A 2WUBH 1DBML 3VFGH 2ZUYA 5DGQA 2ICES 4JEGB 2A6JA 5IHZB 3MACH 2E7MA 2H3NB 3UJTL 4JPWL 2A6IB 4X9BA 2EYTB 2AEIT 2ITCB 2JIXD 4KI5C 3OF6A 3NCBB 3GMPA 3D2UA 5IT2L 3TWCH 4MNQB 2OS7A 2R2EA 5J6HB 4DZBB 2Y36L 2XQBL 1IGJA 1PEZA 4QCIB 1VHPA 1T4KB 2ERJC 3UEZA 2OXHA 4XMKL 2X9WA 3ARBD 3LAFA 5FF6A 1IM9A 2YBRA 4LSPL 4OZ4B 5E6IA 1A4KB 2YHGA 3IETB 4Z7WE 3VCLB 1T21A 4KK6C 1A1MA 4PJ7A 5CLWA 1NC2B 5M94B 4BK4A 3SDAC 1QOKA 4CBPA 5JPNA 2XWTB 2JJUA 3EYFB 4XNZC 5D93C 1MFCL 5F7HA 2Z91B 3ET9F 2QQLL 2PETA 1G6RL 3N1GC 1JRHI 4APQC 5F9JB 4K94H 4M5YL 3STLB 5IG7B 1Q9KA 2H6PA 2DKSA 1ZVHA 3DXAB 1T89C 4HF5L 1ZEAH 4EBQH 4JFEB 2VXVH 3HS0B 1QSFE 2XTLA 5TF1H 1FZKB 1FIEA 3G08A 5FYKE 4OZIE 5HVHC 4XMLH 5HTSA 3FQNA 3V6OE 4EVNA 5IMLB 3EFDH 3MLTB 4AG4H 2EDKA 3A6OA 3SJVA 3TZVA 5E00B 1IAOA 3UTSB 4JANB 4OD3L 3FONA 1GZPA 2AEWA 4XH2B 4KDVA 3QIWC 4GG8B 4PGDB 1SYSA 1GAFH 1PYWB 2VZ1A 1KFAL 1FL5B 3BMVA 5DK2B 3IGAA 5GGVY 2CMRL 3LKNB 5F3HA 4NHUB 4BQBA 4M48H 4G8IB 5KTEH 3LCYA 1SJEB 5ITFA 4OLXH 4BSVB 4DUXA 4HLZG 3VXSA 3LHPH 4I18A 2J12B 3S6CA 4JFQA 5T3XE 6FABL 3TVMD 1WWBX 3FQWB 5KOMC 15C8H 3VW3L 2MFNA 3QI9D 4PY7B 1ED3A 1IEAB 2NTFB 5FO7A 3WHXB 3SGJA 4I77L 3GJFK 3CK0L 3X3FL 3IDMB 4DEPB 4XX1E 3V5DA 5A2JH 3H9SE 4NQCE 3BE1H 5E08L 4OI9A 4MNHB 2NY3B 3O11B 5D7JA 1KTDA 5BQ7B 2FZ3A 1ADQA 1SJHB 4HIHB 2PO6B 3DX9B 4FQHA 3TBWB 2P24A 5M7QA 5IBLD 1F4XH 2WZPD 2VQTA 1KIPB 3RVTC 1YEJL 2B4CH 4P23D 4O4YL 4QOKD 2ATKA 2XZQH 4JM2D 4K7PL 4XP5H 4IIQB 3MV9B 3QPXL 4Y5YA 3Q6FB 1A2YA 3VXUD 4J3OC 5IVXA 1HDMA 4K7FB 4LLAA 1AFVH 4B0MM 5AZ2L 1ES0A 2Q8BH 5LWYH 4X9HA 1ZHBA 4OZGE 4O2EA 4JR9H 4MAUH 1YEFL 4PRPE 5F1IB 3HZVA 4WTZA 4KI5D 5DMJB 5EZOH 4NO0B 3IJHA 5C71A 5L8JB 1CD9B 3W82A 3L5WA 3P4OB 1Y6NR 1FZOB 1GC1H 1NUFA 1OTTC 3QUMA 4WWID 2EO1A 2D7PA 4FXLA 4TTGA 3NPSC 8CGTA 4JG0H 5I1EH 4YGAB 1WJ3A 5JQ6H 3BAEL 3DROB 1RUPH 2EIZA 4PJBF 1RFDH 5KVGH 3SE3A 2HH0L 5F9OL 4S0SD 3RWGA 3SKMA 4HS8H 3S97C 1DQDL 3MV7B 3CX2A 2BRRH 1X5ZA 4M62H 4F80A 4HIEB 3TN0C 4R4FH 5F7EL 2LE9A 1X7QA 1YYLH 1ZVSA 3BWUC 4OF6A 4I0CC 4U6VH 4WVRA 1VGEL 3OB8A 3IJSA 4PV9A 4APQD 4ZUSB 1MFAL 3DBXB 1CGWA 4L3ED 2Y5EA 2VN7A 1U42A 4HH9A 2VLRE 5CSBA 2Y25A 4DGYL 1MCPL 3C5ZB 4RFEA 5D2NA 1H3GA 3KYKL 5DJZB 3C5JB 3RVUC 2CK0L 3AS3A 4ZTOH 3PWLB 4EN3B 4O02H 5C9JA 3B2UC 1LP9B 3T0BA 1ETZA 1YEHH 4U1IA 1HQRB 4M6ML 2IQAA 4CVZA 1ZV5A 3ZZ1A 2V5SA 4LAQL 1N6VA 4F58L 2Z35A 1N64L 4ZSOB 2X4OB 3SDDB 3F7YA 5EZIL 5AWNH 3FN3A 1LK2A 1P7QA 2MKLC 4MYWB 3QIWD 5DC4B 4YEFA 1AXSB 5C0AA 4R9HA 5INCB 1M7IA 3VRLE 4X6DA 4XCYA 4YC2C 5D1XA 4CMMB 4Y4KB 2VLMD 4OCRL 4PLKD 2ADJB 2XNAA 3GO1L 5LXGH 1S7TB 1NANI 2X42A 4ZAKC 1W72H 4EI6B 2XACC 2YWZA 3OR7A 4LSQL 3MBED 2BERA 3LKOA 2ESVD 4MLIA 4I0PB 4AT6B 4LBEB 2UZXB 2HT3D 3O3DB 3E2HC 3FQTA 2F54A 4QRUB 5F1SA 1OT1A 2UVEA 3WS6A 5HI5C 2J88L 4LLMA 4DKAA 4X6EA 3KPPB 3QG6B 3MODH 3KDMB 4WUKL 3WO4C 4FFZH 1MAML 3BPOC 1HSAA 4OLWH 4KDTA 1S9WB 4KHTL 4J3TA 3I3BA 4QHMA 3RUGE 2ORBL 4CNIB 1MCBA 1U8QA 4ZXBB 3BESR 1M1SA 3IFOA 1A3RL 2YRPA 4MGXA 4Q0XH 1DQJA 4HMEA 2BSTB 5F44A 3FT3B 4NO5B 2W0LA 2V2WB 3D3VD 3UO1L 5HHOB 4LVOB 1Z9MA 3QFDA 4F15B 2ZOLA 1T2QL 1P84J 4KZEH 4MDIA 3D39E 4UUJA 2F53A 4XNUH 4LIQL 5MHSD 4E0RA 1UJTA 3DPBA 3LV3A 1CD8A 3EBAA 3V7MA 2HN7A 5I16A 1R3KB 4MSWA 3SE9H 2R8SL 1NCCH 3V7AG 3DETC 2Y7QA 3B3IA 3QDME 2P5WB 4JFHD 1KB9J 2EEAA 3FCTB 1G7IB 3FRPA 5C08A 1OTTD 5GGTH 5CSZB 4GAYB 2L7UA 3O2DL 3CVHA 2D03H 4R2GC 2VITB 3SKJL 1MCHA 3RIAK 3IXAA 2BVOB 4ODBD 1BOYA 5I1LB 4ZUVA 5H37G 2YPKA 3OXSB 4JY4A 3L5JA 3BIKB 4XVTL 1J8KA 5ICYB 4KROD 3ULUL 4PLJD 5JHDB 1J0ZA 3LSOB 1KJMA 3HI6L 4MD0B 3QZWA 4M02A 2AJXL 4OF5A 2C7UB 4JHZA 1BZ7A 3TN0D 3BVNA 4MXVE 4S1RH 2FATH 2FX7L 3BP5A 3EKCA 4X6CF 3D69A 1INEL 1VB9A 2WIMA 4PLOB 2PTTB 5BW7C 1CL7I 3NN8A 4C56A 5IGXL 4FQ2L 1NGYA 5TH2B 3TBSA 3OR6A 3U0TB 1WC7A 4GRWE 4PJBB 4PRHE 1T0NB 4JO4H 4BFEA 5GRZA 4NFDA 1UADC 4G80B 3L3GB 3B2UD 4Y2DD 4L1HA 2VE6A 2E27H 3HRPA 3NOIA 3O9WA 5SV3A 1C8PA 4PRDA 2QTEA 2VLLA 3VH8G 2VL5A 3T0EE 1Q38A 4WI9A 1IQDA 1SBSH 2V5MA 3MLXL 4D0DB 5DD6A 3RWIB 1CGUA 1IGFL 3FO1B 1NFKA 2OP4H 3RPIB 35C8H 1IEBB 1NCTA 1AGFA 4RGNE 5HJ3B 3LIZH 1OAUL 1QRNE 4UV7L 2GCYB 3LKRA 5FK9A 3NTCL 2Q87A 4Y4HC 3AVEA 1RZJC 4GO6B 4JVUA 5GSVA 3NCYS 2CKBL 4LCYA 2HTLC 1GL4B 4JDTL 3MLYH 5A3IC 3DGCR 5A16B 3SY0B 1I1AA 4L9DA 3VFWA 3OKMB 5FUZL 4PBWD 4G6ML 3FTGA 4YO0B 4CAGA 1NGWB 3WSQH 4DVBA 4FQJH 1A3LL 4PBVC 5HI5D 1QSFA 2H32H 4HPYH 4KRPB 1FFNB 3P9MB 4OZIA 4KV5F 5DTFB 3V6OA 1T7VA 3V6FA 4XXCC 2BFVL 5BXFB 1N0XH 3T0AA 4HFWA 2RBLA 1V3KA 2DJ4A 5DJYB 2V7HA 1ZLVH 4DVRL 2X70A 4XCNA 5L9DH 2YUZA 5IBUB 3SQBA 4YHIA 5F96L 1ZMYA 1PY9A 4GRLB 5I1GH 3IFLH 12E8L 3O3AB 1JGUH 1S9XB 1QBLH 4I5BB 4FHBD 2H45A 3VJ6A 1RUAL 4YXHH 2CDGA 4LPCA 3NCEB 1KC5L 4DN4H 3WO3B 2DM4A 3ZL4L 1FN4A 5LAXA 1XF5A 4K3EH 2FEEL 3MBXL 3DETD