2OTUB

Crystal structure of fv polyglutamine complex
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
118
structure length
118
Chain Sequence
QVQLQESGGGLVQPGGSLKLSCAASGFTFRDYYMYWVRQTPEKRLEWVAFISNGGGSTYYPDTVKGRFTISRDNAKNTLYLQMSRLKSEDTAMYYCARGRGYVWFAYWGQGTTVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Implications of the structure of a poly-Gln/anti-poly-Gln complex for disease progression and therapy
rcsb
molecule keywords Fv light chain variable domain
molecule tags Immune system
source organism Mus musculus
total genus 28
structure length 118
sequence length 118
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2007-02-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2otuB00
3NTCH 5EO0B 1GZQA 5I1GH 5A43C 5IEHA 4NNYB 3CK0L 4LCWD 2C3HA 4P5TC 4Y2OA 25C8H 1PG7W 3KPQB 1KCRH 4L8DB 5BOPA 5CUSL 1TZGL 1S9KC 1CDYA 3V9FA 4DQOL 2L4OA 5IVOA 3BPLC 3NVQA 3DXAD 1A9EA 4F8TA 1SYVA 4MLSA 4LKXA 3NFPA 4HPYH 5BZDA 4YXLL 1I85A 1IGYB 1S8DA 5F7NC 3HUJB 1IGML 3PV6A 4C58B 3LV3B 2BSTA 4Y0GA 3CFIC 4HUKB 5L2JB 1J12A 4NKDB 4FABH 1HYRC 5LKNA 4X6EB 4OIBA 5TPWL 1EERB 5ADPL 1OPGL 5CGYD 3S9DB 1R5WB 5D6DA 4X4YB 1I7ZA 4C55A 3S34L 4U3XA 1BVKA 3D39D 3RVUD 5L9DH 4PJ7A 3LAFA 4YE4L 2DAVA 1JRHH 3H3KA 5BJTA 4F7CB 1DQMH 4HGKC 1CXIA 3IDMA 2WZPD 3RVWC 3W9EB 4CRPA 4HIEA 3VFMB 1RUML 3VGBA 3X3GL 5D1ZC 1VCAA 1VEOA 4NKOA 3VFNA 5AYUH 2O5XH 4K3GA 5ISZA 5KS9E 2C5DC 4LSQH 3HC4L 1CGUA 3MLXL 2QR0B 3KJ4C 5GZNC 5B3NA 4KQ3H 2AABL 1M05A 5IF0B 3GSXA 4XBGB 4UV7L 3CFKB 5HHPA 1RZ8A 1BZ9B 4OFIA 5D1XB 4ZXBB 1MCFA 3FQUB 3QI9A 1T3FB 4K7PY 4JO3H 4BFIB 3M8OH 3MRNA 1N5AB 3IB4A 4M4RA 5DZNA 1OWWA 4J6RH 5JW4Q 4LGSB 1RIHH 5E8OA 4DKDC 5DK0A 5K9JL 4OZHE 3LRHA 3CVHA 1L0YA 3V5KB 1JZ3A 3GHBH 4DGVH 4P3DB 4PYGA 1F4YH 5IW6A 1A22B 2VR5A 2HKFH 1B4JH 4N1HB 5E6YA 3LN4A 2P7TA 3H9YA 4TRPL 4JZOB 3FFCD 1RU9H 4P2OA 4UTBH 4F3FB 4WUUE 3FT3A 5KOVC 3ARFD 2EZ0D 4MA1B 4YXKH 1OT2A 4LCUB 3BXNB 1Z6JT 3WFDH 3WHXA 1ZA3B 2AEQL 3D18A 3OKLA 3FTGA 5GS1A 3KS0H 1Z9LA 1DBJL 4BFGA 3MGOA 4NOBA 3TZVA 3VWKB 2WQRA 3BZDA 4LVEA 4XXCC 1U8KB 1JGLH 3AS2A 4TUOA 4XWGL 4XTRC 2B1AH 2BOCA 3MRCA 3L3HB 4PIRF 5K9OA 1FVDB 4R7NB 4XC1H 1RZ7H 4PJAF 4JPVH 2IPKB 1XFPA 2DQGL 1ADQL 4TVPD 4APQB 4HJ0D 4QXGH 3HTLX 4JHAH 4KTEL 2VDKH 1BFTA 3S7GA 1U8QA 2J3SA 4NKQB 5JLZA 2GCYB 2X4SA 2HTLC 1BWMA 5B3JF 1T89A 3JWOH 5JZ7C 3GSRA 2NY5H 1XGTA 1AP2B 2AGJL 2VXTH 4AIZA 1NAML 3BP4B 4IM8A 5K9KB 3GB7B 5CWSA 5T1MB 5HGAA 2GSGA 4JQIH 3OKNB 3KLAA 5FUCE 3K74B 3QBTB 4EBQH 3UTOA 5MHSE 2DJUA 4MAYB 5EA0H 5EIIA 3NCEB 1OTUD 2D7PA 1BBDH 4RWHA 3PWVA 3BDYH 3HE6B 3WNMA 2IANE 3LEVH 1VGEH 4OM0L 1KCVH 1S7VB 5I18L 1N59B 4JG1H 1JPGB 4IHOA 2VDQL 5IK3B 1W0VA 5T33L 4I1NB 3U4BH 3O3BA 4FXKB 1IAKA 4PJGE 5F88A 3AB0B 2NY1D 2FBOJ 3MGTA 2F53E 4H25A 4LSTH 4YQXH 4RA3A 1CQYA 3WFCL 1A3QA 1EEUA 1NAKL 4FFVD 3VWJB 4XPAL 1VESA 3RAJL 4GRLA 4WU7B 4FQQB 3QNZA 2R39A 5J3HC 2AJVL 3FQXA 4TSBH 4LSRL 1BQLL 4NHUA 5GRVL 4IOIB 4GAYB 5D7LE 2WWMD 5AZ2L 5I15L 3NABH 3OZ9L 2EDRA 2EDDA 5CILH 5BVJB 1TTFA 5CD3A 3D0LA 2ERJC 1DVFD 1FDLL 2JIXA 3O45A 4ONFH 1CIUA 3IDYC 3W39A 2JB6B 1YUHB 1MI5E 3OAUH 3LHPH 1D5MA 4MNGE 1KYOJ 3EYFA 1A6VL 1CXEA 2YN3A 2V2WA 5C0BA 3U7WH 2DKMA 4K8RC 4MMZC 1ZKAA 3ZDXF 1AH1A 4HUWA 4W4NA 4QT5B 4X5LA 4WGWB 2ILLA 3O9WC 4MNHB 3ZT6A 5I6XB 3UTQA 1I7TA 4NZTL 4XRCA 2OSLA 2WLYA 3RWHA 3V0WL 2DI8A 5L8JB 2XWBB 1YY9C 5SWZB 3PJSB 4H5SB 4IRSD 1JF1A 3WIHH 2D0FA 1JZ8A 1CBVH 4Q74A 4B5EA 1MHEB 2XFXA 3QJHB 4PB9L 5DLMH 43CAA 1KCKA 4OJFH 2RR3A 4UQ3B 1LO4L 3HMXL 1BVLA 4X7FC 3BE1H 4PBWD 5EZJA 3VH8G 3OQ3B 2HN7B 3HE7C 3GNMH 3H7BB 2DQDH 1QNZH 4XCFH 3RUGE 3TO2A 2PXYB 5TJWK 1F3RB 5T3ZH 1NBZB 5I75C 2P8PB 4JFED 4GRMA 2E3VA 4MD5B 4WO4D 1KN2H 2GUOA 1MCSA 3UTSD 1Q0XL 4QNPF 3LPFA 3QUML 3X3FH 3RRQA 5EBMA 5D7SH 2EDHA 1MFBH 3L7FB 4LVOB 2PF6A 1UB5B 2SEBB 3FO9B 1YJDC 4OCWL 7FABL 3RDTC 1JHTA 1CD8A 3C6LD 2UVFA 3EDJA 1KNOB 4OF3A 1MWAB 5C09E 2DQCL 4L8BA 4PG9B 5CMAA 5CGTA 5GGSY 3P30L 3E3QE 4GSDH 5IFJB 4ZSOA 3SGJC 1G9NH 1BM3H 1XCTA 2WINB 4JZJB 4PJBE 5F7MC 4PJHA 2JF1A 4O9HH 3VDCA 4KKLD 1LO5A 4N8CH 4RISL 3U9UB 3RWEB 3VFUA 3KAAA 5IJKA 3QCTL 1E6OL 3D25B 5ICXA 5FDWA 3FO1A 5KANG 1LEGA 3F5WB 2HFFA 1I9JH 1NBVH 3EJZC 5HI5C 2XZCH 1OD9A 1IAIL 3QRGH 2WV3A 3T04D 3PDOA 1FL5A 2APVA 4F8QA 5BS0B 3BPCB 4PJ9D 4P2RD 3RBSA 1AI1L 5EO9A 5FUCC 3SKOB 3QUYB 3T4AB 1ZANH 3MROB 5DUMH 3C6SA 4HGMA 2MOVA 1ZT4A 2DBLL 1CLYH 2GJ6E 5DS8A 4TULL 3IDJA 3MLRH 4PREA 2BVPA 3DHJA 4HLZH 2C26A 3JV6B 1VDGA 4FFZL 4XMPH 1UM6L 2FRGP 2NTFA 2RFXA 4I48B 4HKBB 4OF5A 3QDJA 4JHWH 4LOUD 2VL5A 2MTPA 4L8CA 5AUMA 3VFOB 5HYJE 4GXUM 1A1MB 2B0SL 1MJ8H 3C5SA 5CEYA 3EYSL 1JV5A 4DOHE 4O51A 2E7LA 1LGVA 3C2SA 3JV4B 3PGCA 5FYJH 5TFSL 4ZS6D 4I18B 3C08H 5C0AA 1QSFE 1BECA 4ZTOH 3NIDF 4FTVE 2OJZL 3RIAK 2DQJH 3BEVB 1K3ZA 1S3KL 5D2NA 1GH7A 4EOWL 4M7LH 3QUZB 5CEZD 2FJFA 4TVPL 4ONGH 4NQDB 4X6CB 5FUOL 3QA3B 4D2NA 2P5WB 5EO1A 1YNLL 5E2WH 2A6JA 4ODUB 3MRMB 4FZ8H 1F6FB 4OGAC 1IEBA 5FK9B 4R8WL 4MD0B 1K3IA 4KZEL 1D5XB 4ZOCA 1T2QH 3SEPA 1FAIL 2N56A 3NA9L 5IB5A 3EZJB 1QBAA 4PGDA 1MH5B 1HQRA 2COQA 2GJJA 3QHFH 1QUNA 4PJ8D 2VABA 3VXQB 3NCMA 3PHQB 5JXED 5C0CD 4HKXA 4R7DA 3VJ6A 1PSKL 4QCIB 1J8HE 3EHBD 3DGGA 4HXAH 5J1TC 2GJZB 2X4NA 4YHNA 3VXMD 1EX0A 1ACYL 2Y1VA 5C3TA 3BW9B 1Z3GH 1DEEB 3QO1B 3RL1B 1KLFA 3ULVC 4S1RL 5DRNA 3GHEH 1MIMH 5EZIL 1T2JA 3BEWA 1A9BA 1XT5A 1BGXL 2NW2B 4LPYA 4PRDA 1MUJB 4RFOL 1YZZA 4OZFA 1A6AB 1KIRA 2QQLH 3G6JA 5DD0H 4KRLB 1WQVT 4WEUD 4LCYA 4GMTL 4YBQC 3L6FA 1JNNH 3F6LA 3LSOB 2KZWA 3HAEH 1QVOB 8FABA 5FOJA 2RCSH 3O2VL 1HHGB 4MQXD 5TE4L 1LD9A 2CLZB 2V5SA 4OLWH 4XVTL 4N0CD 4JJHA 4P5KB 3RY4A 2DN7A 4JFQB 1I1RA 2M2DA 3CDGA 3Q5YA 3ZLQC 3VFPA 3TNNB 3QEHB 2PYEA 4K23H 2EDJA 3O11B 2X89D 1NCUA 1P5UA 4L4TA 4PRIA 1RK0A 3SE9L 4P9HC 1I1AC 1A7NH 3CMOL 1N0XH 4ELKB 5I1DA 1S9VB 3O2WL 5EZOL 1MCDA 1IQWL 2BNRE 1FC2D 4KXZH 5DJAB 2VSDA 5KJRH 3JBG7 5JIPA 3SDXE 3WS3B 4X7EC 4OCLC 1H3PH 2OZ4A 4P23A 4J3TA 4QLRA 1DLFH 5EU5A 1EEYA 5IB3A 5KSAB 4X7TB 2XRAH 4WHCA 5IHZA 3VDAA 4LCCC 3OF6D 3QEQD 2A2QT 4QRUB 1F4XH 3T1FA 2J8OA 3OKMB 1UYWL 3EYQC 2HWZL 3S36L 1HI6A 2GITB 4MA7H 1ZHBB 4YFEA 3FB5B 5JXAH 4I0KA 2R2CA 2YC1B 4Z7WF 4JFDE 1Y18B 2CRZA 1DDHB 2DQTL 4DUXA 4OCXL 4WGVB 5TDNB 3SE4C 4NQCD 3IRZA 4WJ5B 4PP1C 2Y7QB 2FYYB 4PJCA 5T3XD 1MLBA 5ICZA 5DO2C 1AGEA 3H9HB 4LPCA 1ITCA 4Y16A 4JFPA 3P4OA 1RJYA 3QIBA 1C7SA 4LDLB 3DSFH 5FECB 2ADJA 2I24N 4FQHB 4KVCH 2YD5A 2NW3B 2Y23A 4D9RD 3VFSA 3RGVD 3MUHL 3KPSD 3WD5H 5L8KB 1KJMB 3MRFB 3HHRB 3VRLF 4FFYL 3FRUB 2A6KB 4HV8B 4JKKA 3P4MB 1IGTA 1AQKH 3F58H 1PKQB 4FQ1H 4PRAA 3NN8B 5DJZA 3IDUA 3GSQB 1CXLA 4L4VB 2Y07L 4OQ1A 1MQ8A 1U8IA 4AMKH 3MODH 4GRWE 3UTTB 2AI0L 4NRXA 1TZIA 1YQ2A 4RDQG 3VFTB 5D1QA 1XR9B 3DV6B 3FAWA 1OP5H 3NTCL 1YDPB 32C2A 1BOYA 3MRDB 1CLZH 3UPAA 1I85C 4A2MA 2JB5H 1DQQB 4X8XA 2LV4A 3U46B 5LWYL 5FKAA 3X17A 1KCRL 4PGCB 3HUJF 3FOMB 5JHDA 3UCRA 1DQJB 1QLRB 3FQTB 2EEAA 1NBQA 3W11C 2J5LC 3ZT5A 5C3LD 4X83A 3RWIA 2D4FA 4BFBD 4DEPB 5D6DC 1WC7A 2XTJD 4Y5XB 1MFDL 1A7OH 5IP4A 3RU8H 1FH5H 2BCKB 5FO9A 2VDRL 5C0BE 1PX4A 2YMXH 4HCRH 1LP9E 2DDQL 5IBLC 5EU3B 4QOKB 3MRKB 1JHKH 2ATKA 3GUTA 2BMKB 1U8LB 5L7XH 3DX9A 1RI8A 3P9MB 1OTSD 3RNQB 3WLBA 2AERT 2HH0H 1IILE 2DM7A 4GAJH 4U1KB 3PGDB 2VMFA 1YMMD 3CXDL 2Q6WA 3V6ZB 1T21A 3ROLA 3TBVA 3L7EB 5L9DL 4NC1E 2MCPH 2XZZA 3QI9C 3BP5A 3PWPD 4J8RB 3AREB 3X14B 8CGTA 2DMBA 3VWKD 2V9QA 1HEZA 2Q8AH 3P4NB 3L9RB 3W81A 1NFDE 4N9OB 1CIDA 1U8PA 3OR7A 2DM3A 4YDKH 4LSQL 2GAZA 4U1NA 1AD9B 4XNQA 4H1LG 4KQ3L 1OAUH 4ZTPH 3QIUB 3MZTA 4G6ML 3BWAA 5EG6C 1JZ4A 2BVOB 2AK4A 2BZDA 3TO4D 4P5TD 4JO3L 4U1HA 4ELMA 2JELH 1F4WH 3GSVB 5BQ7B 2NX5A 3SDDA 4PJDE 1YN7B 4P2OC 1TJGH 2ITDA 1CE6B 1RIHL 3GKZA 4G5ZH 2HVKB 3GHBL 1ULVA 3FQNA 4DGVL 4J3XA 1F4YL 2XXCB 1JPTL 4R2GB 4Q9RH 3QDGB 2P5EA 2DQHH 3QXAB 5GS1C 1V8HA 3QQNA 2UZXB 2MSPA 2OM5A 3DRQB 3QDAA 3TZVC 1CICD 1RZKH 2EXYD 2V2XB 3CLEH 4WI7A 5DVMA 5A2LH 1RU9L 4UTBL 2EKSA 3DO3A 1GSMA 4HC1H 2XG4A 2P44B 3E0GA 2H2PD 4ZSOE 3OKOB 1T0MB 1FE8L 4RX4D 2GSIB 2NY4B 1BD2A 3RZCB 1EHAA 3WFDL 5F3BB 5C0IB 4WW1B 4NO0B 4IRZH 5IMLB 3LKQA 3S37H 3QJFB 3CFJB 2E5EA 3N0PB 3SN6N 1JGLL 4AIOA 3Q5TA 2FWOA 2B1AL 1T89C 5CIPH 1NJ9B 1OY3B 1Q72L 5I8OL 4BUGA 3P9LB 4KMTL 5EUOA 3MV7B 3VGFA 3SDCB 4YHML 5C7XH 1P1ZB 4XC1L 1XF1A 2VLME 4GUPB 2W65B 4HS3A 4JPVL 3PQYD 5JMRA 2E8ZA 1FFNB 2F5BH 2HG5A 4KVNH 3HR5A 4QXGL 5F7HA 1QRNB 2CIIA 1I1FB 1G7JB 1NGZA 4MNQB 1HSAB 2KL6A 5F44A 2IH3A 3O8XD 5HSFA 2BNUB 2FL5A 5CP7B 2IQ9H 2Z31A 3JWOL 4PRHA 1DP0A 4A6YA 5H35A 5TF0A 2A83B 1ZLSL 3MJ7B 1Z2KA 4GMSH 3T3PF 5E1AA 4EBQL 1MCEA 2VB5A 4OZGB 5H94A 5IG7B 4TSCL 5EA0L 1KJ2H 1BBDL 4P4KA 3INUH 4U05A 1D9KA 3LEVL 5E2UH 4MB3A 5LXGL 4GRLC 1A6ZB 1KCVL 2Q86A 3ULVH 4NKIH 4H88H 5F9WB 3JUZA 1CXFA 1BIIB 2D0GA 4M1CD 1CFTB 3DECA 4MQ7B 1A14L 3IETA 4PTUB 4LSTL 4Q2ZB 4G6FD 4UUJA 4AM0A 4P46A 5KOMC 1VACA 3BHBB 4I0PA 5D2LE 5FXCH 1NMCB 2VITB 4TSBL 5KSBB 2DWEB 3IDNA 3QDMB 4OD1L 2Y4SA 3GFUA 2GW5A 2RB8A 3MRIB 3NABL 3HPLB 4KQ4H 1KLGA 1TZHA 4Z78B 4WW2B 5CD5D 1SJEB 5KW9H 5DDHB 2E9JA 3E1F1 2FX9H 1OB1A 3ZDYF 1JGDA 1X4ZA 1U93A 2YN5A 2YD3A 3OAUL 3LHPL 3D3VD 3I75B 2OTWB 2HTLD 5F9AC 3U7WL 1UXSB 1NCDH 4NC1C 4P9HH 5BRZB 1O7VA 3SCMA 1HH9B 1A4JB 1NEZA 2R4SL 4JY4B 4AENB 5B22A 4AEHH 4PJXB 4KKCD 3HI6H 2N4IA 2D7MA 5J06A 4DW2H 2XZAH 1UJ3B 1WGOA 2BSSA 4AEIH 3IF1A 5JW3H 1BAFH 4IJ3C 2N1KA 3C5ZA 4KJYA 3GMMB 3FB8B 2FHBA 3MA9H 1DUZB 4X7SL 3SJVB 2C4FT 5DLML 3C5JA 1IGFH 4HWEL 4ORGA 2FR4A 3DIFA 2PO6D 3BE1L 3PNWB 4NP4H 5C8JB 1KIUA 5DMJB 3S4SG 2DTML 4QHKJ 4I5BB 3DX6B 3GNML 1YEDA 2DQDL 4OFKA 1QNZL 3L3DA 5HBBA 4XCFL 1T7YA 5J3HD 5T3ZL 1ZGLB 5DGQA 3QIWD 4UIKH 4DCQB 1BQHG 1KN2L 5E8NA 3RKDD 1MRCL 4XP9H 4FZEH 1G7PA 5D7SL 1MFBL 3HNVH 1TETH 2EEDA 4WTZG 4GG6E 1CD1B 5GRXG 4R97B 3F7RA 5T1DH 1ERNA 1KB5A 3VFRB 2R0ZH 3L5XH 2DS4A 5I17B 4PRIE 5DQDL 1SYSB 2Q76B 4ERSL 3JUYA 2DYPB 4YBLB 1X7QB 4K8RD 5ICYB 3DVNB 5IJKC 1P4BH 4H0IA 4LAQH 3OKKA 1VHPA 3T1WA 2OYPA 3BN3B 5E0QA 3OJ2C 4WI5A 3CFBA 1KIQA 3EDEA 4O9HL 2W9EH 2NY6B 1RZJH 2VDMH 3FJTA 1MCPH 4N8CL 3QZWB 4M6NL 4CADA 1P7QB 3GRWA 2F8XC 3TPKA 5DF0A 2AK1H 3SOBL 4ODVL 1E4WH 2HVJB 3MNWB 1I9JL 1NBVL 4N9GB 4NQEE 2A6DA 5E2TL 2OS7A 3GMPA 1OARH 3HNSH 3QUZD 5FO7B 4G8GA 5CZXC 3ECBB 2AV1A 1T7WA 2EE2A 1MIEH 3D2UA 4HJJH 3B9AA 1IEAB 5IUSA 1ZANL 4R3SB 3MPCA 1GOGA 5J57B 3U0PA 1NGYB 4JPIB 1EMTH 5FHAH 1UVQA 5AG8A 3RL2A 1JPFA 1KJ3H 4BZ1H 4PJCE 1A3LL 5JQHC 4JZNA 4JY6B 2DQUH 5I76A 4NUGH 2E7LC 1PLGH 1BFOB 4HUVB 3GEWB 2P4AB 3ARGA 3GSWB 4D0BA 3FONB 4PGJA 2ARJQ 3ZDZE 1O7SA 1EO5A 4UOJA 4KV5F 5F7DA 5EC2B 2GTWB 1RPQA 5HYSG 5D2NC 5HY9B 3OV6A 1BEYL 5FDYA 5ID0A 2W9DH 1D6VH 1LWRA 4X6CF 3C8HA 5I8CA 5EOTB 1ZEAH 2X05A 1I8MB 2Y5TA 3C08L 4Z7VA 3SY0B 4JFXA 3V7AE 3PG2A 4ZTOL 1CVRA 3OG6B 3LDBB 3CVHH 1M7XA 5I74C 3W2DH 4UMGA 4ONGL 3H3PL 5HI5D 2B5IB 3TN0D 5GHWH 3VD3A 1FSKB 5JHDE 1AO7A 1FRGL 4FNLL 3OKEA 5E2WL 3MV8B 1FFPB 3KYNA 5L2KA 3KXFE 4PRPA 2BY3A 4EDXA 5MHSD 2XA8H 3GBNL 4L8SB 4GLRI 4LNRA 3H9SA 5CHNB 1CVSC 2VAAB 1T2QL 1KLUA 2VLKA 1MJUH 1I1YB 4K55A 4WU5B 5JW4M 4QRPE 2IBBA 1H8SA 4G8IA 1A6TA 4QRRA 2A0LC 1AKJD 5E8PB 3T0EA 3ULUC 2F53D 4ZFOA 3EO9H 1P7HL 2GK2A 3ROOB 3X13A 3GIVB 4X6BB 3DNKA 1I8LA 1W2KT 2HLAB 5E70A 5HPMB 1HOCA 4KHXH 4EXKA 1YEKH 3GJFK 3GHEL 3QUXD 1MIML 2H1PL 4LLDA 3SGEI 3L95B 4JN2B 1QEWB 1FNEA 4NZRH 1H8OA 1PY9A 2KZ1B 5HVHC 3BQUB 4UZGA 2QQLL 4HUNB 4KK8C 4MDJB 1KG0B 1S9XA 4JKWA 3EFFA 2DIJA 3K8MA 1JNNL 2OTPA 3QULB 4U3CA 3LKRA 3LRGA 2OL3A 1MI5D 2PETA 4LIQE 1W72H 5H2BB 4POYA 2C4FU 4HS6A 4NNPH 2ZG2A 4TUJB 4DWHA 5ETUB 4OLWL 1NBYB 4ELME 3DROB 1WBYA 3NCYP 2NX5E 5I0DA 1G7QB 1FG2A 4G7VL 2I9TB 1EXUB 5B39G 1W8OA 4OGAD 5SWSA 5ESAA 5E5MA 1JUFB 2CDEA 4K23L 2X4QB 4WFFD 1IAOB 4P23C 5CZVL 4RGNE 3QISA 1N4XH 4GKZA 2IH1A 1A7NL 1N0XL 5I16A 3QG6A 2C7UB 4ZAKB 2YD7A 4JRXA 4NQSB 5IESH 4PFEA 2AJSL 2D7NA 3O6FA 5KJRL 1I9IH 3BJ91 4XXDB 4AQ1B 4MJ6A 1GC1H 1H3PL 5F9OH 3ZHKA 3FT2A 1NMAH 2LE9A 5HHMB 1EHNA 5HHOB 1NH6A 1B4RA 2XRAL 3BIAX 4RAVB 4N5EC 4Z77B 1OT1A 1F4XL 3FB6A 3TBYA 2FJGA 4WWKA 3VGGA 3BWUC 4XPTL 2QKIA 4U31A 5ECJE 3QQ9C 1KXQE 4U49A 3MRBB 5DJDB 1JGUH 2BY1A 4QHMA 3FZUC 4Y16C 5A3IC 3GGWA 3IU4L 5JXAL 4J23A 1TNMA 3QIBC 4D9QD 2VE6B 4PY7A 4U7KA 1KT2B 5DSCB 2HMIC 2VLJB 4XNXH 3OR6A 5C09D 4R4NC 3SE3A 1MFAH 5IKCA 4PRHE 1IC4H 5C2BL 2XKUA 4K8RL 1FYTE 3T0BA 1LEKA 2X9YA 2EE3A 1VADB 1CDUA 4J1UA 3DSFL 1LK3H 3WEXB 4NO2A 4QOKD 3WLWC 2BDNH 4KVCL 2MMXA 3BPLB 2NQCA 4PV8B 2IGFH 3FO2A 1FIGL 5CJBA 3WD5L 5ENWA 1G7IA 1X5YA 4D0CA 1H5BB 4J2XA 5D1QC 3C9NB 1MOEA 4HEPG 4RFEA 3M17A 2J8UB 2YPLB 4TPRL 3RVXD 2EYSA 1AQKL 3F58L 4FQ1L 2X4UB 5CP3H 5CJQL 5D6CA 5C08E 4EN3D 3BN9D 4Z8FH 4ZUTB 1IJ9A 5DC9B 4LLYB 3MRHB 2CKBA 4AMKL 1JTPA 2ESVE 3GMNA 3FB7B 4GG8B 4UBDD 3ARED 2A74B 2E6PA 1LVEA 5C9JA 5FYKH 2B8OT 1FFQA 3EOTH 2BSED 3FQWB 5DA4A 5I1JL 3MJ8B 2VKWA 4PJIB 3CH1B 3KPRB 4LMQI 5DFVD 1IL1A 1EGJL 1HILA 2GJ6D 4MJIB 5DJ8A 5IB2B 3W5MA 2JB5L 3VXOA 4R26H 5SX4H 3OJDA 1T1WA 2XZQH 1AE6H 1BJ1J 1FNSH 4NM8L 4LSUL 1FPTH 1CE1H 3P73B 4PTTB 1ZWIB 3D69B 4MCZB 5C0EB 1AC6A 3QHZH 4PP1D 3C8DA 5HYJD 1A7OL 4X4XB 3RU8L 1IGIH 1YJDL 1IM3B 5DO2D 4HCRL 3STBA 3T8XB 3QAZC 1IGCL 1WFNA 1JHKL 4HZLB 4OGXH 1UWEH 4OCMC 4LPTA 1Q9KB 3ARRA 2VXQL 1FN4B 1NLDH 3NOIA 4GAJL 4DKEL 5E8EB 1XF5A 2PW1A 3EIFA 4FTVD 4G8EB 3QQ4B 3KPOB 2EDTA 3WFHA 2AVGA 3VXRE 3EZ8A 1F6AA 4NO0D 3RJDA 1PFCA 2Q8AL 3CDFA 3SDDC 4FG6C 1QFOA 2G2RB 4YDKL 3WUWG 2YK1H 4M9OA 4LEOA 3X12A 3CSGA 3DYMA 4OFYA 4ZTPL 5FGBA 3FFDB 3MV7D 4X80H 3QUKB 3OTTA 5EOQL 1Z0MA 2AW2A 1JE6A 2VIRA 4O2EB 5IHUH 1X3DA 1S7RB 1UKTA 3F12B 1WJ3A 4HK0B 1F4WL 1QRND 1XZ0A 1CFQB 1NDGB 5LAXA 2ATPA 1RAMA 5CSZA 1TJGL 4MNQD 4F15B 1A64A 1NCBH 4PJ5E 4QTHB 5HI4C 1JF6A 5EU6A 2A9NL 4NJAH 5F96H 3WBDA 3HAEB 3I3DA 1J8HD 3PGFH 1Q1JH 3FN0H 3DMMA 1XGUA 1BF2A 4HX1A 4L3EA 4XPGH 4ZMAT 3EOBA 2E7BA 3CLEL 5BVPH 4B7IA 2I27N 5CZKA 4CNIA 4ZUWB 1FZOA 3RWFB 3FRPA 4HC1L 4DGIH 5JPNA 1V3LA 3IKCB 5BV7H 4WHDA 3H0TB 4QRSB 4ZFGH 2E7HA 3PDDA 1C1EL 1HYSD 4G43B 2AKRA 4IRZL 4LCWA 1H9VA 3S37L 3BO8A 3GMOB 2D4DA 3JTSA 3JTTA 4IRJD 2VXSL 4HUUA 2Z31C 1JK8A 4QHUA 2AV7A 3RWGB 3DXAA 1GZPA 4RDQF 3CFEA 1TXKA 3UYOD 4TUKH 3QDMD 4N1CA 3P0VH 1ZK9A 1A1NB 1UM4H 2F5BL 4Y5YA 3FO0L 2ZOKB 4LP5A 2DMCA 1V7MH 1RUQH 1Y6KR 4XHQA 5DMKB 4P4KC 2P45B 1NL0H 4Y4HA 2BNRD 1D9KC 4C56B 5GJSL 4BKLB 1YEGL 4KJWC 3I3BA 1B0GA 1SBBA 4HIXL 4LLWB 4OIIH 3PL6D 4EI6A 4D9LH 4F7TA 1SMAA 3D39A 2I5YH 4LF3B 3ULUH 4FRWA 1KJ2L 3IAPA 4OZFH 3VCLB 5JDSA 4EVNA 1KEMH 1ZT1A 2V17L 4IOFD 1C12B 4P46C 3AAZA 1IQDA 4I0PC 3SKMB 3I3EA 1FL6B 1I4FB 1RJLB 4P3CH 3ULVL 4RGOL 2A73A 4CVZA 5KSBF 3O9WB 1DCLA 4XVJL 3OJMB 3VXSB 1CR9H 4Z7VE 1DANT 1T1XA 1XH3B 5AG9A 4WW2F 3TA3B 4JFDD 1EHLH 4LRNH 1U3JA 2VYRE 1PW3A 2DQFB 2NXYD 2R23B 3VMPA 1MNUH 2NYYD 1F45A 3SCMC 4NO3B 3O2DA 4KQ4L 5FGCB 4HWNA 4LHUB 4PJAA 2YD8A 1AO7E 2V7HB 2VQ1B 2XACC 43C9A 3UBXI 4XP1H 4PJXF 4EKXA 1HCFX 2EXWD 4PRPE 1TQBC 1A4KA 1U92A 4ZFFA 4N0UB 3UTPE 4YHPB 2VO5A 4AL8L 3FFCA 2OZ4H 3SKNB 3FN9A 4JM2B 3WUWB 3ILQD 3ARFA 1NCDL 4P9HL 3DUHA 4XNUH 2JKXA 2ADIA 3C5ZC 3QSKB 3B2VH 2FGWL 3ZE1F 4OCSH 4JAMB 3RIAF 3HI6L 5FFLA 2NY0C 3IJYB 4KRMB 4YDVA 2UUDK 5KSVA 2BK8A 4K3JL 4PJFB 3NIGF 4XZUB 1FVEA 4POZD 4DW2L 1CL7I 1HHIA 2XZAL 1T1YB 2QL1A 3FT4A 4LLQB 5JW3L 2D03H 3RDTB 5MENE 1CFSA 2NY6D 4OF0A 3MA9L 4M61A 4WV1B 4U7SA 4ZS7H 2VXVL 1IGJB 3T2NH 4LMQE 1QSEB 4ORZC 3QNXA 4Y4FB 3WJJA 5I73C 1RZGB 4U6XB 1YYMH 4JPKH 1AQDA 2XQYK 3BH9A 1X6LA 2DKSA 5JMOC 3NBNA 3S36X 4UIKL 2VLRA 5DRZB 2CPCA 3SDYH 3LKOB 4PLKC 4S1SH 3MLTB 3MOBH 2P8LA 1BZ7A 3OHXA 3ET9F 3PWJA 4FZEL 1KPRA 1ZV5A 2QHLA 1ORSA 1U9KA 4W6XB 2FECI 1TETL 4L3CB 5DK3A 1PG7H 1JPST 1SVZA 2ZZUT 4HQQL 5T1DL 4B53A 3HMWL 4XPFL 2R0ZL 3L5XL 4NSKA 3P11H 2ZNWA 3KPPA 4Z7UB 2W0FB 3RWDA 4XCEA 1H3XA 4G8FB 4ISVB 4M00A 3LKSA 2D7TH 2EO9A 2IFFH 2EYRB 4K71C 4U6YA 3TCLB 1TCMA 2W9EL 4OM1H 4UDUA 1CZ8H 3MJ9A 1MCPL 5EPMA 2P1YA 1HXMB 1AGFA 5HYQB 2AK1L 3IXTB 1MF2L 3DETD 3WXWL 4YO0A 1K8IA 1NGXB 4PS4H 5IW1B 3MCKA 3ZE2E 3HNSL 3QFJE 1IC7H 3K2UH 2Y6SC 4LFHG 1AFVH 3UYPA 3MA7B 2EDXA 4E41B 3ARGC 3LPWA 1MIEL 4HJJL 4S1QL 4H20H 2CH8A 4XBEL 3GMQB 4BH8A 4UIMA 1P4IH 4FA8A 5IB1B 4DN4H 3HZMA 1EMTL 5CIPB 5FHAL 3K3QA 3DGCR 4MXWH 4X5WA 5DHYB 1A2YA 1KJ3L 3OSKA 1IBGL 5DD6A 2DQUL 2IPUK 3NAAH 3LKNA 1MAMH 4Y4KB 4YDLB 5J9PA 4NOFA 1D7FA 4IRSA 2XWTA 3VRJA 5D71H 4K9EH 4U1IB 3HB3D 4ODXB 3HPJB 3V52H 4LLVB 3GKWH 1ITBB 2X4TB 4G6JH 2IWGA 1W8NA 4JDVA 5DRWB 5IR1B 3WE6B 2W9DL 2EIZA 3EW3B 2AXJA 1D6VL 4J3VA 5HD8D 4LARH 4YEEA 5JNYA 1BQUA 2VLMD 5DYOB 4JFYA 4CMHC 4JRYE 3I6KA 4ONHB 2CD0A 2NY7H 1KJ2B 4HWUA 4MAUL 3U48A 2ZCLH 4JFEA 3G08A 4HEME 4WO4A 5FIEA 2CK0H 5I8EA 3CVHL 1FC1A 5D7IE 3UTSA 1OQXA 3TVMD 3Q0HA 3A6BH 4LSVH 2HTKC 1KEGL 1QBML 2CIKA 4Y8DC 3LEXB 1EHXA 1DANU 2HFEB 2IBZY 3OG4B 4QYOB 4OZIB 2DLFH 1O5DT 2DOCA 3CUPB 3T0EC 3C6LA 1F8TH 2XA8L 1AXIB 4DZBA 3WKNA 4OCNC 4BH7B 4LGPB 4KHTH 3I9GH 2R1WA 2MWCA 1ROWA 4F58H 1I8LC 5KZCD 1MJUL 2IQAB 5EH1A 1J5OH 1MHCA 2WK2A 4HGWB 4PRBA 2NY3C 3O3EB 1T4KB 5JIHA 3EO9L 5E2VH 3BZEA 2UWEB 3T3ME 2EH8L 2DQEH 1BWWA 1I1AB 5HHMD 3OGCB 1YQVH 1ES0B 5J1SC 3PWNA 1RMFL 5HHOD 4XHJD 1YEKL 3KHOA 4PJ9A 4P2RA 2BXZA 1KF9B 4MA8H 3B9VA 4NZRL 4P2QB 4YGVA 3KLHC 1T1ZA 2X1WL 1LO2H 1N8ZA 4MXQC 2VDNL 4H0HB 4HKJB 4J3SA 5ITFA 2VH5H 3CIQA 1NEUA 1WIPA 4NIKB 3RA7H 1R3HA 4LCCB 1YNKL 3VD7A 1PD6A 1NKRA 4NNPL 1CDCA 2H6PB 3S3SA 2IALB 5DJ6B 3HG1B 4O2CB 3M45A 3O6FC 1WZKA 1JJUA 4MDIB 2G75A 5DI8B 2X41A 3AUVA 1XGRA 1CGVA 2VLJD 2W0PA 4KK9D 5A2FA 2UYLB 4EEEA 2VERN 4NCC2 4NPYA 1JNLH 5GSVB 4JHBA 4X6FB 3LKPB 5I9QB 3TWCL 5F1IB 5ALBH 4IDLA 1N4XL 5KG9A 2K3TA 3Q2CA 4LASH 4LLUB 3U83A 4L3EE 3W9DA 1QQDB 1QHOA 4RNRA 4WHTB 2DL9A 4NKMB 5IESL 5KN5A 4NRYB 2HJFA 4LL9A 5C0RH 4G7YH 1I9IL 2ZOLB 4WWKC 3MREB 3T4YA 4FQXB 3QP3A 2IG2H 2UZIL 5ITBH 5J8OA 2DLTA 5F9OL 1NMAL 4ZUSA 2EDFA 1I7UB 5MI0C 5AYQA 2NZ9C 4K7PH 3VU2A 4OKVB 2CRMA 3HI1A 5J0BA 3KDMA 3LQMA 3QPQC 4O5LL 2ZUVA 2RAMA 1R3JA 1S78D 2GTZA 1QPXA 3B2UC 3SE3C 4P57A 2C3WA 3DI3B 5DUPH 2BVQA 4KK8D 4MJID 3ALWA 4V1DE 1FZJA 2E6QA 1YPZB 4XT1C 2G5BB 4R9HA 1JZ7A 1U91A 2QQQA 3IDGA 3QWOA 4Z7OF 4PRID 5ANMA 2VLLA 1A9EB 1SYVB 3LS5H 4JN1L 2X10A 5E7BA 3HS0B 1EIBA 2DD8H 1S8DB 2ED8A 4ZOBA 5TH2A 5JXEA 3BKYH 1IC4L 12E8H 2AJXL 2BSTB 2Q3AA 2WIIA 3KVQA 2J8UF 2IMNA 4D3CH 1YMHB 3DPBA 1EFXB 3VXMA 2CMRH 3IFLH 2BDNL 4S11A 3VGAC 2IGFL 3D39E 1ZHLB 2HP4A 1I7ZB 3BMVA 3U1SL 2XT1B 1WCBA 1BVKB 1GGBL 3MXWH 4NQED 5D70H 3DWTA 4AH2A 3PWUA 4PJ7B 4PJIF 2ITCA 3TPUA 1I3RA 3TJHD 3PWLA 3V7MA 4D8PA 4HIEB 1M7DA 3QQ3A 3RY6A 5ISZB 2CGRH 5E08L 1S7SB 5T5NF 5FYKL 4OSUH 1U8JA 3HZKA 3CVIH 4ODWB 4KGLA 4MS8C 1V7NH 2K9UA 5HHPB 5K9QI 3LQAC 2R4RL 1REIA 1RIUH 1Q9WB 3QI9B 1T5WA 3RFZC 5TQ2H 4JQXA 4KY1L 1OW0A 1FPTL 1FZMA 2X89A 4PJAE 4XMKH 3RJQB 3QIBD 1KTDA 5DK0B 4KDTA 5IVXA 3CVHB 2B1HH 4LKCA 2J2ZA 5IW6B 3QHZL 2Y25A 4CUCA 3MRPA 3UBXG 4OQTA 1IGIL 3SHSA 5B3JE 3B3IA 5EU4A 5FA3A 3BZ4A 1JWMA 2ZJSH 2FEEI 1KXTB 2P7TB 4OGXL 4JCMA 3FT3B 1PZ5B 4Y2DA 3DX8B 2JK5A 5LGJA 3RWJB 5GQBA 5CFHA 2QADB 3DUSB 3OF6A 3CH8A 1K4CA 3QEQA 5ELIA 1TTGA 5FGBC 3D18B 3OKLB 3FTGB 1QD0A 4XNZC 4KZDL 5GS1B 3DURA 2EIBA 4Q9BA 2VUYA 5EO0A 1T7ZA 1S7XB 3FMGH 4ENED 2X4RB 3RI5K 1J0YA 1RZIA 5I1AB 4TUOB 1JGVL 2G9HA 3MRCB 3MRJA 1J1PL 4YHLH 4JGMA 3T2OA 4L8DA 5DMGD 2YK1L 5D72L 5IGXH 5K9OB 3KXFD 2XN9B 4R4BA 4NQCA 3PXJA 3TV3H 4X80L 1JFQH 4HFWB 4MMXC 3DMMC 2Z8SA 1UADC 2AXHA 3IFOB 1IGYA 2DLEA 1L7TH 2VLRE 2X4SB 4HXBH 1NCCH 2MFNA 3GSRB 1WK0A 4QRPD 5L2JA 1XGTB 4YHIB 2YZ8A 2FO1A 2PCPA 4XP4H 3RGVA 5F96L 3KPSA 4JR9L 4JGUA 5CWSB 4UT9L 5HGAB 1Q1JL 1R5WA 1W72B 3FN0L 3KLAB 4B0MM 4RMWA 4CU6A 4M03A 4OCRH 3U4AA 2W59A 1K6QL 1ACZA 3QWRD 1HHJA 3RVTD 1JZ6A 4R96A 3ZDXE 3G5VB 1KIPA 3MOQA 1DSFH 5H8DA 1J1XL 1DQDL 3VW3H 2DRUA 4M6OH 3VGEA 1AGDA 4YUEL 5F88B 5E9DB 3KYKL 5MEPA 3ZTJH 2QR0A 3MGTB 4H25B 5B38G 4OFPA 2KUTA 5IF0A 4Y5YC 3FCTB 4WUKL 1YEJL 3VXSD 5D1XA 1GJIA 3FQUA 4GRLB 3QNZB 3FQXB 1NC4D 5JW4R 5IVZA 3DVGB 4Y4HC 4NHUB 4RWYH 4F9LA 1BZQK 4BK4A 2MPAH 1N5AA 1WFUA 5CGYC 5A16A 4TUKL 4XVSH 3P0VL 5FO8B 3ETBF 3HZVA 1WTGT 5EC1A 4NUJA 5CD3B 3V5KA 4KMQA 4RGND 1IKFH 3RVUC 1NSNH 1RUQL 3O45B 4HG4K 2DTSA 3W39B 5E94A 1RUKH 1D5MB 3EYFB 4LQFH 2YXFA 2BJMH 4FFWD 4JZOA 2W92A 4KGJA 2WBJD 4F3FA 2YRLA 4QNPE 4HUWB 4OIIL 4TTGA 1YMMA 2AEWA 4D9LL 4ODSH 3FHAA 2R2EB 4U0RC 1EDQA 2I5YL 3ULUL 2Q7YB 5IFHH 1UH2A 4AEEA 3PWPA 1KEML 4YFLF 3CK0H 1OAZL 3VWKA 3CSPA 1HCVA 3P3YA 2OL3H 5CUSH 2XFXB 3R06B 1GGUA 3LD8C 4MSWA 3UBXB 43CAB 4GW1A 1BVLB 2FO4A 4NN6C 5HDLA 4R7NA 4XGZB 1CR9L 3BMWA 5EZJB 4HWZA 1MQKL 5I30L 2QSCL 4KJQD 3TO4A 2IPKA 1H15A 4YXLH 1EHLL 3MLZL 4I4WA 3MLVL 2XIDA 2QSTA 5JHLH 1IGMH 4IJ3B 1BIHA 3C60D 5E6ZA 5HYEA 5F7EH 5TE7H 3HFMH 3QCUH 2EEBA 3ARFC 2GCYA 4GRMB 2EZ0C 4JM2F 2AJUH 4PLNC 4FP8L 4Y88A 5ADPH 3UZQA 1FYTD 2EC8A 2OCFD 4JB9H 3FQRB 3BP4A 5GS2H 4UDTB 1T22A 4H8WC 4E42B 1QLFB 1J87A 3CX5J 1Z9OA 1CICA 1UWGH 3O4LE 4PJFF 4S0TD 2OZ4L 4PV9B 5IQ9A 4YE4H 5D96B 1CK0L 1MFCH 3DTXA 4XNUL 1RUMH 3X3GH 3B2VL 4RX4A 1QFWH 1S7VA 1QBLH 5C08D 3HC4H 5CMAB 3U2SA 4XI5D 2LTQC 2OTUB 1B9ZA 2ESVD 3WJJC 4W6YB 3RKPA 4HJ0C 4YIQA 4PJHB 5I1CH 4M62L 2IAMC 1P6AB 1LO5B 1VFBA 2JCCA 2D03L 4LHJB 3MRRA 1FNLA 4FQQA 3VFUB 4F57L 4YAQA 2D31A 2NXZD 4ZS7L 3FO1B 3S98A 5K33A 4IOIA 5K9JH 3PQYA 5IT2L 2ZUUA 4X5XA 4S0SD 4F2MA 1FL5B 4Y1AE 5FV1L 5BVJA 4W70A 5TE6H 3KPNA 1QYGH 4YHKH 1IAIM 1OTUC 2KDGA 3NIDE 3O8XA 4JPKL 3WIFA 1KULA 3UJTL 3LOWA 3W0WE 2CDGB 4GAGL 1YUHA 3C6SB 1LE5B 3Q3GB 1PDKA 4S1SL 3MOBL 5B38B 3SCMD 3JXAA 1D5BB 1N2RA 3CAFA 5DS8B 2BVPB 5BMFH 4M5ZL 2NY1C 3B4NA 4Z7UF 3U4EA 3MFFA 4MX7B 1DBJH 1HSBB 4FFVC 1PG7L 1OD7A 3KLDA 5SWZA 2OI9C 1FNFA 4H5SA 2NTFB 1WIOA 2QQNL 3P11L 4HZAA 3FKUS 3VXRD 3QDJB 3MV9B 2VL5B 4L8CB 4KUCF 1M7IB 1G6VK 1OSZA 1MHEA 3C5SB 3SQOL 5CEYB 5DURB 2NY2B 1JV5B 1N6UA 2FATH 5E2JA 2D7TL 3PGCB 1HN1A 4UQ3A 1ADQH 1CDIA 2GT9B 3PDGA 4X0KA 1CZ8L 4WEMB 5MEQA 2AXFB 5C0AB 1CGXA 2HN7A 4ESKA 5CEZE 5A1AA 3ZHDA 4KRPB 1JI1A 4PJEB 5IJVA 1FCCA 3MV01 2VISB 5D2NB 1WAAF 2PXYA 5EBLB 2AGJH 2CO6B 1NAMH 2WUBL 3LQAH 5T1LB 5BV7B 4QXUL 3NA4A 1IC7L 5EO1B 5CJ5A 4UU9B 4PJ5D 4QXTA 4NCC1 5AEAA 2A6JB 2X42A 3D3VA 4DK6A 3VFWA 3WL9B 3UJJL 4IRSC 1VENA 1IEBB 4HLJA 1YEEL 1FFRA 3OXSA 4XMLH 4DN4L 5I74B 2F58H 3EOYG 3F65A 1PKOA 1C5DB 1MWAA 5CINH 5F7FA 1GIGH 3EYVA 1T2XA 5GS0D 3RVVD 2VZOA 4PGDB 1MAML 1HQRB 3ARYA 4BFEA 2VABB 3WFCH 1N6QL 2WINA 3V5DB 3VXME 1QSZA 3V4VL 3ELAT 3IVKB 3I02B 3KYMA 4HKXB 3VJ6B 2AJVH 3MUZ1 4WHYH 3GSOA 2X4NB 1CGYA 4YHNB 4GQPH 4WO4C 1BREA 2PO6A 4OB5H 4LIQL 3D25A 3ULVF 2XNAA 3V6OA 3F5WA 5DRNB 2J6EA 4LARL 4M8QA 3T08A 1MRFH 3DSNA 2FB4H 3BEWB 1FDLH 2YSSA 1A9BB 5BS0A 1J0ZA 4PRDB 4OZFB 2GYSA 5HDQH 2R56H 3G6JB 1A6VH 3QIWA 4OZIF 4LCYB 4BQ9A 3T4AA 2CK0L 4OGYL 5HHQA 3MROA 1A7RH 8FABB 1PEWA 4MLIA 1LD9B 4MJ5A 2H8PB 3A6BL 1OAXH 5K9QG 2Y6SD 2PTUA 3SKJL 1XEDA 2QSVA 1LO0H 4OF8A 4KKLC 4RCAA 3JV6A 3HG1D 4Z7WE 1F8TL 5C86A 2PYEB 3NZ8A 1J10A 1VSCA 1HE7A 3X11A 4JFFE 4L4TB 2G60H 3WJLA 1RK0B 2UWEF 3HRZB 3I9GL 1MFEL 3IKKA 2B2XH 5I1DB 1LO4H 1A1MA 3HMXH 4F58L 5KS9A 1KB9K 1N0LA 3D1MC 2CJUL 4I9WE 4LFHD 3CC5B 1TITA 2QJDA 1J5OL 4PJ9C 2PYFB 4ZYKA 3L3KA 4HIIA 4TQEH 2X7LA 4P23B 3MUGA 1GGTA 4UTAH 3BZFB 3E6FA 3E8UL 3QEQE 2DQEL 5EU5B 3EGSA 3QT2A 3BEVA 4CN6A 5IHZB 3VRLE 2ARJA 2RIKA 3QUZA 3C8KA 3QUMH 1MAJA 4OZHA 3QA3A 1NLBH 3T1FB 4TTDD 4M9PA 4MA8L 3ZKMD 1UZ8A 1SM3H 2YS4A 4A6YL 3S37X 1C7TA 3KYOB 1CU4L 1TJIH 2VH5L 4OCWH 3CXHJ 4LOUC 3UTPD 3BRFA 2WUCL 1U3HB 3RA7L 4U1MB 1M4KA 4JDTH 3AXLA 2ICWI 2DQCH 5F3HB 4P59L 1A5FL 3P30H 1D5XA 3TESA 1SJVA 3VH8A 4OF6A 3MQIA 1Q0YL 3HUJE 1GPOL 4LLMB 3BRDA 1XGPA 5TDPA 4U1SA 4XCNA 1PAMA 4JFPB 3PHQA 3VXQA 3TYFB 4D9RE 1RJYB 1INEH 3MBED 4QCIA 1U8MB 3QCTH 4LVHB 4LASL 5MEND 3BW9A 4U6VL 3RL1A 1DEEA 4CAGA 3WFEH 5C0RL 4G7YL 5DR5H 3ARBD 2ZNXA 4BQCA 4OFVA 4PRAB 4ZDHA 1AI1H 2IG2L 4PRNA 4JY5L 1JBJA 1U8IB 2W1NA 5JORB 4M48H 1FGNL 1ZLWH 1RQ5A 5ESVB 3O2DH 1BOGB 4NRXB 4K7PL 1TZIB 1YPZF 3TN0A 3WNLA 1QVOA 4LPUA 5E6IB 1J1OL 4ZUUA 32C2B 4LCIH 3GJEA 1CI5A 1SEBA 2DL2A 3MO1A 2R29L 4HK3N 5HHVL 5JXEC 5FKAB 4QGYA 3QRFM 2P42B 4JFQA 4FQCL 4RBPH 5FYLE 3EHBC 1LDPH 4HDIA 5GGTA 3QEHA 3BP7A 5IBUG 3RWIB 3S5LG 2AXGB 3O11A 4PGEB 5GJTH 5BO1H 2DD8L 4Q9QH 1WC7B 3MBXL 3MZGB 4M5YH 4ELKA 3LS4H 4PJGA 1S9VA 3BKYL 5FO9B 5JOFA 2F53A 4D3CL 4MHHI 5F7LB 5DK2A 2ATKB 3M07A 4M7ZB 4PJ7F 5FGSA 3VG9C 3SGDH 5I19L 2CMRL 1SY6A 2OJZH 3IFLL 4AJ0A 3WLBB 1S3KH 3OWEA 4M02A 4WFEE 1H3UA 3I84A 3GSUA 2F8OA 3RY6C 4TVPH 4MQXC 1ZHKA 4X7TA 2Q6WB 3QUXA 4XAWL 4ZO8A 3ROLB 2P48B 2QADD 3TBVB 4K7FB 3MXWL 4QRUA 4N0CC 4RAHA 5D70L 3V4UH 3QAZB 4M93C 3BP5B 2JJUA 3OKMA 3TFKD 3QFJD 4NBXB 4Z5RA 2GK0B 3JWDC 1HEZB 4OLXL 1JP5A 4ZQKB 1MI5A 1OW0C 4R8WH 5JO5B 1ZGLM 1ZHBA 4MNGA 1U8PB 4LEXL 4KZEH 4U1NB 1B0RA 5HGDB 4OSUL 3CVIL 1FAIH 1QR1B 1V7NL 3NA9H 1FL3A 1YEIL 5D7JD 5T1KD 3HZYB 1CFVL 5DVNA 2AK4B 1KB5L 1LK2A 2R0LL 1S9WA 2FYYA 3AY4A 4U1HB 3ZKND 1T5XB 1J18A 5B4MD 3H9HA 3SDDB 1PSKH 3N1FC 4XMKL 2ITDB 3R4DA 5KVDL 4G9FB 2HJLA 4Y2DC 3K4AA 3ZYIA 4DGYL 5JA9A 4WFHD 1TVBB 2EDQA 2B1HL 2V5YA 1FORH 4FQHA 4S1RH 2P5EB 5L6YL 1DL7H 1GL4B 3GRWL 1EUUA 4TNVK 4X9HA 4KJPD 3MJGX 2ZJSL 4HV8A 3LH2H 2IFGA 3P4MA 1L4IA 1PKQA 4UV4H 3T3PE 3MYJA 4CVXB 4KROD 4GMTH 4JRYD 3GSQA 3RUGA 4DVRH 1X5FA 2Z93B 3MLYL 2DLIA 5C6TL 1BD2B 1UC6A 1FJ1B 1Q8MA 5F7YC 1N26A 3VFTA 2MNUA 4XVTH 1UB6A 4NDMB 5E9DD 1XR9A 3DV6A 3FMGL 1I3UA 1U2HA 4U7MA 5DMYA 3VXUB 1QBBA 4YHLL 4JANA 1EAPB 1QLRA 3FQTA 5EUOB 5GGRB 5FUZH 3RGVC 4HS3B 2X70B 3TV3L 3CMOH 5C09A 2HG5B 5EZOH 3HR5B 4C57C 1IQWH 4G6KL 1UH3A 4Y5XA 4WDIA 1NGZB 4JLRA 3CU1A 2FL5B 4HXBL 1NCCL 4YK4B 5IIEA 5H35B 4OUOA 3MR9A 5EZLB 4QOKA 1BFVL 2BMKA 3DUUB 1U8LA 3G5XA 5KANI 4JFOB 3P9MA 1UCTA 4MCYB 4XP4L 3NPSC 1NANH 4B41A 1AIFA 3V0VB 2VDPH 3MYZA 4U1KA 3PGDA 1I1CA 1IFHL 5SWZE 3QEUA 4P4KB 1OAKL 2Y72A 1UYWH 5CS7A 4EN3A 1D9KB 5D1XC 5HTSA 1DSFL 1BVZA 1TIUA 2Q86B 3W82A 3VW3L 3AREA 1MVFA 4F9LC 3L9RA 3IETB 1WWAX 5LQBL 1AD9A 5ADOL 3GZKA 2XTJC 2YRPA 2GJ6A 4J4PD 4UUJB 1U95B 4P46B 1VACB 4I0PB 3D87B 2RGSA 3EJYD 2BVOA 4YFDB 3UO1L 1F5WA 3IDNB 4PP2A 2ICEB 1XR8A 3GSVA 2MPAL 3IDXL 4M6MH 4NZJA 4LRIA 3MMEA 3QNYB 4FQLH 4XVSL 1KLGB 1TZHB 4J7RA 4MA1C 3UAJD 1CFNA 1SMOA 4A2LA 5HYJA 1F6LL 4CJ0A 1OGTB 1OB1B 1B0WA 1IKFL 5I1LA 4FFYH 1JGDB 5JPMA 4ZFOL 1U93B 1S5HA 2Q1EA 5J13C 1IAII 1RUKL 3QXAA 4QRQA 3P40A 1LDSA 3DRQA 4LQFL 2BJML 3ZL4H 3VWKC 3WNPA 3ZTNL 1RULH 5JOEA 4WRLA 1NEZB 2HFGH 3CPLB 3OMZA 2AI0H 4FTVA 1OTTD 1D6EA 3OKOA 1T0MA 1I8KA 1TQBB 3HKFA 5F3BA 1HHKA 2X6MA 3KG5A 5IFHL 3TO4C 4NO0A 4V2CB 5LWYH 3SDAD 3ZTJG 4APQC 5IMLA 4Z76B 2BSSB 2R1XA 2Y06H 2BOBB 3QJFA 1TDQA 4L9LB 2OL3L 3C5ZB 4KJYB 2BC4B 5MEOA 1BPVA 3V6OE 1I75A 1G0XA 3P9LA 4ORGB 2FR4B 3MV7A 1RSFA 4NNXA 2W0KA 4V1DD 5BS0E 2C4XA 1F11A 4MGXA 3V95A 1MFDH 3BAEH 3WYRA 5JHLL 1A47A 2J88H 5C1MB 5IQ7H 2V5MA 3DYOA 2VDRH 3EDDA 3LMJH 1CICC 1QRNA 2EXYC 2FBJH 1I1FA 3L3DB 2DDQH 5F7EL 5TE7L 3HFML 3B9KD 4LAJH 1XCQB 3QCUL 4MNQA 1OGAB 4Y4HD 2AJUL 4UINH 5I1HH 2H2PC 2IADA 5E8NB 5I73B 1J8HA 1NGWB 3SGDI 4JB9L 2H3NB 3CXDH 3DX7B 2Z92A 4OZGA 2YUXA 1UWGL 3REVB 4Q6IB 3RPIB 2YD4A 1AXSA 4PJHF 1MFCL 5CEZH 1U58A 4HWBA 4UT6H 3GO1H 4QO1A 4RFNB 2YWYA 1KPVA 4YHYC 1QFWL 1QBLL 3F7VB 5D4QA 1PX3A 3MV9D 5LG1A 3OKKB 3HI5H 1BIIA 4MQ7A 3RBGA 1CFTA 4G6MH 2W0LA 2R0WL 5I1CL 3OPZL 3CFBB 4KV5E 2NY2D 3L5JA 1IKNA 2FHCA 3CDYA 4DTGH 3RNKA 3EO0B 4Q2ZA 4IRJA 4CADB 3O8XC 1CT8B 2YD6A 2VITA 4JRWA 1KN4L 1MLCA 2DWEA 2R8SH 5ERWA 4NQDE 4X6CE 3QDMA 3BD3A 5GSRA 2A6DB 1J05A 3MRIA 1K9TA 2P5WE 3GMPB 5D93C 4Q58C 3RWCB 4Z78A 1JPTH 4G8GB 4XVUD 1SJEA 5TE6L 5DDHA 1QTYT 1QYGL 4YHKL 2MHAA 5T1LD 1LEIA 4OLVL 2R2HB 2YUWA 3WSQH 2BNRA 3D2UB 3HN3A 3T0XA 5H37H 4KTYA 5IOPA 3NPZB 3U0PB 3I75A 2OTWA 5EU7E 1AY1H 3SDXA 3J7HA 3E2HB 1MCLA 3PL6A 1ZLWK 4LVNB 4H1LA 1DBAH 1C8PA 1FE8H 1JPFB 1HH9A 4G6AD 5DEZA 1A4JA 1UZ6F 4M1CC 5BMFL 4PJXA 5I76B 4D0BB 7CGTA 4XP5H 1OAQH 4DUVA 2CKBL 5F7DB 1UJ3A 3VXTA 2BVYA 1R5VA 4RBPK 2OBGA 1QZ1A 5KSUB 1Q72H 5I8OH 1IEHA 4KMTH 4PJEF 4D0DB 2PXYC 5FB8A 3FB8A 2JJVA 4YHMH 2OR9L 5ID0B 1T80A 1YA5A 1HQ4A 5CD5C 2FATL 4JFDA 3EJJX 5I8CB 1M1SA 5C6PB 1FNGA 1G0YR 3JWDH 4YXHL 2IAMD 4JFXB 2CR3A 5K59F 3MSPA 2FJHB 4I5BA 4LVOC 2OJEB 4EXPX 3VE0A 1WZMA 3O41B 1ZLSH 1ZGLA 2VLRD 2C1OA 1C16B 4DCQA 2XKSA 3LQAL 4KKCC 3CGTA 1Z0NA 1OSPL 4OQTH 2Q20A 4TSCH 4NT6A 4CMHB 3OKEB 4Z7QF 5L2KB 4AYFA 4UT7H 2KH2B 1NUNB 4EDXB 5AAWA 3IJSA 5E4EB 3WS6A 5LXGH 5DC4B 4XMLL 5F89B 3VFRA 3H9SB 1L9MA 3CLFH 1SYSA 2F58L 2Q76A 1L7IL 3IGAB 5BZWA 5MP6L 3BPNC 4OCYL 2PO6C 5CINL 5DRXA 1D5ZA 3L5WB 1GIGL 3REWB 2VLKB 2E7MA 1A14H 3V6OC 4QXWA 1MHHB 4YHOH 1A21A 1HHHB 1RD6A 4G8IB 1NFIA 1A6TB 4QRRB 3BSZH 4OZ4A 1T7VA 3T0EB 2MKWA 4MHHG 3GBLA 3ULUF 3QIWC 5HVGB 3G6JF 1IVLA 4OD1H 4HUMB 1EA9C 3X13B 3RKDC 1ZE3C 4ZD3L 4OB5L 3MNVB 1G6RB 1AR1D 2HVJA 1X5LA 1KC5L 5T3XH 1HOCB 2OQJA 1MRFL 4LLDB 1A6UL 2FB4L 3R8QA 5EOCJ 1FNEB 5FO7A 4ZPVA 3OX8A 2HT4D 5DD5H 5HDQL 2R56L 4OI8A 1S9XB 3EFFB 3K1KC 3MLPA 1X5HA 3U36A 1KYOK 1LP9A 1U41A 1MVUB 3QPXH 1A7RL 3WJLC 2R4SH 3BISA 3NH7H 4GBXB 1CL7L 1OAXL 1CDGA 4RIRB 5DUBA 1F3DJ 1LO0L 5FM8A 4HF5H 4WFFE 5I1KL 3EFDL 3OJVC 1BFOA 3GSWA 4RZCB 3FONA 4I3RL 4AG4H 5SWSB 3VFGH 4I18C 5E5MB 2CDEB 4BSJA 1NCTA 5EC2A 2G60L 1AGCB 4X7SH 5FCUH 4GKZB 2IH1B 1JWUA 2B2XL 2X4OB 4HWEH 1NFDA 4JRXB 3QUZC 1NUGA 1P4LA 3O6FB 3O3DB 1K8DA 2DTMH 1PKQE 2BX5A 5EOTA 4TQEL 3NCFB 2CK2A 1MCRA 4Q6YA 4L4VE 3SY0A 3FT2B 1ZT7A 2ICWB 4UTAL 4UAOC 2EE6A 3O6LH 3UTTE 4X98A 1VB9A 4PJDA 5E5RB 1MRCH 1MJJB 5E5UB 3TBWA 1FZKA 4RSVA 5DFWH 3TBYB 3G6DH 3H6JA 1NLBL 1GOHA 2FJGB 4R4FL 4WWKB 4YNYA 2CUHA 5E6ID 2QKIB 1SM3L 3IAQA 1VFMA 4D9QE 1TJIL 4QHMB 2N7BA 5DQDH 3BYYA 5F1KC 3AGVA 4ERSH 3O4LD 1ZS8A 5IFAL 1JRHI 2HJKB 4JDTL 4L8SA 4B50A 4PY7B 5CHNA 1AHWA 3QH3B 3S4SA 4KTDH 3OR6B 5IKCB 2MKLC 1I1YA 4QOKE 4M6NH 2EC9T 5IBTH 1LEKB 1J0IA 1INEL 2CLRA 4FMFA 1BQHA 4J1UB 1Q9LA 3SOBH 4ODVH 3RI5F 3O6KL 5DT1L 4LPVA 2ZSVB 5E2TH 3FO2B 5SWQA 3GIVA 3L3IA 5ENWB 5EULV 3TN0C 1G7IB 4NJ9H 4D0CB 1T66D 4FMKA 3WFEL 3CMGA 4RFEB 2HLAA 4WTZA 5HPMA 3BD5A 3M17B 5DR5L 1WF5A 2EYSB 3MLWH 2WW8A 4IDJH 2WWKT 1QEWA 5D6CB 4BYHA 4Y1AD 3IXAA 3ZT7A 5TGBA 3BQUA 1XF2B 2IJ0C 1KG0A 3NGBB 4M48L 1XIWB 3D0VA 4N0FA 3O2DL 4ODTL 3K4DA 3QFDA 3TVMA 3W0WD 4U1JA 5C9JB 2ORBL 2CDFB 1A3LH 3TT1L 4DKFH 3LY6A 3QXVA 4LCIL 1IL1B 5ETUA 3BDXA 3LPGA 5AD0A 2X5PA 1NBYA 1FVCB 5I66A 3OJDB 1T1WB 5DJ0A 1G7QA 5DJ2A 1KUMA 3TH4T 3RZWA 2I9TA 1EXUA 1LDPL 2X4QA 1IAOA 4H8WL 1NAMB 5GJTL 1BEYH 1QA9A 2F54B 1AC0A 5BO1L 1RHHA 4Q9QL 3QDGE 4G9FD 4M5YL 3QUXC 1EEZB 3WNKA 2C7UA 3OAZK 3AMLA 3LS4L 4IS6B 1XF3A 1ORQA 1DBKH 3OB8A 3K4ZA 5C07B 3WHE0 4XX1G 1ZVSA 1K4DB 2Q7NA 4CDGC 5D2LA 1WIUA 4OGZA 4L1DA 5HHOA 3V0AC 3H3PH 1XF5B 2PW1B 3E6HA 3MFGB 4RRPG 5HJ3A 4Z77A 4U4BA 1T04A 3WFHB 3V4UL 3ARSA 1FRGH 4FNLH 2AS5M 1F6AB 3KLSA 1RFDH 5DEGA 5JQ6H 3AY4C 4NQXB 1F02I 1YC7A 4HUXB 5HYSA 3MV7E 3GBNH 2OR8A 2O5YL 4LEOB 5E1HB 3L5IA 3QHTC 5EFIB 6FABL 4PGBA 1QRNE 3GMLB 2VIRB 2NR6D 2A9MH 4LP4A 2VLJA 4MNQE 1HWGB 3RIFK 1CF8H 2VZVA 5LAXB 1M6OA 3S8WA 4BM7A 1VADA 3UEZA 5IMKB 5EU6B 3CFDA 3WEXA 3H42L 3TIEA 2ZUSA 1G7LB 4HJGA 1FORL 4OZGE 3H7LA 5J56B 3ARDB 4CN1A 5E95B 3DMMB 2V5TA 5DQJB 5HHNB 2PKDA 2Q8BL 3S3JA 3MJ9L 1DL7L 2QQKH 2Z8WC 1HKLH 2H1PH 3SPVB 5FV2A 1H5BA 1EUTA 3EOBB 4Y5VB 1EO8H 5EOCL 3KJ6H 4U6TA 4JDZA 1PG7X 3K8LA 3LH2L 3BJLA 5CBEA 4CNIB 1FZOB 4HIJA 4UV4L 2X4UA 5FCSH 4EUPG 4LLYA 4DVRL 3MRHA 3KWWB 5ESQA 5MERB 3FB7A 5EUOF 1U8HB 1QFUL 2A74A 1H3WM 4UNUA 2BVUA 3BD4A 1FG9C 3MJ8A 2C3VB 5KBNC 4LCWB 1Y6MR 3BKJL 4DEPC 1NMBH 3E3QC 5DVKA 4UB0L 4Y5XC 5DJCA 3JTSB 4G7VH 4MJIA 5KSBE 2I26N 3QDME 4HUUB 2ED7A 4GG6A 4YX2H 2AV7B 5CZVH 3TBTB 4O58L 3DXAB 3CD4A 5FUZL 1B3JA 4PTTA 1CG9A 2BY0A 3PXHA 3D69A 1LO3L 4Y5YB 4JFFD 3DRTB 2AJSH 1OM3H 3U0WH 3PIQA 1DZBA 3QUMB 4DZ8A 3RVXC 1DQLL 1A3RH 4X4XA 1IM3A 5DVLA 4RMVA 4EN3C 3BN9C 4I9WD 5BRZE 1B0GB 4UBDC 4OLEA 2QLVB 3AREC 3G6AA 4PJXE 1Q9KA 2WLZA 4Y2DD 4EI6B 3O3UN 2J6EH 3D5OF 1WZ1L 1MCOH 2VDPL 4WI9A 2M8XA 4F7PB 1NC2D 4NC2B 4NQEA 5DFVC 5I1EL 4G8EA 3BH8A 1EK3A 3KPOA 4XPTH 4EVNB 1ZT1B 5B39A 3MXVH 4K94C 5JOPE 3EO1B 4E9LA 3AAZB 4YC2C 3ZE1E 1L0QA 1ZVYA 2EC9U 3IU4H 3SJVE 5IEKA 4CVZB 3BOVA 2NPLX 3WN5B 5GRWA 3NIGE 1MCBA 2GI7A 4LRIC 3MUY1 4OD2A 4U0RB 1SBSL 3OKDA 2PW2B 3FFDA 3DHMA 4EQ3A 3QUKA 4WNQB 1YN6B 2X9XA 1J11A 4R2GC 5C2BH 5DVOA 1SEQL 2DM2A 4TN9A 4K8RH 4XCYA 5EN2B 3F12A 3MGAA 4HK0A 3STZA 3LD8B 1NDGA 4M6ML 4BSVA 4EI5B 2BY2A 1TLKA 4FQLL 1H3VA 1OGAD 2FX8H 1U3YA 4OUUB 1FIGH 43C9B 3S88H 1PQZB 4M7KL 1U92B 2DIBA 2DICA 4ZFFB 4TPRH 3A6OA 3FFCB 1T0NA 1UENA 4JM4L 5CJQH 3ARFB 3ZL4L 1GYAA 4M43L 2BSRA 5DQ9B 1RULL 4CJ1A 4ZUWA 5CJOH 4Z95H 2HFGL 2XV6B 1QHPA 3IKCA 5I1JH 2Q87A 4QRSA 1FVEB 1SJHB 4G43A 2PTTA 1NCNA 1EGJH 2DBJA 1PJ9A 3FT4B 4ZXBD 3V8CA 2Y06L 5D1XD 2CKNA 1CFSB 4NM8H 1F2XK 4LSUH 4M61B 3KXFA 4N1EA 5HYFA 5CEXA 2XPGA 4JFHE 5FYLD 1UXWA 3QNXB 3RWGA 4WEBL 3ESUF 4L1HA 3T0VA 3ZE0F 3TH3T 4KI1A 1CCZA 3BAEL 2VUOA 2FDBP 2J88L 3U79A 5IQ7L 1YJDH 3LMJL 2FBJL 2ZPKL 2J7LA 1JWSA 2VZTA 4EUPB 1CGSL 1IGCH 3BH9B 3MRLA 4QRPA 2JJSA 2VAJA 4JE4B 4UINL 5DEFA 1QRKA 5I1HL 4NO5A 2VXQH 1P53A 2P8LB 3HNTL 4NBZB 4ALAL 3N85H 3OHXB 4DKEH 3PWJB 1IT9H 4NGHH 1HYSC 4NWUL 1KCSL 2XY2A 5F9WC 3TBSA 3WIIL 5IMMB 4WFED 2VZUA 3QWRA 2I60H 2BNQB 4XNMB 1IKNC 4LF3A 5DJYA 1CXHA 4IRJC 4DVBA 1FV1A 1ED3B 1PEZA 2APXA 4NSKB 5CEZL 3C09B 1I8IA 3KPPB 1C12A 5CAYB 4UT6L 3GO1L 3ES6A 2F5AH 1NMCC 4O02H 3SKMA 3CU7A 1RJLA 2AQ2A 3RWDB 1RV6X 1DE4B 3JV0A 1E27B 2OR7A 3G5YA 3LKSB 3HI5L 4U1LB 5EOQH 2F8VA 3FN3A 3VXSA 3ILPA 4DTGL 5KTEH 1XH3A 3TA3A 2OI9B 5J11C 4APQD 1NC4A 1H3TA 4G3YH 5GGTH 1X5XA 4EDWH 2R23A 2APFA 4U1GC 2R8SL 4GXVH 3TIDB 1WFOA 3LZFH 4P4RB 3IJHA 1QG3A 3PL6C 2FSEB 1NGPH 2A9NH 4DFIA 3MCKB 4K7PX 3ZYJA 1H0DB 1DVFB 3GJFH 4ZODA 3GSNA 1MY7A 1F4HA 1WITA 2VQ1A 5CSGA 3VRIA 5HGHA 3MV8E 3S3PA 3OGOE 1OCWL 4LPXA 1XGQB 3WSQL 2FHFA 1SJXA 4IOFC 4N0UA 4MAYD 4BH8B 1T20A 2WBJA 3SKNA 1UJ3C 1AY1L 1AXTH 4JM2A 3WUWA 2EE9A 3HE6D 3HZMB 1DBAL 4X5WB 4U2ZA 1X5IA 5DD6B 1C1EH 2UY6A 4J3UA 4JAMA 3D85B 2LU7A 3LKNB 4LU5H 5J9PB 3VI4F 3HR6A 1ONQA 2XWTB 4IRSB 1UH4A 4C59B 4XZUA 2UVEA 4XP5L 1OAQL 2NXYC 1R3IH 2R2BB 4B7LA 1T1YA 4LLQA 3VWJD 2VXSH 4BA8A 2NYYC 2EH7H 3JVGA 4WV1A 4JDVB 4Z0BL 2AJZA 2EIZB 1IGJA 4WCYL 1B88A 5GS3A 3ARVA 4Y4FA 2EXWC 3FO0H 1QACA 1RIVH 5JNYB 5J7CC 3C60A 3JWDL 5HDOA 3I6KB 3WO4C 1X9QA 5AZEL 3ILQC 4KXZI 4JFEB 5GJSH 4R97C 3WS6C 3G08B 3QZWG 4WO4B 5I8EB 1YEGH 3U30C 1UKQA 2Z35A 1FYTA 2V9TA 3FHQA 2OP4H 4N5UA 4OTXL 3UTSB 1E4XH 4HIXH 5H37G 5DRZA 2P8MB 3LKOA 4KK6D 3UPRA 4L29A 4PLOB 4OQTL 1EH9A 3S97C 1WWCA 2CIKB 1NFKA 4POZC 4GBXD 3LQZA 2EDNA 3TNMB 1NCWH 4OLZH 2V17H 4UT7L 4L3CA 3C6LB 1FBIH 1TCRA 2NY6C 5SWZD 5T3ZE 2LABA 2L0DA 1OL0A 4DZBB 4F7EA 5C08A 3CLFL 5F93C 4RGOH 4QF1A 4F33A 5AWNL 2P24B 3QO0B 4N8VG 3ZHLA 4QHLB 2ESVA 2E8YA 1P84J 4XVJH 1K85A 1NCAH 1P84K 4ISVA 4YHOL 3LEYH 3MCLL 3BSZL 3TCLA 5HHME 1J88A 3KPLA 4PUBL 4YDJA 3WDIA 5HHOE 4IEFB 5GRJH 1HXMA 4L9DA 4LBEA 2CQVA 5HYQA 2I9LA 3B43A 4NYLA 2PXYD 2YUVA 3PWNB 2C9AA 1KBGH 4UI2A 2V7NA 5T3XL 5FAAA 3TCXA 5IW1A 3LRSA 4KI5F 2YRZA 4P2RB 1R3KA 4JREC 3L3GA 3ZKSD 4QY8B 4YGVB 1AJ7H 1T1ZB 2AJYH 4XNYL 1N8ZB 4YFLI 4Q7DA 5DD5L 4AL8H 4JJ5B 2ICWJ 4OAWA 5DGRA 2O5ZL 2Z4QA 1WAAA 3LN5A 3ULSB 3O4OB 3QPXL 4M6AA 1R3HB 5IB1A 2FGWH 3WDHA 1EZVX 1DLHB 3NH7L 3BESR 5CIPA 1F58L 2NY5C 1N3NB 2VLJE 3P0YH 1WEJL 1X44A 4K3JH 4LSPL 1KJVB 4HF5L 3F8UB 2G75B 4Y4KA 2F19H 4XPHH 1MHPL 4AG4L 3VFGL 3VXRA 2DLGA 4NPYB 2JJTA 4Z7OE 1BJ1H 1HINH 3DETC 2P46B 4U1IA 1JYWA 3HPJA 2VXVH 5FCUL 2X4TA 3W9DB 1EVUA 3LDBC 2FCBA 4PYHA 4RNRB 4DUWA 3C2AL 5GZOD 5DRWA 5HPOA 5IR1A 15C8H 3WE6A 2YA0A 2HJFB 2J8UE 2YPLE 4K94H 2M1KA 2B5IC 1M71A 2HLFD 5GGVY 5IHBA 4RQQA 1II4E 1FSKC 4X8JA 5BS0D 1WBXA 4ONHA 4ZUSB 3O6LL 2WQ8A 3QUYD 3VMOA 5D9SB 1G9EA 2GHWB 4L8SC 4Y19B 1MCCA 3HI1B 3WFBL 4M1GH 3VI3F 4PJ5A 4F7MA 4PJIE 3KPRE 3G6DL 1AHWC 4MJIE 3ARXA 1R3JB 5FYJE 2YEZB 2EYTA 4HQQH 5EUKA 3ZZ1A 3HMWH 3LEXA 4XPFH 2BVQB 5JW5A 3HB3C 4OZIA 1K5NA 1GGCH 1FZJB 4HIHA 3T77A 3FL7A 1PZUB 2P43B 3RTQB 5FOBB 3QWOB 5IV2A 3UZEA 5ANMB 2VLLB 1S7QA 4BH7A 2ZCKH 5HD8C 3S6CA 1DN0A 4KTDL 4PJ8B 1G9MC 5TH2B 1E4KC 2F54D 5C0CB 2IQAA 5IW3A 1BP3B 2WIIB 5IBTL 2XQBH 1KELH 4E0RB 4ETQA 2Y36H 4E5XA 1KACB 1MF2H 3BQUC 2FIKA 3BUYA 5C07D 3WXWH 3DI2B 5B8CA 2FLBT 3VXPB 3TVMC 3SBWA 1DJSA 4BQ8A 2ZUQB 1JVKA 4MZ3A 4NJ9L 3N9GL 3OGCA 3MV11 3T09A 4R6UA 4LSDA 4NQDD 2E27H 5C0ND 4AH2B 3MLWL 2P5WD 4IDJL 2ITCB 3KPTA 1S7WB 4LHQB 1I3RB 4S1QH 1DBBH 3VG9B 1DUYB 4XBEH 4HKJA 4N8VB 1VKXA 4D8PB 1LILA 2QHRH 5J1AA 4BSWA 2EDYA 2GFBA 3HZKB 1R5IA 1IBGH 4DKFL 5CSBA 4I2XB 1P2CA 4LPWA 5E00A 1JZ2A 4I77L 2IALA 3HG1A 4O2CA 3EOAA 4MDIA 4Z7NF 4HWBH 5DI8A 2W07A 4XP6H 1OAYH 1KTDB 3LKPA 5IVXB 3MACL 2WAHA 3HC0A 4LLUA 4R0LA 4XHJC 1P69B 3IYLW 1QQDA 4NKMA 1EJOH 2GQHA 4NRYA 5FA3B 3ARDD 5J6GA 1JWMB 1DBKL 2VC2H 2RJMA 4BK5A 1G9NC 3MOAL 2ZOLA 3MREA 2YD1A 4FQXA 4MAUH 1F3JB 3FOLB 2JK5B 1I7UA 5LGJB 4IIQA 1EPFA 1IAMA 1ZHNA 1DBML 4KPHL 4OKVA 1QO3B 1KEGH 1D3CA 1QBMH 5GGRY 1OLLA 4MWFA 3M1BA 4KK9C 4Z18A 4YZFF 1RFDL 4HLZG 5JQ6L 1RZIB 2G9HB 4I3GA 3MRJB 4H1LH 5FA4A 5LCVH 5GIRA 1YPZA 3GM0A 4R4BB 4NQCB 2G5BA 2NNAA 1NQBA 1UGNA 3GI9H 2A9ML 3HS0A 1C5CH 1H5BC 1CF8L 3DO7B 1UA6H 4C56E 5GGSA 1E28B 3MBEA 2KQNA 4YHZL 1L6ZA 1YMHA 3UTZA 1BBJB 2EH8H 1EFXA 2PCPB 5MENA 3RGVB 4G9DA 3KPSB 5T5NG 1RMFH 4NRZA 2GKIA 4PD4J 4X6DB 1ZHLA 5KSAD 1TVDA 3ARBA 2QQKL 1HKLL 4PD4K 1S78C 5C0GB 1EO8L 3KJ6L 5J12B 1HHJB 1IC5L 4R96B 2VDNH 4FXGA 1U36A 1KIPB 5I1IH 2H9GA 2Q3ZA 3NPSB 1AGDB 2B7DT 2BFVL 1P7KB 1YNKH 1WISA 3VXSE 5C2UB 1QKZH 5MEPB 4QRTB 2ZCHL 1S7SA 5E8DH 5C0JB 1ETZA 5F72S 2UUDH 5HVFB 4M7JH 4ODWA 1MJ7H 3VA6A 1HK6A 1NMBL 4BUHA 1LQSR 1Q9WA 2HT2C 2R9HD 2I07B 2M26A 5IVZB 1H8NA 4KKBD 1RJZB 4KKNA 5E03A 4YX2L 3TWCH 2VKXA 4ZG1A 1MWAL 5FGCE 4GRWH 3P0GB 5A16B 5I71B 4MJ2A 4EI5D 2XTJB 3HZVB 5EC1B 4NUJB 4CKVX 5DA0B 1OM3L 3U0WL 1Q94A 4N0UE 1A3RL 1OP3K 4AQOA 5KAQF 3GM8A 5E94B 2HKHL 3TJHC 2UZIH 4U0QB 1A7QL 4YWGL 1WVZA 1PZ5A 3IFNH 1YMMB 2VRAA 4L4VD 3L3JA 2J6EL 3DX8A 1VFAB 3NCBB 3RWJA 1MCOL 2VZ1A 3DUSA 4L5FH 3IU3B 4PJFE 3K1DA 3UTTD 3LN9A 1E6JH 3RX8A 4ODHH 3HAEG 4HKZB 4M7LT 4O5LH 3IDIA 5J13B 3PWPB 3QFJA 1INQB 3MXVL 1DQTA 1S7XA 1S7UB 1YECH 3BYTA 4X7CC 2X4RA 5D5MB 4BZ2L 5I1AA 2FEDD 1UQSA 4MSWB 1QSEE 4GW1B 2FO4B 4F15C 1KSRA 3QG7H 4XH2A 1ZA6B 5TF1H 2XN9A 2ADGA 4JN1H 4HWZB 5D7JA 5T1KA 2NZIA 3TO4B 1H15B 4I4WB 4P5TB 4HFWA 4CMMB 1UM5L 1BMGA 2AJXH 2Z91A 3CJJA 1AGBB 3S96B 3IFOA 3O3AA 1Y0LB 2XKNA 4FQPA 1HH6A 4GKSB 4YHIA 3Q48A 5IM7B 2FX8L 2ZG1A 3SGKA 3S88L 5F1NA 3U1SH 1T22B 4PLJD 4KKAC 5HGGS 1KCUH 1W72A 1CICB 2EDOA 1GGBH 5IQ9B 1WBZA 5ALCH 4ENEC 3GBML 2X1XR 1JTTA 4JRYA 2BNQD 3DTXB 3G5VA 1FGVH 5DMGC 5CJOL 2DF3A 4Z7UE 4Z95L 5E08H 3QWQB 3U2SB 2VDLH 3MCG1 5D7IA 5E9DA 4YIQB 2R4RH 3BKML 3QIUD 5HI3D 1VFBB 2JCCB 5LBSH 5ID1B 4XPBL 3FCTA 3BT2H 3QXDB 3NFSL 4KY1H 3MRRB 5D1ZB 4YAQB 2JJSC 2D31B 4YHYB 5CBAB 4HHAA 3DVGA 3F7PC 4TSAL 3KJ4B 4HK3J 1BX2B 3PQYB 1YY8B 4X5XB 4HT1L 4F2MB 1G1CA 3WDJA 5F71A 5FO8A 1MFNA 1K2DA 2OMNA 3KPNB 4E41E 2F9BT 5TQ0H 3O8XB 3BVNA 3WIFB 1EZVY 3RVTC 4R2GD 1WAAE 3QDGD 3D9AL 1JIBA 1TTUA 3A0OA 1TQCC 5F21B 1MCQA 5INDB 5D93B 1N2RB 3N85L 4EQ2A 5L88H 4NC0B 1JZ5A 1IT9L 1G9MH 4NGHL 3JZ7A 4OLYH 4MD4A 3U4EB 2J4WL 3MFFB 4KZDH 3RZCD 2NY4D 4LHUG 2R2EA 1X6NA 3BKCH 1S7TA 1PYWA 2I60L 4RA0C 2YA2A 3D85D 3Q1SH 4UILH 2Q7YA 4Y8AA 3TA3C 2XG5A 2YD2A 1FP5A 2Y5EA 1JGVH 2E9IA 3WHE1 3RGHA 2F5AL 4O02L 3MC0A 1J1PH 4YPGA 5D72H 1OSZB 3R06A 3UBXA 1RZFL 1NGQL 4G6FB 3SDCD 4QHNA 1CLOH 2YZ1A 3WO3B 4RGNC 3AU1A 3PABB 4J4PA 4XGZA 4X0KB 2WMPA 5KTEL 5MEQB 4OBRA 1HDMA 2E9BA 4JG0H 4JO2H 4NN7C 4G3YL 5GGTL 4FFWC 3LB6D 3ZKXC 1F42A 3VXNB 5IJVB 4NWTH 5EBWA 4EDWL 2B4CC 3MRQA 5E7FA 2WBJC 4GXVL 3ULVE 5CP3A 3LZFL 4JM2C 1F2QA 1KOAA 1NGPL 1P9MA 5T5FH 3V2AR 2NLJB 4JR9H 3ZYOA 4UT9H 2UY7A 3FQRA 4QXTB 5F9JA 5C0DB 4UDTA 4XWOD 3D3VB 1K6QH 1QLFA 3NCYS 4E42A 1T7XA 4OZIE 3VFWB 5FKPB 5FF6A 1SY6L 4PV9A 3OXSB 1I7RA 1AXTL 1RVFH 3CSYB 1J1XH 3OXRA 3DVIA 1DQDH 3I50H 5F7WC 3JVGC 1GVIA 4YUEH 3B8SA 4WV1C 3EYVB 3KYKH 2OTUA 4LU5L 1ZSDA 4KJQC 3ME0A 5I0ZA 4Y4FC 4IMKA 3SDAA 4WUKH 4IOSD 1YEJH 3C60C 2FZ3A 3KYMB 1FIEA 1R3IL 3TEUA 2UWEE 3GSOB 2EH7L 4MYWB 4DN3H 3S35L 2AJ3B 3OKYA 4K3HA 4AZ8A 3BPNB 2PO6B 3DVFA 5FYJU 5GGUA 4V1DA 2XNAB 1Z5LA 5HYIA 4M8QB 1RIVL 2FH6A 3Q6GL 5J89A 4P2QE 2XWJA 2YSSB 3CDCA 2PR4H 3B9KA 2H2SD 1GGIH 2DQIH 1ND0B 4N90E 3QIWB 4CW1A 3V6FB 1GCFA 1NDMA 3EYOA 2CDGA 5HHQB 2OP4L 1E4XL 1LE5A 1HIML 3Q3GA 4XI5C 5BRZD 4MJ5B 5B38A 2VN7A 1D5BA 2ERJB 1TJHL 3HG1E 1O0VA 1Q9OB 4CDHA 2WBKA 1X5AA 3DOSA 3IDYB 2P49B 5HXMA 1NCWL 2A6IA 4MX7A 4OLZL 1OAZH 1HSBA 2DB8A 1FBIL 2BVTA 4W4OA 3NZ8B 4ZOAA 3VA2C 2NXZC 4M3JA 1B6UA 3NACL 3X11B 4PG2A 1RZKC 3CCHB 5JOPD 3MV9A 1M7IA 3MTRA 3T65A 4M4PA 5KS9B 1AR2A 2Z9TA 1HNFA 1NCAL 1SVCP 1YNTA 4QWWD 3SJVD 1MQKH 5I30H 2QSCH 3LEYL 4Q97A 2VWEE 3MLZH 3MLVH 3VFVA 4WENB 4ZYKB 2GT9A 3L3KB 4HIIB 2X7LB 2AXFA 3ARPA 3MUGB 3PHOA 5GRJL 3E6FB 3QDHA 1CYGA 1KENH 2VNCA 3A67H 3EGSB 4FP8H 4PJEA 4Y89A 4HH9A 3V6BR 3F7YA 2VISA 5EBLA 2ARJB 1KBGL 4H26A 3C8KB 5M95B 4NN5C 3HE7B 4OZHB 5T1LA 4Y19D 3OBAA 1UZ8B 2NCMA 3RX7A 3CZFB 4UU9A 1AJ7L 2AJYL 1IZJA 4S2SA 4HBCH 4Y4KC 4YDLC 1CK0H 1IM9B 4UAOB 3WL9A 5I75B 3K0WA 1KCLA 1YPZE 2JJTC 4ZOEA 5EWIH 3AXLB 4WUUB 2DYPD 5IMOB 5BW7A 3P0YL 4Z0XA 3VH8B 3RTQD 1C5DA 5HHX