2OTUB

Crystal structure of fv polyglutamine complex
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
118
structure length
118
Chain Sequence
QVQLQESGGGLVQPGGSLKLSCAASGFTFRDYYMYWVRQTPEKRLEWVAFISNGGGSTYYPDTVKGRFTISRDNAKNTLYLQMSRLKSEDTAMYYCARGRGYVWFAYWGQGTTVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Implications of the structure of a poly-Gln/anti-poly-Gln complex for disease progression and therapy
rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords Fv light chain variable domain
total genus 28
structure length 118
sequence length 118
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2007-02-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2otuB00
3O4OB 5FK9B 4OB5H 2J8UF 3FOMA 2BNRA 4JAMB 4MD0B 5L0QC 3OKKA 4JDTH 5GZOD 3L7EA 1HH6A 3EDJA 5C0CD 5HGGS 5KZCB 1RZ7L 4I3GA 1BVKB 1DANT 5ISZB 4CADA 4ZPVB 3R0MA 3R0NA 2CLVB 3FFDA 1U8KA 3VH8A 4WV1C 4DOHB 2Y5EA 5ICYA 1OTUC 2E9IA 2HLFD 3KYMA 3MV8D 5HHXL 5J3HD 1P53A 3CC5B 2LVCA 1HYSD 4MCYB 4HS6A 2M2DA 1CXKA 2EH8L 4XPBH 3ES6B 5BVPH 1MWAB 4PRPA 4G42A 3PUCA 1FHGA 2A0LD 5C0GA 3QIUB 1C7SA 3GBNL 4WENB 4Y16B 3T2NH 3LKNB 1SHMA 4HPYL 1IGCL 4JRYA 4Q97A 5IEHA 5IB2B 4WUUE 4BSWA 1JPSH 4DJMA 2VLJD 5HHVH 2R1WA 4JHWL 1HHKB 5TE6L 5E9DB 2QHRH 3N1QC 2MJWA 2XQYG 2Q76B 2H2SC 4N8VB 3SE9H 3W11C 1XIWC 5F96H 4AL8H 4KVNH 1YQ2A 2BHZA 5DF0A 2GT9A 4FZEH 1W0WB 4LPWA 3STLA 3BDYL 2CO6B 2R2BA 3RWFA 1FLTX 3ARBC 5D5ME 2A6JB 1A5FL 3AAZB 5F1OB 1Q8MA 4OZGF 1NAMH 3CLEL 3U2SB 4U1SB 2J5LC 4DUXA 4XPTH 1NSNH 4LSTH 5C70A 1MFEL 3UP1A 4RIRA 4RGMC 4ZAKB 2FLBT 4D0CA 1AO7D 3SO3B 4DK6A 3ULVD 2B1HL 4O02H 4RMRA 3F5WA 4S0SD 3F8UB 2E9JA 2IADA 4DCQA 1HQRB 2J8UB 2IANA 1DCLA 5SV4A 3W39A 1YEIH 1M7DA 3KJ4B 3B8SA 1N5YH 1T1WB 4CMMB 4W4NA 3JWOH 4MNQA 3MNZB 3SKJL 3OKEA 3MV9D 3FQUA 1A6AA 4FXGA 4X5XB 4BQ6A 5EZJB 2P5EA 4MWFB 5F1NB 3BEVA 2FX9H 4GH7B 2N4IA 2DQTH 2VUYA 1FG9C 4NRXB 2APVA 2EDLA 3BESR 2M8XA 3O6LH 3UTZB 2E6PA 5SX4H 5HHME 2AKRB 1ACYL 2VLJE 2EYTA 1S5IH 5DXWA 5EBLA 3B43A 4GMTH 3QNYA 1C12B 1NGPH 1QQDB 1DUZB 1LEIB 1LMKA 3HFMH 4ODUB 1D5ZA 3DJ9A 3KXFD 3ZKNC 2VIRB 5JXAH 4P2QB 1F00I 1I8LA 1IC1A 3I9GH 2UUDH 4HH9A 3U48A 5C0AD 3CZJA 1VCAA 4X6CB 5GGVH 4JM2C 3GMPA 1U8KB 5J6GB 2VKWA 3KLDA 3OQ3B 3O6MH 3BWAA 4HC1H 3LKOA 2B39A 1IGCH 1S7VB 5CILL 1G7LB 5BS0E 5I75B 2UWEA 4JFXA 4WTZG 4PRPB 3RVUC 1JP5A 3SQOH 4KKCC 4Y16A 3BRFA 2XICA 1OW0A 1CL7I 3N1FC 4DZBB 1K8DB 1XZ0A 1H0DA 4ZXBC 4M7KH 2Y7QA 1JPFA 2YA1A 1Z9OA 2GJ6B 1FNAA 2OQJA 2HYMA 2WBJA 1EXUA 2YK1H 1KULA 2V2TB 3C8KB 5HGAB 5ISZA 4IBLT 2BVOB 3EYVB 3OJDB 3QO1B 5EU6E 3HNSL 4WTZA 1EX0A 5INDA 3AS0A 3BUYA 32C2B 2EIBA 4ZUTA 1CK0L 3SDDC 3GSOA 2CDEA 2HN7A 4XMPH 3FT3B 4K7PL 5E03A 4NZTL 1NMAL 2VDNH 3C5JB 3L5HA 4BH8B 1VFOA 3QIUA 3BAEL 5E8DH 1BQHG 2ADJA 4F80A 5LWYL 3PWNA 1NCDH 4OKDA 3ARZA 4KUZH 3B2UD 5B3JF 2QKIB 1JWUA 1GGUA 3NCCB 4R97C 3H6JA 5L88H 3S8WA 4O4YH 4XAWH 4NO2B 5BMFL 4PY8J 4Q9CA 4HGWA 3L6FB 4KQ4H 3LY6A 1YPZA 1O7VA 5HVWA 1CFNB 1DVFD 3MA9H 4KI5E 1A7NH 2YPLE 1HHHA 5IFJB 4P3CL 4U1JA 2DWDB 5I1EL 5IBLD 2R69L 3U2SA 4XP4L 4PLNC 4XC3L 1P84K 5HXMA 1UVQA 3PHQA 3VXUD 3U7WH 1FIGL 5HHMB 5L2KA 5EZLB 4P46B 3BD5A 4NO0D 1MIMH 4OLUH 3K4AA 4MGXA 4YK4B 5JIIA 2B0SH 2PW2A 1UYWL 3OAUH 3BKCH 1LO2L 4HUXB 2V5RA 2BOCB 4ZUWB 4QNPF 1ITBB 4AEEA 4I0PD 3B3IB 4EDWH 1XMWA 4HWNA 1N6QH 3B9KB 4JFYB 3B6SB 4MQ7B 5DRNB 5CUSL 2P5EE 2X4RB 9CGTA 4QRQB 5KSAD 2JIXB 3AS3A 2NX5D 3MNZA 1F2QA 3NIGE 4Z7UB 3WXWH 3DVFA 2PTTA 3U30B 1J8HB 2QSCL 3EO0B 5K59E 1YNLL 4JJ5A 4CMHB 3SGKA 3C60A 3V4VH 3KPTA 4M93C 2X6MA 3W0WD 2P8PB 3D85D 3FN3A 3WHXA 4FQJH 4HKBA 4FQXD 1HWHB 1S9WB 2R0WH 4LLYA 1F3JB 4M6NH 3ARQA 5DD6B 1V7MH 5HYSB 1J86A 5C0BB 3HI1A 4NDMB 1INDL 4NO3A 4HX1B 4OF5A 5FCUL 3BZ4B 3E6HA 3WNMA 2A0LC 6CGTA 2IQ9L 4WI6A 1IEBA 1E4XH 4Z5RA 4KHXL 1DQTA 4NGHL 3SDAC 1SQ2N 4LGPB 5GS3A 1JGUL 1YQVL 2UWEB 3RNQB 1F90H 1P84J 2EKSA 4EI6A 2C1PA 4WI2A 5ALCL 3H7BA 5D6CB 3VFVA 3X14A 2VXQL 5I1HL 5GXBB 1H15A 4E41E 5JNYB 3C5ZB 3GSUA 4XCCH 1OWWA 1PSKL 4MHHG 3BEWA 2IC2A 4MJIA 4MLIA 2Y72A 2C3XA 3RWHB 4PFEA 3DMMA 5JOFA 4PG2A 1OAKH 3MNWB 4G8FB 3QXUA 5HYSG 3T1WA 3ARBD 2JCCF 1KIQA 3CXDH 1K5NB 3VXQB 3HZYB 3O0RL 1NUFA 3TA3A 3T3ME 2V7NA 3MOQA 4L8BB 35C8L 3L3KB 4OT1H 4P23A 5D2NE 12E8H 4CMHC 3CFKB 5DDHB 3BVNA 4UINL 2VSDA 2IAND 5A16A 1T6WA 1XF3A 4P2OA 4K3JH 1ZT1A 3UXFA 4ZFOL 3MUY1 4QOKD 2CRIA 5D7KE 5CBEA 2DYPD 1ZLSL 5ESAB 1T5WB 5I1CL 4CNIA 1UKQA 4PRDB 3HCVA 1LEGA 3BKYL 1SYSA 1RJCA 2V5SA 2AJXL 5C07B 1Y6NR 3BIBX 2FJHA 1NCWL 4LSDA 5LAXB 2WWKO 5C09A 3WXWL 5HGHA 4K9EC 1HHIB 2OR9H 5GRZA 3P9MB 5HBBA 1IC5L 2ADGA 5C0IA 1OP9A 1QPPA 2P4AB 1U8LB 2NMSA 1UT9A 5CAYB 3RQ3A 1ADQH 1CDYA 2EECA 3K1DA 3I6LD 1QVOB 3FQRA 2ESVA 1AGCB 3MLZH 4LARH 1BOGA 3PV6B 2VWEC 4KMTH 2R2HB 1BVLA 2NY0D 3WL9A 1WJ3A 3FJTA 4WFGE 3R1GL 5FO7A 4DZ8A 3M1BA 3BRGC 4ZFGL 2XXCB 3D39A 5IFHL 5DQDH 5CP3A 1GOGA 4U7MA 4JAMA 4LLYB 2FWOB 5E5MB 5A2KH 5D8JL 4XZUB 2X4NB 2FECL 5FM4A 4ZUUA 3HC3L 4MXWL 5C6TH 3FO1B 4JFDA 3QQ9C 1CG9A 3MRKB 1HOCB 1LP9A 1OAZH 4RA3A 3BH9B 3G6DH 2ZCLH 4QRSB 1MLCB 4FXKA 1BIIB 4UQ2B 3QIWC 1SYVB 5B38A 3VH8G 4MZ2A 5DJ0A 2G2RB 4NJAL 1DBML 3GIZH 2YA0A 5D2NB 3SE4A 5IB3A 1NC2B 1NANH 3VG0H 3SQBA 1QTYT 2HH0L 4UILH 3GSNB 4KDVA 1IGMH 1ZGLB 4FQLL 3OKLA 2EDYA 3WS3A 2YD5A 3ULUC 4JFFD 4NN6C 4PJHF 3F58H 4AQ1B 4FNLH 5K9KB 1XR9A 2OP4H 4XWGH 5CHNA 3IXTB 3TVMC 4HKXB 4YK4C 3BE1L 4UDTB 2W60A 1W0WA 1X6NA 3RKDD 1JRHH 4ZD3L 5DDHA 2HFFA 1U3YA 3GMLA 2J8OA 2Q1EA 2D03H 1D6VL 3FB6A 3HAEA 1JNLH 4HS3A 2FZ3B 1YNLH 4FG6D 2NTFB 3I3EA 2CRYA 4JFOB 3VXTA 3MACH 3HE6A 4CVXA 1MHPH 4BA8A 4MMXC 4HMEA 5GGSA 2VR4A 4LEOA 3AM8A 5C0BE 2BDNH 2C1PB 4JHBA 4LSSL 1F13A 1LEGB 1H15B 5JNYA 4G8EA 4X9HA 4S1QH 3WNOA 4H1LH 1FDLH 5B21A 3RDTD 1CFBA 3ARVA 1AC0A 3MLZL 1Q1JL 2I27N 2IBZX 3TT1L 1NGXA 5DD0H 1HQRA 4IRSD 4PV8A 3WO4C 5DQJB 1LO4H 2CIKB 1UWXK 2CXGA 4XCNA 1P4LA 1I8MA 5DJ6A 1FPTH 1UQSB 4H0IA 4P3DA 3R06A 3HR5B 3B8YA 4J2XA 1DJSA 1R6VA 1TNMA 5HD8D 4NM4H 4DKFH 4XBEH 5FB8B 5LCVH 2X4TB 4F7MB 1ODAA 3BN9D 5F72S 3UTQA 4YHLH 5IW6B 3I02A 5HPMB 2IAMB 1DUYA 4YGVB 4P2RB 4IIQB 2HTKD 2AKRA 3FN0H 4WEUD 2E6JA 2DYPA 4S2SB 3T0EA 1XGPA 4NWUH 3QNYB 1NBQA 3RX8A 4HLZG 1AR1C 1XF4A 2X09A 3VFMA 4ERSH 4NJAH 5D7JA 3O2DL 3SDCD 3E6FA 4HH9B 5T3ZD 3LKPA 3VW3H 1Q0XL 35C8H 4Z7UF 5E00B 4C56E 2DQEL 2YPLB 1CGWA 4X9IA 2P8LA 2I07A 5KVMC 4A6YH 3OPZL 3S4SA 1T66C 1U41A 4WUUD 4ZTOH 5GISL 4MQTB 5AUMB 1I7TA 5SX5H 4L4TB 2R2HA 5GS1B 2I5YL 3HPLA 2NY2C 5I8EB 3ULVF 5I1CH 2DBLL 5IBTL 3CH8A 1I4FB 4JM2B 3VWKB 3FQNA 5IJVB 1C5DA 3HN3A 4LCWA 3JTTA 5KSVA 3EDDA 5FECA 1GGIH 4HKXA 3NCMA 3BN3B 3QIUC 4MQSB 1MLBA 1UH4A 1Q9KA 4X9BA 4O4YL 1G6VK 3LIZL 4OZ4B 5GS0D 2PW1B 3GB7A 1KTLA 1Z9SA 1ONQB 4G9DB 1KCRL 2WWKT 4WWKB 3IDNA 4W4OC 2BY0A 2X4OA 5MHSD 4KGLA 3IRZA 1ZTXH 4AENB 4X83A 1N64H 5KSUB 1D9KC 1MRCL 1CXLA 4XPGL 5DK3A 5E2UH 4WHDA 1TENA 4R7DB 4X4ME 5GGTA 4PJDA 3SOBH 1I3GH 3AGVA 3MBXH 1R24A 4MXWH 2DIAA 4GRWE 5C6TL 4PJEF 4Z7WE 5I30H 4F3FB 2NW3A 3UBXA 2R39A 3IXTA 2J6EL 4UIMA 4OM1H 4EDWL 4ALAH 1S9YA 3GMRA 4EXPX 5I1DB 5E8PB 3HR5A 2E9BA 3TVMD 8FABA 2HT4C 3V52H 2CR6A 3MRIA 5FM5O 1P5VA 2J5LB 4OQ1A 3ZDXF 1JK8A 4UUJA 4FS0A 1S7RA 4H88L 1EFQA 4KK8D 4YFLF 4P2RA 4NKMA 3AMKA 3IDGA 5ADPH 2W65A 3ZE1F 4ZYKA 5F6HI 3RGHA 1EBPA 1DQDH 4I3RL 2OXHA 5DA0B 2DS4A 1XF4B 3TBTB 2ZJSL 4QXGH 1WIPA 4XWGL 1WFUA 5DGQA 2ZWLT 4QXUL 3REWB 1FYTA 1FFPA 2UZIH 2YD2A 4WHTB 1HZHL 4S1DD 1AXTL 5ACZB 5EUKB 1RSFA 1T7XA 4OZIF 2DQIH 3ROLA 3T1FB 4LCCC 5IBTH 4FQPA 4X9GA 3QHFH 2APBA 1C1EH 2R56L 4NIKB 2CH8A 4IRZH 4HAGA 1P4IH 2AJSL 5FEBA 3L5WB 4UT9H 3MROA 4WFHE 5F70A 2BCKB 4MJID 1FN4B 2X4PA 4UTAL 3JXAA 5FAAA 4WV1A 1KLFA 3O8XA 4HWEL 3LIZH 1BWMA 2QTEA 4FP8L 1B2WL 4WI7A 4LIQL 1OWRM 5L2KE 3S34H 4I3SL 5DA4A 3FO2A 1CIUA 3PGCA 3ZTNH 4ZG1A 3G9AB 4HX1A 4RISH 4QRRA 5AAMA 3U9UB 3IDIB 4NFBA 3QPQC 5ICYB 4Z7VA 3MV01 1EEQA 4WWKC 1X5HA 1MRCH 4P2RE 4MS8C 4KMQA 2IQAA 4P9HH 4PJ8D 2X1PA 1QLRB 4OZIB 4P5MA 3UZQA 3GMMB 5DD3L 1T1ZA 2ARJA 2YXFA 1DFBL 2QADD 3MR9A 3NFPB 4KFZC 4OZHA 4FQXA 3VI3E 5J3HC 1NC2D 3QG7L 3NCYS 2CGRL 2A73A 4XPAH 1UH2A 4PJ8A 4PJBA 3NAAL 5FDWB 4DWHA 3GMPB 2VSCA 1A1OB 4X7TA 1QSEB 2BNUA 3VXMB 2DLEA 3BO8B 1R3IL 1FCGA 1X5JA 6FABH 1DBAL 1B3JA 2Z9TA 2GUOA 4CAGA 1J5OH 2NX5A 5GS1C 5MEPB 4NQEA 3VD5A 4KQ3L 3TYGL 3STLB 2N1KA 2AJVL 4AIOA 2IG2L 1IM3B 2DQJL 5F7WC 1ONQA 1RJLB 2VKXA 1CD8A 2X4UB 4F9LA 4UZGA 1NEUA 4RMQA 4UUJB 4IS6B 5I16B 4DKEL 4QRTB 3AREA 1LK3L 3TYFB 3QXWA 4MNHA 4MA3A 5E6YA 3QWOA 4OLYL 5EOQL 4LDOB 4PJEB 3PXJA 5D72H 1IGYB 4Q6IB 5E8OA 1E4JA 2HG5B 5J6HB 3NN8A 3G04B 4LBEA 1JF6A 2NW3B 1QYGL 1GOFA 4P0DA 5C1MB 1P4IL 1GZQA 3HRPA 3PL6A 3SPVB 1FYTD 1RIUL 4PB0H 2GJJA 3OXRA 5EZJA 4NC1E 1K4DB 4PRIB 1S9VA 4OZFG 5CJQL 5J1AA 5EBWA 5FKAB 1FFQA 1RD6A 3WFCL 2YWYA 3WNNA 4MB4A 4RISL 1EEZA 5IIEA 2Y5TB 5C8JA 2PR4L 4WVRA 3TP4A 5DURD 2FWOA 4S1RL 2CKBA 2EO9A 3EJYD 3K46A 4QTHB 1UZ8B 1YPZB 1T7ZA 1OAYH 4XZUA 3PGFH 1IKFL 3IDMB 4FOMA 1EEUA 4FNLL 2GJZB 3BGFB 4R4FL 5DTFB 5EC2A 4I2XE 4QHKI 3RDTA 1HOCA 4ALAL 5SWQA 2ARJQ 1TPXB 4XC1H 2RQ8A 4LNRA 1W8OA 3QDME 5K9JH 4CW1A 2VDKL 3QAZC 4XVJH 3AS2A 3TNNA 3L3OA 5L2KB 4F7TB 2NY7H 5KVGH 4L4VD 4TOYL 4HS8H 3PJSB 3IDYB 3HE6D 4DK3A 4P5MB 4LSVL 4M7KL 3CXHK 5ADPL 5H94A 4YHPB 1XF1A 2CUIA 4Q9QL 3DV4A 3G9VA 4NQDE 2Q86A 5KOMC 1JGVH 1AE6H 2ARWA 4NN6B 3B9VA 5GS0C 1RQ5A 1G6RH 1VFAA 4NPYB 4LCUB 4NQSA 2I24N 5EN2B 5E4IA 3GKWH 2OQJB 1UJ3C 2XG4A 3ARYA 3D3VB 2PTTB 5F7MC 2GCYA 1Q1JH 1I9RH 5EZOL 1J8KA 2X41A 2RCSL 1MFAL 5EPMB 3WEXA 3U9PL 4XTRC 4HIEA 4X6BB 3WNPA 5EFIB 1OP5K 2GTZB 1RZGA 4KK5C 3B2UC 1M7XA 1K3ZA 4QHUA 4R3SB 2XZQH 1E27B 2OTWB 1N26A 1PKQE 2YN3A 5DD6A 1OP3H 4K71B 4HIHA 3PGDA 1SVCP 4WNQA 1KIUA 5C08E 3CU7A 1PY9A 1LO5B 1MWAH 3Q0HA 5F7LB 1MVFA 1IAII 2FYYA 3D48R 5HHPB 5ITBH 2A73B 5IOPB 5MEQA 2HG5A 2HT4D 4HUKB 2AK4E 4GBXB 4BELD 2VDOL 4JFDD 3B9KD 3MA9L 2HJFB 1MY7A 5CJQH 3ULVL 1F3RB 3O2DH 1ZHBA 2XG5A 4Z7OF 4JHZA 3MGTA 1C5BL 3UMTA 1SBBA 4U1KB 3VRJB 2FO4B 4HDIB 4KK8C 3QEQA 4XP4H 3WFCH 2NY1C 1A3LH 1DBBL 4LQFL 5DEZA 3X14B 1Q9WB 1MQ8A 2COQA 4JRYB 1FSKC 4DFIA 2FECI 5I16A 1T1XB 5JZ7C 4LDLB 1AO7A 4JZNA 3KPOB 5HDBF 4C4KT 4OFYA 1R5VB 3EIFA 4KY1L 5ALBL 3K7UA 5F9WB 4U3HA 4OGYL 5C6WH 5D7JB 1FNEA 4Y8DC 1KIPB 2R9HC 4NQCB 5M7QA 4KQ3H 3ESUF 1IKNA 3WS6A 2JE8A 4LKXB 3LQZA 4ZQKA 1RK0B 1OM3L 3RNKB 5HYJE 1A6VL 4KK9D 1JGVL 3LKRA 4H1LG 5SWZB 4JANB 2WSKA 1I7TB 4QCIA 5D2NC 4KDTA 4JDZB 1FO0L 3D1MC 5EIVA 4MDIA 1OCWH 3U4BL 4C54A 4P9ML 4H25A 4HT1L 1EEZB 2DLFH 3MJ8B 3EYFA 3QIBA 5F93C 2BC4A 3F12B 3QEQD 1BFOB 4GAYB 3TA3D 4P57A 4PJGF 1A6UL 1IC7L 4LSQL 3QUXC 3MBXL 1BWWA 1CR9H 2R29L 5E4EB 5J7CC 1AQKH 4X4XA 3GNML 5IWLC 1FL6B 1YEEL 3DGCR 4M9OA 3OZ9H 2YPVH 3GEWB 3M1BB 3ET9F 1IEBB 3HE7C 1X9QA 1CLOL 4TSAL 3VXPA 5DHYB 1PFCA 2G9HA 4K7FB 4WO4D 1T2QL 5BOPA 4PJAF 3ARDD 4P2QD 3THML 1KFAL 4ODTH 5KSUA 5IMLA 5IG7B 4LPTA 1GZPB 2KUTA 4G3YL 4PJ5A 1ED3A 3L5IA 4WFED 3BEWB 4R7DA 3KYKH 1HIMH 4Y4HA 3AXLA 5T33H 5IHBA 3RHWF 1OARH 4DVRH 2W0FA 1FO0B 5JORA 2GSIB 1J88A 2AQ1A 3D3VA 3UTPD 5D2NA 3H9SB 4M7LT 4XC1L 3UYPA 1NC2A 3BZFB 1CGYA 2HRPL 1OGAA 4PGCB 1HZHH 3KNBA 3ZO0A 4Z7WB 5DRWA 2HWZL 3D85A 2ZOKB 2FATL 4FFYH 1Y6KR 1WAAE 5SV3A 3RUGE 4P59H 1U2HA 1IKNC 2BJMH 3SKJH 2X9YA 1UM6H 3R4DA 1QD0A 2F5AL 3ZHKA 2DLTA 4PJ9D 3QUKB 5J11C 4CN1A 1QG3A 1Y18A 4PS4L 4UDTA 3OR7A 4BUGA 2CIIB 3GGWB 4GQPH 1CTOA 4MMZC 4YO0A 1CL7L 4AEHL 1L6XA 2RAMA 3HUJE 5D93B 3BGMA 3REWA 3GJFK 4PY7A 4P2YA 2D0HA 3O9WC 3QG6B 1BZ7B 1F4YH 2LU7A 5CGYD 5C0DA 3R1GH 4EN3C 1JRHI 2BVPA 3CIQA 3WFZA 3VE0B 3LDBB 2F54E 1YN6A 2NY1B 4ONHA 1QA9B 2NY1D 3LRGA 4M61A 1D5MA 3SCMB 4JDZA 5I6XC 2AV1B 4K2UH 5MHSE 5E9DD 1I8KB 4NWTL 5IROA 4HG4K 1RK1B 5DI8A 1W8NA 1GHFH 2YEZA 2R29H 1U8IB 4NUJB 3WKMH 1FH5H 1QHOA 5JO5B 3I6GB 1SY6A 4LKCB 4JO1L 4GMSL 4NQVB 2XWBB 2X4NA 3QI9A 3DX9A 4X80L 1KIPA 4JO2L 3FO1A 1M7IB 4JFDB 4NQCA 3HMXL 3T77A 2JB6B 3ZDZF 3QO0A 2GAZA 1ZT4B 4EBQL 3RY6C 3UTSD 5DGRA 4J4PD 4Z7VB 4KKNA 2VLJB 3HKFA 2ATKB 3ARBA 5H35A 3LQMA 2E7BA 4LPUA 4NCC1 5FYKD 3X3GL 4B0MM 3IVKB 3M8OL 3TVMA 4DVRL 5HYIA 2ZUXA 4XNMA 4HJJH 2FJFB 3HA0A 4YHZL 3B9KC 2HRPH 1RFDH 1MVUB 5E00A 1BF8A 5C0ND 3D2UD 5ACLA 3QDHA 3VXMA 4BK5A 2VLLB 3P73B 2GSIA 2WBJD 4UT7L 4KDWA 5HJ3B 5T5NF 1WBZB 3F7PC 5HDOA 2ZSWB 3ELAT 1FRGH 1IILE 1RUKL 2QHLA 4PJCA 3ARDB 1MOEA 3DO3A 3VFPB 1RIUH 4PB0L 2YUWA 4AM0A 1B9ZA 5IBUB 1T5XA 4AEFA 3F7YB 2GHWB 5FGCB 5EZIH 3RZWA 3P0VH 4YH6A 3PP4H 2JKXA 5DD0L 3FO9A 5DQDL 3MCLL 4PJEA 2DLIA 4Y19B 5JMRA 2F53A 5JHLH 3BZ4A 2FHFA 3FCTB 3MRLB 3TFKC 2VE6A 5F8QC 3G6AB 3CFJB 1HNFA 4UI2A 3GKZA 4XPFL 4IMLA 2WINA 2K1MA 3O3DB 5KSAA 4ZSOE 4D8PB 1BQUA 4LHQB 1IL1A 4NM4L 3D6GA 4WWID 5MERA 3RUGA 4PJBE 2HTKC 2NX5E 1BF2A 1OGAB 2LU3A 4Z7WA 5E7FA 3D0VB 1MWAA 4EI6B 5IT2L 1CLOH 2MKLC 5C07D 1CXEA 3LKNA 5KSBB 1V3MA 3K1KC 2O26U 4N0UB 4YAQA 2Y4SA 1D5MB 3SCMA 1CQKA 4IRJC 5BS0A 5FB8A 3G5XA 1U95B 2X1OA 2IAMA 7FABH 3UTSA 4O58H 4OD1H 4NRYA 2AJZB 3BOVA 1OGAE 1DL7L 2DYPB 1T22B 2W9EH 1A7QL 2I60L 4FQHA 5TE4L 3UTTE 5GGQL 5D7JD 1CGVA 1KT2A 3LKSA 1RY7B 4G5ZH 2PXYB 2IPKA 4IRSB 4Y5XC 1B4JL 1TETL 4M3JA 1EA9C 4ELKB 1PX3A 2GJZA 5EC2B 5C7XL 3A67L 4K9EL 3RFZC 3BP7A 3MLPA 4P2CG 5CSZA 1ZGLP 5JR1H 4HUVA 1QLEL 2D03L 2PF6A 4P99A 4F7PA 5FGBA 5IP4A 2DQCH 2I07B 4WU7A 1KENH 3SGKC 1KN2L 1YEJL 4JPKH 4JPIA 1QA9A 4KHXH 4KWUA 1MHPL 5AG8A 2D7TH 1AFVL 1SEQH 1M6OB 5CEYA 3DVNB 4GXVL 5FGSA 5DUBB 5A2FA 4M1DL 4RFNB 3F5WB 5KN5B 3N85L 5IW1A 2Q86B 3SKOA 3QFDA 3EFFB 5JIHA 3V5DB 2VXQH 3GSXA 1MCDA 3KPLB 1WLHA 2AW2A 1MRDL 3BW9A 1KJMA 1G7HB 1YC7A 5C0JA 4N0YH 1PQZA 1UH3A 5DWUH 3MXWL 1A7PH 2EH7L 1QFHA 4LHUD 4JZOA 1AGCA 1NKOA 1UXSB 2G5BA 3HG1B 1HCFX 2A6DA 3KWWA 5GGSY 1BVLB 2VITB 2FR4A 2V6HA 2BMKA 2HRLA 2O5XL 2KH2B 1ZT4A 4ZOAA 1ZE3C 4AIZB 2E8ZA 4OIIL 1FYTE 2DM3A 4X98A 5FM5M 3STZB 4MAYC 5IFAL 4AM0B 4ZUSA 5DFVD 3GM0A 4UQ3A 2APTA 5I9QB 4RBPH 3KYNB 1SM3H 4NC0B 1GGYA 2QHRL 1Q9LB 2HLAB 3UTTD 2LE9A 1BIHA 3W2DL 4MQXD 4HXAL 4RAUA 5H2BB 5GGVY 4AL8L 3MRQA 4PTUB 4JM4L 4LLWB 4A6YA 4LF3A 1XGQA 4JO1H 1MVUA 1E0OB 2DIBA 5EG6C 2VABA 5IT2H 4X80H 2D2OA 1SYVA 5B38B 1W72L 4U0QB 2HMID 4Y4HD 3QEHA 1J0YA 2P47B 3MGTB 3QUZD 3DPBA 3CK0L 3MRMB 3LB6D 1WFTA 4KKLD 3DETC 5DMJB 5EC1A 4XPTL 5C0AA 5I1KH 4KUCD 4OD1L 2ED8A 3NTCL 4KRMB 1BEYL 4JFZL 4N1HB 3ZYIA 2Y9RT 4G43A 4OTXH 3NFNB 3WFHB 2JELH 2VISA 2D7MA 3MYJB 5GRWA 3VXNB 4WFGD 1DQDL 1NMCB 1YJDH 4K3DL 4IMKC 5INCA 1AGDB 5FOJA 3MV7D 4X7TB 1AH1A 4RNRA 3MFFA 4YIQA 1MH5B 2AK4A 3QXTA 4NBXB 2UY6A 4PUBL 2W9DL 1OPGL 4OUUB 3MRHA 2DMCA 4YXKH 1BM3L 1CZ8H 2W59A 5JQHC 3CDGA 2W60B 1NMBH 1NC4B 4ZFOB 3WNLA 1WISA 3HI6L 1H5BC 1YMMA 3EYVA 3OJDA 4G8IA 4LVNC 1CU4L 4WI8A 4YHMH 1FNEB 5FGRA 1JVKA 3ISWA 4IMLB 1RJLA 2RFXB 1UACL 3WO3B 3T2OA 3BYTA 3QIBD 3U6RA 3OR6A 4IS6A 5EUKA 4GXVH 4FQQB 1X5LA 2Y07H 2NYYD 4PJIF 5JTWA 2BSSB 2QR0A 4Y16C 3MFGB 5JQ6H 1EZVX 1KTKE 5F9OH 1J05A 4RAVB 3UTOA 3NCFB 3VXRA 4YDKH 5BRZA 2ED7A 1CDGA 5EWIH 3CNKA 4X0KA 4I9WE 2YRPA 3P4NA 4JPVH 4PJAB 3V0VA 4LIQH 2R0ZH 1NEZG 1PG7L 4NN5B 4LBEB 2VXUL 2BCKA 1FN4A 4PG9B 2P8MB 2HFEB 4HGWB 5DJ6B 5IKCB 1ZLVH 4BZ2H 4EVNB 4M5ZH 4HSQA 3V7AE 5FYJU 5L0QB 1T4KB 3WLBB 3ZKMD 1WBYB 3X13A 3NCYP 4HMCA 2HKFL 2DTMH 2WZPD 4NQDA 3MRPA 4X6CE 5F89B 4GSDL 5IROC 3T08A 3RA7L 2VXTL 4RCAA 3QUMH 3WFBH 1N7MH 3P77B 3FZUC 3OKOB 1FFOB 4Y4FC 2IQAB 4LRIC 4S2SA 4P2QE 3T0EB 3UPRB 4E5XA 3H0TA 2BNQB 2OL3A 3NBNA 5C0EA 4EIZC 2CKBB 4LLMA 3X11A 4P23D 2VLME 2YK1L 1LD9B 2DI9A 5CIPB 4LLWA 5DLMH 3FHQA 4CVWA 2NY4C 3NA9H 3TYGH 2DD8L 2DM4A 3B9KA 3V9FA 2VWEE 2V2WA 5GSVB 1T20A 3KYOA 3CSBA 1VDGA 4EQ3A 5A1AA 3PWVA 2IH1A 2FH6A 3PWJB 1CGSH 2SEBA 3DXAB 4FA8A 2VITA 4JFFA 4LP5A 3FFCE 2J8UE 4AIXA 2FR4B 1OQXA 4PUBH 1AI1L 4IDJH 2CKBH 2A6IA 2P8PA 4IJ3C 2NTSP 3WHXB 4ZUSB 4JM2A 4TUKH 1WEJH 2BNRB 4Z7NE 3SDAD 1RUQH 2VQTA 3OL2A 3T09A 2NZIA 3PP3H 4LCUA 4MNHB 4NQSB 5C2BL 2JB5L 3MV9E 1YEHH 3RWIB 3T2PA 5EB9A 4FMFA 5K9OA 3BQUA 3GZKA 3MRQB 1JI1A 3LHPH 3SDYH 3ZT7A 2FHBA 3WEXB 4MQXC 4OZFB 5GJSL 3RX7A 5TFSH 1FP5A 2BSRB 2RFXA 1ITCA 4M48L 5EWIL 4QXTA 2BHYA 5B4MD 5KSBF 4X8JA 3PQYB 4RX4A 2HT3C 2B5IC 2XNAA 3FFCD 3B9DA 3W0WA 2VR9A 5B39A 4Y2DC 4OIIH 5J1SC 1A02N 2Y06H 3OBAA 3EOBB 3OTTA 2MCG1 3TBSB 5CCKH 3GSWA 5C0GB 5F7EL 4XP5L 5C0AE 3D39D 2PETA 1RZFL 4NRZB 4Y4FA 5DFWH 2ZUQC 3OPZH 2V7HA 5J1AB 4DGVH 5GISH 1UCTA 5CKAA 2GITB 5F88A 1U93B 4RNRB 3MXVL 5JDJA 3LSOA 3NPSB 2ESVD 3CVIH 4F3FA 4PJ7B 2HKFH 4XB7A 5JO5A 1A0QL 4M62L 4DGIL 1LP9E 4MA7L 4F58L 3N0PB 3P9LA 3DX9B 4I18C 1KLGB 3VFTA 1QBML 4JPWL 5C09D 3SCMD 1KJ2L 4L8SC 4U1GC 1T7YA 3EJYC 2BSSA 3UYOD 4U6VL 4Q74A 3P77A 5EBMB 1QOKA 3H0TB 4Q2ZA 3NABH 1DVFA 3FAXA 4KXZH 3WLWC 4XNMB 4YHPA 5BQ7A 5DJZB 3RZCB 2RCSH 4XTRD 1LE5A 1S9XA 2NLJB 3F65A 3DETD 1MCWW 4PJ9B 4EUPH 1QEWA 5GRVL 1MJ7L 1UFUA 4UIKH 4EVNA 3RTQC 1MCLA 1A6AB 1BOGB 2E7MA 2LQRA 2YD4A 1JNJA 3IKCB 2MPAL 3CVHB 4Z77B 4POUB 4KVNL 5FO8A 3IFOA 3HC4L 3QIWA 5FO7B 2CDFA 4FZEL 2X7LB 4GS7C 1TCMA 4MD5A 1ZT7B 3DX8A 3FB5A 3V52L 1CFQB 3BKJH 1TJIL 2BC4B 1LO3H 1BVZA 3SDXA 4QHNB 3QDAA 4XAKD 1R0AH 1IARB 1O0VA 4NQED 1HH9A 1KACB 2A1WH 3ALWA 5E8EB 3QJHB 3QUMA 4S1RH 3PNWB 4OIAA 1XEDA 4H8WC 5F1IA 1BX2B 3GRWL 1CF8L 2D0FA 5CP7B 2F54D 2ZZUT 3L95B 5FHAL 1MCPL 2B1HH 1FE8L 3PWVB 4K7FA 1G7LA 3WMSA 3O3BB 5LGHH 1BFVH 2UZIL 3QT2A 1XR8A 4POZD 3EOBA 3UTSE 4CADB 1R3JA 3SHSA 1KPUB 2CLRA 3BHBA 5FOBB 4D0BA 4WUUB 5GQBA 4DGIH 2FDBP 4FQIL 3JWOL 5IHUL 4WIQA 1I7UA 2AABH 3O9WB 3PF2A 3WS3B 1P7QA 4MDJB 3C2AH 5F7NC 1K8DA 5IJKC 5C3TA 4Q9RH 4KH2A 2ZPKH 3LSOB 1JPFB 5MENE 2XY1A 1DQMH 3FB8A 1U3HD 4ONGL 2VB5A 4HWEH 3TBYA 1KTDA 2XFXB 3W0WE 2HFFB 4I0PA 3L1OH 5E9DA 3FB6B 4RWYH 5E2JA 3U0TB 3V8OA 4KMTL 5DO2D 4CJ0A 5T3XL 1DN0B 3BH8A 4GKNA 2UWEF 4NUGH 5GPRA 3IAGC 2DKSA 2CDGA 4BH8A 5EULV 4NNXB 5I18L 1CN4A 4PRHD 4EUPG 4JCLA 2OCFD 5JOEA 5HDQL 4HBQA 5CIPH 3TA3C 3MV9A 4ZOBA 5T3ZL 3ZE0F 3REVB 1PEWA 5DRXB 1KCUH 3AAZA 3L3DB 3ULUD 3LOWA 1YEHL 1QLFB 1HK6A 2VQ1B 3VFRB 3JVGC 4XPHH 1JYVA 4IOFC 4MCZA 5I74C 1AHWB 2BFVL 1YEEH 3PWPA 3QG6A 5KS9F 1S7XB 5DQJA 4ZAKA 5GHWL 2DN7A 3FRUA 3KHOA 3L6FA 4HJGB 4PJ9A 4P3DB 3IDXL 4IDLA 5E99H 2DM2A 3AM8C 4MYWB 4OCLC 3SDXF 3V6ZA 1PYWA 1C08B 4HIJB 1NLBL 2EDTA 2YBRA 4D0DA 1PZ5B 4TNVK 2BXZA 3LRSB 4ONFL 5D1QA 4C56A 4HUNB 5I1IH 1BEYH 3B5GA 3QIUD 4JFZH 2WQRA 1BQHA 3QUXD 4U0RB 1L0YA 4NKDB 4QNPE 1I9IL 3S35X 4ZDHB 4J12A 1OT2A 1UENA 2VDPH 3BPOB 1A4KA 1NL0L 3SJVE 3TZVD 1JZ6A 1EUTA 3TT3H 3MRFB 3CMGA 2A9ML 3VFMB 3RVUD 3QULA 4J3WA 2GFBB 1A9BB 5LGHL 4YDIH 4MJ5A 3NIGF 1WITA 3BAEH 5ISZD 3K81A 1DUZA 4XNXL 3UZEA 2UVFA 1S7SA 1WGOA 4FQIH 2H9GA 4JEGB 4ODHL 4P2QA 2EO1A 2BJML 5CMAA 2DRUA 4HEPG 1A1NA 5BV7L 4GAFB 5E08H 3AU1A 5DJXA 2FL5A 1OQOA 3LZFL 1N59B 5C92A 3V5KB 4J1UA 3V6OA 2MHAB 4YDKL 3G6JF 1UEYA 2OL3L 3STBA 3LPGA 2ZUUA 4KK6D 4O2CA 5EU5A 3OG6B 2VQUA 4MXQD 1VPOL 1ZGLM 5A3IC 3FB8B 1NDMB 2A9NH 1HH9B 2VXUH 15C8L 2ZSWA 4WTXA 1BJ1H 4Y2DD 5DK2A 4F8QA 1Z2KA 1G7JB 5LG1A 3TBYB 4DN3H 3HB3C 4QKXB 4I0PB 4M6OH 5J13B 3BGMB 3U82B 5BRZE 1LVEA 3BXNB 1CFSA 1URLA 4PPTA 3GJEB 4XI5D 5DMKB 4NWTH 4GKZA 4YHLL 3IRPX 2WWMC 2YPVL 4WJ5A 3U0WH 2XZCH 2N7AA 4WNQB 2NNAB 2JCCE 1WZMA 2B2XH 5HY9A 3VXUE 4WUUA 2ITCA 4XBGA 5CZXD 1I7RB 3REVA 3D3VE 4YXLH 4F9PC 5L8JB 5KVGL 3FQTB 3DMMB 4GMSH 1J0ZA 3EDFA 2VQ1A 1EUUA 5DI8B 1QR1A 5C9KA 2YRLA 1A4JA 3CFCL 4NUJA 4CDHA 3C6SB 1A9EB 4FFVD 4MNQD 3RTQD 3MGOA 4ZFZB 4JKPL 4LVOB 4P49A 3IFLH 4EIGB 2VZVA 1IGIL 4LRNL 2DQGL 4FQJL 1FNFA 4OSUH 4XCFH 3O4LA 5HYQB 2XN9B 2VOTA 3S36H 1OY3B 4WHYG 3MRJA 2X70A 3O4LD 4J3OC 4MXVF 3CDYA 5FUCC 2QBWA 2ED9A 1Z9LA 2OMBA 1CICC 1N0LA 1UWXH 5EORH 5H35B 2DTSA 3OKOA 4Z7QE 4HK0A 4WCYH 5DHXB 3UO1H 4ZOCA 1AGFA 4RX4D 2V2XB 4KAQL 4M7ZC 4RGNC 1N8ZA 1VESA 2F5AH 2DWDA 3QPQD 3FQXA 4X7CC 1QBAA 5CEZH 5IMMB 1I9JL 3QULB 1AD9A 4HFWB 2IPTH 1YY9D 5F8RC 3MLUH 1F3DJ 4LVEA 5MP6L 3ZL4H 1LNUB 3LN9A 3DECA 3O6FB 4FQ1H 4ODVL 5GJSH 1H3XA 2VDOH 4LSRH 3OKMA 3WUWB 4K3GA 1NDGB 1FQ9C 3O0RH 1BJMA 4JRXE 4V2CB 1YEGL 3RY6A 4XMLL 3DROA 3D18A 4UINH 2X4PB 2Z91B 1KB5B 4G80B 3T8XB 4YUEL 3KPLA 4I9WD 4YWGL 3SKNB 5L6YH 3B2VH 4K8RD 2D9CA 3NIDF 5TE6H 2Z8SA 4WFFE 4U1MA 4O9HL 1FH5L 1A22B 3MXVH 1KN4H 2AJUL 2E5EA 4HKZB 3X17A 2MKWA 3RX5A 2VLRE 3MRKA 4I1NB 1A0QH 1MIEH 3W5MA 1FYHB 1UM5H 1VA9A 1S9WA 2X2YA 1IGTB 2EYSB 1U8NA 1ZWIA 5HYSA 3IGAA 4U1HB 3MO1A 4G6AC 3FQWA 5DMKA 2ZUTA 4JFHE 3CZFA 1OHQA 5EOTA 4X9FA 2F58L 2OR9L 5B39B 1JHLH 3WCYA 3P4OA 3DUSB 2APXA 2M1KA 5K33A 3GSWB 1UWGL 2ARJB 1QSFB 4R4ND 4QT5A 5HGDA 4Q9BA 3X3GH 4HUMB 4PJ7E 5TDNB 1S7QA 4PJIA 1IGIH 4LRNH 3OKDA 4P4KB 3TT3L 1ND0A 1J1XH 3QH3A 4KU1A 3ES6A 3C6SA 5JW3L 1A3RH 1NDMA 3H9SA 1P1ZB 2X89A 3VU2A 1TLKA 3GSUB 1RIHL 4RGMB 5E2TL 4CU7A 2XXMB 5IESH 2VH5H 1WCBA 4EDXB 3GMLB 3VFTB 2KL6A 1HHKA 3IU4H 4PRAB 1F5WA 4CN4A 5D96C 3VXNA 3BMVA 2AS5M 2HVJB 1U8PB 3DYMA 4YR6A 3MMEA 2D4FA 5INCB 4GG6E 1IGFL 4WHYH 5SWSB 2RHEA 3I6KB 4M7ZB 4ZAKD 5IVXA 4GRMA 4RSVA 3CFKA 3ALXA 1B4RA 5I1LB 5A16B 4GMTL 1RZIB 5HY9B 4KZDH 1DVFB 2FGWL 2CIIA 3GGWA 2A6JA 2ZG2A 4YO0B 3P0VL 1MELA 4ENEC 5J6HA 1P9MA 2OTUB 2CUHA 5GS2H 1D5IL 1HINL 4B7IA 1JZ7A 4FQQA 4HIIA 4XCNB 4HWZA 3UTPE 5DJDA 2EDRA 3EJJX 4NHUB 3FONB 3BPOC 3NVQA 4TUOB 5C07A 4BFEA 3O4LB 2BVPB 1J05B 3V6OE 5EU7C 3ARED 5I71B 5C09B 3DRQA 3OV6A 3H3PL 3SO5A 1L0QA 5FHAH 1FORH 1RHHA 2OP4L 1XH3A 4X4YA 3HE7A 1OSPH 1RZKH 4AIZA 2R8SH 3BWUC 2Q8BH 4OGAC 1BFVL 5IVNA 2PN5A 3I02B 1X7QA 4KK6C 1FFNB 2F5BL 3STZA 4XRCA 3KPRB 2L4OA 1ZHLB 3PV6A 4QTIL 1ZLUK 2HMIC 2R2EB 2EYRA 1R3KB 4MA8H 2ZUWA 2XACC 4Y2DA 5DFTA 2I9TA 3FQXB 4WW2B 1G84A 4PRNB 4YHYC 4GBXD 5D7IE 5JHDD 2FX8L 3UTZA 4TULH 3MZTA 1KJ3L 2EDEA 4K94C 2Q6WB 1EO8L 1JFQL 2NY3D 5EUOA 4XGZB 1KXTB 4ZUVB 2BHUA 3SN6N 1JZ3A 3CFBB 1OW0C 1KUMA 4X5WA 1LEIA 2IG2H 3PHOA 5DQ9B 4BZYA 5CP7A 1IGTA 2ATPB 3NH7L 3VMOA 1P4BL 5DUPL 4F15C 4U1HA 2A74B 4K23H 4PJFA 4KROD 5ESQB 4WU5A 1EEYA 3ULSB 4ZPTA 4PLKD 4FTVB 3T65A 5EORL 3DYPA 3BH9A 4XPBL 1FLRL 4D9LH 3IFNH 2DQFB 5HGBA 1FG2A 1RU9H 4RMVA 4JY6A 4JG1L 3ZHLA 3VWKA 4HPYH 4LHUA 5IGXL 1IAOA 4K2UL 1KCUL 4LCWB 4OQTH 3BPNB 1T89A 3PWPE 4JREC 5FECB 4Y7MA 2H8PA 2WWMD 4P9HC 1MPAL 1BHGA 2H2PD 4MD4B 1EO5A 2JCCB 3KR3H 2VXSH 5F1SA 4J4PA 1UWEH 3UYRL 1UXWB 2VLKA 3ZDYE 1E27A 3QA3B 5EOTB 1DN0A 3B9EA 3BH8B 3I6KA 4KKBD 4ACPA 1NUDA 5I0ZA 4LHUG 3VFWA 3VFUA 4I48A 4G6ML 4U0RC 4JO3H 5IUSA 4H8WH 2C7UB 5BRZB 4Z7WF 4WI3A 1A3QA 5IQ7H 1J10A 4JFOA 3OKDB 1OAYL 4P4KA 3GI8L 5IHLB 1X5YA 2XQBH 2Z31C 3BFOA 4UV7H 4CL7A 4NQEE 1Z0NA 5TQ2L 5BZDB 2MNUA 2DTML 5MERB 4HFUL 4X7SH 1UEMA 2BK8A 3FB7A 3QZWB 2PCPB 4DFHA 4OB5L 3KLAB 3ILQC 4XNXH 4L4TE 2PUQT 2UZYB 1SJVA 4ODHH 1LEKB 1ZSDA 1T03H 4YR6B 1I3UA 1FVEB 3WIHL 4M93B 2E7HA 4LMQI 5CD5C 1FRGL 1RZJC 5F88B 4JQIL 4JLRB 1S7RB 5GGTL 5AD0B 2IH3A 4QOKB 2QEJA 5IVXB 5E08L 3MNVB 2PYEB 1GSMA 1XGUB 1GVIA 2XZAL 4I5BA 2AXHA 3PL6C 1KT2B 3JWDC 3LKSB 3MRNB 1DBJL 1BBDH 3ILPB 1PLGL 5DYOA 4ELMF 2NY2D 1HE7A 3BP6A 1U6AH 1IM9D 3FT4B 1FFPB 1RIHH 5ACZA 1VGKA 2Z92A 1P7QD 5DJ2B 4PGEB 4L5FH 3MLSH 5E6IA 2C4FU 2ICCA 3EGSA 4JHWH 4LLAA 4Q2ZB 3SBWC 4JANA 2AJ3A 1EV2E 3E6FB 4K8RC 2XTJC 1YQVH 4QGYA 4NOFA 1EGJH 3AREC 3DVNA 3B6SA 1ZVSB 1WIUA 4MQ7A 4OM1L 4NM8L 3WV0A 5IB4A 3MROB 1B88A 1V3KA 2QQNL 4KZDL 4ODBD 3RDTC 1U3HB 5FO9A 1G9MC 4OGAD 5TQ0L 4OFKA 4KHTH 1ZK9A 2B2XL 3O2DA 1DANU 5J56B 4I0KA 1A5FH 3DO7A 1LE9A 1CYGA 1OL0A 3HC0A 4LPVA 1HSBA 5D9SA 1D9KD 4OM0L 7FABL 1UXSA 3U1SL 4AMKL 1AP2B 1MUJA 3LN4B 5DZLA 4GRLC 5J12C 1I1RA 2C26A 2KPNA 4GBXC 4HKBB 4IIQC 5F7KC 4X7DC 1CXFA 3V2AR 1TNNA 4Y4KC 1F3JA 1UZ6E 2APWA 2Q7YA 3QCVL 4FTVD 1ZOXA 3KGRA 5I0DA 1RZKL 3T0BA 3SDXB 4R90H 3BIAX 4PLJC 1YUHB 3RI5K 5EIIB 4U6HB 3C09B 1KV3A 5FYKL 1YEIL 1BMGA 3EYUL 4J3VA 1KTLB 3MYZA 3V7AG 2DQFA 2DQUH 4PTTA 5FUOL 4QOKE 2Y36L 3VDBA 3IDNB 4MA7H 1XGQB 3C5SA 4OCMC 5CZVH 1F58H 3FQTA 4PIRF 1RZ8B 4Y5VA 1MCOL 3ULUF 2GSGB 3C08L 1AJ7H 3GSQB 3H7BB 2GUOB 5D6CA 3OB8A 4PJ9C 1TZGH 2YRZA 3O3BA 4YX2H 5MEPA 3BSZH 5L88L 5IB2A 4LL9A 1MRDH 4G43B 4U49A 1IC4H 4PJDE 5DEFA 1B2WH 1KTRL 5FOBA 4OF7A 4U3CA 1I85C 1FC2D 1M1SA 3MXWH 3HZYA 1I3VA 3RU8L 1Q38A 4B50A 4R96B 4LPYA 4P3CH 5DJYA 4JCMA 1A6PA 4YE4H 3L3KA 2B4CC 2AEPH 5B3JE 2ZKHH 4XBPB 4TTDD 3T0DA 4K07A 4G8IB 4YWGH 1MJ7H 4UIKL 4YDVA 1KGCE 5IEKA 1K6QH 1MFDH 4KPHH 4PG2C 3U0TA 1P7KB 1VB9A 3BGFC 1L7TL 3MOAL 4QYOA 3OR6B 4ZYKB 1DFBH 4Y89A 5BZDA 4CNIB 4G6FD 1JWMA 4XPAL 3PL6B 2GJ6E 4GKSA 1FNLA 1V7NH 2VZTA 4V1DB 2QQNH 3CLFL 2P1YA 1DBMH 3GIZL 4JDVB 1TJIH 2VZ3A 5D1QC 5C0CE 4Y5VC 5C0NC 1QRKA 3EBAA 3IFOB 2YUVA 2MSPA 3CK0H 4GUPA 1C16B 3FFCA 2PO6A 3E1F1 3QIWB 5KANG 3VFRA 1XF2B 3EO9H 4DVBA 3WYRA 1A1MA 5T1DL 5LXGL 2VDRH 3I6GA 4I5BB 3QUYA 3QI9B 2R1YA 3IDMA 1Q9OB 1M7IA 2UYLB 4IM8A 3D39B 2GAZB 3GBMH 3NZ8A 2VTFA 3TIDA 2YBRB 2WLZA 4PJ5D 5DHVH 4PGBA 2NXYC 3MRBB 1QFWI 3VD9A 4E0RA 4XCEA 5IM7B 4CW1B 1MREH 1FFOA 3MV8E 1BQHB 2OR7A 3H7LA 4JHAH 1J0IA 3S3PA 4WO4A 3DVIA 1C8PA 4P4RB 4NJ9H 1IFHL 5FGBC 4PRPD 3T0WA 1U3HC 1SY6H 1N6UA 3KPRE 3OHXB 4OFPA 1QSFA 3PG2A 5LVEA 1CVSC 3NABL 3MUJA 1FAIH 2P24B 1UB5A 3SJVA 4UV4H 1I7UB 4OCWL 5FIEA 3ULUH 5CJXC 4M4RA 1A7NL 1EBAA 1QSFD 1HEZA 2R4RL 3INUL 3LV3A 1VFAB 5C0BD 1JYNA 1H5BB 2NPLX 4KJPD 5GJTH 5KJRL 2R69H 4NO5A 4HUUB 1PG7H 4HG4J 1KJVA 3D9AH 3O4LE 3O41B 1BQLH 2SEBB 1XIWB 3DXAA 4YBQD 2XQYK 5IF0B 5C0CA 4JN2A 4LNVA 2F74B 5CINH 1YY8B 5IK3B 3RGVC 4EDXA 5EO0B 1YEKL 4Z8FL 4GRLD 3L5XH 3QCTH 4DUWA 4F2MA 4V1DE 5IVZB 2V2TA 4O51B 5FUZL 1NQBA 5D6DA 4HIHB 2Q8BL 3RWIA 3VFSB 2YS4A 1IQWH 1WZ1L 3AVEA 1PKOA 1IM3A 5T3XD 3BKJL 3DI2B 1QFUH 5DK2B 3HAEB 4HH8A 3FCTA 3C6LA 3WNKA 4OZFA 1GGCL 3VXTB 3G6AA 1QZ1A 3CLFH 2GKIA 2P5WE 2OTUA 3AY4C 2WINB 3HNVH 4ISVA 1KYOJ 5B38G 5HI3C 3LCYA 3CDCA 4HWZB 4HJGA 1ZHKB 4OFYD 1LDSA 3EO9L 3FONA 3VXRD 3QCVH 3ARGB 5EIQA 5GRXG 4RFOH 1JPGB 3TWCL 3NH7H 1I8IA 1REIA 2VDRL 3O4OC 3UEZA 4UU9B 3V6ZB 5KANI 4U2YA 2CIKA 5EZOH 1U95A 5B3NA 5T3XE 4LOUD 3R06B 1QSFE 1TJGH 1EVTC 1A7OL 2XPGA 3DI3B 3IFNL 2C3HA 4LCCB 1RU9L 5FKPB 4Q9RL 1DSFL 2EYRB 2YA2A 4UAOC 2QQQA 1HILB 4BSWB 4XHJC 2YZ8A 3MLTA 2E8YA 3PWUA 3TCXA 4LGSB 3V8CA 4EI5B 1VFBB 4YX2L 4WW1B 1NBZB 4Z7VE 3RWJA 3OB0K 4M5YL 4ORGB 1SMAA 5DQ9A 4E0RB 2F8OA 3QDMA 3GRWA 1TQCC 5F7HA 4WU7B 4QRRE 1DVFC 1FL3B 1KCRH 3LKRB 2R23A 4O2FB 4OCWH 1T1YB 3G5ZA 3VG9C 3P0YH 2VZSA 3QXDB 3NIFE 1QSZA 3LMJH 2BVTA 4MDIB 3IJSA 4M6AA 3WE6A 4DQOL 3BIKB 3MCLH 1BD2E 4HFWA 1AD9B 2HA1A 4PJGE 5HDQH 4XPGH 1F4WH 2BY1A 3LH2L 5B22A 4OCNC 3TNNB 3D25B 1RZFH 4TNVF 4JFEA 1HWGB 1YEKH 4FQLH 4NCDA 2J88H 4OV5B 4HZLB 1AD0B 3B5HA 1KIRB 3SE9L 1T0MA 5B8CA 5KG9A 1KEMH 2C5DC 2KDGA 4Z9KB 4Y1AB 2AQ3A 5C0CB 5ANMA 4PJAE 4X7SL 4P4KC 4EXKA 1RPQA 1U8JA 4ZO9A 3L7EB 1JHTA 2EE9A 3F62A 5EN2A 4X6DF 4CMMA 4G80A 2DMKA 2ADFH 4NSKB 1INEL 2KZWA 3ZYOA 4L3CB 1MRFL 4M1GH 1N5AA 5DT1H 4F7EB 2ZCHL 3IAQA 4H88H 4ONFH 4UB0H 3LQAL 2NNAA 1ADQL 4QGTA 1JV5A 3VMNA 5GGQH 4WTWA 1WFNA 4Q0XH 1IT9H 5DJAA 1ORQB 5C0FB 1C12A 4AG4H 4RFEA 3ZE2E 4KV5E 3S36L 1D5ZB 2Y6SD 1IBGL 4TPRL 3BQUC 3QUXA 3L5JA 4ZFGH 2X9WA 5ADOH 2DLFL 5IFHH 2XKNA 1YY8A 1KPUA 2CLRB 3VWKC 4HLZH 3WFHA 3HE6C 4Z78B 1ZLUH 4D0BB 4ODXB 1HSAB 4LSQH 3MRJB 3QI9D 2NY5L 4WHCA 3HZMA 3P0GB 5I1AB 4X4MA 4NT6B 1GIGL 3GNMH 4BQ9A 3OAZK 4PB9H 1XCQA 2G75A 3HZKB 3GHBH 4U6XB 5E6ZA 2WMPA 5DVLA 43C9A 1GXEA 3TV3H 5C08B 3EOAB 3QEGL 4KHTL 1HILA 3DGGB 2PYED 1XZ0B 5D96B 2F53E 2HKHH 1IAKA 5E56A 2DJ4A 1AO7B 4JZNB 5HSFA 1H3PH 1D5XA 4GXUM 3QUZC 1G0XA 2DQDL 4RIRB 5DMGD 4F57H 5FA3A 3VRIA 1KB9J 4AJ0A 3HMWH 1JZ2A 2AV7B 4Q6YA 4OZHF 5I8KH 3EUUA 2H32H 4ZS6C 1MCNA 4XVUC 3G5ZB 4R7NA 4ZTPL 3RVWC 3UJIL 1HHGB 5J89A 3O3AA 4MZ3A 2K3TA 1G1YA 4L29A 4NKOA 5D7SH 4IRJB 3WE6B 1NLDH 5K9QG 1G6RA 1OAQH 2F9BT 1KEML 2I5YH 5IHZB 1U92B 3AS1A 1YECH 1EHNA 2Z91A 1F8TH 4LSPH 5F1KC 4P59L 4Y4FD 1JNLL 1IEAB 5M95B 2FBJL 2FIRT 4LKCA 5CZVL 1S5HB 4XB8A 3G5VA 3IXAB 3MV7B 4XMKL 3KS0H 3CCHB 2X5PA 3QIBC 3ZSTA 1C5CL 5HVGB 3K3QA 1U8QA 1DQML 1GGIL 4M7JH 4D0DB 4PJFE 2ORBL 1KCVH 5I76B 1ZWIB 4J8RA 4OD3H 1WBXA 3K8MA 3MO1B 1FZMA 4XP9L 4RQQA 3LDBC 5HI4C 4HGMA 2CMRH 4XXCC 3JV5A 1R3HB 2BVEA 1MJUL 5TH2A 4QHLB 2X1QA 3GBLA 3SDAA 3QDGA 4CGTA 3VXMD 2Q6WA 3IETA 4BSVB 4G6AD 5CEZL 3VXPB 1VENA 4G8GE 4XBEL 1WIOA 3S96B 1XGYH 2JJTA 3GMMA 1WBZA 1B6DA 5HTSA 2IPTL 1A7BA 2C1OB 5MEOB 1Z3GH 4ZAKC 1L7TH 1GIGH 2H6PA 5D1ZA 1HXMA 2R4SH 5GHWH 4ETYA 5CS7A 2J4WL 3K4DA 1KNOA 4LCYA 3RP1A 1ZANL 2P5ED 3SKMA 4I77L 4YXHL 2FJGB 3DX6B 5FF6A 3IYLW 4LHUB 5JHDA 2NX5B 4NQEB 4PGCA 4EOWL 1PX4A 2OK0H 5GZOC 1FJ1B 3VFOB 4XHJD 5TGBB 2PNDA 4ZSOB 4WDIB 5FA4B 4Y19A 5LGKA 4CVZA 2CLZA 4PJEE 3WHE0 5I1IL 32C2A 3TZVB 3MUGA 3MRLA 1VEMA 2HN7B 1Z5LB 2EIZA 3BKCL 4N1CA 2GQHA 4L4VB 4Y19E 1OTUD 2R1XA 1CFSB 1RV6X 3C9NA 3HI1B 3WD5L 5FA3B 3VRIB 3GMOA 3I2CH 1UM5L 2L0DA 1HXYB 3ZDXE 4GKSB 2F5BH 1PAMA 4C55A 4TUJA 2QQKH 4G7VL 1T0NA 1EHLL 1WAAA 4YAQB 3S88H 2VRAA 4WFHD 2EDKA 3LKQB 3VXME 4EKXA 3SCMC 1YNKL 1I8MB 4XXCA 4OCSL 4N1EA 1U9KA 4IRZL 1F4HA 1BLNB 1W72B 4OF0A 3MREB 3W11D 3P11L 4X6DA 4N9GB 1K4DA 1S7TB 3M17B 3MRGA 1G7IB 4G8GA 2PCPA 5HYQA 2GYSA 3EYOB 2R4RH 3INUH 2BRRH 5GJTL 5KJRH 4L3AA 4HIXH 1RMFH 3TGXA 4IIQA 5DZNA 5CLWA 1CLYH 4ZUVA 4POYA 1MHCB 2VH5L 3BZEA 2BVQA 4X99A 1LWRA 5D2LE 5D7IA 3BVNB 2R2CA 4QO1A 1KEGH 4OQTA 4YQXH 2EKJA 1JGUH 3E3QE 4FFWD 1F6LL 5C2BH 3ILPA 4UDUA 5TH2B 3MJ9A 2Q3AA 1BPVA 3BP6B 3IETB 3V6FA 1M4KA 4Z0BH 2A2QT 1AR1D 3P9WB 4LLVB 1G7QA 2XT1B 3RVVD 4P5KB 4BFBD 5T1KB 1RUML 5LAXA 2AJ3B 1G7PA 3DV6B 3QUZA 1HHIA 3PABA 6FABL 5IJKA 1U8QB 4X6FB 4JRXB 2EDOA 4JKPH 1ZVSA 3T0VA 1FZOA 4GT7A 1M7DB 2R0KL 2F54B 3NCJL 5KOVC 3RWDB 1WBXB 3T8XA 5FYJD 1YEFL 2DAVA 4O51A 3MGAA 1QSED 4BZ1L 4LASL 1Q9KB 5EPMA 1KXVC 3S37L 2EXWC 1QRNB 2EICA 3SDAB 2VDLL 4Y4KA 3H42L 2NXYB 2V9TA 1DEEA 1QQDA 1XGTA 3IU3A 1N3NB 5JA8B 4HC1A 4L4VA 2O5YH 3WIFA 1U8NB 3L95A 2BVUA 2PTUA 2W0PA 5TF1H 1JFQH 3R8BB 1IC5H 3EHBD 3DRTA 3T0ED 1YUHA 4K71C 4RA0C 1P4BH 2NY3B 3O8XC 5DUPH 3MA7B 4KQ4L 3TJHC 1I3RB 5FV2A 1MCSA 4ODVH 1JI2A 1A7PL 2EH7H 3L7FB 4OV6F 2XN9E 1QSEE 1IL1B 5T5FL 1DBJH 3SKMB 4HQQH 4RRPG 4Y5VB 3OGCB 2FO4A 1JPTL 4YLQT 4KJYA 3H3BC 1W72A 4DQOH 1A6ZA 3OX8A 3MRIB 3UAJC 1Q9WA 2X4QB 3P40A 3IFPB 4MX7B 4PGJA 4ZXBA 5CD5D 3OKLB 1PBYA 2DI8A 3PE9A 4HV8A 3D69A 5HHMD 4C83A 1VACB 2XKUA 5E5UB 1F42A 1T7VA 2XIDA 1EMTH 3NZHH 4PJ8C 5EH1A 3ZZ1A 1XR9B 5F9WC 4FQXC 2R4SL 2G5RA 1MPAH 3PL6D 2VUOA 3C8HA 2YD8A 2R0LH 4PD4K 1T89C 4L4VE 3IDYC 3GIVB 3KR3L 2IALB 5IQ9A 1IRAY 4P46C 2PYFB 1T3FB 1CDCA 5I1LA 1MY5A 4YXHH 1T2QH 1RURH 4KVCL 3PIQB 1R0AL 2EE2A 2HH0H 4UILL 5F9AC 4W81A 1CWVA 5HHOD 2AJVH 2HT2D 2VAAA 5T1MA 5BS0D 1KYOK 2Z4QB 1YJDC 4Q9QH 1V8HA 1FGVH 1S3KH 3KPSD 3PWNB 1YJDL 3OMZA 4K3DH 1HI6B 1J18A 3X3FL 4HHAB 5DUBA 3MC0A 3ZYJA 3QRGL 2HTLD 5KN5A 3I84A 2BRQA 1IBGH 4TPRH 3X13B 1BM3H 1A3RL 1RHFA 4JRXA 3MLXL 4HBCH 2Z35A 4MXQC 3LRSA 5E5MA 3VI4F 4JB9L 3U7YH 1FC1A 3HNTL 3UPCA 5DMIL 3WN5B 5HYJB 4KRNA 2HAZA 4JZJA 2O5ZH 3RJDA 1YNKH 4G7YH 2CJUL 4U1JB 2BMKB 1LILA 5BMFH 5HHOE 3Q5YA 4FFWC 1JL8A 3RJQB 3SDDB 2ITDB 3CMOL 5DJ0B 1EFXB 5DHYA 1CL7H 2D7PA 5EZLA 4MD0A 3ULVE 2ZOLA 3WJJA 4R8WH 2AAVA 1U8OA 2HLAA 4PJFB 4TRPH 4HQQL 3RVVC 1G7PB 3CXDL 2C9AA 3QUZB 4HJ0C 3V5HA 2AJYL 2PR4H 4LLQB 5HHNB 1HDMB 1X3DA 2FNBA 4MS8D 2FL5B 2AI0L 2B0SL 3OAUL 2ZKHL 1DBBH 5ETUB 2JK5B 4PP1D 1BGXL 1IKFH 3L7FA 3EOTH 3HZMB 3GSVB 3BZFA 3EO0A 2XTJB 2IEPA 3FOLA 3VRLE 1JF5A 5IMOA 3GMNA 3QWQB 3KS0J 5K9OB 3OB0H 3NFNA 3PHSA 1FNSH 1N7ML 5IVOA 3K4ZA 1XIWA 2GEEA 1ZAGA 1KLUB 2A6KB 3AROA 3DBXB 2IFFL 1I7ZB 2YC1B 5KTEL 2FBJH 3N06B 2JCCA 4QXWA 3PQYA 4CVUA 3QQ4A 4YGAB 1NAML 3CSGA 4MJ4A 4YHNB 1EAJA 3CPLB 3KPMA 4PJXF 4PRBB 4WUKH 3GIVA 5K9QI 2R0WL 2NXZD 4M6NL 3RWFB 5ILTL 5T1DH 5LXGH 2NZ9D 4G9DA 2YSSA 4BZ1H 4LARL 4PV8B 4OLVH 2DQUL 2VMFA 4PP2B 5T1MB 3H9YA 1MJUH 3TH4T 3EZJB 4P48A 3SE8L 4P2RD 4NP4L 4OZGE 3RL1A 1S9VB 2IAMD 1HI6A 3O6KL 3LB6C 5D70H 5DMIH 3IXAA 5CJOL 1TIUA 1R5IA 4RDQF 3EYSH 4NNYA 3G5YB 1XGYL 3NZ8B 4YHIA 25C8H 2Z35B 3SO3C 2VN7A 1Z6JT 1Z0MA 3QFJE 1MQKL 1SEBB 3Q6GH 5IKCA 5E8PA 3LEXA 5EBMA 4K3HA 5D6DC 4G6KL 1T3FA 3O2WL 1XGUA 2E7LC 4U1NA 2V2XA 1CLCA 3BEVB 2H32B 5SWQB 1C5BH 4MHHI 4QHLA 5BQ7B 2A9NL 2KQNA 1A3LL 2P24A 1UB5B 2RB8A 3SJVB 1H3GA 5DJZA 2X10A 3RZCA 2ZNWA 5FXCH 3LEVH 2CKNA 1E6OH 1X4XA 3LN5A 4XPFH 5J1TC 2XA8H 2AEQL 2NYYC 3K2UH 4XWOC 4D0CB 1CDBA 5T33L 1OGAD 5TPWH 2H6PB 3CVIL 5D1ZB 1OT1A 4MNGB 2X05A 3V5HB 2ZUVA 1JF1B 3P9MA 4ELMA 1OB1A 1JCKA 4MA1C 4XNUH 5IJVA 2Q3ZA 3DVGB 3RY5A 2Z8RA 5KSVB 1S7VA 3MLVL 1BZ9A 1CFQA 3BT2H 2JJSC 1ZV5A 4LCWD 2Q87A 3Q1SL 1G0DA 2HFGL 4LSTL 4JVUA 3WIHH 5B39G 1UM6L 4GJTB 4NZUH 4QY8A 2ZG3A 5C07E 3P4LA 5EDXA 4DAGH 5EOCJ 5J06A 3KXFA 4L8CB 2GTZA 2A6KA 3CH1A 3DBXA 3BN9C 4M7LL 3O8XD 4OLXH 4XCFL 2VZ1A 1H0DB 4HWUA 3ARGC 4AENA 3PGDB 3A67H 4YHYB 5DEGA 1YNTB 3B5TA 3QFJD 1K4CA 5L2KD 1PD6A 3TT1H 1D9KB 4OLVL 3HG1D 3P4OB 5EIIA 3U9UA 3HNTH 5F7DB 1EIBA 2J7LA 1W0VA 1BIIA 2BSRA 3K74B 4NN5C 3UO1L 3RVXC 5KSAB 5DJCB 1DSFH 4G7YL 5HVHC 3LKQA 3SE3A 4NQTA 2JLLA 3VGEA 1A64A 1FL5B 3RIFF 5E94A 4EJ1C 3NFPA 4PJXA 1UA6L 4QHMB 5FDYA 5HHQB 2WQ8A 4Z0BL 1FFRA 4PJBB 5FDWA 3OWEA 4MAUH 2EDBA 4Z0XA 1D7FA 2CR3A 5DMYA 3UTSB 4IOSD 3V0WH 4RFNC 1T22A 1PVHA 4PJ7A 3QQ4B 4NO2A 2E27H 1UKSA 4FQHB 2NY2B 3GMQB 3V4PL 4KJWD 1RJZA 3L5XL 3QCTL 4OZFH 1U8HB 4ZNCD 1CFNA 3EOTL 4LRIA 3QXDA 1DLFH 5TDOA 4PGDB 2ILLA 1UYWH 5GGRY 1DN2A 4IMKA 3TNMB 1JZ8A 3QP3A 3ULVC 5TJWK 3BE1H 1U8MA 4HXAH 4KI5F 4N8CH 4QYOB 5DD1L 4ZMAT 4CBPA 2FATH 5I66A 2ZSVA 1D5BA 4IRSC 4Y5XB 3MSPA 3MV7E 5SWSD 5I19H 2BNRE 4OV5A 4P5KA 3L9RA 1K3IA 2IF7A 3JWOC 5J0BA 3BT2L 3L5WA 2V17L 1VGEL 1J8HE 4UOJA 2F58H 4UT7H 4LLUA 2A38A 3VGAC 3FL7A 1TZGL 1C16A 3FFCB 4UB0L 4IRJA 4DN4L 1LE5B 5AYQA 1G6RB 1R5WA 1SEBA 3BYYA 3HZVB 2IANE 1PQZB 2DLHA 4XRCB 5BCAA 2NXZB 4KTDL 1IZJA 1J0KA 1NANI 2IMMA 3MOBH 4HK3N 3SGDI 43CAB 2GW5A 5IB1A 3MRFA 3RU8H 3S98A 5JW3H 3VGDA 3BD3A 3MX0A 4NZDA 4NKIH 2IMNA 4HJ0D 1CTNA 2X44D 5CGYC 5JW4Q 1PJ9A 5GS0L 3GBNH 2EDDA 2BNRD 2F8VA 4UQ3B 1B0GB 1NBVH 2QADB 1CE1L 3EDEA 5F7UA 2ATPA 2FRGP 3SOBL 3T0EE 3WFEL 2XI9A 2BXYA 4YC2C 2EEBA 3WKML 2FLRT 1I1AA 5CJ8A 1DZBA 1I3RA 4F9LC 4QRQA 2XWJA 5JXEC 1FVCB 4ERSL 5EA0L 1MI5D 1TVBA 3WKNA 2VO5A 1JUFB 3HMXH 4U3XA 1CFTA 4MAUL 1T04B 1AGEA 4KVCH 3LS4H 1XR8B 1E4KA 5DMGC 3CLEH 3V0WL 4XVSL 4YFLI 1FIGH 2DKMA 3MYJA 3KXFB 5MI0C 3ZLQC 3I85A 5FM8A 1KB5L 3O9WA 4XVUD 5TE7L 3CH1B 5DZOA 4HF5L 5JOFB 4UT6H 1FGVL 1S3KL 4TN9A 4U7KA 4C57C 2VC2L 2DF3A 1EERB 3MLWL 3QISA 1UB6B 5JHDB 4PLKC 4BH7A 3GMQA 2VDKH 5HYJD 3IS0X 1F8TL 3GB7B 4LSPL 3RHWK 4Z7OE 3V4UH 2IAMC 2WBKA 3NOIA 4Z5RB 3RIAF 3D0LA 5IR1B 2AJXH 1CGTA 4LSVH 4XMKH 1AFVH 4R6UA 4DAGL 1U92A 1UKTA 1C5CH 1IAIL 1A9EA 5EU3B 2AJSH 5JDSB 1DTUA 5A40E 3EZ8A 1LO0L 3O6LL 4UT9L 4ONHB 1SYSB 2D4DA 4OJFH 3IT8D 5SWZD 4DN4H 4JFFE 5HHPA 3AB0B 3K0WA 3L3DA 2GY5A 3ARGA 1KCLA 5HDBE 4PJDB 4M43L 5FYJE 1R24B 4O2EA 1OP5H 3LPFA 3VXQA 4JRYD 4TVSa 2P8MA 1U0QA 4JLRA 3ZMRA 2GT9B 3E0GA 1JE6A 3OG4B 3PWLB 3OKEB 2ESVB 2R2BB 3JV4A 2YD3A 3WSQL 4EN3A 2XZQL 4KKAD 4KJWC 1S7TA 3M17A 3MRGB 4MWFA 5DTFA 5EOCL 1NAKL 4JQVA 3T77B 2WM0A 3VFGH 5D8JH 3MV8A 1F90L 1RULH 1MAMH 2B1AL 1WTGT 2UZXB 4W70A 2I9LB 4I0PC 5J13C 1Z3GL 1UA6H 4WW1A 1KCKA 4NNPL 1DBKH 1OAZL 5DJ2A 4PRDA 4QWWC 3F6LA 1JBJA 3MPCA 5I2IB 3TVMB 2AK1H 4KTEH 3O6FA 1H3PL 5IBLC 2ESVE 4ZUUB 5KVEL 2AXGA 1DBAH 4X6CA 4H20H 1NGWA 5GSRA 2IADB 3LS4L 2JF1A 5I8KL 4DEPB 1CLZH 4I3RH 1RK0A 3RNKA 5I1KL 2AEWA 3BWAB 3NTCH 4OFDA 3W9EA 3MLRH 5CMAB 5IB3B 3NCEB 3PDOA 4K9EH 1U91B 3DO7B 1CK0H 2E3VA 1QFWM 4JFFB 1AXSB 1MCJA 1AD0A 1QLEH 3GSNA 1YYLH 1QO3B 1U36A 2A6IB 3WS6C 1QKZH 4U6YA 2A77L 1RZGB 2J12B 3S35L 1T6VN 2J3SA 3O3EA 5DSCA 4F58H 1MCFA 4EEEA 1NCTA 3VFNA 1NCWH 3RRQA 4JKMA 5DR5H 2FX9L 3BMWA 4I18A 1T7WA 3NGBC 3C5ZC 2XTLA 3FO2B 4QRRD 3DSNA 2NR6C 3MACL 2W9LA 5CGMA 1ACYH 2H1PL 4PRBA 2VE6B 3SEPA 3QCUH 5BVJA 1IE5A 2IJ0C 1QFOA 2ICEA 1F6AA 2H3NB 5DWUL 1JGDA 2NTFA 4D8PA 4MVBD 4R0LA 5E9DE 1KXQE 4GKZB 1T04A 1AGEB 2BRRL 1WAAF 1T1ZB 3QR2A 4WI5A 3RPIA 4NRZA 4U4BA 1LGVA 1H3VA 4YUEH 5MENA 4RBPK 3RAJL 5F6IC 4MJIE 5ABDE 1AQDA 1P9MC 1ZEAH 1LQSR 3UJJL 2F19L 2PTVA 2HVJA 4O2EB 4YDJB 1H8SA 5TPWL 3FKUS 4FABH 1MNUL 4N0CD 4XNZC 1P4LB 3BPNC 2WUCH 3WFDH 8CGTA 4N5UA 1FZKB 4IRJD 3U30C 4NWUL 4G6JH 2XRAL 4K7PY 2FZ3A 2B7DT 4D9RE 3BJLA 4JG0L 1Q94A 2A1WL 5GGSB 3HI5H 4JR9H 3HNSH 2OTPA 4TNWK 4GW5A 5C0RH 4P5TA 4P46A 2BOBA 2ADJB 2VLRD 1TTGA 1CF8H 2DQEH 2PW2B 1ZS8B 2R0KH 4Y8AA 4DKEH 5L8KB 2VC2H 1MCPH 1G6RL 2PYFA 1NBYB 2QQLH 4LQ1A 3MLWH 2AXGB 4MSWB 1RHHB 1NGYA 4OLYH 1CZ8L 5EOQH 5GSRB 1NGXB 1T83C 2GIYA 1CGSL 1S9XB 2NLJA 4LIQE 4M1CD 1KJMB 1X7QB 1FFNA 1D6VH 3U9PH 1AI1H 4IDJL 4P57B 3RWDA 3ZDZE 1L9NA 2A77H 1BZ9B 4KI1A 2ZCKH 4U6TA 3DARA 4LAJH 3A6CL 3OAYH 3WIIL 3T3PF 1SJEA 4L3EA 4TUKL 1WWWX 3EHBC 3CCHA 4M03A 1FNHA 3DROB 4Y16D 3S37X 3P30H 4YZFE 2I25N 4XGZA 3GSRA 4GFTB 5C8JB 1PEZA 2CK2A 3FOMB 4OLZL 4FQ2L 3TO4C 4AEHH 1I75A 2FX7H 4XCEB 5IM7A 2OJEA 5IMLB 1YYML 4RAUB 1K4CB 4Z76A 5T3XH 4H0GA 2FBOJ 1YPZE 4U1LB 1AKJA 1CVRA 4YE4L 3AY4A 2PW1A 4KK5D 1PDKA 2YPLA 1TJHH 4YQXL 2R15A 3H2WA 3MRCB 12E8L 2ATKA 5KVFL 4BSVA 2XWTA 3IGAB 3VDCA 4JKKA 3VFGL 1MAML 4L4TA 3OJVC 1OSPL 3MRRB 3HPLB 4NO5B 2E9WA 3U7AA 3TH2T 3HAEG 3RA7H 1UJ3B 1YECL 1U3JA 4MJIB 4XVTH 4LLQA 5HHNA 3RWHA 4ZXBB 1ADQA 2OZ4L 1KNOB 3N1PC 1Y0LB 2YD1A 5HI5C 2V17H 3GSVA 4EBQH 4CRPA 5ISZE 1MLBB 2WAHA 1RJZB 3VFWB 1YMMB 1CICA 5IV2A 3ARFC 3UX9B 5JXEA 3GKWL 4ZTOL 3NACH 3HUJB 4TVPD 4U1GB 3P4MB 4HZAA 4LASH 5IB5B 3P3YA 1CFVL 1AC6A 3X3FH 3DURB 5ESAA 4YHZH 4BFIA 4YDIL 4RGNE 4WO4C 4K94L 4LOUC 4S11A 2EXYD 2R9HD 1ZHKA 2Z93A 4IHOB 4ODSH 5AYUL 1MREL 3ZE1E 1RUQL 3MNWA 1NAMA 3BPLC 4OQTL 1ZLWH 4YJZL 3C6LC 5BXFB 3QCUL 3H3KA 4PBWD 1AQKL 2MPAH 3LHPL 1R5WB 2D0GA 3CUPB 3QRFM 5JW4R 4ELME 3DX7B 3L3HB 1CGXA 4R9HA 3P30L 2E6QA 1EAPB 2ICWB 1G7IA 2WNGA 4OZIE 5EZIL 1JK8B 3QDGE 1E4WH 3FMGH 3EYOA 3MRPB 2HT3D 5CBEB 2OK0L 4EI5A 4OT1L 2MWCA 3TESA 1QHPA 1NBZA 4LAQH 3WHE1 3C5ZD 3JWDL 5GGVL 3HCVB 4Q6IC 5C3LD 4K3JL 3EJZD 1S9KC 1B0WA 1ZEAL 4X4ZA 3LEXB 1U8OB 1I1FB 2VERN 4ONOA 2ERJB 2FH8A 1J11A 4UV7L 2EC9U 4MJ5B 2WUCL 4JFDE 1HYSC 3LQZB 3ARSA 4GW1A 5MI0B 2FIKB 1S7SB 3ROLB 2HWZH 3QG7H 4OGYH 3P73A 4H1LA 3F7VA 3KG5A 4HAFA 2MCPL 2RBLA 2OBGA 3E2HB 3BDXA 3ULSA 4L3EB 3S88L 4CUCA 1KJ2H 3SY0B 5CEYB 5C0RL 3ARDA 4Y1AA 5AZ2H 1ZMYA 1IAIH 1TPXC 4J1UB 2DLGA 2X9XA 4WI4A 1YA5A 3RL2B 3EFDL 1U8JB 5GIRA 4JO4H 1BFOA 4GAYA 4O02L 4DTGH 4LGRB 4X6EB 1CE6B 2DWEA 1MFBL 2QLVB 4L4TD 5ESVA 2VXVL 2YXMA 1F4XH 3MLXH 1J8HD 2LV4A 3BQUB 2Y6SC 4PGZA 3C8KA 3S4SG 4UNTA 3ARTA 1QBBA 2DJUA 4KI5D 4JY4A 4MAYA 1MLCA 3VXSE 5CJ5A 3ILQD 5INDB 2GK2A 3ULUE 3BUYB 5SX5K 2XWTB 2CJUH 5DK0A 5DJAB 5EO9B 5CJOH 2DI7A 2P45B 4BFIB 4J6RL 5LCVL 3EYSL 3MRRA 4N90E 4MA3B 3TBSA 2NXZC 5EU3A 1QYGH 2RGSA 2CRMA 2UUDK 3SDDD 5JLZA 5KSBA 4A6YB 2XTJE 2Q7NA 4KKCD 3CXHJ 3VGAB 4M8QA 2AERT 3AXLB 3G5XB 3UCRA 4JRYE 1QR1B 5ENWB 4ESKA 1GC1H 2EIEA 2ADIB 3TBVA 1JWUB 5ERWA 4OKVA 1DR9A 4R96A 3I50H 3ZE0E 4H20L 4HULB 3CUPA 4TSCL 2IPKB 2YMXH 2ZP0T 3P9LB 4IRSA 4JM2F 4LAQL 5GRJL 2WLYA 4PRIA 2FHCA 1JYWA 4OLUL 4FRWA 4PV9A 4HPOH 3VXUB 2MQ3A 1SJXA 4RMTA 4O9HH 4OAWB 3TN0A 3VWJA 1EK3A 1JRHL 4ZD3H 4QOKA 1II4E 2IWGA 3RI5F 5D1ZC 3MRHB 4FFYL 4LVNB 4P2OD 3U36B 5HHOB 1Y18B 3UDWC 2OI9C 4G8EB 5CUSH 5IBUG 1I1YA 4HMDA 4XVJL 3DHJA 1ZVHA 2QL1A 1KCSL 3TPUA 4R7NB 4LHJB 4EI5C 4PGDA 3Q1SH 2VNCA 2HFGH 3TM6A 1F11A 3UZVB 1FVDA 5FFLA 5JPMB 1NC4D 2X4RA 3BSZL 2VL4A 3CDFA 3DMMD 3DVGA 2YWZA 4JFQB 5AZ2L 4H1LB 2DOCA 1BAFL 3VXRB 1IEHA 4M4PA 4N90D 1EAPA 2IGFL 1NDGA 2FSEB 5T5FH 5EBWB 4LPXA 2DQHH 1MFBH 4R2GD 1QO3A 1QUNA 2W9DH 3UTQB 5IW6A 1T2JA 5KSAC 2YEZB 5E8DL 4ZXBD 1BJ8A 4MD5B 3DX8B 3IS1X 5FCUH 5IIEB 5D72L 1CD0A 1E28B 1XGPB 4JQXC 5HI5D 5IESL 2HFEA 1BOYA 4NPYA 4WWKD 3HZVA 1D3CA 2ZG1A 4WW2C 5HHVL 4OCYL 4NGHH 4BKLA 1FZMB 5HYJA 4NO3B 3MBEA 4AH2B 5BO1H 2F19H 5HVFB 1BVKA 1AHWC 1AP2A 2XA3A 3DLQR 4HLJA 3TO4A 1JNNH 3CSPA 5IB1B 4H0HB 3IF1B 3I3BA 3QZWG 4MAYB 1W0VB 2ICEB 3O2WH 2ITDA 3BDYH 3TV3L 3DOSA 3BGAA 2EDQA 3QEGH 5D2LA 2OL3B 2OTWA 5I71C 2HKHL 2DBJA 1I1CA 4ZOEA 2KKQA 2DJSA 1N2RA 2ZUSA 1KPVA 1E6OL 1MIML 4Y2OA 5IEHB 1WCQA 3RIAK 1T83A 1WT5C 1ND0B 3IFLL 5IW3A 5GRJH 4ZO8A 4IOIA 2Q76A 3JTTB 1B4JH 1TETH 2QQLL 1P1ZA 2H45A 4GQ9H 3VD7A 3QDJE 3FTGB 4FFZL 1MFCH 4NO0A 4J3TA 2EXYC 1GGTA 4OGXL 2ZCKL 1PKQA 5CBAB 4PV9B 3VXUA 4DZBA 4R3SA 3RBSA 1T5XB 5I1GL 1RUKH 3EJZC 5JPNA 3IDGB 2CDGB 3KPOA 4TULL 5DLML 1EO8H 3QWRA 4C59B 4OLXL 4PBVC 4GRWF 2N7BA 1S5IL 3RIFK 3U0PA 3SGEI 3TBTA 1ES0B 5D1XB 5IMKA 1CDUA 3HFML 4FP8H 1JPGA 1LK2A 1CT8A 4RMWA 5IEKB 5ENWA 3WBDA 1QFPA 4QXTB 2MFNA 4DCQB 1OAUL 3JTSA 4TRPL 2CMRL 1TVHB 2YKLL 4U1KA 5D5MF 3MQIA 3O11B 3VRJA 5JHLL 3BRDA 4TNWF 3C5JA 4IEFB 4NHUA 4DN3L 1RAMA 4L9LB 5GS0H 4GW4A 2EIDA 4LCCA 3OSKA 1AXIB 4QCIB 2QV2A 5A2IH 4NQDB 3MLTB 3PWUB 1A6UH 1X4YA 4WEBH 2GK0B 1R5IB 1VFBA 5I1HH 3U79A 3G5YA 3SQOL 2CO7B 3IKKA 5EBLB 1A1MB 3BX7C 4N5EC 4M48H 4WW2A 4BKLB 2AGJH 4OUOA 4WY7H 1YEDB 5LQBL 1T1YA 1UWEL 3UYRH 3L3JB 1A14L 4I2XB 4WHTA 2CSPA 2IFGA 4GLRI 4YPGA 1A7QH 2X1XR 5CP3H 4XVSH 4H8WL 4LP4A 4ODWA 4F7PB 2ZJSH 3LKOB 4ZO6A 1LHZA 1M05B 3KYKL 3E2HC 5ESQA 1S7WA 4LLVA 5KZCD 4NC1C 4JPIB 3QFJB 2V5TA 5I2IA 4FXLA 1M6OA 2C4XA 3JBG7 1CFVH 1KIRA 2BOCA 4ZUWA 3B4NA 3D5OF 4YXKL 3B3IA 3K2MC 3GHEL 3C60D 4JFYA 3ROOB 2WIIA 4XCYA 1Q72H 4PR5A 5GRUH 4M8VA 4JPWH 3KPNA 3VXRE 3RWGA 3V4UL 1QEWB 5K9KA 4HWBL 1PGRB 4JRWA 4R26L 4YHML 2P7TB 1QNZL 4HUWA 3MJ6A 4MAYD 1KJVB 3MBEB 1XCTA 3WJJC 1IGJB 2OS7A 2Z0BA 3FTGA 4XAWL 3C60B 4R0LC 1IGFH 5BOZG 1QRNA 4KV5F 1CICB