2OULB

The structure of chagasin in complex with a cysteine protease clarifies the binding mode and evolution of a new inhibitor family
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
107
structure length
107
Chain Sequence
KVTKAHNGATLTVAVGELVEIQLPSNPTTGFAWYFEGGTKESPNESMFTVENKYFPPDSKLLGAGGTEHFHVTVKAAGTHAVNLTYMRPWTGPSHDSERFTVYLKAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of chagasin in complex with a cysteine protease clarifies the binding mode and evolution of an inhibitor family.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Falcipain 2
total genus 21
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2007-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF09394 Inhibitor_I42 Chagasin family peptidase inhibitor I42
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2020 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2oulB00
2NQDA 3PNRB 3CBJB 2OULB 2FO8A 2NNRA 2H7WA 3CBKB 2C34A 3M88A 3M86A 3E1ZA 2WGNB
chains in the Genus database with same CATH superfamily
4KZ0A 1JD9A 1NCHA 4MA3B 1NBZA 3ZKMC 4GUPA 1E4JA 4IIQC 4JDZA 2G4GA 3BP4B 5CIPH 3V4PH 1BAFH 5FUCE 2IAMB 3ETBF 5I1CH 3NRPA 5JMRA 4NQDB 2Z7UA 1JL8A 3MV7E 4NJAL 1NMBL 5D2LB 1JTTA 2ZUYA 1S9VA 3EYSL 3HZYA 3OKMA 5I1AB 2Y36H 1VESA 1BJ1J 1AP2A 2EDWA 3R06A 2RFXB 3APNA 3CVBA 4HJTA 4PR5B 3DUSA 4KKZA 1AQKH 3O6FA 2FD6H 1F45A 2QKIB 1GYCA 2BY3A 3MJGX 5DS8B 1EQWA 2DIEA 3B7TA 4J1UB 3S96B 4GXUN 3CBJB 3GO1H 5MEPA 1LO4L 1S7QB 4PSRA 4QRUB 4TL5A 1FH2A 4N2OA 3VXQA 3ISWA 1FL6A 4PP2B 2H2PC 4CVXB 1WBZB 3IPFA 2O5YL 4QRSA 1UWYA 4FZ8L 1KYFA 1SZNA 2V9TA 4UDUB 3CNKA 4JREB 1CVRA 1N8OE 2K6YA 1UHVA 1OL0A 1ZA3B 2D7QA 3ECUA 4GUQA 4JFSA 5IEHA 3AUVA 2BK8A 2GUYA 3O8XD 3CFJA 4NM8H 3B56A 5DUPL 1RMFL 2XN1A 4XXCA 3BSZL 1XCXA 3SOBH 2OI9C 4KROC 3MUJA 1G1OA 3VXRE 3ZE0E 1YJDL 1QNZL 1PY9A 1P4UA 2A9DA 1E7UA 4NQXA 4UQ2B 5DFVC 4CW1B 2V2TB 1XGYH 4NUQA 5GRYA 4APQA 5B21A 2CDFB 3V0WL 1J8RA 3OKNB 4GW1B 3GSOA 3PWLB 2E6PA 5B4MD 1PG7W 3FAWA 1KJ2H 4GFXA 5DJ0A 5LN8A 4UWQB 3WU1A 5BQ7A 4N8CL 5EIQA 3U4BL 4HAGA 1FNLA 2J6WA 2IH3A 3MC0A 4MD0A 5F3BB 4RZCA 4XMZA 3KHOA 3BVNB 1QA9B 4TUJB 1KTBA 2X4NB 3B5GA 4X4KA 4MS8C 1N5AB 2PCPB 2CCWA 3S88H 4ZTOL 4JQVA 4MQSB 4NQCE 4NUGH 4ZO7A 1W0VA 5AW3B 3ZYIA 2D7OA 4JFZL 5KSBE 2P80D 4M4PA 2BIQA 1TZIB 3MLVL 3CC5A 2VAJA 3EYQC 4YHZH 4X80H 1IKNA 5D1XA 3LRHA 3OHXA 5KVGL 2EDDA 4D9QE 3PLYA 4ONHB 4Y19E 3PJNA 3M7OA 5EU6B 2J21A 4M5ZL 3RL1A 3U9PL 3RU8H 3O8XC 4AZ8B 1NCCL 2VO8A 1UOVA 1YEDA 2F5AL 1H8OA 3ZQ9A 3HBGA 4DCQB 3R7QA 4JHUA 4BZ2A 1J0ZA 4JY6A 1HQ4A 3VWJB 4P9HL 2WLLB 5CZRA 1TQTA 4IHOA 1LEKA 4C4UA 4AWJC 4XB7A 5HGHB 1TF4A 3AAZA 4HUWB 1FCGA 3GJEA 2R2EA 3ZZQA 2Z35A 4CU6A 3R8QA 5KSAA 1QPPA 3ET9F 2JIXA 3TPKA 2OMWB 5FYKD 2FTAA 5KYWA 4HQQH 3PHQB 4MD4A 5MENA 1IBGL 4LRIC 4G1EB 4MXWL 1N59A 1B9KA 5HD8D 3FQYA 1I1YB 1GC1C 1J1XH 1RUPH 5BS0A 4N5UA 2IQ9H 5IQ7H 3V10A 1OQOA 2F0CA 2HB0A 3OTTA 4IM8A 3EOTL 4Z7OF 5FYLE 3WOVA 2BNQE 3GM0A 3M17B 5IFAL 1FHNA 1XF5B 1IJNA 5DJ2B 4X7FC 5KSBB 2F74A 4OD2B 3P2DA 5BMFH 3B3IB 1IFRA 5MP6H 2ALWA 1CLYL 2W9DH 3JV0A 3GMRB 4RGMB 1TLMA 2NUTB 1V3MA 1OANA 1G1KA 2R29L 1R5VB 1XCQA 1KSRA 4YE0A 1FGNL 4G7YL 4WJ5B 3KXFE 4NZTH 3WHE0 3VJ6B 4NO0B 1AQHA 4JZNA 2QPUA 2FCBA 1SQMA 2FX9L 2H7WA 5DTFA 3NSXA 4AQAB 3FB6A 4KDTC 2BVPA 5B39B 1NSNH 4KUCD 2YBRA 4D0DB 1DVFB 1T04B 3BEVB 3EBIA 2UX7A 1K72A 2X6BA 5JYMA 2AXFA 2GABA 4Y16C 2FEDC 4K15A 4JDTL 5F9OH 5AKRA 3S34H 4RAVB 4LCVA 4ABQA 3VFWA 2HJLA 1NCBH 4ZBJA 2FLBT 3RPIB 2YMXL 1ZV2A 4ICXA 1ORSB 3EHBC 2OTUB 3U0PA 1OTSD 2W1NA 3FU5A 4HPOH 2KMWA 5C8JA 3ZDWA 5AEAA 3FT3A 1FNEA 3TNNA 2XYBA 7FABL 3R1GH 1YUHA 1T0NB 1LO0L 1NAMH 1HHIB 1YN7A 4MJ5A 4LIQL 5EUOE 1J8HD 1FL3A 4KJWC 5AB2A 3HMXA 5IB2B 2JK5A 1DJYA 2NR6C 3Q48A 4H25A 1Q38A 4EOWH 5JPMA 1N6QH 5JR1H 1MCWW 3LKNA 2BLFA 1DJWA 1B4LA 3POCA 2HT4D 4Y5VC 2C3VB 3WFBH 4W4NA 1UKQA 3FSZA 2YWZA 2YGQA 3VXUE 4IW4C 4GBXC 3SY0B 2NY0B 5BVPH 3JBG7 2VITA 1S7RA 4TF4A 1OT4A 2JJTC 5IHBA 2WYTA 4JKMA 4P4RB 1KJMB 2K8MA 2ZJSH 4AL8C 4DNLA 1NC2D 5KYUA 2LW3A 3B3BA 2OYLA 2JCCA 3HHSA 4J3BA 4MA1B 1GC1L 3LN4A 3WSQL 3MJ8A 4X42A 4HOMA 1CBVH 1U4FA 3AB0C 1DSFH 1ET5A 2VAAB 3DNKA 2LE9A 5JXEC 3VH8G 3CX2A 1ET8A 3GMLB 5HGDB 1FI8C 1LMIA 4PJ9A 3MLXL 1P4LA 4UF7C 3HFML 3N85L 2K0RA 3WO4C 1F3DJ 1DSWA 2OMNA 4EI5A 3JVGC 3IGUA 3P4OB 3HE7C 4KVNL 4UNIA 3SDXF 1FRGH 3D0VA 4QLRA 5AZ2L 3L3OC 5A3IC 1T83C 4HU2A 1SOKA 1W6WA 3QI9C 4HPYL 3V52L 4J27A 1CXLA 1KCVH 1NWOA 1UWEL 3LQMA 4ALAL 1RJLB 3PREA 5AW4B 2IDUA 5AYUL 2BP3A 1X5XA 1P1ZB 3PWUA 1DEDA 3W56A 4JFEE 4UOJA 3CZSA 1F6AB 4DKTA 3IGKA 3LRSA 2VH5L 2V17L 1IT9H 4ANVA 3JSSA 1MHPH 1A4KB 2YUXA 4XBPA 4IU2B 1QMUA 2XN9A 1SF5A 2JVUA 3QFGA 4PEEA 4I48B 4KJQC 5J3HC 3IU3A 1RVFH 3P4NA 5F93C 5FGCB 3NSFA 4K3JH 4NUPA 4DKFL 5C7XH 2H0JA 3PNWA 3SDCB 3WE1A 5L9DH 1OB1A 3MV8E 5EOCH 5I6OA 3NT0A 3HN3A 4P5SA 2X70B 5CGTA 1X44A 4A6YB 1IAIL 5GIRA 1KIUB 1CFBA 4GMTH 4HH9A 4HIPA 1PZ5A 1VEOA 3G5VB 4UQ3A 2FQFA 3IJHB 4G5ZL 4TNVF 1MELA 3FT2B 3QO0A 3VA2C 3HKZA 3IWVA 5HDBF 2ITCB 4UAHA 5CBAA 4NO5A 5DK0A 3QUYB 3DETC 4FYTA 4L37B 2IOMA 5TE6L 4BDVA 5B3NA 4L4VA 1YEKH 3TA3B 1NBYB 1TZ8A 1Z0NA 1QLFA 5I30H 4Y4HC 3KCPB 5I8KH 3EGSA 4U6VL 3T3MF 4AIZA 2D3VA 2PWGA 3G6JF 3N1FC 3TN0B 4ABUA 1AKPA 2RCSL 3FO0L 1JVOA 1X5IA 3S35X 2WP3O 3HE6B 4RAUB 1ACZA 3PHSA 3G3LA 4NQDA 3DVNA 1GMEA 1JNLL 4NNXB 4Y4HD 4GQ9H 4N1EA 3QJZA 2DI9A 3CFBA 2H1PL 2WUBH 1UT9A 4IBZA 3PHOB 4ZS7L 4XOCA 5GJTL 2R7EA 3FH5A 4UNVA 5KS9A 3REWA 5DS8A 1KCBA 3TURA 1RLWA 1SN5A 4D7PA 3SJVD 3SDDB 1NH6A 3VFNA 3VI4B 4ODWB 1PNDA 4PP2A 4MMXB 5HDWA 4N8VB 1U58B 4GKSB 4WY7H 1ZXQA 3CDYA 3MRBB 3IFLL 3KLDA 4NBXB 2Y69B 1KB5A 4JPVL 5G5DB 1Q8MA 3OKDB 3SDXA 3A47A 3W11C 4XVTL 5GRVL 1A0QH 1YA5A 2NQ3A 4ESKA 4P2OA 1IGML 3SPJA 3TEZA 4IQHA 2DEWX 2VZ3A 4EUPG 1JE6A 4P4KD 3V55A 3F58H 2A0LC 1G6RL 2D0FA 4MA8L 1ZLUK 5D7LA 4GSDL 4ZUVA 3W0WB 5AOJA 4A7VA 1SMDA 3W9EA 3RIAF 1BXAA 3DTXB 4JB9L 1C1EH 3GBMH 3U4EB 1FVDB 3HG4A 4UU9B 2AAVA 3VXSE 4HSCX 2P45B 3W81A 4UIKL 4KQ4H 3RTQC 3RX5A 4M43L 4BHUA 5F1IB 5I1EL 4FRWA 2TSBA 4DN3L 3ME0B 4Q97A 3ZKXB 4BFIA 1UB6B 3C87A 3A6BH 2DQ6A 5I0ZA 2Y0SA 3KDMA 4NO2A 2DH2A 4OCRL 2AVGA 1VJSA 5FGBC 3SQBA 4NNPL 2IJ0C 4PJFA 4D8OA 4E9VA 1U8LB 2PR4H 5GGRY 2FH6A 3BFWA 1B0IA 4WCYL 5J9PA 3CZFA 5HYEA 4A7TA 3A67H 4ZUSA 3MJ7A 4NWTH 5CD3B 5ESVA 1QPXA 4FS0A 1MPAH 4FQJH 5T1KA 2E9IA 1MIML 4M1GH 3SGDH 5LBGA 1Y1UA 3NJMA 4LDLB 3FONB 5J13B 4JFWA 3WFDL 4ZNEA 2FBJH 2CR0A 4X98B 1CLZH 3VSVA 4CRPA 1F6FB 1IL1B 4MD4B 1SUHA 3IKKA 1KMGA 1N7MH 3BKYL 4OF7A 2V7HA 1EDQA 1JWUB 4XMUA 5EBLB 5DJCA 3O9WA 1PNCA 3FO1B 3GMMA 3F84A 3DVGB 4QXWA 2MPVA 5DJ8A 5EOQL 1QBLL 2VE6B 3VWKD 4Z3GA 4IRZH 3NBNA 1N5YH 5FF6A 2UZYB 4HU8A 1WFMA 2D03H 3HZKA 3BE1L 1KYOK 4QAWA 4POUB 2WQXA 4B9FA 5GRXG 1QX1A 4XE5B 2NUTA 1RZ8A 2L8AA 1V54B 3FNKA 3OJ2C 1S5HB 1KN4L 1OOAA 5GGVH 4ZXBB 3ZTNL 3L3IA 2EACA 4NO0A 2ORBH 3VGHA 1PG7L 3E3QE 2J8UB 1H8LA 1I1FA 4G3YH 3GZKA 1Q1PA 4X4XB 5C0CD 4FHJA 3GSVB 4HIJB 3GKZA 5G4MA 3BHBA 2VL5A 5C0AD 3NZ8A 1UH4A 4KZEL 3WKMH 2Y6SD 1GZHC 4N8PA 5IOKA 1AY1H 3DX1A 4JANB 4RWHA 1FNSL 4N22A 1RZIA 1HIMH 1N3NB 4MGXA 5I8EB 3FQXB 1BQHA 3IF1A 3RY6A 4BWTA 3LB6C 4E9QA 2CDEB 5I76A 1AGDB 3ARWA 2E7MA 2J44A 1KPRA 1CC3A 1DFBH 3ARSA 3MACL 1MIEH 4WGKA 1WZ1H 3VD9A 1AZNA 3CHOA 1J5OL 1JXJA 3KJ6H 5HDLA 5D7JC 3CCHA 1YMMB 4P9MH 3UG3A 2V2TA 5JW3H 2ESVA 4OB5H 4ZFFB 1QBAA 1RURL 4HJ1A 4X6CA 4RNRB 5T1DL 3BVUA 3DX9A 3SDDC 1M7IB 1VEMA 3FUKA 3Q8FA 1KGXA 4J3TA 3EJZC 3VFPA 2ATAA 4KHXH 2XN2A 1S7RB 2WB1A 1EZVY 1ZVHA 2XWTA 3O6ML 3U7WH 2VXVH 1MFBL 4BA8A 1UQSB 1NDTA 3Q6FA 4N5EC 5F89A 1L3NA 5IG7A 5KJRH 4IJTA 2Y23A 3RNQB 2VUOA 1FNSH 1JN6B 1NCGA 2DM4A 1ZV5A 4PY7B 4XXWA 4NQSA 4Y5XC 5A2KH 5F70A 3TU6A 4MB1A 3WKML 1LK2A 1MY7A 3EJPA 5FUOH 4F8PA 4XC3H 2X6CA 5H37G 1ITBB 4H44C 1HXMA 5TDOA 3RWCA 4MCYB 1NMAL 1COBA 4YDVA 2WOYA 3HZVA 4GSXA 4NQEA 3BAWA 1AGCB 3D0VB 4L3ED 4X5QA 5HTSA 2AEPL 1QP1A 5EZOH 1KWKA 4QI3A 4GRLC 4QGYA 1NGQL 2XUWA 1HHJB 1MREL 1KN4H 1NGXA 3O4LB 1KV7A 3OKLA 4JLRA 4ZTEA 3H8NA 2H0PA 1UVQA 3T0BA 3MLZL 2I60L 2OS7A 1HU8A 3CDGA 3FHAA 5CINH 5I15H 5KG9A 4TS6A 4PCSA 5AB1A 4B6ZA 1OAKL 1V7MH 2F7OA 3BE1H 4I5BA 2BZDA 4XPFL 5CJQL 2KZKA 3KH4A 2QPDB 1U8PB 1EDHA 1TETH 3LIZL 4TTDD 3C60C 5B1JC 3O41A 4X99A 3SYAA 1KENH 4PJAF 1WTLA 4PBXA 5DFTA 4ELMB 1JNJA 1KUMA 1G94A 2BVUA 5TE4L 4MLSA 4ELDA 1KNOB 2FVNA 1ZT1B 5HYSA 3MX0A 2OCJA 4AE0A 4M48L 2XN9E 1M71B 4NQQA 3GHEH 4A6YA 4A7SA 1IM9D 1KY6A 4N2LA 4FQCH 2P49B 2BOCB 3MROB 5JW4R 1OGSA 4X6FA 3DDGA 1BM3H 5KYYA 4GQQA 1ET7A 2VXUH 2X42A 4MQXC 4MQ7A 4OLXH 3CQFA 4ZPTA 5E2JA 4OZGF 3ZKSD 1WITA 1NDGA 3PQYB 1QLFB 2HLFD 4EBQH 2PTTA 3FF8A 4IGBC 3UYRL 4Z95H 2FRGP 2VZOA 4OZHA 4DKAA 3QZNA 2ZCHL 1OZUA 2F19L 1J05A 5IZ7A 3VVVA 5J57B 3U9UB 4MXVE 2FZ3A 2XRAL 4ODHH 3MRCA 5EIIB 1GVIA 4NRXA 3ZE0F 3ZRCC 5GSRA 3KYMB 4YDNA 1M6OB 1A5FH 1YAIA 1F2QA 4F9PC 2D73A 4DGYL 4BBWA 2G5BB 3MV01 4HIXH 2UWEE 5C07D 4MCZA 4XNMA 3JTBA 2FQDA 4KZDL 3QUXA 4UCFA 4F9LA 3G6JA 1MFCL 4XXDA 5DVLA 3K8LA 1MCJA 4V2CB 5JO5A 2VR6A 2WIMA 2YPLA 3GBML 1BAWA 3HB3B 2A4EA 4X5WA 5KTEH 5C08D 1HXKA 2VLLB 5D6DA 3T4AB 2PXYB 2GTQA 2DMCA 1AJ7H 3QA3A 1CBJA 1YYCA 2CLVB 4OLVH 4PJIF 3B1TA 3SDXB 1V55B 3BP7A 4JPQA 3AQXA 1GGCL 3L54A 1AC6A 3MRRA 2VC2B 2DJUA 4UBDD 3HB3C 5K1JA 1P7QA 3CMOL 4Y5XB 5FWRA 2EKJA 1IGMH 3PGDB 3BGFB 3IGAA 4KO6A 15C8H 1YN6B 2YK1H 1KJ2B 5DQDL 5DVOA 2NSQA 4JFXA 3O2VH 3P0YL 2AJXL 4L1BA 2E8YA 4AJVA 2EUWA 4LVOC 4UTBH 4YSRA 1WC7A 4FYQA 1A1OA 1EXUA 1JPTH 4K2UH 4AVKA 3FQ1A 1LP9F 2AJSH 3QAZC 4P2RE 3SB3A 1N64L 4OTXH 1LEGA 4FQXA 3FJTA 1G9HA 4WW2A 4AUUA 2VR3A 1KGCD 2YD7A 4RVBA 1ED3B 1CU4H 2AK1L 3LNHA 1PG7X 4G43A 3GSNH 3BDYL 3DBXB 4H2CA 3QIBA 1ZKAA 5CN1A 5HPOA 3MLWH 3SQBB 3H7LA 5DD0H 2P28B 4CSSA 3AJ7A 2KH2B 3VWKC 1MCPL 3CVIL 2MTAA 3VB9A 2R0KL 1A3QA 3ARRA 2W0FA 3KWTA 3PPSA 4IHBA 1MWAH 4P57B 2X89D 3FU9A 4BQ8A 4BSWB 5T33H 3TFBA 3T1WA 1X5MA 2ARJQ 5HYJB 1EV2E 2C7UA 2DS4A 4P49A 3EO9L 2XWJB 4GAGL 2NYKA 4LP8A 3WEOA 5CZVH 3SBWA 1AZUA 3C2AL 3D05A 2WQSA 3ROLA 4Q4IA 4X98A 5D1ZC 1M6UA 4Q6IB 5JNYB 3QZPA 1RP8A 2VLJE 3L3KB 5FM5O 1TIUA 4JFFD 3MRPB 4QRPA 2NCMA 4WEBH 3BSZA 4TRPL 1GZQB 3VI3E 5HD8C 3NCCB 4OIAA 2NCEA 4N2DA 2EH7H 1ASOA 1WCBA 2EZ0D 2FR4B 1EZLA 3F7YB 2QPEB 4Z3EA 1A6VH 3MRIB 4LSSL 3VQ2C 1SHSA 4XPFH 2X1PA 3WCYA 3IWUA 4LSTH 5KSVA 2Z0UA 3D85D 4LBAA 4LIQE 3J07A 1FRGL 1A7RL 1NZRA 4NQDD 5KN5B 2XG4B 2XI9A 3GYRA 2JWYA 2YPVL 3NABL 5I66B 2FIKB 4HCRH 3IETA 2DBJA 1KDIA 2E4TA 4KV5E 5DJXB 5HHMD 3TJEH 6PCYA 3GB7B 4Z7OE 5JORB 1FH5L 3ZZLA 3LNGA 1L0YA 4EAEA 1DLHA 3B2UC 4A2DA 1IGJB 3OJVC 1I8MB 1OW0A 1UB5B 4H1LG 5D2NA 4DOHB 4S10A 4XC3L 4ODSH 3RBSA 3HCVA 2WGNB 3D25A 2IALA 4R3SB 2ZJSL 2AEOA 4CN4A 3RX7A 4D9RE 2YXFA 3DJTA 5EU4B 3T8VA 3SQOH 1FZMB 1BVNT 4P3DB 1NGYA 1BZOA 3FFDB 2AJ3B 3L17A 2X12A 4X0NA 5IVZB 5DZOA 1Z66A 5DI8A 2AXHA 3B6SA 5HHNA 3WIIH 1VGEH 5K39B 3WFBL 3SPCA 5D71L 2HKHL 3KPRA 1Y6KR 4YEEA 2CMRL 4BFBD 1DDHA 1LE5B 4OZGB 3DX9B 3S8GB 3DV6A 2NDFA 1FLRH 1Z3GH 5EC1A 2B2XL 5GRWA 3RPKA 5L4FA 2VZVA 4L9DA 4ODUB 1MUJB 4Z5RA 2WWOA 4FFZH 3VE0A 2H32H 3PGFH 4POZC 3WV0A 4P2QD 5GZOC 1X9UA 3HE7A 3N40P 1SDDA 3VX1A 2XZCL 4RFNC 4Q4EA 5AVSB 4LSQL 1U8MA 3WD5H 2HLAB 4OM0H 4KRPD 2H9GA 3GS4A 1TNNA 2WNGA 4PRBB 4JM2F 1I3RB 4W9DC 1NBZB 4JFHE 1NCBL 2G5RA 2IAND 3L1FA 3NFNA 4NZFA 5JTWA 4KROD 4AEIH 4ATWA 3GQFA 2ZP0T 1P9MA 2YPVH 1M42A 1S9VB 1NM4A 1S7SA 1TYEB 2F54A 2X2IA 3L7EA 4ORGA 4QYOB 4XNQA 3ARDD 3I50H 1CGSL 2QPFA 3MYZA 3V6OC 3VI4E 5DRNB 5AKTA 1HYSC 4MCYA 3EJRA 4ZMZA 5JIMA 5HDBE 1PKQB 4UOQA 4BFGA 3GHBH 3FB8A 2GIYA 1ZA6A 5DEGB 1E2VA 4HC1H 3MOAH 4BZ2H 1M53A 3TTSA 1KBGH 4G7QB 4NQEE 3UPCA 1RHHB 5DO2D 2UUDH 1G7MA 5E94B 4DVBA 4JPSA 3EFOA 1FC2D 3GDCA 4UDUA 1FVEB 1K3ZA 1HN1A 2WBJD 1XIWA 4S2SA 1X7SA 4U1NB 3B2DC 2IEPA 1NEZB 1MXGA 3IFPB 1VACB 1THCA 2CIKB 2H32A 3NSCA 1ZT7B 2P8MA 4NN6C 3ULUE 1KGWA 4Q14A 2PKDA 1BZDA 3BZ4B 3K4AA 4E9RA 1UXWB 1BX2B 1HWWA 3O41B 2K3TA 3GSWA 4OUUB 4ZO6A 3S7GA 1KIPA 3ZW3A 1JF5A 1QSFA 1XZ0B 3HS9A 3QHZL 4UQ2A 4DPAX 1QBLH 2HFEB 4UOZA 2JKXA 1N0LA 3QCUH 1X6NA 1P0SE 1G7QA 2GTWA 4O02B 4FLHA 3DK0A 4XB8A 2H4EA 2B4CH 1TJXA 5ALBH 3U6RA 3VQMA 1WICA 4U0QB 3QUKA 4S1QL 4A55A 4DHLA 4I9XA 5DRZA 2OP4L 1LWRA 2F58L 5SV4A 4ELMF 8FABA 1D9KA 1V27A 4AV5A 3MTXA 4UTBA 2KZWA 3EADA 3MO1A 3EOAB 5D7SH 1DN0B 4F2ME 3ABGA 5C71A 1KCSH 3WTSA 3QWOA 3SDAB 3G6AB 4XMKL 3C5XA 3EH4B 2A38A 1IB5A 1N5AA 2IH9A 4GKZB 2X6AA 2ZF9A 3FN0L 4OZFH 1UH2A 5EA0L 2NW2A 3V95A 3QUMB 4JFUA 5F7NC 3G5XA 4MD5B 4XCEA 3E2HC 3M8OH 1LTXA 4MZ2A 4Z7NE 3MRDA 1YAZA 1CGUA 1GJUA 3HHRB 4M7LL 3C12A 1F90H 4FG2A 1N64H 1F58H 2B8OT 2NZIA 2CJUH 3FU7B 4Z9KB 3QEGL 1QNIA 3D18B 3MBWB 2RJMA 3VI3B 1BWMA 1NC2A 5FR3A 3SYCA 5CAYB 3GD1C 5C0GA 4TVPH 1CK0L 3A6BL 1NAMA 2B08A 4C47A 1QAWA 4MB5A 4Y19B 1PD1A 1M3IA 3CFCL 3K1KC 5IF0B 4AK2A 3IEAA 4G7VL 4QOKE 1BECA 4DN3H 4XVJH 1H8SA 1UT2A 3T3ME 4O2FB 4NO3A 3EYFB 4NFCA 5AL8A 3L81A 3HRZB 4JFDB 4HG4J 5EEUA 1PFCA 3BSZH 2WLMA 4GRWB 3TV8A 4NP4H 2AQSA 3IGAB 3MA9L 1ZMYA 4MXVF 4I77L 1X9LA 1M1XB 2W80C 2AW2A 3VM5A 1UM4H 2BRRL 5G4NA 4MJIE 5DMIL 1BMZA 2UXFA 3DX4A 2XSKA 4J7RA 2R4SH 4NPKA 3E8VA 3SE9L 1T21A 2Q2LA 4KKAD 3US1A 3PWNA 3ZHFA 1R5IB 3JWNC 2BC4A 4N0FB 2EECA 4Z0XB 3BLKA 3MRFA 4YX2L 1GGTA 1SPDA 2DLTA 4F92B 4M6NH 5LG6A 3QXVA 4QR7A 5DVKA 2K7PA 4LPYA 3DARA 1W6LA 4CN1A 4XN7A 4ZSOA 1L9QA 3V0HA 4M03A 1Z6JT 2OCCB 3UGUA 4BUHA 2PABA 5JHAA 5AVUB 4BZYA 4AG4H 2GUOB 3VFWB 2NXZB 1N8ZB 4ZS7H 3V4PA 1VLXA 3HC2A 4EBQL 3NEXA 5IV2A 1JNLH 1JV5B 4HBCH 1TCRA 3Q43A 4YSAA 3WHE1 3G6DH 5ENWB 4PB0L 2CKNA 3DX6B 1A6TA 5B8CA 2EDHA 3BUYA 1JVKA 3DX2A 1HKLL 3CSPA 3QIWB 4IKIA 4QD2E 3ZJAA 3HC3H 4D9QD 2NY3C 4Y2DC 5CSZB 5KANI 4FQIH 1JHTA 1YMHB 5DJDA 2B59B 4RIRB 2XPGB 3QDJE 1K4CB 5JPMB 3VG9C 2E9BA 1LLAA 5AD0B 1ZEAL 3T0WA 3TPUA 5GS2H 1JUFA 4OLZH 2BO0A 1H3PL 1AXIB 2ZTBA 4GO8A 3LKSA 3UZVB 4FQ1L 1GW0A 1SY6L 4YMPA 4FMVA 1IAOA 3O2WH 5ACMA 2BXYA 3U2SA 5LDUA 3KBEA 4YEFA 1IKNC 1HYSD 5D1XC 4E5XA 2BW4A 3O9WC 2OKMA 1TSRA 2IPUK 1CDJA 1CD1A 2ICEC 3SDAC 2PPAA 2YKLH 4HBCL 4HJSA 1OE3A 4ZQKA 3RWGA 2WSPA 1CR9L 1AYRA 3WXVH 3ESPA 1NCWH 4FA8A 4LHUA 5FM8A 3MGOB 3UYPA 1SN2A 1XV8A 2J2ZB 4UINL 2JV6A 4LK4A 5I5JA 4MNGE 4Y1AE 5JW4Q 2UYLA 3V5KB 4PJ9B 3E0GA 5F8RC 1CE6B 2B4CC 2GSGB 5LGKA 1TQBB 4EI5B 4XO3A 1BIHA 2W60B 1QYGL 2Z4QB 4BJLA 4TLKA 2Y5TA 3HW7A 4YHOL 2A6KB 5D6CA 1G7PA 1EAOA 1D5IL 3GB7A 3V5HA 3K7UA 3SE9H 2DEXX 2R4SL 4ISVA 1UUNA 1QABA 3LH8A 1UB5A 3OJDB 5E8NA 4PJ8D 3N85H 5SWZB 1Q0EA 4PPTA 4U1LB 3O4OC 1FLTX 4HCFA 2VXVL 1R5WB 4LARL 4LEOA 3WIHH 4FAAB 2X9XA 2NNAB 3LN5A 1HVXA 4BK5A 2OL3B 1IC5H 2YSTA 2ZF8A 4C4KO 4GKOA 3TF7C 3JZ7A 1BGXL 3T4YA 1HH9B 1NGYB 1U0QA 4NBZB 2GBVA 4PW3A 5TE7L 1MCNA 1A9EB 2APFA 1GS8A 4DQOH 1HKFA 1L5GA 4WV1B 3TYFA 1HCFX 5LNDA 4OB5L 5IROA 1OGAB 2OXHB 4G7VH 3TBVA 2EDBA 4K5LA 1PZ5B 3DHPA 4MSWA 2WLNA 2Z34A 4NS0A 5CLWA 1U2HA 4DPRA 4JEGB 3DX7A 3OKEB 2VC2L 2G2PA 1DQJB 2OTWB 2ZXWB 3CHRA 3QUYA 2W9LA 2FO1A 1BZEA 4EOWL 5G2NA 2JKSA 2K9FB 3N3EA 1KLGA 4LP4A 4M4RA 3B4NA 4POYA 2F2HA 4K0OA 1ZHKA 4N9GA 5EBWB 2VDKB 3W11D 4UDTA 2KPWA 2QVFB 3TESA 4I9WD 1GKEA 4EN2A 1TTGA 3FCBA 4HPOL 1IBDA 4PREB 3QS2A 4IBUA 3VI3F 3LQZA 1T89C 1P7BA 3ZKND 3FN0H 2DYPD 3QG6B 3EFFA 4NNXA 1YNLH 2APTA 2MQGA 3H7BA 1RPQA 3Q01A 5IQNA 1KEGH 5HDQH 2FJUB 2Q6WB 4OGXL 3QQ4B 1U3HB 4JDTH 5I6NA 5D7IE 5GGSY 3VXPA 2E75C 4FNQA 1R19A 3S3PA 3HAEA 1UGKA 5CGYC 1HOEA 2L7JA 5DS2A 3VI4A 2CGZA 2F15A 4XNXH 3VQ1C 1F6LL 4O02L 4UBDC 3CIQA 3RUGA 4EI0A 1S9YB 3L3HA 5IVXA 1WZMA 2CRIA 4C58B 1JYXA 2DWSA 4M1DL 4D2NA 5G5DA 2D2OA 4WWKB 2CGRL 5E9DB 3ZO0A 5E6ZA 5HHOE 5HPMB 4P2OB 1C5CH 5F0MB 3CHSA 4Y89A 1CICA 1F4HA 2DWYA 2X4TB 4IDLA 4ZZFA 4Y9BA 4H13C 5HI4D 4AT6B 4M9PA 4R90H 4HGWB 5MHSE 4NYLA 4EJ1C 3DO4A 3KEHA 3BISA 3CFDB 4DFIA 4HG4K 3DPDA 4G11A 4O02A 3T1FB 1BJMA 1U91B 5BRPA 3U6RB 4Y88A 4AXWA 1MHHB 3GXIA 5IMMB 5JOPD 4QPEA 1F86A 2WZ0A 3HG1A 1GSKA 2M26A 4M6ML 1XX9C 4LVNC 3P11L 3A67L 3GRGA 2XJLA 4G1MA 3Q1SH 1JZFA 1UB6A 3HMWH 3X1BA 4R7DB 1PLBA 3ESVF 4J3SA 4P46A 5JHDB 3ESNA 4W93A 4OZFA 4ZX4A 1D7DA 2V6HA 4PWJA 1QD0A 1IC7H 1WBYA 4S0HA 2DDQH 1CN4A 3J2PA 1FFNA 3FU8A 1URIA 4XBGA 5CBEA 4DO5A 1JV2B 5CZXD 5CD5D 3DX8B 4Q6IC 3SGDI 3BDBA 1KEML 3VFGH 4M43H 3DYPA 1NCNA 4WEUD 3O3AA 1P5VA 2MWCA 4QXTB 5T1KB 1EJOL 4NQCA 1MG2C 4G71B 3SZ6A 5IQ9A 4NUGL 4DEUA 4PJ9C 4S0SD 4QHNA 4ZW6A 2IDCA 4ZTPL 4WSGA 5C0GB 2E6QA 4X7DC 1GMIA 1RZFH 2O4EA 2BW5A 4AKQA 4YN3A 1BJ8A 2L4OA 2BP0B 4KRPB 2ZKHH 2O30A 1VGEL 1OZTG 1U3ZA 5CUSL 1B90A 1X5LA 2BVQA 4M6OL 3EKCA 1QATA 3RVXC 1Z9SB 1I7RA 3CX5J 1A0QL 4HWEH 4Y9GA 3HRZA 4JFDA 2XTLA 3A6CH 3UCRA 3TO2B 3II1A 1UUSA 5LVEA 3VW3L 4LASL 3ARGD 4MS6A 1VFBB 5TE7H 4M7ZB 1YJDH 4MVBD 4PRHB 4FG0A 1QRKA 3T6QC 2XWBB 3AS2A 2X88A 5C0DB 5JW5B 3LEXB 4HUNB 2J8OA 4M61A 5HYSG 2ZX5A 3K6SA 1RZ8B 1M9SA 3I3BA 5F7DA 1S5HA 2JKIS 3ZZSA 4HLJA 1WFIA 2VSMB 5JXAL 1CT8A 3OLEA 5I2IA 1HYRC 5GRVK 1BZQK 4LARH 4Q9CA 4F80A 1P2CA 4ZOAA 3PWNB 3QB7C 2IG2H 3ORJA 4X6CF 4ZX5A 3ZSTA 4QKTA 5E00B 3KGSA 4I1PA 4MNQB 3MZGB 1RUKL 2BSBA 1QFWM 1EZVX 3NJNA 1KIQB 5KVDE 3H54A 4HHGA 2YLHA 3FHEA 4LNRA 4LRIA 3EG9B 3TIEA 1XH3B 2B7DT 2XACC 4MMZB 5KJ7E 4LSTL 1CDCA 5JOFA 1BD2E 2CNZA 4M00A 5CJXC 3HUJB 2QFRA 2V3EA 3MRQB 5L2KA 2JB5L 1NCDL 4KJQD 4OR1A 1A6VL 3BVDB 4YK4C 1HAUA 1HE8A 1AD0B 1T3FA 2I07A 4HHAA 3U83A 1PDKB 5TH2B 4WWOA 2GJ6A 3FQRB 3DO7B 3QO1B 5AWNH 4UINH 4YBQC 4ZFZB 2VLRD 5HHME 5L8JB 3VRJB 2G30A 2CA3A 4J8RB 3L95A 4XOBA 1G7LA 3WXVL 1Z9NA 4PGEA 4GRLB 3JTSA 3U7YL 2E27H 3UPRB 3IDUA 1IAIH 1CDYA 4PS7A 1Z9MA 2OYPA 3WDIA 5EH1A 3KWVA 1Z9PA 4A6YH 2C1OB 5DMKA 1ES0B 1E9QB 4Q58C 3AWGA 2WSKA 2C4FU 1QEXA 3DRTA 3T65B 4HFUL 4JCWA 4JZJA 2BFGA 3C8KB 2NY3D 4Y2DD 4LSDA 2ZUUA 3HC3L 3ZR6A 4N4YB 4CILA 3V52H 2AAAA 4MA3A 5KS9F 2J71A 5C3IA 5IMLB 3VXUA 4AQOA 4F93B 4N86A 3QULB 5EOTB 5B1AB 4YL9A 3FTVA 4RFNB 2NY5H 4XB3A 3D0LA 4PCTA 1UFGA 2FIRT 1OAYH 5L4IA 2YC1A 3ECBB 3M1BB 4I18A 3U25A 1R3LB 4P2QA 2VM3A 5C0RH 1FYTD 4QMEA 5JXAH 4KK8D 2YA2A 4N6RB 4FYRA 3T4AC 5KVDH 2Y5TB 1DYZA 2A6KA 4NDMB 1AD9A 4BQ6A 4KUZL 2OMXA 5BJTA 1WAEA 3DGCR 3L1GA 5HHOA 2EAEA 2HYMA 5LQBH 2AJXH 3ZZ1A 1EX0A 4G7RB 2ZWYA 2EDNA 5C08B 2BJMH 3DWTA 2RB8A 1B2WH 1TVDA 2X3AA 4Z78A 5ADPL 4B9ZA 1ZHNA 5A6MA 1F8TH 4M6OH 5DZJA 1OV8A 3C5JB 4YHLL 3IT8D 3MV11 3QNYB 5JR1L 4Y5YB 1IZKA 4AYDC 3ARQA 4NP4L 4AIXA 4L0YA 3SKUD 3JV6B 2CM5A 3VFUB 5EDSA 3GSOB 3PWLA 5DZLA 2BRQA 2UZXA 3OLGA 2OJEA 5DJ0B 1EJOH 5FKAB 4BUQA 1XH1A 4LBEA 4ZMYA 1VKXA 3TVMA 2B3RA 4J3VA 4O2CB 3QDJB 1AHWC 2ERJB 4G59C 1MLBA 4P2OD 4YQXH 4P23C 3US0A 4AIEA 4AEHL 2WXHA 3BIBX 1YQ2A 4J2QA 3ARFB 1ZD6A 3QDMB 4Y5YC 4HWNA 5B1JA 2OMVA 3OMNB 2BDNH 1DQVA 1NDGB 1H5BC 1Z5HA 4K7FA 3ZQXA 43C9A 4DKEH 5DEFA 3SHSA 4E9TA 1ND0A 2MCPH 2VDOB 2YGOA 3P1VA 4KY1H 3GSNA 4HJIA 4JO1L 5DHXB 1T20B 3BWSA 4QEGA 3QDGE 2QKIA 4XAKD 2XRAH 4K73A 4Z7UA 5IHWA 1P7KA 2WTRB 2HPOA 3C6LB 2ROXA 1DO5A 3LQZB 1D2OA 2JJWA 5CU9A 5ESQB 1ZTMA 3UC0H 2VMDA 3P11H 3QZBA 4AZ8A 3UYRH 2NYYD 3EGDA 2P48B 4PGDB 3IDIB 1A3LL 2YD0A 2CUIA 2HUHA 5T5NG 1J87A 3IJSA 3DUUB 2VDLL 1OT2A 3DSFH 5EEVA 3ZHKA 3OAYK 2Z35B 2DQMA 2DTMH 3DIDA 4F7PB 4BFJA 1KXTB 3Q2LA 2Q7YA 3VXSB 5BW7A 5KYWB 1G7JA 1RD6A 2Y7QB 3NJFA 1Q1JH 5EO1A 3EBGA 1WA2X 3MAWA 2GJJA 4GQPH 4IIZA 4WKXA 3T2NL 5HPMA 2VRQA 3OKNA 5IQ7L 4FFVD 4XMWA 3QQXA 4O2EB 2JKLA 2X4TA 3QCUL 4EKJA 3ARUA 3HHMA 1XF5A 4Q8BA 5CJQH 2ZZUT 1EZSA 5FB8B 2WXOA 5SWZD 3MRLA 5E8PB 4Q9QL 5FFOA 3T2NH 1NOLA 5JQHC 4RZCB 5L2JA 5AAPA 3CLWA 4ZDHA 1QA9A 1TJMA 3RX9A 2FHCA 1BYPA 1UTDA 3A23A 1MREH 1C08B 1JK9A 1Y6MR 4L8BB 3CFTA 3VWJC 1J8KA 4G80A 1WFJA 2VDNH 4JHWL 5D7IF 4AQ8A 5C09D 4NT6B 5HDQL 4GRMA 4HEMA 4NCC1 3WFZA 5EUOB 5KZCB 5IR1B 3RVWC 1T04A 5BUGA 3L1EA 1SXAA 4HCRA 1JAEA 3VWJD 2AV1A 3BQUC 2UX6A 1WS7A 3MPCA 4IRSB 3DYOA 4XP4L 5FX3A 1E5YA 1AACA 4P23A 1E50A 2E86A 1E9OB 1CXKA 1FN4B 1K8IA 3FRPB 5D7JD 5A7BA 1JMZA 2DWDB 4MHHI 3DX8A 4L4TB 3S35H 2OTUA 3U0PB 1BG1A 4PRHE 1AXSB 4XN5A 2HFFB 1CGXA 1KJVA 3NUKA 2WVVB 4RMUA 1CLCA 3BWUF 3TA3D 1KJ2L 2R56H 2WWMD 1W72B 2Y7LA 2WQUA 4OQTL 4YQXL 1V10A 4PJFE 3HPLB 2IPTH 4FE9A 3ROLB 1FIGH 4Q6IA 5JNYA 1S8DA 1EEUA 4DKDC 3LKRB 3D30A 2C9SA 4M9OA 4X7TA 3DIFB 5JA9A 3SOBL 4F1ZA 1Z3GL 2GBTA 5GGSB 3SYPA 1A1NB 1NL0L 4OQTH 1HI6A 1ZOXA 1LD9B 1MXDA 4RGMC 3SY0A 5M95B 4PJXB 1T80A 2VITB 5CR1A 2WJ5A 2E7LC 2ZNXA 1HXYA 4NQTA 3WE6A 4ILDA 4FFZA 3VB8A 2CRZA 2SEBB 3CFKB 1WFOA 4NZJA 2Z6FA 3O6FC 1CTNA 1ZJBA 1QASA 4WSJA 3QZWA 5IBLD 3GMPA 3BQUD 4JZNB 4JFDE 3S98A 1QUNB 4M8VA 4N0YH 3QCVL 2JCCB 1HIML 4PGZA 5C0DA 2WXIA 1Y07A 3V6OE 4PB9H 3G9AB 3MJ8B 3NRQA 3RTQB 3WEMA 5BRZE 3OKKB 1UA7A 1AY1L 3WY2A 2CHNA 4P2QE 4IIQA 3CDFA 4WF7A 2F6AA 4XPGL 3FN9A 2XBTA 4G6AD 5FGCE 3BWAA 2GI7A 2DMBA 3O3EA 1GTFA 3MLUH 2CIIA 2BHUA 4ABVA 3KBFA 5I6XB 5DRWB 2VDMH 2CPUA 1MVYA 5DQJB 3M6DA 5CCKH 2R2BA 4H26A 3V4PL 1LWHA 2VXQH 3EG9A 3O3DA 3NABH 5EO0A 5C0EA 2NY5L 3W39B 5JOFB 2YKLL 5IESL 3MRQA 2LLGA 3HS0C 5L2KB 1CF1A 1X4ZA 2EVHA 3QQ3B 5JLZA 2XXCB 3K46A 2W07A 3AREB 5JHDE 3ZGIA 3DXAD 5IB2A 1AKJD 2HJFB 3O2WL 4LKCB 3GBEA 2P5EE 3WMPA 4K5PA 2ZX9A 1Z9LA 1LHZA 2HT4C 4WUUB 5IJCC 3UIZA 5C0AE 4F58H 5B4MC 2GPZA 2J8UE 3KPTA 3SE4A 4J3OC 4I0CC 2GFBA 3CHPA 4DP6X 3JQOB 5EDXA 2BSED 3B6SB 2XVBA 1KLUB 3IRPX 1Q1JL 4U1MA 4ZO8A 3T3PF 4GP4B 2DBLH 3HI6H 2XG5A 4QHLA 5JQ6H 5A43C 1BV8A 3U46A 1KXQA 1Y0LA 4PVNA 3S5LG 4F9PA 1DUZA 5CCHE 4JRXD 1XWVA 1MAKA 2OJZH 1ZHLB 4OZGA 3I2CL 1PCXA 1VAHA 3GJFB 1EEYA 2ZYIA 3EXJA 1U8IB 3D2UD 4JGMA 3DHMA 3CZKA 5F9DC 3AB0B 4M1GL 5GSVB 4HUCA 5CU5A 3DGDA 4FQJL 2TSAA 1XB6A 3RVTD 3SODB 4BDVB 1U8NA 3RA7H 1JGEA 3QR2A 4N3UA 4NWTL 2ZPKH 4JVPA 3WO4B 5JA8B 1JGLH 3UC0L 4HHWA 4YFLF 1CUOA 4KVCH 1AIZA 4LP5A 3EO9H 1WT5A 2EXYD 1JVLA 3QHTC 3QUYC 4PRBA 4TQ8A 3P4OA 4ORZC 4HUKB 5DHVB 4XMXA 1I1AC 3EO0B 5I1DB 2FT8A 1E5BA 1N0XL 2JKJA 3HE6A 4H0GA 3RTLA 5J1AB 1JGDA 2YKKA 4P4KC 5I73B 4UV7L 5DZAA 2P8PB 1PPIA 4YHKL 2DQDH 4LEXL 2NY4D 4CN6A 1HHGA 4J3XA 3ECBA 4JFFE 5GGVY 1ZXKA 3SJVB 2R7EB 4NNYA 4PTUA 2W38A 2WTPA 1RUKH 4AYGA 5JIPA 1DVFD 3BGAA 1WE5A 3UTZA 1QLRB 4HWZB 5FYLD 1PKQA 3LSOB 2YXMA 2XWDA 4HC1A 2QKIC 4PRPB 5AVTB 3SE3A 4PW9A 3KZ8A 5EF2A 1UG9A 4DN4L 1NIDA 3EJUA 4MMXA 4XVOA 5HHOB 2DM3A 4OTXL 1G7MB 1U58A 3ELQA 4GKSA 5E94A 3MRBA 1DQKA 4GIOA 4BFRA 5E4OA 2EIDA 5C08A 3UL4A 3P2BA 1NEZA 5EIVA 1KV3A 3EHBD 2ZXGA 5TDPA 3IVKA 3QORB 3TVMC 2D31A 3G5VA 1BX2A 3MQIA 1F8TL 2NY5C 4XCYB 4WDIA 4JO5A 3VM7A 3NIGE 4F3FA 3FT2A 1KIPB 3X17A 5ADPH 5EZPA 3GMQA 4UT9A 1FGVH 1FGVL 4JPVH 2FSDA 3TJHD 3CLEH 1V7NH 1I7UB 3DPBA 5LQBL 3PWPD 4Y4HB 1TMCB 2Y06H 4HLEA 4GB9A 3KNBB 5JIQA 3V4VL 3KCPA 4KUZH 5FKAA 3EXLA 4N8VG 4X7SH 2AXJA 3RVVD 3N41F 4M29A 1GGUA 1NC4B 1UZ8B 4W68A 1KYAA 2JKRM 2VDKH 1F90L 3QG7H 5F1NA 3VMPA 4RAUA 1QTYT 3AY4A 5KTEL 4OI7A 2XVLA 5FC9A 3SDAA 4XN9A 4JHVA 4PRNB 5FDYA 2X53A 1KFAH 3CFBB 2ICWA 4OAWA 4XPHH 1HINL 3GSNB 4P5TA 1RAMA 2CLRA 3GSQB 4N2AA 3II2A 4NM4L 4Z3IA 4HKJB 3RFZA 3GSRA 4OM1L 5DLML 4U6HB 3SCMA 1D7BA 1REIA 1NUGA 1R24A 3SDDA 4QY8B 4QCIA 4U6VH 1KCSL 2NY3B 4Y2DB 3UBXB 1WTGT 1DLFL 4I18C 2G0LA 2RR3A 3EGDB 5I30L 4M93C 3DTUB 3MA7A 1MZZA 4YAQA 3VD4A 5ALBL 3IJSB 1JGLL 1I1RA 5E03A 1J8SA 2FL5A 5BW7C 5DSCA 4CC4C 1P69B 2CHZA 2L3BA 2NTFB 3QI9B 5ELIA 5DZPA 4Y19A 3EHBB 4F7MB 1L9NA 3SPIA 4PYHA 4OJEH 3JTTB 3W0WE 5J13C 1JZIA 2AABL 2W0LA 3F7RA 4R5XA 4TNFA 3NIFE 5I0YA 2JJTA 3FO1A 4MAUH 4HSAC 2PWFA 2C9AA 1PYWB 3DTXA 2R1WA 3HC4H 4HMEA 1JPFB 1PZ2A 2F53E 3BVXA 4GBXA 5FF6B 2XY1A 1EEZA 3U9WA 4Y16D 2ZG1A 1QTSA 2G0KA 4Y7MA 1KENL 4AYFB 1H3WM 2FGZA 1TO4A 4YDIL 4ZXBD 3HC0A 3ZPDA 2Y5QA 2E74C 2HMID 4UQBA 3SPGA 4LLDA 5EZJA 4AGNA 2VN6A 1A14H 1L4IA 2Y07H 1FQ9C 1WIOA 4GI6A 2PW1B 4Y9FA 4EZLA 1IKOP 5FO2A 4G80B 5C0FB 3QE5A 5CINL 5I15L 1FNAA 2I60H 3KHQA 3MKKA 3Q3GA 1LDPH 4GRMB 3TL5A 4FABL 3MGAA 1DBKH 2BS71 4TOYL 4UANA 3ZE0B 2ZWZA 3CZFB 2VXQL 3L3JB 3WUWG 3CFUA 4AEIL 3CSGA 1DL7L 3GK8L 3QIWC 2VDPL 4TNWF 4U49A 4HEME 2VDML 4QWWC 5B8CC 4NFBA 3TM6A 5AW1B 1YLBB 5D4QA 4GAYA 1GYWA 3CQPA 1II4E 4GNKB 1U95B 4GOSA 4U1SB 4P5RA 4NN5C 1MI5A 1PD0A 3FRPA 5ECGA 2MRYA 3GLDA 1AQDB 3BAKA 3DXAE 3C5ZB 4FNUA 1U8CA 4AUYA 1G84A 3FTUA 1BVLB 2J7LA 1N2RA 4UIMB 3PNRB 5HGGS 4R26L 5JUEL 3WFHB 2Y1AA 5D71H 1NANH 5CUSH 3CN3A 3A6OA 5DD3L 4ZOEA 1BLNB 1DVXA 3F5WB 1KCWA 1Y7VA 2LLLA 2QPSA 3LKRA 1N6QL 1P1VA 5ICUA 3QJVB 5JUEH 3WKPA 4YBLC 1M7IA 1CCZA 1XFPA 3SQOL 1A1NA 1P5UC 3VFVA 3GNMH 2BZCA 4HSQA 3EFDL 4EF3A 5CP7A 1EDYA 5E70A 1FIGL 2WM0A 3LKOA 1FVCA 2DZEA 2VT0A 5GGUA 3ASNB 4G6MH 4KK5D 1BGXH 3Q6FB 3VFGL 4BFNA 4BHUI 3EDEA 5IHZA 3IDGB 3QRBA 4ZW3A 3IGLA 3G7TA 4HS8H 5I6KA 43CAB 1JN6A 1MIEL 1Q72H 4LCCA 1DFBL 4ANWA 3RTQA 3WKYA 4PJGE 3S2AA 4OVVA 1L3WA 5T3XH 1DBKL 1LK2B 3IE9A 4G7SB 1ZSHA 4LLWA 4JZJC 5GZOA 2ALAA 1DTUA 1EAPB 1OALA 5LG1A 3DOSA 4XO8A 1FORL 3RWCB 3Q1SL 2OX5A 1RFDL 2XX0A 2FX9H 1AGCA 1A14L 3C60B 4OI8A 2HRGA 2QHRL 1SJEA 5J12C 1ZS2A 5F71A 4CVZA 1PLAA 1KPRB 1DJIA 5GXBB 4MNGB 4J6RL 3T77B 3NAAH 4G3YL 5MP6L 1EUUA 1INQA 4OLWH 3ZE2F 1KIRB 1S7VB 2ENQA 4DPCX 5ICZA 1BQLH 5GGVL 1BFOB 1BP3B 3TBTA 2P5WD 1K9TA 3D8MA 2DAVA 3FFCE 4S1RL 1ZCRA 1TSHA 3FRUB 4XTRC 4ZPVB 4GO9A 1ROCA 3MSPA 4KTGA 1SY6H 4O9HH 4U1MB 4CW1A 2GCYA 2CDFA 2NT1A 4YXHL 4HQQL 4KFZC 4GW1A 2QTVA 4OLZL 1KB5H 1JPSH 4O02H 1AS8A 1NCJA 1PQZA 1M7DB 5H2BB 3CQQA 1EEYB 3BXNA 4JO2L 2PETA 4QRTB 3BP4A 3AS3A 3C5SA 5BCAA 4C83B 2MKLC 4XGZA 3D9AL 2A9CA 2KL6A 2OTPA 4POZD 4K8RH 4Z7VF 5DD0L 3V6ZA 1OCZB 4NZUL 2CPCA 4KXZI 3G6DL 3ATEA 2QKSA 2VGLM 1PX8A 1UADC 4ZMOA 2WYIA 1ZWIB 3FL7A 4HK3J 1OO2A 2IV8A 4V1DE 3R0MA 3BDYH 3IS1X 4YDVB 5EG6C 2QSVA 2WUCH 1MJ7L 3CN2A 1TJHL 4LSPL 4WNSA 5F1KC 1F3RB 4XNUH 1FL6B 1HHJA 1FZJB 4R7VA 3RLSA 3UH8A 3OLIA 2AQ1A 2WZ6A 4FA6A 3LZFH 3QQ4A 5A2BA 2J72A 2XC8A 3N5AA 5JPNC 4JO1H 3TO4D 2PP9A 3WS3B 5E4IA 1ZA3A 2CD0A 3QJSB 4KTEL 2ZOLA 1P4IL 4HWZA 3QQDA 4N2GA 3RVVC 3RWEA 2YZ8A 2OA9A 3O45A 3VG0H 5B38B 5H4YA 3ALXA 1Z0MA 4KMTH 1ODUA 3QJRB 1CFNA 3HS0B 5DT1H 3VNYA 3AXLB 4FJ6A 5DQDH 4YDLC 3BKJH 4RMSA 4I3SL 5HHQB 3WTYA 1XGYL 1RUAL 4Y8DC 1U92B 1I1YA 1KNOA 5D2NC 1ZT1A 2J6EH 4JB9H 5BS0B 5EIIG 3LV3A 3HBZA 1BVKA 1TXKA 4YC2B 3RJDA 3FUHA 3BSHA 4JAMB 2LTQB 4EIBA 2R1YA 3Q05A 4LCUB 4YGVB 1X9RA 1FFTB 1I9RH 1SUJA 3PGDA 4UM9D 2MSPA 1G6RH 4L0ZA 2DPKA 4FDWA 1WYJA 4WNJA 1D5BA 1RI8A 4DN4H 3UJIL 2EXWD 2FAUA 1I7UA 1VZGA 3JWNH 5DJZB 4HUXA 3BVNA 4N1CA 4TUJA 2VRAA 2PTTB 4A2MA 1A6WL 5CKAA 2BJML 2E9GA 3ILDA 4TNWK 3ULUF 5FYJU 5CHNB 2VLMD 3FSWA 4PMFA 2GT9A 3UTTB 3VXSD 1TQWA 1ZT4A 1QVOB 3IJ9A 4N2CA 1LNUA 4Z18A 2NSMA 3DI2B 3IAPA 2E56A 3QAZB 5LKNA 3N9GL 5T3ZL 4GAFB 3RGVC 3E8UL 4WTQA 1XH0A 1B0GB 2YJLA 3OR6B 4KO9A 1OF2A 2WZPA 1Q90A 1HCYA 1MI5D 1LEKB 4IHOB 4XN4A 1OAYL 3CVCA 2HTLC 4IGBB 3WDJA 4YBHA 5LGHH 2GAZA 1CR9H 4QCIB 2P5ED 4LESA 3VGEA 4JN1H 1RIUL 1URLA 3UBXA 3SKMB 4DF9A 4NKOB 5CEXA 2OMWA 3CXDL 2YD4A 3ZTJG 4EZMA 4JNXA 2J73A 2C3GA 2CCLA 2IPUG 3NESA 4QXUH 4DUXA 4MDJB 1BMGA 4QHNB 2LFGA 3L5WB 5TFSL 2GY7B 1G4RA 3EIFA 2JK5B 1U8QB 2DQTH 2BIPA 3GMOB 2CHDA 3CHXA 4PI0A 3JTTA 3L3KA 3QRLA 3AT0A 3NG5A 4PLJD 3TO4B 1P7HL 4X7EC 1GZQA 4P48A 3QNFA 2FBRA 2YGVA 1ZLEA 5DLLA 4FP8L 1SEBA 5LGYA 4ZNEE 4GSQA 4JFHD 5DK2B 4F1SA 1GYVA 5H94A 2NY7H 1NINA 3D69A 4QOKA 5TQ2L 2CJSA 2Y6SC 3FB6B 4CJ0A 3LN4B 2YBRB 2ARJB 3PIQB 2IFFL 4MCNA 2N56A 2Q7AA 4OLWL 1PW3A 2V17H 3SGJC 2C1PB 3UZQB 1GIGH 3FYIB 2HRPL 4G43B 3WLBB 3H3PL 1JI1A 4LAQH 4AM0B 3E6HB 2X1QA 5TK2A 4JPWL 4YX2H 3LH2H 3K80A 4MQXD 4XPGH 1RFDH 4X6DF 4D0BB 3FQUA 5FPIA 4KQ0A 3POHA 4P59H 3IETB 1NM9A 2WN2A 4JM2D 1BXVA 4R6UA 5AZ2H 1KGJA 1PZSA 2RA1A 1RIVH 2FECL 4DTGL 1RJLA 2F54D 4PJDF 3DV4B 3LZNA 4BFFA 2IG2L 4MB4A 4KPHH 4X9BA 3K2UL 4MBOA 4LOEA 4M5YH 1PDKA 3O6MH 4OCYH 3U7WL 1INDH 1AQDA 1CXHA 2FYYB 3P30L 3UG4A 3WSQH 3VRJA 3QFJD 1JNHB 1MI5E 3IBEA 3QWRA 1OAXH 2IADB 3I75B 4JR9L 2H6OA 5IVZA 1VGKA 2YSSB 3V4VB 4FFZL 5FM4A 4HPHA 4FEMA 5E9DD 2PW2B 5I26A 2HVKB 4LASH 4HIIB 5EU6D 2Z93B 2R23A 4YHMH 3VXTB 1SY6A 1QFWH 5HVWA 2NYZA 4Y1AB 2J5LC 2IDFA 3KPRB 3ZIYA 1WT5C 1LDSA 4K8RC 2R1XA 3NJJA 4TLTA 1MJ8H 5KYUB 3QO0B 2ZAGA 1UJ3C 2IPKA 3WIIL 4ODUA 3L4WA 4N24A 1VFAA 5CP7B 3ZKQD 3BUPA 4PLJC 2OK0H 3LKOB 4FTVE 2CRMA 1WVZA 3D39E 5EB9A 2GBUA 4Q89A 4YC2C 1U8MB 3CTTA 3B9VA 4BM7A 4AIZB 5SWZE 4K3DH 3BKMH 4BH7A 3QZOA 4EN3A 1UJ3B 4LHUD 5IROC 4KKBC 2KLTA 4NI3A 4ODSL 3VXUB 2ZAHA 3NFNB 4JFYB 4J3UA 2JLPA 2ZKXA 4L2LA 2XLLA 2X4SB 4WFFE 1S7SB 2HT2D 1GL4B 3L7EB 4LGSB 4LVEA 4YSPA 3U48A 1AIFA 1YNTA 3IK2A 4OD3H 5GZOD 3SDDD 1U8KB 2DDQL 3PAUA 3HCVB 2VDOH 5B22A 1ZSDB 4DO4A 1LMKA 3MCLL 3EJZD 1RERA 4J28A 1U8HA 3NDYE 1F00I 5DD5L 5DR5L 3WUWB 2OP4H 4ZUTA 3NH7L 3X1FA 5I5IA 3FO2A 1H3XA 3HMWL 3TLRA 4MNGA 3EF7A 2XN9B 1BQSA 2NZ1A 4QTIH 5FFGA 2XTJC 3C5ZC 3CVDA 3HE6D 1QSFD 3WHXB 1XIWB 5BZDA 1JWSA 4NOFA 5EEWA 1RZGB 1MNUH 4Z78B 1AHWA 5ANMB 1D5XB 1RIHH 2YAMA 2DW5A 1HEHC 2DIJA 2W9DL 2IAMC 5KSUB 1E27B 2MNJB 3DV6B 3C5JA 4OUUA 3ZRFC 2QMJA 3S37X 4CADB 1RV6X 4R90L 1JZJA 4BYHA 2QADC 3EJYC 4IK7A 2GCYB 2V5MA 3F05A 2GJRA 2WKOA 5E1QA 1NBYA 2A99A 2DQHL 2X09A 3L4XA 5BRQA 1VZHA 2PYED 3B83A 4HJEA 3KGRA 4LBEB 4M1DH 5AW2B 1ZE3H 3QWNA 3GHBL 5IJDC 4PJBF 1I3RA 3NCJL 4MA7L 3ZL4L 3KPMA 4CMHB 5F1IA 1MLBB 5D1ZI 4QRTA 3HG1D 5EHFA 2DWTA 4K7FB 2FQEA 4XI5C 3W9DA 3O2DA 4GKZA 1BREA 5IB1A 3MCLH 2IVFC 1HSBA 1ZWIA 1OP4A 2LHAA 3PE9A 1XR8A 3G5XB 4MD5A 4XCEB 1KCLA 3CVIH 2I32A 2XV3A 2AZAA 4OD3L 4FFTA 4WHYH 2R0ZL 1GJIA 2R15A 3F7LA 3L9EA 2J12B 4MNHB 3OAUL 2WD0A 1KFAL 2JCWA 3MLVH 5FV1L 2VW4A 3BKML 3P4MB 2V5TA 3WL9B 3MV9A 3OKDA 4PJBE 3PP3K 5TF1H 4B96A 5MEQB 1ZT7A 2P8MB 4Q2ZA 5K9OA 1T66C 3WN6A 4DOHE 2Q7YB 1MG3C 1X5HA 1LXMA 4HOZA 5CM1A 4O2FA 4HXBH 3DBSA 3ERXA 4PJIB 5ACLA 5F9WC 1V7NL 2UWEA 3CMGA 1BVKB 5GRUL 3Q2VA 2H5UA 4IRZA 1WBXB 3K5SA 5AB9A 2YPLE 4UU9A 4FG6C 4F2MB 4WY7L 2HLEB 2UZYA 2ZX7A 1HEZB 4G9DA 5FGBA 3MO1B 5HI4C 5IB4A 5E4EC 1J11A 1USZA 1PLGH 4OCSL 4UM8A 4BQBA 3R8BB 4LF3A 1FNFA 1N9PA 3KL0A 4YDZA 1C8QA 1YG9A 2DV6A 1NDMA 2IQAA 3TPUB 3WIHL 5A40E 1KELH 1SVZA 3ARZA 1LO3H 4L8CB 4JRFA 2UXTA 3AQZA 4AW7A 3ES6B 2OQJA 4FFYL 5IEKB 1NKOA 3THMH 3KL3A 4Z3FA 3Q8CA 2ETWA 3UAAA 3UTSB 4KMQA 4YHOH 4A37A 3CJJA 3SGKC 4YHKH 5C2BH 1C5BL 4OI9A 3QORC 3IS0X 4WGVB 4WFGE 2HFGL 3ZT7A 2WNWA 2Y36L 1L9RA 4LAQL 4LQFH 1A7PL 3BUDA 2BP5M 3ULVD 1TEGA 2CDEA 5I76B 3MV9D 4F7EB 3K1DA 4W6XB 1FCCA 2O6DA 1N68A 4JL2A 3WIHA 4NO3B 3O3UN 5B7FA 4GMTL 2A6DB 3FHQA 4X5LA 1CLOH 5A6IA 2I9LA 4MB3A 5DJDB 1ADQH 3O9WB 1T1XB 1D5ZB 5EOCL 5I74B 3DVGA 1FAIL 4NO0D 1P7QD 1RZJL 4L1DA 1CLOL 2NX5D 3I2CH 4Q7DA 3RBGA 2F7QA 4KK5C 4WO4A 4AC2A 1FO0B 5C0BB 2V2WA 1IILE 4KXCA 4MAYC 3FU3A 1IM9B 4GAGH 4JL1A 1E8YA 3C2SA 1I1AB 2EDRA 2ZIDA 2EEXA 3HZ3A 2NZ9C 2JB5H 4F58L 1N12A 2WV3A 1JWMA 3K2MC 4RA0C 4PJ7A 5CIPA 2AXWA 3D69B 4ALAH 2BC4B 4QXUL 1LP9B 1U8JA 2XETA 3RNQA 5TK4A 3A3YB 3MGOA 4GJTB 2NY2C 4PY7A 3UYPB 4KO7A 1F0LA 3EBHA 1GTNA 3G08B 2X2JA 4Q0XH 3ULVC 5LGHL 4JY5H 1GJWA 1LQBC 4W9GC 2GJZA 3KW7A 5T1MB 3UTSD 4AGLA 3H2QA 1LO3L 2DQJH 3E6HA 4M5SA 4MJIB 5HVHC 2ZAIA 3IMVA 5C0BD 2V8LA 2KPNA 3ALWA 3QBTB 4EUPB 1XF2B 1ZGLB 1UOLA 3FQXA 4OY9A 2XV2A 4MDIA 3MLUL 3P3YA 3ZDXB 2BHFA 4ZOBA 1WDAA 3O3DB 4DZ8A 3FCSA 5C0EB 2FUTA 5C0BE 5ABZA 4JLRB 2NXYB 2XQYG 3ARGC 2AQ3A 1G7IB 1YHPA 2V5YA 3CK0L 3QC5X 1KPUA 3X12B 4RRPM 4N2HA 3LN5B 2YK1L 3CZJA 3ZBMA 5CFAA 4F2FA 2XKNA 1CYGA 2FYYA 4BRVA 1JUFB 2H6UA 2OLDA 5DMIH 4X99B 4EZJA 3UJIH 2NXYC 5FOBA 2B15A 4F37K 1KYOJ 2AEQH 3VU1A 2OCFD 1BD2A 4N0CC 1IAOB 3U2SB 1L5GB 3I6GB 1P84J 3MUY1 1RZFL 4XX5A 5HYSB 2OXHA 1HT6A 2JI2A 3A4EA 5F1SA 1HS6A 3FUIA 4MYPA 1ZHLA 5EC2B 3T0EE 2WXQA 3QI9D 4TXVB 4WK0B 5F89B 3D3VD 2VN4A 3F8UB 3S48A 5AOLA 2VJ8A 2FYVA 5DDHA 3DX7B 3X3GL 5JW3L 3BZEB 3JZYA 3OQRA 1G9EA 1A4BA 3AITA 4PS3A 2QVTA 4NQSB 2R56L 5K1VA 1AS6A 3FZUD 4JO4H 4F5CA 3BLPX 4BWUA 1CK0H 4N0CD 2R0ZH 4AV4A 1J88A 4K5OA 2XZQL 4TQIA 4DGYH 2DM7A 5I1AA 2QEJA 4OZHB 4KAQL 4N9GB 3DUSB 4HFWB 4V2BA 5D5MA 5DHVA 5FYJE 3KYAA 2CO7A 3UP6A 1UJ3A 4Z7WF 3HZVB 3QUXC 2J20A 4NQEB 2VLJB 2ARWA 1S7TA 3ZDZB 4PREA 3SGJA 3H3KA 3MRMB 4J3OH 3C8HA 3TP4A 4UV4H 2NRDA 4YSOA 3I85A 4ISVB 1NICA 2VN3A 3BT0A 1CYXA 4A68A 4IOFD 4U1LA 5EA0H 3T0EC 1ZSDA 2Q3XA 2HKFL 3CG8A 4TSBH 3VXPB 2XV6B 1OSYA 2BSSB 3LX9A 3OVUB 3F01A 3JWOC 1H9VA 1EVTC 3QUXB 3WUWA 1FJ1A 1QR4A 3K8MA 1A65A 4JHWH 3F7PC 4X4MA 3B37A 3FTGB 1EXHA 1W16A 1IBHA 4PMEA 2VLLA 2N01B 4WI6A 3SBWC 5DA4A 3QYMA 3BRGC 2EYTB 3NQIA 1OGAE 4KHTL 2B14A 1I1AD 2GW5A 2EC8A 3UBGA 5AAMA 1QLEH 3EOTH 1OWWA 1UGNA 2YHGA 3BP7B 2D03L 4NN7C 1T2JA 4TUUA 5KSUA 1USQA 1TETL 4E36A 3VWKA 1XQ4A 3NTCH 3DVIA 3GMQB 3LNDA 2B1AL 1SOSA 5D2LE 1DQJA 2OTWA 4YSSA 3CFDA 5IW1B 4S1RH 4QJ4B 4JBSA 3BKYH 2A83B 3TBYA 3ZVVA 5DD5H 4IKJA 2X4NA 4NUJB 2D4DA 1BQLL 5FYJD 2D7NA 3OR7A 4JM0A 3HG1B 2UUDK 1A1OB 1I4FB 4HJ0D 5AYQA 1SLVA 3C5ZD 2VDLH 3DSFL 5A16A 4ACTA 1F3JB 4X5RA 1EFXD 3MUGA 4R96B 1R47A 5E1GA 4U3SB 5D4HA 4I85A 5BS0D 5FUOL 2DF3A 1ITCA 2LR4A 3UO8B 4BD4A 4JFZH 2V0AA 3QIBB 4K3DL 1RLBA 5J6SA 4P5TB 4ONGH 5B1CA 1U3HA 3GRWL 4YL4A 3VWJA 1B4JL 2PR4L 2BWQA 1OSEA 4HUWA 4B41A 4QY8A 2J1WA 5T3XL 3BGFC 4MNHA 2YPLB 5GPRA 5C09A 2AK4D 4MZ3A 1XIWD 5KUKA 2VMJA 2XZQH 2DIBA 1EHKB 2RQEA 2OZ4A 4FTDA 1XGPB 5I71C 3IJ8A 2K70A 2KHAA 3QIUA 4IJ3C 4N20A 3V0WH 1FWXA 3FUMA 5DSCB 5I1EH 5HYFA 1R3HB 4N90E 2Z65C 4UQEA 3LKQA 5T1DH 1TZHB 5DJ2A 5E5LA 1YN6A 2MTPA 4N2NA 2AQNA 2OR9H 2QTEA 1TG8A 1EUTA 2R51A 2X4RB 5IKCB 4WW2C 4Y2LA 3VRIA 5EUKA 3BPCB 1XEUA 2X1XR 1NCOA 5CGYD 5IW3A 5DC2A 5CD5C 4RGNB 4J3OF 1JRHL 4WJ5A 5LXVA 3P9WB 3WJMB 1X3DA 3F12A 3VJ6A 1EEZB 4PGBB 3ZT5A 1IM3A 3HG3A 3LEXA 3FCTA 1D5IH 4WW2B 1XEDA 3GGWA 4LO9A 2AQ2A 2F7PA 3CK0H 1XD1A 1HOCA 4AEEA 3LB6D 1BBDH 4KZCA 1SN0A 1T2XA 3PWVA 5CMAA 5C0NC 3HLAA 2VJXA 4GS7B 4IRJD 4PG9A 2AQQA 4RAVA 5EV7A 1OXYA 1J0JA 3ZKMD 2OW6A 2OQJB 4HDIB 4CBZA 4MNQA 3H3PH 3TA3C 5L7XL 1NFIB 2CJ3A 2XFGB 5GZNA 2AZUA 2VDPH 2ORBL 5TJWK 1D5MB 2DKUA 4LLAA 3F00A 3UTSA 3RGBA 4LNRB 1SJMA 1DBMH 2OR8A 2CE6A 4BSWA 3KMDA 1A9BA 4TOYH 4Z7NF 4PV9A 4HGKC 1DVYA 4QXTA 2C7UB 4YHYB 2P4AB 2OAAA 4FKHA 1WHPA 2BS9A 2RACA 4KJYA 2X4QB 3WFCH 1MRFL 1U95A 4FP8H 3OAWA 1KDJA 4Y2OB 4LLQA 2Y07L 5I8KL 3LKNB 1UD5A 3NN8A 5EU4A 3KPSB 4EDXA 4J8RA 4L3AA 2BNRA 3BZ5A 2CH8A 2WINB 1FUNA 1ZLVK 4R7NA 1I8IA 3KYKL 5DFWH 3WIAA 3T0EA 2N4IA 2Q20A 4GT0A 3AS1A 3KXFB 3HC4L 3RURA 2V2XA 3RKDC 1ZIAA 2UY7B 1QWUA 3AROA 5BZZA 4M1CC 3QW9A 1DDHB 1LE5A 4WEBL 5F96H 3PL6A 5LLIC 1KJMA 2O26U 1AFVL 4RGND 2JELH 2UVFA 3MV7B 1HKLH 1HNGA 1FAIH 4PRHA 3GJFH 5GRZA 3WFDH 5FYKL 4A2GA 1UEYA 2EADA 4DP7X 2VSCA 4XOEA 4OVUA 1MLCB 1R3IL 3LVEA 4IEFB 4DKFH 2FLRT 3GZQA 5D5ME 5FM5M 3RDTD 4JZJB 5F7DB 4KX9A 3MRGB 2AS5M 1JS4A 2LU3A 4Z3TA 2WXGA 3B5TA 2G3MA 3C2AH 5DGRA 2UY6A 4Z0BL 5ALCL 5TD4A 1MFEH 3CDZA 3L3OA 4YZWA 1NEUA 1LP9A 1U8JB 3BWUC 5DHVH 5T33L 2FIKA 5E8OB 3T3MB 5E6SB 1KTLB 3CUPA 3MLYH 4KTDH 2HFGH 2WB7A 4OCRH 5E9AA 1IE5A 5IMKA 4FNPA 3U6XA 4ABWA 1OHQA 3MTRA 4LDEB 4CC4A 2DKMA 4XNZC 3ATAA 3HUJA 1AOHA 3JWOH 5DRNA 4JKNA 4NM4H 3RI5F 1M3JA 4FFWD 4JVUA 2OX5B 2WVSA 2BSRA 2NW3A 5BO1H 5E2VL 4XXCC 5CEZL 3DO7A 4PJ7F 1ZA6B 5DEGA 3MLXH 3IE4A 4XHQA 2Q76B 4I3GA 5DRXA 1OP3H 2X1OA 4HALA 4IU2A 3FZUC 3CLFH 2VDKL 3QG7L 1UD6A 3MA9H 4F8OA 1KPUB 1VPOH 4RFOH 3X12A 4X7SL 1M2OA 1YEGH 4P5TC 1PLGL 3F58L 4XC1H 2P7TB 2IV9A 3WNPA 3LKPA 1G9MH 2FJFA 3QWQB 3LPPA 4PLKD 1J5DA 2C1OA 3CHQA 1KBPA 4PJ5E 2NR6A 3CLEL 3GSWB 2OSXA 2W94A 1E9QA 4XZUB 3VW3H 4C59B 1LM8V 2LU7A 5CCJA 3DETD 1QUPA 3ARYA 4LFHG 4K7PX 3I6GA 5A2CA 2CUHA 4Q9BA 1GXEA 4HXBL 1FYHB 1VADA 1SDDB 1DP0A 4Y7OC 1KCUL 1Q9OA 5F88A 5GZND 2PCXA 2AGJH 3B1UA 3R0NA 3QEGH 5G55A 4K8RD 2APXA 3AWFA 1NAML 4RA3A 2MCMA 8FABB 1DN0A 4J4PC 1JRHI 4RX4D 3C5SB 2WXJA 3PL6C 1EXGA 2NY0C 7FABH 2EP6A 3HPJB 4P3WA 5LO7A 1MFCH 1CZ8H 3D09A 1ZGLM 1GOGA 4ORGB 5B3SB 1GW6A 5E0QA 2VZ1A 4KZDH 3BH8A 4N2EA 1R3LA 4FLQA 4R4ND 3QUMA 4OF8A 5ICXA 2WYZA 4NN6B 3MV8A 3Q2WA 4K8RL 5FAAA 4W9ZA 1W0YT 4LEXH 2DQDL 1U33A 3TV3L 3WLWD 4QTHB 3DMMB 1NFDB 4ODWA 1UZ6E 4D8PB 1G6VK 2R2CA 5BJTB 2JSFA 2IH1A 2PPFA 2J88H 2L04A 1N18A 1THAA 3ZYZA 3Q6GL 1FVEA 4NZDA 5FCSH 2AV7A 4KVCL 2ZCHH 1NSNL 4S2SB 1NGPH 1ETA1 4U1NA 4DH2A 2B4CL 2YGPA 3QQDB 3O45B 2RIKA 4FL4B 2EIKB 3ZL4H 1MCLA 4G5ZH 1KGUA 2X7LA 3AMKA 1D2PA 2V8MA 5IJKA 1S7XA 2WWKT 1FV1B 3TEYA 2Y7QA 2Z92B 2XY2A 5LN4A 1ROWA 5EO1B 1OD7A 1KC5H 1F2XK 2E47A 3MOBL 1XSOA 3P9MA 2GTWB 1G7QB 3H4HA 3IRZA 2L7UA 3RWGB 3VSTA 3GM8A 4GP8B 1G6RA 4NHCH 1PKQE 1DHKA 5DRZB 1FVDA 1ZRUA 2KLSA 3TVMB 3N0AA 2XV0A 1M1XA 4LOUC 1MNUL 1W9XA 1M9WA 1O6SA 2XQ0A 5L2KD 1A9VA 1U3HD 3D51A 4QJ3B 3ARFA 3QDMA 3ZGHA 4BFIB 2UV3A 4ZS6D 5IVXE 4RSYA 2ATKA 3ARXA 2MEJB 1WWAX 4AL8H 3SCMC 5JMOC 3L1OL 2FO8A 5HYQA 3TGXA 1FORH 2NW2B 4W1TA 3A4AA 2WTRA 5IR1A 4FG6D 4Z0XA 1MCHA 1JHKH 4ZZKA 2VDOL 4FXGC 3QISA 5DMGD 3K2KA 3OL2A 4OFIA 4XBMA 1U3YA 3H1ZA 3N42F 4M5ZH 2F61A 2VQ1B 1UWXH 5F3HA 3TCXA 1NC2B 4IBYA 1GC1H 6PAZA 3TA4D 2VXQA 2VQ4A 1X5GA 3HG5A 4WI9A 5CEXB 1TCRB 1R33A 3F7KA 4F7PA 1PSKL 3D08A 4QF1A 5HJ3A 3QHFL 3VXSA 1KG0B 1WAAE 3Q5YA 2B2XH 1IL1A 1GZHA 1MQKL 4NAJA 4XVUD 4DGUA 3NSJA 5B8CB 2WVVA 3LMJL 4BELD 4RGOL 5KJRL 1WD8A 2IGFH 1JYNA 2C8NA 2I7OA 1YMHA 1XGPA 3OWEA 3RGVA 2ZSWA 2YJQA 3KPQA 2VC2H 3SYQA 4DESA 1MHCB 4L3EE 1R3HA 3U4BH 4FN0A 2QGBA 1U8QA 4XX1E 5IB5B 5I8CB 1DJZA 1QQDB 5HJDA 1A47A 4M8QA 1LVEA 4YVNA 1QFWL 3UOAB 1LO0H 1HDMA 1HHHB 3WGVB 3UZVA 5C6PB 2Q0ZX 5BOPA 3R1GL 1YJDC 2O5ZL 1HXYB 2Z1PA 2CLZB 2DQFA 3KBHE 5D7IB 4LVNB 3QEQD 2KS0A 5L4MA 3Q1EA 5CXPA 5T3XE 5B7MA 3F12B 4S0TD 3EOBB 5D1ZA 1R34A 4PD4J 3LQAH 4PGBA 1MSPA 4EQ3A 2P3YA 1J9QA 4PGJA 3GSVA 2Z9TA 3FQNA 2A1WL 4HEPA 2BZ7A 2J2ZA 1UZGA 2IGLA 5CO1A 3NZ8B 5GS0D 3UCQA 3KPSE 3WLBA 4GKNA 2YEVB 1M57B 1LDPL 4G9FA 5E8EA 4H5SA 3BZDA 4JFPA 3QK0A 3MREB 4JANA 4KMLB 1AI1H 2BNQB 3H9HB 5KZCD 1DEEB 3OB0H 4P23B 5DHMC 5K59F 1UURA 4JS7A 3KS0H 2WYHA 3D2TA 4RRPA 3ILQD 5DQJA 4L3EB 2YPVA 1VZIA 2XTJB 5E51A 1FG2A 2WOBA 2CR6A 4U1KA 2L0DA 3O6FD 3PFUA 4ONOA 2G2NA 2AXGA 3I9IA 5I1HL 3OMIB 4N90D 3UTSE 2C34A 2B59A 4RIRA 2QZQA 1JXGA 3HAEG 3SQRA 3SKOB 3H6AA 5TQ2H 5DYOB 4OCNC 4GFTB 4W70A 4ZRGA 3V7AE 3E6FA 1WV7T 1GOHA 1Q94A 5A2IH 3R4RA 1HH9A 5GGSA 1CVSC 3QJOA 4TQHA 3VFPB 4YIQB 2VW6A 1A9EA 4IRZL 3LS4H 4TUKH 3RIFK 4L4TE 1ILUA 2R23B 2XG5B 1DQLL 4LB8A 2PWEA 4PS8A 4YS4A 1BG9A 2X6UA 4LZKA 4JRWA 5IHUL 3PL6B 4H8WL 3L7FB 1ZEAH 3BUIA 3O3BA 5HHVH 2XIBA 4YHPA 4HK3N 5B1KA 1N7ML 3B2UD 1JFHA 2AC0A 2IPKB 2Q3ZA 4G8IA 1KJ3H 3UAJA 2J6EA 3HMXL 4ZG1A 3UROR 1B3IA 3TONA 3EAKA 4GG6E 4BFEA 1ASPA 2O6CA 1MCPH 4H40A 5KAQG 4UQCA 4XODA 4JRYD 5DZ9A 2C5DC 1KLGB 2UY6B 3ZDZE 1MCFA 3V0IA 2RFXA 3LDBB 4OKVA 1DJXA 1D6VL 4KK6C 4J23A 2CBMA 2JKNA 4W9HC 1MPAL 5SX5H 2Z31A 3R19A 2H1LM 2Z4QA 4X80L 5I1DA 1R4XA 3P40A 5E8OA 1IGCH 5MEPB 3S96A 4TUOA 4RLDA 4X6CE 2R8SH 1YEWA 3VXQB 2IWKA 5EO0B 2LFEA 2J8UF 3D39B 1AXTH 1AIFB 1YNTB 3OKLB 4I3RH 4KU1A 4NNPH 3BN3B 5HHXH 3MHZA 4WV1C 3FPXA 3CDGB 3TFKD 1OD9A 3CDCA 3SKJL 3V4VH 3UO1H 1R5WA 3S9DB 1RUML 1U8HB 3KPSD 2MCPL 2NW3B 3NIDE 4Y5VA 5BZWA 3HR6A 3D4GA 3SE4C 5IEHB 4N8CH 3P69A 4PJGA 5KYXA 1IEAB 5DJYB 4PJDE 1CD8A 3DC0A 1ANUA 1A6WH 2AK4E 2E76C 4ELMA 8PAZA 1YMMD 3VD0A 4G2AA 1EPFA 4L8SC 1A3ZA 3MX0B 5BZDB 2WANA 5E9DA 4A2HA 2P42B 2XIIA 1F5WA 4QNPF 2GI0A 5C92A 1RMFH 4FQ2H 3QDME 1QHOA 4RETB 4MNQD 4MSWB 4LCCC 3MRJA 1HSAB 5IJBC 3UFIA 5DMGC 1UACH 4YHLH 5I1GL 4MD0B 1B0RB 1U8NB 3EO1B 4P5MB 3ZDYF 3PQYA 1NBCA 4I3SH 4RBPK 1E3ZA 1QBBA 1NJ9A 2VLME 2WLIA 4GUCA 4ZFQA 5H8DA 3Q7JA 3BD3A 1AO7A 2QADB 1MCOL 1NC4A 1UZ8A 3W5MA 1KBBA 3VA6A 1AS7A 3D34A 1TZIA 3EJCA 5F1NB 1AZVA 3OHXB 3AADB 1FZKA 3QH3B 3VD7A 3V79C 2FD6L 1AQKL 1XAUA 2BY1A 3QG6A 3KYMA 2P8PA 1IARB 1RJYA 3L5JA 1N0XH 2CJUL 3NPSB 4PJDB 1UOWA 2VABB 2IAMD 3EYSH 3NJKA 1I75A 4P8QA 1G4MA 2WLKA 1DVFC 3QJHB 4HKJA 4IS6A 1MJ7H 4PRPE 5C6TH 3RFZB 2O6EA 2ZPKL 3CZGA 4IBLT 1IGCL 1XF3B 3M8OL 2WUCL 3LSOA 1QOKA 5CBEB 3VDCA 3KYOA 3RPBA 3DMMA 4FQLL 1A7QH 4RFEB 4HP5A 2FJGA 2VXUL 4PBVC 1TLKA 5F7YC 5ES4B 1IFGA 2YXWA 4JJHA 2HMIC 5CJOL 5AG9A 3JYCA 1S9YA 3L3HB 1BA9A 1C5DB 2OBGA 1SVBA 3W37A 4DP4X 5IQ9B 1UM6L 2ITFA 3GHEL 1S7WA 2FL5B 1MCDA 4PRPD 4Q2ZB 2DBLL 2BFVH 4L3FA 5JQ6L 1MAML 4JFFB 3T2QA 1N70A 5EZIH 4LLVB 2BP0A 4MXQD 4U4IA 4W9JC 4OFKA 5E2WH 3STLA 1WP6A 4HGWA 5KSBA 1KB5L 3AGVA 3QYNA 1E5CA 2OULB 4EDWL 4PJIA 3RZCC 5JDSB 3LIZH 3OX8B 4Z7UF 3BAYA 2ED9A 3B9KB 3H9ZA 3QJFA 4XE0A 2WLYA 3MGTA 4KKQA 3SE6A 4GBXB 4K3JL 1HEZA 1MZYA 1O6SB 4NENA 4M3JA 1P5UA 3OD3A 5D93B 3FO9A 1LEIA 4P46B 4OQTA 1A2YA 4PJ5B 1OPGL 5I1HH 4J6RH 1CTOA 4OZFB 3HJEA 1URZA 3FYEB 4IMLA 1P2CB 4B9PA 4O4YL 4UOW1 3QEQE 4QJ5B 4NPYB 2QHRH 3UX9B 1BFVH 1BF8A 2GQHA 2GEQA 1FFNB 1IEHA 3QR0A 1O75A 2E7CA 2YAHA 1SYSB 4JM2B 2QGEA 2VN7A 1JV2A 4HPYH 1CGSH 4G9FD 3LS5H 2QLYA 4AJYV 3TIEB 3IDXH 5D6DC 4PJCE 5HGBB 4B9CA 4KVNH 1A7OL 1E6OL 5GGTH 3QUZC 5F44A 3QUYD 5JQIB 5HYJA 3AM8C 5KBLA 3UAEA 3HFMH 1M56B 4EZKA 2FLMA 3HB3D 3EBAA 3ZN6A 1A6ZB 4HS8L 3GLZA 4QF1B 4GLRI 1QWHA 2WXMA 1I7TA 1P4BL 2BX5A 3WTVA 2FB4L 4YDJB 4CVWA 2DYSB 3BAEH 4RMQA 2R69L 1YECH 3GTVA 5MERB 2FEEI 4XRCA 4QLWA 2VIRB 2EC9T 3L6FB 4OH2A 1QRNB 3LEVH 4OGAC 2XNAB 4NGHH 4GRWH 3D39D 1U41A 1D5ZA 4F8TA 5JHBA 4XPAL 5CLZA 4KDTA 4HWEL 1QQDA 1JPFA 4WO4B 2G5UA 4YO0B 4RQQA 1CXEA 4E41A 5DD3H 3QJQB 4AYFA 2XWBA 5JW5A 5L0QC 4ANUA 5IFHH 2HSIA 5EF1A 3HBQA 1UKTA 3K6SB 4QGTA 5IBUB 2K6WA 3BPOC 1YO4A 3GI9H 3TT1H 2IGFL 3WS6C 3KLHC 1JBJA 1TEFA 1RZKL 2ZUVA 5I2IB 2IC2A 1LE9A 4WFHE 3IJEB 3F3HA 3HRZC 3QHFH 4BUGA 5GS3A 4JGJA 4RH4A 4QHPA 5F6IB 4APQC 5I66A 3L48A 3OZ9H 3QR1A 1CFMA 1JF1B 1OAUL 2YRBA 4IGBD 5JHDD 4ETYA 1IV8A 4L1HA 2DEYX 2QZ5A 3UG5A 2YMXH 3FQ4A 3TEUA 4XMPH 3SYOA 4YLCA 2GJZB 5T1MA 3GK8H 5E2UH 1VENA 4IDJL 1JG9A 2VISA 4J3OD 4P99A 4U1SA 4NZRH 3K74B 5EBGA 3K3QA 3ZMNA 4HGMA 1YQVH 3SE3C 1EFXB 4DK3A 1DVSA