2OULB

The structure of chagasin in complex with a cysteine protease clarifies the binding mode and evolution of a new inhibitor family
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
107
structure length
107
Chain Sequence
KVTKAHNGATLTVAVGELVEIQLPSNPTTGFAWYFEGGTKESPNESMFTVENKYFPPDSKLLGAGGTEHFHVTVKAAGTHAVNLTYMRPWTGPSHDSERFTVYLKAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of chagasin in complex with a cysteine protease clarifies the binding mode and evolution of an inhibitor family.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Falcipain 2
total genus 21
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2007-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF09394 Inhibitor_I42 Chagasin family peptidase inhibitor I42
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2020 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2oulB00
3CBKB 3E1ZA 3M86A 2WGNB 2NQDA 2NNRA 2H7WA 2OULB 3CBJB 3M88A 3PNRB 2FO8A 2C34A
chains in the Genus database with same CATH superfamily
32C2B 4HDIA 3ZRFC 2KMWA 3Q5TA 1K4CB 1M9WA 4HKXB 3ARBC 1YN6B 5BOPA 4O2FB 5JDJA 3PQYB 2Y1ZA 4KPHL 1JGVL 4FABL 1JV5A 1HH9B 1UKQA 1AP2A 4Z7OF 3JWOH 1GRWA 4B9YA 2Y0SA 3DIVA 1KBKA 1ZK9A 4AQ8A 5JIDA 2C4FT 3LEYH 1Q0YL 3TJEH 1VPOH 5LQBH 4PRNA 4D0BB 4F5CA 1UATA 2JKXA 5FXCH 2E27L 3TNNB 1VKXB 1LNUA 2PXYA 3EH4B 2EILB 3LPWA 4QXUL 3NAAL 4AJYV 5FDWB 1G7PB 3V4PL 1AHMA 4MJ4A 1QTPA 2WKGA 4BE6A 4HBCH 4HJGB 3H9ZA 3KDPB 1WTGT 2E9WA 1YY8B 2WKOF 4H0GA 4RBPH 1FNSL 4HUMB 3HUJE 3OX8A 2EIMB 3HPJB 5GPRA 3OLGA 3Q8FA 3KPSE 3FCSA 3TFKC 2VOTA 5IP4A 2WLHA 1E5UI 3EJZC 4EN3A 1YNKH 4P9HC 3DUHA 4QHNA 1F56A 5AW5B 5H4ZA 4JM2B 1QSFB 8CGTA 2VR6A 4Y2NA 1SHSA 3UAJD 1IC7L 3VTMA 1OPGH 3OBAA 3ZE2E 2NCMA 3WNJA 3DSNB 4E5XA 4WHTB 4U1HA 2MCAA 1WGVA 5I82A 3RVVC 3GSUB 1JSYA 3TCXA 5DK3A 1OLLA 1HILB 3BGAA 1MZZA 1ZEAH 4L8BB 1OT4A 5DC0A 4BE5A 2Q3XA 2VCOA 4OF3A 5JW3H 4LLMA 3KPPB 2CBMA 4PRDA 1A3LL 4XO8A 4XPGH 3U9UA 4D9RD 3ABLB 4D8OA 3VXRE 1A9EB 4PJ5B 4MHHI 4PPTA 5CF3A 4L3AA 2LAGB 4PGEB 3T0EB 3CX2A 4V2BA 2W5PA 2XX1A 4KOBA 5ALBL 5AB2A 2VAJA 4S1RL 5E08L 3M17B 5LXVA 5I1HL 2L7UA 4M6MH 1ZA6A 3GHEL 4NCC2 2ZXDA 1JPGA 1EBPA 4ABWA 2BVUA 3O9WC 1L6XA 3TO2B 2P8PA 3V6FB 2FWOB 2MQGA 3KW8A 4X83A 4M1GL 1CD8A 4IJ3C 1MW1A 4MNQB 2FX9L 3DGGA 1CFMA 1S7QB 1N8ZA 5B1KA 4ALAC 5GZNC 1BQKA 3DXAA 1BFTA 1IARB 2ODIA 3GMRB 4HJIA 5HGAA 5JMRA 3LKNA 3IMBA 1A21A 2ZP9A 1I1YA 1ZHKB 3ISRA 4G72B 1KC5H 2ADJA 1Y6NR 2W65B 1OM3H 1RI8A 4BZ1A 3ABZA 2Z31A 1M4KA 3MOBL 4APQB 1ZVYA 3TLRA 2WWNA 4HA1A 1ESOA 1EHLL 2L04A 2QLVB 4AI7A 2R0WL 4PTUA 4W9CC 3WU1A 2QFRA 1JN6A 3TU6A 2BNQE 3BUYA 1XBDA 5GS0D 3UC2A 4LSPH 3K2MC 3MV8A 3VWJD 5ADOH 3BKMH 2WXOA 3F5WB 3O4OC 2HMIC 5BZDB 3OXRA 4OF5A 3CVIH 1YEEH 3U7WL 4QEGA 4IBQA 1HHJB 3M86A 3RNKB 4U6VL 1SDAB 3S2AA 4BUHA 1CGYA 5DJ8A 2Z7YA 3DURA 1BSIA 4TKWA 5F8QC 1AGBA 1DDHA 3AMKA 3B7TA 3DWTA 4GRMB 3AABA 3MYJB 4XPFH 1WGOA 3NQIA 1NOAA 2DQHH 4XXDA 4RZCA 2AKRA 4PJDE 5KEZA 1FFTB 4RZKA 1A25A 1MCRA 3JSSA 3N5AA 4ACTA 2RH0A 4EXKA 5IFAL 1UZ6E 5DUPL 1QO3A 2YARA 3IJYA 5AVXB 1EHXA 1FVDA 3CX5J 3DX2A 2CCWA 3NCEB 1KTLA 5I1LA 1X5JA 5IROD 6FABL 2XWDA 4P4RB 4ZS7H 2I9TA 2B4CH 4K7FA 1CFNB 1YPZE 2VQTA 3QEQB 4H8PA 4DZBB 4NNYB 2HX9A 3RWHA 3X1EA 3ZDXB 5E8OA 5EZOL 4TOYH 3HC0A 5E6IC 4K8RC 4LSRL 1NBVH 2JB6B 3ZE2F 5FA3A 1CLZH 3W9DB 3BP4A 3H3PH 4XRCB 3NCXA 2C1PA 4MMZA 4YSUA 3IN2A 4MXQD 1DBBH 3HHSA 4MYWB 3NBNA 1KFAL 2HP4A 4XAWL 2L7JA 4WO0A 4M8UA 2YO3A 2XZQL 1U3HC 3TZVB 2F53A 4LBEB 3QZOA 3V2AR 2JSFA 1YEFH 5I16A 2IBZX 1I1RA 5K9KA 3WO4C 1P5VA 2DLIA 3S4SB 4G8FB 2UWEB 1KMGA 2Z3FA 2FEDD 2Z4QA 1CL7H 8FABA 3BWZA 5F89B 3HAEB 2A6IA 5J6HB 4FEMA 4FNPA 4OLXH 4M6OH 2I07A 5IEKB 4F27A 3ALXA 1I9IL 2VLLA 2K6ZA 4AYDC 2APXA 3CFDA 5KW9L 2BZ7A 2V3DA 5H2BB 4FAAB 3BW9B 1LEIB 3NACH 4PRPB 1OP9A 3NIDB 4JFED 2KL6A 4ZOBA 4MMYB 1K2DB 2OXHB 2X41A 2ZZUT 4EE2A 1QFUH 1ZHKA 1FGVL 5F9DC 1GSMA 3A67L 1XR8B 5FYLH 5KUKA 1NH6A 1U91B 4HS8H 2DI8A 4HUWA 1JXDA 1PD1A 2BNRD 5DRWA 5TDNB 3S3DB 4EQ3A 4XBMA 4RFOL 3ZMNA 4Z7QB 3TA4D 1J5CA 3QDGD 4GW5B 4ZAKB 5F6IC 5C0JA 2ZYSA 4N8CL 1CZ8L 1I3GH 1KTRL 1TZ8A 4OZIB 1A7OL 4HW6A 5EMYA 4AIEA 3K80A 4MJID 4OKVB 2C7UA 1QSED 4XMLH 1Z66A 1H6UA 2AVFA 4AQAB 3NUKA 4Z18A 2XYCA 3ZKQD 1HKLH 4HPYH 1VADB 3LNIA 4K73A 1J18A 1A2YB 1MFDL 1L9RA 4A6YA 2BVTA 4FNUA 3L95B 2EXWC 4FP8H 3LB6D 5L88L 2FAUA 4NO0A 1A6WH 3I9GL 1ES0A 1WA2X 4HAGA 4HBQA 4H8HA 5JDSB 3I75B 1E9QA 4KVPA 5MEND 3WO3B 1HH6A 4X7TA 1F41A 2IG2L 4HUUA 4FHJA 5DGRA 4ZFOA 4F24A 2AEQL 2ZX7A 4RQQB 5DVOA 4Z78A 3ILPA 2YBGA 3KPSB 2AMGA 2WNXA 1AZBA 2HLAA 1INDH 3LMJL 4QJ3B 2MNJB 1OSPH 4AGMA 4DP2X 1D5IH 4NO5A 4NCDA 3HMWH 5DJDA 5FLUA 3JWDL 5HHME 1O0VA 4D0DA 3AFLA 4KKLD 3TYGL 4PRHE 5EUOA 5EDSA 3RL2A 3QISA 1FV1B 2CKBA 5T5FA 3FONB 4XB3A 3V0EA 1UXLA 1U8QB 4XPTL 4NQDA 5DRZA 3ET9F 3O2DH 5HSFA 3D0LA 1OM9A 1Z0NA 1BLNA 4HUVB 3GPSA 2Q9OA 4IBZA 5FM4A 4EI5A 2DQFA 2R2BB 3DARA 2A74A 3CQPA 2VR8A 5TQ2L 2BNQA 5GRJL 5I17B 4LHUD 2X2HA 5AAPA 5ITFB 3L5HA 1Z5LB 2A6KA 4JR9H 3Q01A 1P4BH 3CFJB 4QRTA 1BFVH 4KDTC 1DSFH 2AXGA 1ROCA 1RZFL 4O51A 1G4RA 1CFVL 1ITCA 5IFHL 1F4WL 3TNNA 2BSBA 2VDQB 2HX7A 5L2KB 4G43A 1ACXA 4JW3A 5C09D 3U30C 1UZ8A 3BPCB 2Y5QA 4PI0A 3EDFA 3EDDA 1UD8A 3NJXA 4KJYB 1QHPA 1Z5HA 1T6BX 3D3VB 4OLEA 3V5KB 1Q8MA 3MRLA 1CWVA 1R1CA 5D7KD 2QV4A 4NO3B 3MRPB 2P8MA 3DTDA 1E27A 5HJGA 3QUMB 1NCIA 1I3RB 1M53A 4CN4A 3MCLL 4LARL 3V6ZB 1EZVX 1UM4L 3VG0H 3QO0B 3D05A 5CD3B 3MXWL 2AXWA 5ID0A 3QXWA 4FULA 1BQHA 5KAQG 1S3RA 4KNTA 4GAYB 3SDXA 5JR1L 4D3CL 2DYSB 1F11A 1DQLL 1YYLL 3U1SH 3AQDA 5DXWA 2WGNB 2PO6D 4FE9A 4G9DB 1QA9A 1LHZA 1BP3B 4D9QE 1EO8L 3RWCA 5K1NA 2E7HA 1BGXL 3VM5A 2ZCZA 1VJSA 5SWZD 4W9KC 4B41A 1NWPA 4QRBA 3QZNA 3QJHB 3UP1A 4BZ2H 3V0AC 2QVTA 4QWWC 5D8JL 1T0MB 1DJWA 2XZZA 2C7UB 3CDZB 3BH8B 3QUYA 1D6VL 1TYEB 1XH1A 4G8GA 2VXVH 3KS0H 4JY4A 4Q6IB 3BGMA 3FQNB 3VFRB 2XDHA 3CDFA 3KYKH 3QAZC 2DM2A 4U6XA 3ZKND 3BVUA 4Z8FH 5C2BL 3E6HB 2YSSB 4QHKJ 1I7TA 4U2YA 2UZIH 3NDZE 4FFTA 4HGWB 1AY1L 3N44B 5CJOH 3DGDA 1H8OA 3IDUA 3W38A 1OCOB 3G6AB 2XV0A 1HOCB 3D33A 3O9WB 3TBYA 3NIGF 2IH9A 1FNLA 3FFCD 3U4EA 1HWGB 5KJ4A 4OCRH 4I85A 2PN5A 5C0IA 1HL8A 3MNWA 1MI5A 4OI7A 3TN0C 1H5BB 1H3XA 3TBYB 2JJTA 2JB5H 3K0WA 3CLFH 3EO9H 2NX5B 4FYSA 4LQFL 1GR7A 3LAFA 2LU5A 1FE8L 4ALAH 5I6LA 2FZ3B 5AYQA 4F33B 3LVEA 2MTPA 2JJSA 3HLKA 5HGBA 4CA4A 1C1EL 5JOEA 3GBML 4UT7L 2IDQA 4ZI8A 4PG2C 4Z76A 4NZUL 2ZCHH 4ORZC 4KQ4H 2DOCA 5LGKA 2YD8A 1IGIL 3ZHLA 2EYRB 3C8KA 4DQAA 1TZOA 3AS1A 3CIQA 1O6SB 3MUUA 5EU6A 3VXPB 1A3QA 1IZJA 1G9ML 1G0YR 2JXMA 2Q7AA 1R47A 5AZEH 4CBZA 3F7VA 3A6CL 3HR5A 4XNDA 3K6NA 3U6RA 3WEOA 2IBZY 1OARL 3FHEA 5AAMA 1MRCH 1FLRH 1KLGB 2JMRA 3GB7B 3WNIA 2GFBB 2XJLA 4AEHH 4ZMQA 4A2FA 4FYQA 3REVA 2AAVA 3GIZH 3MJWA 3NIDE 5GHWH 1R24A 2NW2B 2EYRA 5TE7H 4ZUVB 4JZNA 3IAGC 2VNCA 2IJ0C 2EABA 1XF3A 4L4TD 2Q8AL 5EA0H 5FWRA 2WQ8A 3SD2A 5CJ5A 4AEIH 1MCNA 4E41B 3NSJA 1DQML 3V4VL 2FX7H 2VH5H 3MRJB 2OULB 4JFFA 2XPZA 4U7SA 4F7EB 3ULUL 2TSAA 1M05A 5DD3L 1E27B 4WFHE 4ZK8A 1B2WL 1OGAD 1KCVL 4B97A 1QFWM 1EJOH 1VSCA 1YZZA 2F58L 3EDJA 2KS0A 3UYPB 1Y6KR 2E76C 2Y3NA 4R8WL 4U6TA 5FAAA 2NY3C 3VACA 4AYBA 4M5ZH 5D2NC 1HIMH 1YEDA 1MY5A 3FO9A 5F7AA 3EBHA 3US9A 1Z3GL 2ENQA 3QDJB 3WS6A 4XN2A 1UWEH 4OJAA 3QUYC 4O2EA 1E3ZA 1YN7B 4GRWF 1SLWA 2E7DA 3K46A 4QTHA 2VR3A 3ULUD 2I7SA 2QSCL 2A1WL 1A5FH 4M5TA 4HJ0C 4OI9A 4HHAB 4JK0D 5DDHA 3SYPA 2VLJB 2OMNA 1EAOA 4JFPB 1ZGLB 5C0AA 3ULUH 3DJZA 1JGVH 2DI9A 4JQIA 4YSEA 1KJMB 4NERA 3NJMA 1I1FA 3HCVB 2E6PA 5KVEH 1GL4B 1T0MA 4APQA 3L2MA 4WWKC 3LEYL 2VW4A 3WO4B 5F3BA 3K6OA 5E56A 2ADJB 4HJJL 5F3HA 4I2XB 4Y4KC 5BW7A 3NA9H 3QFDA 3RPIB 3ZLQC 4HP5A 4LVEA 3RKDC 1BV8A 4WW1B 2DD8H 5DJ0B 5EU5B 2V5MA 2WANA 3T2PA 3ISWA 1UYWL 5FUCC 3QRGL 4FFZA 4ZOCA 4PJAF 2H0PA 3EFDH 3G6DH 1QLRB 1AACA 5BOJA 3W56A 2ZX9A 4Z3GA 3SDCA 1T6VN 1YQVH 4NRYA 4GG6E 2CGYA 4Z78B 5LWYH 3ILQC 3MLZL 4UU9B 2XXMB 3UZVB 2PPCA 4N5ED 1CGSL 3RE0A 1V3LA 1YNKL 1NDTA 2UXGA 4PIBA 4PWIA 4RFNB 1TJIH 3PPSA 4XHJC 4IU3B 1P6AB 2PMZA 1KN2L 4X6CB 5ECJE 4GRLB 1UM5L 4MS6A 3BQUD 5IHZA 1M2OA 4CC4A 1VADA 1GTNA 4X80H 4PTTA 3GK8H 2WBKA 2K4AA 5JMOC 3H42H 3PWUA 4XNMB 1HILA 3S37H 1SQMA 3GMLB 1MXGA 5IVZA 2NR6D 2GKIA 3PL6C 4QRTB 4Y5YA 3IDYB 1ZEAL 1ZMYA 1LO0L 2Z93B 3FZUD 4NLHA 5FCUL 3SEPA 1Z5LA 2G2PA 4QRRB 35C8H 2FQGA 4HJ0D 4JZJB 1CXLA 5DD0H 4AQZA 3OZ9H 3I2CH 2XWEA 1BAGA 3NIFE 1NCAL 2IO5A 4HZAA 1QSFA 4QTFA 4WF7A 4JREB 3S96B 4OD1H 3E6FB 1C5CH 2BVOA 4Z3FA 1JZ2A 1UTDA 4P3CL 3VFNA 3UTTA 2Q1EA 2XXGA 4R5XA 4PYGA 2CUMA 5LAPA 2WO2B 4UQ2A 4FABH 1FYTD 3I50H 4JO5A 1LP9A 3S34H 3ARYA 5DRNB 1BOGB 3WTYA 2IPKA 5DMKA 4IKKA 4H1LH 2BVYA 5CIPA 1TVBA 2RQ8A 1QRNE 3IAQA 4N2EA 4OFYD 3ZHDA 1LE5B 4IIQB 2X1WL 1P4UA 3CFBB 2HTKC 3EJRA 1ZGLM 4H13C 3G5ZB 1JZHA 3D30A 1LNUB 4MA3B 2WWMD 4N2LA 3OZLA 5EU3B 3V4PH 2EIZB 1KC5L 5IK3A 4N0CC 3WMPA 4XBEH 5DF0A 2WBJD 1AD9A 1CR9L 4EPSA 1TF4A 4PJXF 1T4KB 2LLGA 1JZ6A 5F3FA 5ERWB 1OALA 3TPKA 3CUPA 3ZL4L 4MLSA 4KX7A 1B0WA 1U8NA 4W6WB 9CGTA 1USQA 1A6ZA 2B5IB 2YPLE 4LSPL 4K23L 5ADOL 5JZ7D 1HL5A 2ZSWB 5FO9A 1LGVA 4F7MA 4PJ9A 2VDOB 5EH1A 1FFOB 4Q2ZA 4M7KL 5E1GA 2QJDA 1LDPL 3E38A 5D2NA 2KLSA 4XO9A 4L4VD 1J5HA 2H3KA 4BWUA 3ULUC 4I1PA 3Q5YA 5I15H 1AXTH 3ZHKA 1MEXH 3FQUB 3UX9B 3SQBB 1UB6A 2HRGA 5JO5B 3ZL2A 2IIJA 2G3XA 4GIOA 1G6RL 3FTSA 4XPFL 3TIEA 2XN2A 5KN5A 4PWEA 4LMQI 3IJYB 4IU2A 5KVMC 2Y36L 3V5DA 3Q7JA 1BX2A 3KL5A 5B39A 3JYCA 3CFUA 5BPPA 1WAAA 1X5MA 4HIPA 4L29B 3TH3T 3TJPA 3BGFB 3BW9A 1QD0A 4LRIC 4PJDF 5IHLB 1INQB 5KS9B 1F3JA 2ZE0A 2VLLB 2HJKB 4U1KB 4PWHA 4XWGL 1X9LA 3ARGD 5D9SB 5DQJB 5K39B 3AXIA 3CV5A 1HYSD 3LHPH 3MPCA 1CFQA 4AG4L 4MASA 4N90D 2RR3A 3VFMA 4M1GH 1RUAH 3AU0A 4TOYL 4U1KA 2FX9H 3VFPB 2FWLB 2F53B 5MEOA 2GY7B 2R4SH 5KS9A 3FTWA 3K4AA 4NRZA 1I85C 3N40P 3MX0B 2KZBA 2OMYB 3HAEH 1JXJA 3G04A 1ILUA 3WV0A 4EDWH 5JOFB 3MRCB 1MKFA 2H1LM 2VZTA 4X0NA 2A9MH 4XAWH 2V2TA 5CCKL 4Q0XH 3T5WA 5TH2A 1LXMA 1ZS2A 3EYFA 4X6EB 3GGWA 2EXWD 1F0LA 2P80A 3CN1A 1FDLL 4HF5L 4ONGL 5KSAC 4ES8A 3K6IA 2FEDC 4NNYA 2CLRA 4W9IC 3SYAA 3A23A 1FZMA 1V8HA 3IF1A 4PSPA 3KVDD 5I1KL 4GUOA 5DK0B 2G3NA 2R59A 2R0WH 4N85A 4UOW1 1RP8A 4N1CA 5KW9H 3MRMA 2Z31D 4M1DL 4MNHB 4OV6F 3P3UA 4KK8D 4H0LC 1B88A 4QRAA 1DJYA 1UACL 1KTLB 1YEEL 4JFUA 3BLKA 5JHDA 1PX4A 3SGEI 3NK4A 3WY3A 2EYSB 4EZKA 1T7ZA 3NT0A 1TSRA 1JF5A 1I8LC 1RSYA 3QZMA 1F1AA 4OSUL 4U6VH 1FGVH 4FQLL 3NPSC 2ZP0T 2F5BL 1IT9L 2K7QA 1AOZA 1DDHB 1VB9A 1HHHB 2DQHL 1WS8A 3RWIB 1NUGA 2VDOL 3RTQA 1JHTA 3HZYB 4YQXL 5H94B 1DQTA 1XL6A 3QFJD 5EU3A 3MRDB 2ZUQB 5KVGL 4JM0A 2IV8A 5MERB 1AR1B 5I8KH 3LXCA 2HKAA 2K1MA 5IIEB 3OXRB 4RVBA 4E9LA 1QEWA 4IIQA 4YDNA 1AO7B 3E8UL 4MJIE 4JJ5B 4L8SB 5E6YA 2GB2A 4AQ1C 1HHHA 4DOHE 2H32A 4OT1L 2WBJC 2DEYX 1A6WL 5E7BA 5D5MB 4J3TA 5GJSL 3OWEA 4M62L 4PJBF 3ZXAC 4ZFGL 1U8LA 3P4NA 1TZAA 3HG1E 1BW8A 1Q1PA 4XH2B 1AKPA 3OL2A 2VJ0A 1T5KA 4LSUH 2AQNA 5B3JE 1FVCB 1HL4A 1TMCB 3M45A 2Y69B 4D2NA 4X4YA 3HB3B 1PG7W 4KTDL 1M9SA 3B2VH 1OK0A 2EDYA 5TE6H 3D0AA 4CILA 1QBBA 3Q48A 5DK0A 4CVXA 1VERA 2HRHA 2OFQA 2Z93A 5F7EL 4QRPB 4JHWL 5FDYA 2GSGA 2LU7A 1X5IA 3MR9A 3MUZ1 5CFHA 3O45B 1Z3RA 2JJTC 3ZE0B 4R3SA 5JPNA 3AMLA 4OLXL 2HTLD 2KQNA 4XBPA 3P0GB 3MRCA 3ZK0A 4K5MA 4L4JA 1HSBA 3T0EA 3OMZA 1SZNA 1GGUA 4U49A 3L6FA 2R56L 1WA1X 4NBYB 5B1BB 3WIHA 3VFPA 5MHSE 1KSRA 1JNHB 4L9DA 5GS2H 5K9JH 2PCXA 4Y2LA 1O9WA 3AU1A 1HWHB 3MV9E 4DEPC 2X4OA 1RZFH 2ZAGA 2RACA 2V5RA 2ZF8A 4O58L 4YR6B 3VI3E 1TJHH 1D5BA 1JIBA 3ZDYF 4HV8B 2DQDL 3FCUB 1CFTA 1IAIL 1P6FA 2MJWA 1VZIA 2XTJD 4RFOH 2Y1VA 5KBDA 1BG9A 2H8PA 3RHWF 4ZO6A 2G75B 1XZ0A 1CZ8H 1I3GL 4M43L 4YH6A 1FNFA 4KJQD 4B3EA 1TEGA 1O7VA 1OGAA 3RUGB 2E4TA 3CHPA 2ZXEB 4Z6AT 3H9SB 1IU1A 5D7KE 1K5NB 1ZA3A 1TKWB 3BC9A 4NZFA 5CSZA 4R4ND 2ZXGA 2X4PA 4JZJC 3L5XL 5FECB 1QUNA 1CLYH 2G9HB 4K8RH 4A67A 3JT0A 4W70A 3I9GH 3STZB 4LPWA 1YEKL 2IPUK 1X5ZA 3Q1SH 4TQPA 3RUGF 1YYLH 4OCWL 2ZOTA 4GAGL 3R7RA 3C6LA 4LZKA 4KKCC 4Z0BH 3CLWA 3VWJB 3WN5C 2XV3A 3SKOB 4LESA 4X5QA 1OSZB 2C3XA 1INDL 2O5YL 4P49A 2OSLB 3MLUH 3EBGA 4JFVA 5E9DB 5F8RC 5C08D 4WI0B 3V7AE 3ZDYB 4BH7B 1NSNH 1U8JA 2JELL 1L0XA 5D1XA 2EEBA 3V0WL 2XQ0A 3PU7A 2VKWA 4IW4C 1DDTA 1MWAL 1M2VB 5LUMA 2OTPA 1HL9A 2VYRE 3O6FA 4F7CB 2O6FA 2G0LA 4UV7H 4Y1TA 5EU4B 1D9KC 4MD5A 3K8KA 4NGHH 3QUXC 3CIAA 5T3ZH 4R96B 1ZV2A 1LL1A 3TBTB 1IBGH 4AGPA 4FQXA 3BEVB 3MFFA 3RX5A 2TRHA 1SVBA 2A9AA 1EDHA 4B5EA 4ZD3H 5TQ2H 5CIPB 2AV1B 5IQLA 3ZE0F 1DZBA 4Z9KB 4G7VH 1LP9B 2VUKA 2XG5B 4OCRL 3SDDC 1YNTF 1P4BL 3ZO9A 5FC9A 3S98A 3C5ZA 3GPEA 3MOAH 4YFDB 1LJMA 4TL4A 5IFHH 3MBED 2JB5L 4N2HA 4LRNH 1OQOA 4XVJH 4YNYB 1E90A 1F6FB 4LL4A 3S8WA 3MLXL 3ULSA 4POYA 5F9OL 4XE5B 5I26A 4X9IA 3P2DA 5TDOA 4DSYA 1O6SA 4FA8A 1IV8A 4NHUA 4AYFB 4EUPH 1AS7A 4HIJB 2R9HD 3IGFA 3R06A 3WFEH 3D4GA 4QRRA 4CKVX 2ITCA 5EO1A 1CBJA 2WPGA 5KANI 2F54A 3TBSA 1NC2A 1ZXQA 5IHUL 4ZPTB 3SCMB 2PCYA 4YMPA 1KZYA 2YPLB 2I9LB 1G9MH 3BJLA 3UTPD 4CC4C 3WUZA 1KGYE 4DKDC 1RZGB 2ISDA 5IVXB 5JR1H 4AYEC 4D3CH 3B5GA 3VRIA 4PBDA 4OKDA 4JRYD 2C9VA 1U3HB 3MROA 3ZZLA 1QPPA 2DICA 1ADWA 2Q3ZA 2HN7A 4X6CA 2Q6WB 2MFNA 3PAVA 4UF7C 1RULH 3U0WH 3NIFB 2CH8A 4Y5VA 3LKSB 4ZAKC 5FYLD 1BGXH 4X7EC 3O3BB 3WMQA 3V5HB 1HOCA 1KDIA 3O9WA 4P06A 2A9NL 3EO1A 3BZEB 5AKRA 3PQYD 3VYOA 2JKTM 4AEIL 1U93B 3GSWB 2PPDA 3RZCD 1JRHI 1SOXA 4KITB 3SDDB 3LQAL 3B6SA 1VFAB 1D6VH 4IDJH 5JW5A 2F1AA 2XVLA 1B2WH 2DEWX 1L9MA 2EIDA 2F58H 4LGPB 4E9TA 5FKAA 3WNLA 4FEIA 4GEJA 4Z8FL 3UC0H 1HIML 4NAMA 2XWTB 3N1MC 2E6QA 1S9VB 5D1ZD 1FL6A 5SX5K 1DBKH 2EIEA 1CDGA 3AXHA 4IOSD 5I8EA 4NWTL 4Q6IC 4NUGH 4MD0B 4UM8B 1U95A 2XWTA 3QJSB 3T4AC 1EMTL 1JGUL 1YMME 2QZ5A 3P9LA 4KI5E 5D7LE 2QSCH 3HI1A 2F53E 3VD5A 2VDRL 4JRLA 3KHQA 4JQXA 4EN3D 1E28B 3PAYA 2WLKA 5E9DD 5HDRA 1BA9A 4MSWB 1KBGH 3TCLA 4K7PH 3CLFL 2FRGP 3NOIA 4CJ1A 1N6VA 4FADA 4MKTA 3FUKA 4YDMA 1XQ4A 4ALAL 3V79C 4FL4B 4J5VA 1KYOJ 2V5YA 1A7PH 3QHFH 4F9LC 1FIGH 4QRSB 3T65A 4FLRA 2CUIA 2X10A 4HEME 3O4OB 2VM4A 4JO4L 5I8CA 3WHXB 4ZMVA 4KQ4L 1BYNA 2V2XA 4K15A 2YXWA 3R0MA 1EUTA 5DVPA 2WY3B 4P5SA 4KDWA 3O2WL 2I27N 1OE2A 2X4QA 4EO5A 3CPLB 4GXFA 1N3NA 1UH3A 4WWPA 1SN5A 3RWFA 4ETQA 3CN2A 1FL3A 3CU1A 3P3SA 3WJMB 4AKOA 3ZIMA 2GI7A 3IDMA 2DDQL 5L2KA 1TENA 4M9PA 1OARH 2EXYC 2EDRA 3B8YA 1FLRL 1TQTA 4WFFE 4UOZA 3C8DA 3U83A 1IEAA 1M71A 2J8UF 5C8JA 1M7XA 5GHWL 1CGSH 1I8KB 2NXZD 3QJOA 3R06B 4UTBA 3TBWB 5GS2D 1TTGA 1G7IB 2BNQB 1KDJA 1Z6JT 2WP3O 3QHTC 2CO2A 5L8JB 1RZ8B 4BHUI 4TXVB 3EIFA 5AKTA 1JWMA 3MV01 3FUDA 2DLEA 4WGKA 3MNDA 3VXTB 1FL6B 4MCNA 1F4YH 5BO1H 1KXTB 2WLZA 4XPBH 4AZ8B 3SGEH 5EO0A 2JNZA 3LZLA 5LB1A 4F7KA 5F96H 3C8KB 2BDNH 4N6QA 5CLYA 3T2NL 3D4YA 5AB1A 1TLMA 4CVZA 4PJ9C 2B16A 2WV3A 2CDEB 3D85D 3L3HB 4P2QB 1NAMH 2XKUA 3B6SB 4XMTA 3KWUA 3OKMB 4RNRA 4GQPH 4G42B 4A55A 3EOBB 2A4CA 1KIUB 4B0MB 5I1AB 2H3NB 4DP8X 2AITA 4OD1L 2WXGA 2EDBA 2V8MA 5HDWA 4J6IA 1V5JA 4P3CH 1UT1A 4X7TB 3CBKB 3NZ8A 1N12A 4DN4L 1ZRUA 2RBLA 1WBXB 4GKZA 1VA9A 2Z91B 1QBLL 3MJ6A 5I18H 5DHVH 1OVZA 2CLZA 3HVDA 3FN3A 4HK3N 4FI7A 2OCCB 3FOLB 4CGUB 2MPAL 4EBQH 4JFDE 3DX7B 3ARSA 3WS3B 3QS3A 3ZTJH 4PHZA 1P69B 1N5YH 1H15A 2P5WA 3WAKA 1QG3A 5AW7B 1OGSA 3TTYA 2I24N 4KK5C 2YXMA 1UYWH 2OZ4A 3TT3L 3ETBF 1F3RB 5EBWB 3U7YH 2N59A 5H8DA 4N2GA 4Q97A 5IZ7A 3PJNA 3QUZA 3APFA 3D07A 2X4PB 4MCZB 3AC0A 4PU2A 4P05A 2P52A 1Q90A 1YQVL 3GSOB 4R5VA 4XCEB 4DUWA 5DD5L 2LT9A 3G6JF 3IDJB 1FH5H 1MOEA 3BKJH 1AQHA 3UJTH 4K23H 4P5KB 4OIAA 1EZUA 3SDCC 5I2IA 1MHCA 1GIGL 3FFCB 3L3IB 2H8PB 5GJTL 3H4FA 5A2KH 1ZLVH 2OXGA 4N26A 1J8SA 4XMXA 4B9GA 1S5IH 3WDIA 3ZE1B 4G3YL 2I07B 5KSAA 1JYVA 2LABA 1HEZA 2ADYA 4BH8A 4DK3A 2G2RB 5I19L 2D2CC 1HINL 4HC1A 3QQXA 3OKMA 1GYAA 1C9SA 1MFEL 5IJDC 2GBUA 1LO0H 2OSYA 3PJSB 4NFBA 4S10A 5HDQH 3X3FL 1OAUH 1JOIA 4QYAA 4I0PD 2R2HA 4L48A 3OZ9L 3I2CL 2GAZA 4X8CA 3MNVB 2H1PL 2NX5D 2XQYA 3AGWA 4JL2A 2ZOLA 3H3BC 1E9PA 2FL5A 1UZ8B 5H37A 3IGAB 5D2LA 5E6ID 1DLHA 4FFZH 1HAWA 4OLUH 1DQVA 4FXKA 4U1NB 2JH2A 5HHVL 3GLDA 2FGWH 1NEZG 1KIRA 2A6KB 1U36A 3GSNL 3S34L 4GG8B 1PLAA 5AOJA 5K9QI 3DOHA 4KZDH 3GMPB 4IHBA 4HPOL 4P04A 3QNZA 3BOVA 4ZZKA 4R7NA 3VQLA 2RD0A 3PXHA 3TIDA 5BRPA 4Y4FA 4MVBD 1IAKA 1XGZA 3WIFB 5F44A 4MXVF 1F6AA 1FG2B 2XN9E 5DJ6B 3J2PA 5HI3C 2N0KA 4HS6B 3OHMB 5JIPA 1UQSB 4HF5H 4ONGH 4K8RD 3EF4A 2BINA 1IGFH 1MRFL 2FHBA 1Q94B 1S9XB 2QVMA 3DURB 3HRZC 4ZNEA 5EC2A 3U6XA 3CG8A 5IB2B 3X1FA 4WI2A 4KI5F 1G6RA 1DVFB 5DJ2B 1WAEA 3RNKA 4HV8A 2WINA 4M1DH 2SEBB 3VWKC 1R17A 1SFHA 3K8LA 1SY6A 4ZRGA 1XB6A 5E1IA 4FA7B 4GW4B 4LCWD 1YJDC 4OSUH 4AX3A 1JP5A 3RTQB 3IK2A 4AEEA 4J23A 1Q0EA 5EFIA 1CTOA 1T04A 2Y2WA 2QKIB 1EZLA 3LPGA 5AW6B 3VSUA 1ZJAA 4YFLF 4HX1B 1KF9B 3A0OA 4WY7L 4M8RA 1P84K 1E5ZA 1ZT1A 2K3TA 4WO4D 3GRBA 2DL9A 4R3SB 3U25A 2NNRA 4LKCB 4Z7AA 1REIA 4LCCB 4DUXA 4MAUL 3Q8CA 4G5ZL 4BQ8A 3MRKB 1KLFA 4A37A 3SDAB 5BRZB 2JCCE 4XOEA 2J2ZA 4DNLA 5I74B 3L9BA 1ZLUK 3GSVB 1OAZH 1EWHA 1VEOA 1TQCC 1ND0A 1JWUA 2H1XA 4XWGH 4OT1H 2YQ3A 4LCCA 3WSQL 1ZLEA 3COOA 2CGZA 5C0BE 1NKRA 5GJSH 3LHPL 4I3GA 3EJYC 3BGFC 2X70A 3GSRB 5CZVL 5JXEC 1Y0LA 3FQXA 3Q9PA 4BCXA 3G04B 2R4SL 5IB4B 4WNQA 5GQBA 2VERA 4E9WA 4TVPD 4PJ5A 4K71C 3GHBH 5C3LD 4FTVD 5EO0B 3MCYA 5J6HA 1ECYA 4TUKL 2XA3A 3GSNB 4X7DC 4ZMLA 4N2CA 1WAPA 2F18A 3BH9A 5ESAA 4Y7OC 2ADIA 4KKCD 1FQ9C 3B9EA 2Q10A 2YN5A 2XRAL 1RZ8A 3RB5A 3UMNA 3N44F 5FK9B 4BK4A 3C08H 1DQJA 3VFSA 3TZVA 3I6KB 4XCYA 3W39B 5KS9E 5IMMB 3IPBA 4OQTA 5I6OA 5FGCE 1HXMB 1KGXA 3NCBB 1P4LA 4DO4A 3SGJC 4A7GA 4H25B 3IGLA 1NUFA 4JB9H 3UTZA 5I5RA 3UJIH 2ESVA 2B9BA 3BKCL 2L8AA 4LVNB 3RZCB 1KPRA 1Z7JA 4R7NB 2EADA 4FQLH 1CFSA 1IQDB 3LVTA 4H8WL 1CFNA 3ARFB 2W0FA 4NN6B 1FUNA 4WTQA 1T83A 5BMFL 3L9YA 5K9QG 2QTEA 1PEWA 1RZJL 2M26A 3BT2H 4MAYC 5ICYB 5FDWA 1I9RH 2K6WA 4KKQA 5KVGH 3GS4A 1PKQE 1MCCA 2WYHA 3ZGIA 3C8HA 4JCMA 3U2SA 5KYYB 3W0WA 2HJLA 3RB7A 3FT9A 3II1A 4XX1G 1GS7A 3QIBA 2R7EB 2XXFA 1BPVA 4GSUA 1N26A 4PP1C 3L5XH 4YBLC 2DF3A 1GH7A 1G5AA 5BV7L 1AZZC 1CLYL 4G2AA 2AEPH 4NSKA 3QEQE 5DHEA 3FB6B 2W88A 2ZUUA 3DSFL 4N0RA 4UM8A 4KTEL 4PRID 2WYTA 3J07A 1RJYA 1WITA 2F1EA 3BUTA 1JJUA 3CDCA 1WVZA 2QPSA 4RMBA 1Y18B 4TSBH 4WO4B 3TPUB 3IJ7A 3LIZH 3QFGA 3T4AA 2WOBA 5KSBB 5F7EH 1YRKA 2P47B 4JHWH 3CVHL 3NFSH 1U58B 3I6LE 3EJZD 3L4VA 4Z7OE 1JK9B 4ZDHB 4JFQA 4UV7L 3U4KA 5HI4D 4IBVA 2VAAA 1BX2B 1L4IA 1QACA 3DHPA 1DN2A 4IOFC 2F7PA 3S88L 2ZONA 3UCRA 4D9LL 2B3RA 3V8OA 2WQAA 2BSRA 3CVBA 3T1FB 3LKOA 2R56H 3IS1X 4NUQA 5I1JH 1CVRA 3O4LD 3V7MA 3IDGB 2CKNA 3UTOA 4A7VA 1COBA 4TLSA 5J6SA 1OCCB 3HG1B 3DO7A 2MNWA 1JFQH 3LSOA 2XBDA 5D7EA 4AE1A 3VSVA 5M7QA 1EK3A 1ZV9A 5DR5H 4C54A 5HVWA 1JGLL 1UA7A 4XVJL 4CN1A 4ZO8A 3AREA 3A6OA 4L3EB 5FYKH 2XG4B 2B08A 4XNYH 4GQZA 2CLZB 1O5PA 2XLLA 2VXTH 1B3IA 1T2JA 2W9DL 3P1VA 4HIJA 4M43H 1G6VK 2HTLC 1AQKH 3ARGB 5E2UL 3EUDA 2E7BA 3EGSB 2HRPH 3RHWK 2ITFA 2VC2H 4P2QD 5GRYA 3T0VA 3W0WE 4YHYC 5IK3B 4P46A 3MRBB 3O11A 5HGDB 4D0CB 3O45A 3EYQD 4XC3H 3UIYA 5IJBC 1E4XL 4MA3A 3BUQA 3EOBA 2ZOKB 2WCPA 2JLPA 2NMSA 1H6EA 2Y6SC 4OI8A 4P2QA 5CZRA 3VG9B 5IHHA 1YEKH 3FRUB 2PR4L 4FZ8L 3GXNA 2D4DA 1N4XL 4PJGE 4UT9L 1XD1A 2R1YA 3HUJA 3P4OB 3MFFB 4ZMXA 5EU6E 3UTTB 3B1UA 3MKKA 1ZLWH 4Y1AD 2X12A 3MLUL 2Y5TA 4UDUB 5DLMH 3QG7H 4I0KA 3SDXE 2VABA 3MUGB 3V0WH 4MJ5B 1F4HA 3O6FB 5DD6B 1KJMA 3LQAH 4JKPH 4I7ZC 4U31A 3T2OA 5KVDH 1YY8A 1KYAA 3W5MA 2NZ9C 4OAWB 4PMFA 3NIDF 4PUBH 5FHBL 1QEWB 2EDXA 1U8PB 5HHMB 3VXUD 5E8PA 5GGRY 5I23A 3P73B 3QRBA 3AAZA 2VDNB 1IBGL 1DCLA 4M9OA 1MWAB 1UB5A 3RY5A 4PREA 2Y7OA 3CSPA 5DI8A 4MGXA 4GKSB 4I3RL 1NAKL 3WXVL 4NWTH 4NUGL 4ELMA 4ELME 3VXSD 2YD2A 3K2UL 4ZW5A 5CN2A 2FBOJ 1EMTH 1JGUH 1YEDB 2VDKB 3B3BA 4XT1C 3RGHA 3KPRB 2CO7A 5CXPA 5DJCA 2YGQA 3MACL 4ACPA 5D7LD 5HHOE 4AV4A 1U0QA 4BRJA 3FMGH 4UU9A 3UZVA 3BCFA 5E4OA 5JHLH 1JK9A 1EIBA 5J57B 1U58A 4AM0Q 1JWUB 3X11B 1QLRA 2BVQA 1YNTA 4M48H 4KQ0A 1CI5A 4OF7A 4KFZC 1YMMB 4H5SA 1VEMA 4NPKA 4XAKE 5D71L 1KXVC 3KYOA 5D7JA 5CS7A 3ROOB 2VKXA 1VFUA 3MHZA 4K7PX 5C07D 3GB7A 3QUGA 5MP6H 2QVFB 2X4OB 1WPCA 4DPBX 4X6EA 1DBJH 4N5EC 2LGNA 5F3HB 2IADB 4QRRD 1A7NL 2FB4L 2F54D 2WWOA 1NC2D 1WBZA 3QUMH 1OCRB 1VFMA 1NGWA 1NIBA 4Y4KD 2EXYD 4Q4EA 1H8SA 4TULH 3PXJA 1RULL 5EFIB 1G0XA 3U0WL 4QHPA 4NPYA 2F8VA 3C60B 1JWSB 4WW2F 5C6WH 1BVNT 3F05A 1RJZA 2VXQH 5D6CB 5HXMA 1ULVA 2P48B 2YC1B 3UABA 2BIOA 3QC6X 3ZDZF 5E6SB 4QRPA 4XCNA 3TO4C 4MNGA 2YLHA 3CE1A 3LNGA 5DEJA 2DWTA 5DHXB 1Q94A 3T0XA 4IRJA 1J5OH 3DRTB 2W0FB 3EJPA 4GXVH 3DOIA 1NL0L 4FG6C 1UKTA 3CX5K 1LO3L 4NKMB 2HT2C 1QZNA 1MNUH 2NYYC 1E5CA 4BRVA 4K3GA 3CGTA 5AWNL 3RVTD 1TETL 2DQEH 1HZKA 2EQDA 5AG8A 2AAAA 2OMBA 4HWEL 3EHBB 3KVQA 1P4LB 5F7UA 3X12A 1JVLA 3GMPA 4N2DA 4HALA 4U6XB 3IGKA 3RZCC 4YFEA 2AJVL 3IMTA 5IGXL 1TU2A 2PYEA 4LP8A 2XV6B 3G5YA 1FNGA 3GDBA 4Q6IA 3VFRA 2H9GA 5D4QA 3QUYB 4Y16B 4FCAA 3ENEA 2D4FA 2J56A 1KXQA 4LPYA 4F7MB 2BERA 2ZCLH 3WIHH 2F8IA 2ZSWA 3CFCH 5JXAH 4ESKA 5JOPE 2CRIA 5DVNA 3RFZC 4GNKB 1S7XB 2JJSC 4HLJA 2QADD 4WI9A 1F8TH 4WLCA 5F0JB 3SBWA 3RWIA 4AM0B 5E4IA 3N85H 4DEWA 3O2WH 1F2XK 4HHGA 2FLMA 4G9DA 5HHQB 1I7UA 1T7YA 1WZKA 1RUMH 3FTZA 1NDMB 2YQ2A 5DMJB 2C9PA 2CKBL 5L9DL 3AT0A 3TT3H 3AQZA 2V9TA 3MRHA 3GO1H 2NQCA 1ZY9A 1WFMA 1I8AA 1RU9L 1U92B 2ZD0A 3UJTL 1K8DA 1JPEA 2XOTA 1UUNA 2P7TA 2XU9A 3MBEA 1X5AA 3QUZD 1I9JL 4WKZA 4MB1A 2FVNA 4NN5C 4QOKE 4D7PA 1AFVH 3L3IA 4MD4A 1GOFA 3RA7H 4R9HA 1A4KA 2IXQB 4A2GA 5F1NB 4YZWA 3UH8A 1T66C 2NXYB 2FIKB 4ZXBB 1I7RA 3WTXA 4CSSA 3O6ML 2OL3L 1GZQB 3FT0A 4IEFA 3TXAA 3UEQA 4OCYL 2MWCA 1E3FA 5EF2A 5CEZH 4Q4IA 2BDNL 3GKWL 1CT8A 2PCFB 4WWKA 4JFOB 1RHHB 5FGRA 2HFEA 1JTPA 4TQ8A 1TFHA 4E2OA 5I17A 4I9WE 4QF1A 4JFDA 4HUVA 1XF1A 1BD2D 1G7MB 2OSWA 2E59A 3FPYA 5I1IL 2PO6A 3I3EA 1CG9A 3LN9A 4LEOA 2WINB 3ZHNA 3DUUB 2HFFB 4KK6C 1KELL 2YXVA 4JFHE 4X9BA 1XR9A 3RWJA 5HHVH 2X88A 2CDFB 2VITA 3QQ4B 3EGDA 4AIOA 4YPJA 1QBLH 5I71C 2YRPA 4XI5D 3S8FB 3O8XA 1D2OA 4LVHB 4E9VA 2ZOWA 4KZDL 4A39A 3SDXB 1FG2A 1KB3A 1X3DA 2Z31C 4C47A 3QO0A 3STBA 4K3DH 4LSSL 4RH4A 4PJ8B 2CK2A 5BS0D 3VXME 4O4YH 3NJVA 3SDDD 3CN4A 4N3TA 5JIHA 1IMHC 4TNFA 1FWXA 2QSQA 4NO0B 1OTSC 1VCAA 3G5WA 5BVJA 4Q2ZB 1MRFH 3I9PA 3DI3B 3U36B 3KH3A 2OTWB 3OJDA 3HPLA 4YE4H 1FH5L 1LQSR 3P77A 4U6YB 4NWUL 3VXMB 1P5UB 4JKWA 3KWXA 4CDGC 1I1FB 3ARWA 1UJ3A 4M00A 4S1QL 1XCTB 3CUPB 3N91A 2RB8A 4L0ZA 1AZCA 2JKSA 4HWBA 4LBAA 4XVSH 5KBPA 4X4KA 2W1NA 2XA8L 3QI9B 5AYUH 3GRWH 2PCFA 5GGQL 2KH2B 4JRXD 1LD9B 4GSDL 4P57B 4YSPA 3S3CB 3MI6A 5DEFA 1P4IL 1MHEB 4PJDA 4GUCA 5C8JB 1VIWA 4LT7A 3HNTL 3H54A 5I28A 1IC0A 4ZQKA 1WAAF 3V6BR 4U4BA 2OMTB 1Y07A 3P4NB 2WIIB 3FONA 4OGYH 1A4KB 2IXQA 1TTCA 4Z3JA 3SY0B 4G6FD 4XCCH 4RRPM 4RAHA 2N4IA 1J8HA 4ENED 2F7QA 5H2BA 5IMOA 4FGMA 5KYWB 1ZWIA 2H1PH 2YXFA 4KRPD 3VYPA 2JJUA 3S3JA 1MFAH 1ZANL 5AVRB 3O4LB 4ONHB 1OD7A 2WIIA 1OAZL 2J73A 1ETA1 3ECBA 2W07A 4Z7UF 4OTXH 3DX1A 5DC9B 1GOGA 1XDTT 3ZTNL 3EKCA 2DMGA 3RQ3A 3H6AA 1YAIA 2F5AH 3T1WA 3GSNH 5KVGE 3AGVA 3S5LA 4P9HH 2XX0A 2HX8A 3GS0A 1GYCA 1LK2B 3PFUA 1MLCA 1O9VA 1DUYA 2BS71 3TBCA 2FCBA 2RCSL 1ZHNB 1FP5A 3LDBC 3T6XA 3MJ7B 1OOAA 4OLYH 3GMLA 3O6KL 1S7TA 4IIQC 3NABL 4JY5L 3LIZA 4P5RA 1XGTA 4IQHA 5D7SL 3QPQC 2Q8BH 5ICUA 3J7HA 4M7LH 3H9HB 1LWHA 3MRQA 1AIFA 4LLWA 3PNRB 4AGNA 4POZC 1T1ZA 5IHZB 2Y1AA 4A7GF 4AZUA 5J3HC 4G9FE 1FH2A 3F7PC 3C08L 3CAFA 5GSVB 2J4WL 3UPRA 4UANA 3X12B 3D52A 1IRAY 5AVTB 5IHWA 3MJ9L 2DJ4A 3E9UA 3CSGA 3E7JA 4OFKA 5FYJU 4HEPG 4X6BB 3UTQB 3UTTD 5J1TC 3GEWB 4J3WA 5FGSA 4XGZB 1NEZB 2H2PC 4MCYB 2ATAA 4NRXA 1JZGA 3SO5A 4MNGE 4NKMA 4H4NA 4ZSOB 3W9EA 3BKCH 3LKSA 1W9XA 3WENA 1EA9C 4ZODA 3IDYC 3BO8A 3BYYA 3MLYL 5GRUH 1CLCA 4PJ8D 4WY7H 3UROR 3ROLA 1I53A 4KAQH 3JYBA 2A6IB 1CN4A 4JZOA 3U30B 4RX4A 3DLQR 3HBQA 2WAQA 2MSPA 1SBSL 2R8SL 3JWDC 1WBYB 3ZKSD 3V10A 2ZUYA 3HG0A 1HQRB 1P7KA 3HE7C 3KGSA 3X2QB 5B1CA 1NPNA 1QATA 3KPMB 3OHXB 5DDHB 3UGEA 2VDMB 3B2DC 3BH8A 1MLBA 5D1ZI 3CDZA 3NCWA 5TDOB 1OTUC 1MCKA 5EOTA 5CR1A 4Y88A 2QHRL 4KTEH 2HKHL 1BM7A 3HC0B 1AKJA 2NQ3A 1I7RB 2DAVA 2GABA 3QEQD 5EUOF 1PKQA 3U79A 4FL4C 1FZOA 1JTTA 3U48A 3WJMA 5F1NA 4H0HB 1G1KA 4C56A 4DGIH 5KN5B 4NAJA 3DJ9A 4JDEA 4ZNEE 5CBEB 4CL7A 1RPKA 2YIHA 3KYOB 3SQBA 3LZRA 5CEZE 1BCIA 1ZLSH 1GGBL 2WAHA 1NCBH 3R7QA 3FRPB 3LIZL 5FPIA 5JXEA 2R2CA 4UQIM 2WQXA 5D2NB 5A6IA 2JE8A 5JUEH 3HG4A 1SM3L 1N6QH 5KYUB 3NFSL 5T5NG 3V6ZA 5ACZB 4EJ1C 2I5YH 2EDQA 2P28B 5CLWA 4X4ME 4JFEA 3KWVA 1QSFD 2GVYA 3B7RL 1L7TH 3S88H 4FC3E 4KI1A 3HI5H 2VLMD 3BQUC 3DTUB 1M2VA 1VFBB 1B6UA 1A9EA 5IBLD 3REVB 3KPPA 4PRDB 5PCYA 2ZUWA 4PJ8C 3WDHA 3S5ZA 4JB9L 3KLLA 4MB5A 4KROB 4JRYB 2WLLA 2WWKT 3TS8A 4NQXA 2J8OA 3MJGX 4LAQL 3WJJC 1I8MA 3CFJA 2WTRA 3RVXC 1JGDA 4NN5B 1LE5A 1FJ1B 1KEMH 1G43A 4M8QB 1QI5A 3DSNA 4E5XB 1M6OA 2VLRE 5DURB 4KXCA 4PJIF 4W4OC 1XHHA 1W6WA 2J12B 2J6EL 3ARPA 1NCDH 4KX8A 2ZOUA 5DD6A 1L5GB 4PS3A 4ZMNA 4XBGA 3II2A 2IH3A 4Y4HB 4N24A 2YAEA 3KMDA 1BLNB 2QZQA 1AQKL 4OF6A 4BFNA 1R0AH 4ADGA 4U1GC 3GSWA 1PZSA 2EDDA 5CLTA 3S0PA 1ZS8B 1L9TA 5BCAA 3BZEA 2CJSA 4BK5C 2W80C 4XC3L 3MZTA 4ILDA 4EZJA 3LKNB 1ZSHA 4F2MB 2P8LB 2X89A 3LZOA 1F45A 1EEYB 1FC2D 3MLVL 2PR4H 2MH4A 3TEWA 4LFHG 3DSFH 4ZSOA 4NZ8A 3W9EB 2O72A 1G7PA 5CCGE 1NLDH 4DOHB 3L4CA 3QIBD 2O5XL 2PXYB 4UT9H 1GOHA 3KPSA 4F15B 1Z9PA 3H9SE 1ZA6B 3WFDL 3KPNA 3ZYIA 1RZ7L 3BSZA 4G7QB 3FW6A 1Q9LB 1ET8A 1J10A 3K7UA 3KEHA 4NZRL 5E4EC 4P99A 4GRLA 1AP2B 2K3HA 2HFGL 5EPMA 2VDQH 5E7FA 2VERN 3L95A 4V1DE 2R1XB 4YEEA 2XQBL 3QAQA 4AENB 3F58H 1SQ2N 3IJSA 1PY9A 5T1KB 4PUBL 4WTZA 4KQ3L 1PZ3A 4G6MH 1T1WA 1GZPA 4X8GA 1FL5A 1FZJB 3ULVD 3FUNA 1HHIB 2LW3A 4U1HB 4XVTH 5FM5M 1NAKH 3WXVH 2WXIA 4ODWB 5IB3A 3NP3A 3FUIA 3K2UH 5LN4A 5AVVB 4YHMH 2GT9B 3APDA 4N0FA 4LSQH 5CP3A 5D72L 5C09E 1KGCE 2XKSA 5IBTH 3R4RA 4JHVA 4ABQA 4OD2A 4ZNCD 4XH2A 3RPIA 1GMEA 2JIXA 4CADB 4KXZH 2W91A 4W9DC 1KTKE 1KYDA 2D2OA 4ZPVA 3O4LA 5FYKL 4F58H 3BIAX 3EOAA 4IKLA 2VXTL 1RUQL 1R6VA 4XNAA 1WD8A 4K4KA 5E0FA 1CD1B 3IFLH 4LLYA 2DYPA 2G5UA 4KKAD 4FTVB 1BD2B 3ML9A 1OSYA 4PR5A 5T1LA 2WP3T 3RX7A 2E7LC 4QTHB 2VXUL 1XGPB 2PCPB 5D2LE 3QWNA 4IK7A 2VIRB 5FUZL 4J3SA 2YWYA 4ONFH 5HYJE 4XXCC 5SWZE 3VDCA 2QSVA 3L3OB 4WO4C 2GJZB 4PS7A 4TULL 4P5TB 1UD4A 1X5HA 1KJ2A 1E8YA 4RDBA 2MCPH 1K6QL 3PGDA 2WC7A 1WIOA 4KI5D 2NYZA 5I66B 3X3GL 1TKWA 4KZ0A 4B96A 1FFPA 5JHDE 1M05B 4HDIB 1UJ3C 2VDRB 3QXAB 1RVFL 5DLML 1NIDA 5E8OB 3WN6A 2B8OT 3QZWB 1OGAB 3IMWA 3ISYA 3WHE1 1YQ2A 3SE3C 5KVDL 1RP9A 1KYUA 2G60L 4KK8C 1IM9B 2OAAA 2CGRL 1U4FA 1IFHL 2X4SA 3CZFB 4PJGA 1WEJH 4HWNA 5JPMC 4NKIL 1YNLH 4R2GB 4GXVL 2X3CA 2YRLA 4LLUA 1JPSH 1QBAA 2GFBA 2N7BA 1PZCA 4LVNC 1LO3H 4KKNA 3BRDA 1G9NH 4QTIH 2GJ6D 4O02H 3ZE1E 1MNNA 4AW4A 3MLTB 1E5YA 5AWNH 5HGDA 5JIKA 1UVQA 4PJEA 4TQHA 3L4XA 3QWOA 3CC1A 4KNQA 3BWSA 3ARVA 3ZSTA 1ONQB 2HUHA 5B8CA 1UEYA 5GZOA 4JREC 4WFFD 1TOXA 3EJSA 1Z1WA 3FO1A 4GLRI 1T7VA 2CJUL 3BD5A 2FO4A 2YAFA 1IIKA 4TUUA 3PP3H 4FG4A 4QYOA 4C4KT 4M48L 3KNBA 1GTFA 1QKZH 2WLJA 3GINA 3Q2WA 4GW5A 1FO0B 5D71H 4OLWH 3VG9C 3UFIA 4KTGA 1GKOA 3N85L 1M3IA 3RJQB 2IDSA 3SDCD 1PVHA 2ITDB 4NOBA 1V7NL 3DV6B 3W2DL 3DMMC 3BP5A 3N1QC 5MP6L 5I74C 2CKBH 1R5VB 3B3IB 1GPOL 2HVKB 1F90H 3GMNB 2Q86B 5GGVH 3UG5A 1RH8A 1TNNA 3ARZA 4I0PB 2Z35A 2BJML 3UGUA 3DXAB 3MZGB 5HPMB 2V37A 1OT2A 5FW7A 1S7VA 1HCZA 4YXLL 2J2ZB 1U8OB 3CFEA 5EZJA 2J43A 3APMA 4JY6A 1K8DB 3NPSB 4XP4L 2DQ6A 3MMEA 2P4AB 4JJHA 1K3IA 3ARED 2NY6D 4ZFOL 1KENL 3D3VE 5C09A 4Y9GA 4N2FA 3H9HA 1WUNT 3WY1A 5E95B 4EKJA 4NYLB 2WLLB 2AI0L 1JRHL 4H2AA 4NKOA 2QDVA 3O6MH 5LHDA 1KN4H 4YO0B 1KACB 3P11H 1OAKH 4XP1H 4ZMPA 1TMQA 4ZW3A 4WSKA 3S37X 1T1XB 4UOQA 3PS6A 5E2VL 5T5FL 4M5SA 1HHKA 1MNUL 3HG3A 3JVGC 4HUKB 1CLOL 4L8BA 4FQHA 1SXBA 2DQEL 4YGVB 1MHPL 3P69A 3K71A 3OJMB 5I1IH 3RWHB 3NPZB 3HLAA 1I3RA 3HS0C 5CBAB 4OZHE 5L8LB 2PLTA 4YDKH 2IC2A 3IMSA 4MNQE 5IGXH 1BIIA 2OL3A 2WXHA 2BVEA 1CQYA 1BDYA 3S3SA 4Z7QE 8PAZA 4HOMA 5IMKB 1FZMB 4Q52A 1PIFA 3H4HA 4HS6A 2DN7A 1UA3A 4RMQA 3RZCA 4HG4J 2ESVB 4G8AC 2JCCF 3DPDA 2W9LA 3EYFB 4G7YH 4O51B 4G8GD 5DMGD 2VWEE 4MZ2A 1MZYA 2H3XC 1Q72L 2HYMA 5IQ9B 3OHXA 1QR4A 1DO6A 2NLJA 4UBDD 4KJWD 3I6KA 4XCYB 4GO9A 3W39A 2BXZA 2YA2A 4IS6A 3QXVA 2ESVE 3A21A 5HHMD 4N6RA 3MBXH 3RVWC 2FO4B 4DGVL 1TXKA 4U6YA 3C9NB 3P40A 4C4KO 5DTFA 4NQDB 2ADFL 4JZOB 4WK4B 4HLZH 5D70L 3IJHA 3C5ZC 1JN6B 3ROLB 1T21A 5F72S 5GGVY 1C08A 4MA7H 1VCBC 3WLWC 4XNXH 1HK6A 4UYPA 1XEUA 4XVSL 3SGKC 3LKPA 1SUJA 1QQDA 2IPTH 4KMLB 4MQSB 2YWZA 5DD1L 5A2CA 1P4IH 5C0GB 3T2QA 4TQEH 2EDHA 2AK4D 4UAHA 1JV2A 2X4RA 1MF2H 4B53A 1ND0B 5IG7A 3ROOA 1ZT4B 1TVHA 3VDBA 3RVUC 4JJOA 3D5OF 4JX0A 3K91A 3V7AG 3BPLC 2HG0A 5D2LF 1PQZB 3UL4A 2LE9A 3BMVA 3Q44A 4OLZH 3RI5K 3GC3A 2AMUA 4WI3A 3V52H 2ETWA 1FL5B 1FZJA 4KX9A 1R33A 3CFTA 4PJAB 1FFOA 2GBVA 1EXUA 4AIXA 2P8PB 3DUUA 3VD3A 1W15A 5FYKD 2VMDA 2QQKL 1E43A 5AW4B 1SYVA 3N43B 1KELH 3WNMA 4J1UA 1JGEA 1IC4L 2IALA 4OFIA 2YPVH 4U1SB 1NDGA 1I8UA 2DBLH 4OUUA 3SO3C 4NQSB 4QMEA 3L3OA 3SHSA 4ANVA 1SEQH 3M8OL 1CT8B 3KPRE 4KC3B 1WJ3A 4EI6A 3SGDH 1IILE 4P9MH 1AGFB 1E30A 3ZT5A 4DP7X 5T1MB 2PCPA 3WTSA 3FT3B 3VNYA 4PJXE 2UZPA 4K3DL 4LSSH 5I73B 3ARFD 4JL1A 4D9QD 4YBQC 3JXAA 4ELDA 2KZKA 2Q8BL 4FFYH 3LH2H 5EC2B 5IB2A 2YK1H 2YPLD 1IKNA 1V05A 3QZBA 1WBXA 1TTAA 1BYPA 2C4XA 4GKZB 5IY5B 4MJ5A 5D6DA 5I76B 5I1GL 2ZKWA 1F6AB 1CE6B 3EFFA 3TA3B 4MCMA 5F89A 1IAKB 4OJDH 2GG1A 1HZHL 2XTLA 3DYPA 4RIRA 2FHFA 1OE3A 3FU5A 3P9MB 4A6YH 1L5GA 2CDEA 3UTTE 4M4RA 4OGZA 1XF3B 4OY9A 4U3CA 4F9LA 5HP5A 4DVRL 2UY7A 3ARDC 4PBXA 3D69A 3N43F 1R24B 2NW2A 3T3MB 1QZ1A 2OMZA 4B5ZA 1YG9A 4GKLA 2YAQA 5BUAA 3SYQA 1W2KT 1YMHA 4ATWA 3W11D 2FEEL 3EHBC 4LPVA 4JHBA 4P46B 2ADGA 3SPVA 1SVCP 2GUYA 5D2LB 1BWWA 4NM8H 4DP1X 4JVWA 3L4ZA 5J1SC 1VFBA 1N6UA 4ZSOE 1JV5B 4R2GC 3QUYD 5ENWB 1UEMA 4RFNC 5LQBL 3EYVB 2EE0A 4HXAH 3ZX1A 3U46B 3LEXB 5I1LB 3FB8B 4IHOA 3KPNB 2XIDA 5HGBB 3FF8A 1DANT 4GP8B 3ATEA 3SIKA 2QADB 2R69A 3U2IA 4LDCA 3VD2A 5E6RB 5CUSH 3R0NA 2W60B 2MCG1 4HBCL 3IDGA 2F5AL 4FLOA 4XO3A 3TJHC 3QORD 3CPLA 3G9VA 2CPCA 4PVNA 1I3VA 3INOA 1SF3A 3CQQA 4TSAH 4AJVA 1FVEA 4WW1A 1SXNA 3EG9A 4K3HA 1XR9B 2KQMA 5I8CB 3QEGL 1LO4H 5LDUA 3NABH 2QGCA 3L4YA 4IOFD 4ZMWA 5HPOA 3K6FA 2HSIA 4L3ED 4C56D 3GM8A 3MRNA 1CG9B 3PUCA 3CFKA 3H3KA 4RMTA 1SM3H 1YDPA 4FJYA 3K81A 4PCTA 2H7WA 4XZUA 3VFVA 3RDTC 4BINA 5C3TA 2ZG1A 4N0YL 4PCYA 1E0OB 1OPGL 4TS6A 2WKOA 4M7ZC 1S5HB 3KLDA 4X98B 4KFMA 4ZTOH 2HFEB 1WFJA 2R29A 4UT6H 3WFZA 4PJCF 1NGXB 2IVFC 1CXHA 3MJ9H 3EJCA 1W8OA 2BSSA 1RSFA 3K72A 2WLNA 3CFKB 1AGDA 2H32H 2W65A 2QPDB 5C0CA 1YEGH 2PF6A 4JRYA 4DFHA 2FUQA 3LKRA 4QHUA 2OR9H 4XPGL 5E4AA 5AZ2H 5H4YA 3VDAA 1R3JB 1RY7B 2E7LA 1TTBA 3RWCB 5I8OL 3D6GA 4JUSA 1U3NA 1PCXA 43C9B 1C16B 1EFXA 4ZMOA 1IE5A 2BVPA 2HXAA 2D31A 4AV5A 5JW5B 1CDIA 4R2GD 3HOGA 3GJFH 3NIGE 2C9SA 4WQOA 5I1AA 1IBBA 3WKPA 3MRJA 5TF0A 4PV9B 2AQSA 1AZNA 5KBLA 3EYUH 5CWSA 3CZGA 3FRPA 3N42F 3FU7A 4X6DA 3C6LD 1S7WA 2HUEA 4H7VA 4PW3A 3UO8B 1I7UB 4LLDB 2WQSA 3CZSA 5T33L 3NDYE 2ATPA 4HUXA 1HEHC 3SPJA 4PJ9D 3WE6A 2GITB 4GT7A 5EF1A 4JQVA 3IEAA 4PREB 5DI8B 1AKJB 3MOBH 5ILTH 2Z8WC 3QDGE 4L4VA 4Y89A 4BFEA 3S8GB 5I1CL 4J28A 3GF8A 4NUJA 3FUMA 4QY8B 3HN5A 3WFDH 5C0DB 5D7LB 1BM3H 1M1XB 1WCQA 1JZ7A 1ZLSL 1PDKB 3P9WB 5KZCD 2ZNXA 1WCBB 2EDWA 3C12A 4NZRH 3BKML 3QI9D 2A74B 4OB5L 4YSAA 2VDQL 3HB3D 4U7MA 3B7YA 5JUEL 1MH5B 1RPQA 4RIRB 1L9SA 3C09B 1A47A 3CLEL 2FNWA 2FX8H 2FZ3A 4V1DD 1IAOA 2HWZL 4X5WB 2OMVA 4W68A 4YS4A 5IQMA 4QRUB 4AGOA 1H5BA 3FU9A 3RL2B 4P0DA 5IMOB 2XG5A 2I69A 1J8HB 3PABA 3UAJC 2AXHA 2IDTA 1MFMA 3FQXB 5D96B 3PWPA 1S9KC 1DO5A 3HFML 4MB4A 2NY6B 3IXTA 3QDMB 3P54A 3G6AA 4W6YB 1ZGLP 2X4TB 1XT5A 1AGCB 2CPUA 1YHPA 4JVUA 3ZUNC 2HT4D 3QCTL 1MREH 4ZS7L 3TCTA 3C60C 5MEQA 4Y4FD 3HC3H 1ES0B 1U4EA 3LQZB 5F93C 4BFGA 1XB8A 1NCDL 2L7EA 4ELMF 1TQBC 4HC1L 4PM1A 5DEGA 3FHAA 1WBZB 1AIFB 4LLWB 3EZ8A 3UO1L 4OGQC 1XGRA 1URZA 3VH8A 1AAJA 1HKFA 2PUQT 3UBXG 2FEEI 2XFXA 3DIDA 1DBBL 4H88L 2HCZX 1GGIL 3RYMA 3ZTDC 4PJ7A 4TPRH 4WVRA 3VGAB 1J05A 4KK9D 1HDMA 2WSKA 2XZQH 4ZAKA 4PB0H 5BQDA 4AEFA 4YHLL 5C0JB 1YEFL 3MLVH 1PG7H 3PHQB 2O1AA 1ZPLA 2G9HA 4PLKD 4N0UB 1NLDL 4P4KA 1ZDQA 1CL7L 1U91A 3I6SA 1QTSA 4PJ5D 4FLSA 3ZR5A 3VFVB 5ID0B 2AF2A 4LPUA 4LK4A 3GI9L 43CAB 4RCAA 2KKQA 3X3GH 2IDUA 5DMYA 4KUCF 4ZDHA 3I02B 1B3JA 3FUHA 3QR2A 2A83B 3RVTC 2NUPA 3V0IA 1R4XA 3HC2A 3VI3F 1G7JA 1PCSA 5GRWA 4GG6F 3RL1A 3VFUA 1QW8A 1XH3A 2YA1A 3QG6A 5C08B 3FDWA 3MRRB 2HJFB 5F7DA 4ZS6D 1IFGA 3QDGA 4L4VE 4UTCA 5DJ6A 2ZXAA 3LH9A 4GKSA 3E8VA 4KQ3H 4EXPX 1JPSL 2OI9C 4HS8L 2J88L 4IHOB 5A3ID 3F6JA 4MRBA 3QEHB 2DWSA 3QDAA 5DEFB 1P1ZA 3GRGA 3UGXA 3OMNB 1AKJD 3DYMA 4HK3J 3WHE0 4NUPA 4QRRE 3STLA 4YHML 3PL6A 3SD5A 2X2YA 1DJHA 1SXCA 5CP3H 1LMIA 3SPVB 1HKLL 2QADC 3VXMA 3D0LB 1R3HA 2BPBA 5DMGC 4FI8A 1JDAA 4GSXA 1YMHB 3VWKD 2EINB 3T08A 4PH8A 2AVGA 1R5IB 2MQCA 2DW5A 1JI1A 2Y6TE 2Y25A 3H0TA 3NZHH 3P0VL 4KKPA 3ECUA 3ZDXE 3MJ8B 1FV1A 2CKBB 3CMGA 4MD4B 3G5VB 4CVXB 4R4FL 4WV1B 3EOTL 4FLHA 1NMAL 2V4LA 3PJSA 2YUVA 4OLWL 3VI4E 3RDJA 2H0FA 1F2QA 3P30L 4P46C 3QI9C 3SDAD 3TC9A 2AEIT 4QR7A 2VQ1A 4R96A 4GT0A 1OSPL 3UTZB 5DFWH 4FQHB 1D5IL 1XIWC 4RWHA 3HI6L 3WGUB 3JWDH 1EJFA 4NXSA 3DETD 3G6JA 5EIIG 3TYGH 1U8IA 3MYJA 3PQYE 3ESOA 5F0LB 1HNFA 4XMPL 4LF3B 2XG4A 1U8JB 3DOSA 3KR3H 5LXGL 4FQXC 1BQ5A 1CVSC 4X5LA 2CHNA 4X0KB 4AYID 1CGUA 4G11A 1NCOA 2X44D 2DS4A 4K55A 5JIMA 4QAMB 4QF1B 1EJ6A 1MFBH 1JRHH 2GY5A 4G6KH 2NSXA 2WBWB 3IKCB 1WZ1L 4KO5A 1OAKL 4ODSH 1PL3A 1NDGB 5JPNC 3RVWD 5DRWB 5TDNA 3SQRA 2J5WA 2JV6A 4JKNA 5G2NA 4LPCA 4JQIL 4JS7A 4QNPF 2F68X 2D7TH 4KK6D 2DWEB 2AGJL 1XIWD 3H9SA 1OQXA 1TQCB 2PW1A 1KGJA 1LWRA 1D7DA 5HD8C 1CBVL 4L4TE 3QCUL 5KUMA 1WK0A 2ROXA 4JPQA 4DQOH 3DV6A 2DWXA 4PRPA 1XXFC 1N8ZB 3FU6A 1ZOXA 4IRJB 5J06A 1ACCA 4YSDA 3AVEA 2EDNA 3BLPX 2DLTA 4R4BA 2G4EA 3VM7A 1FGNL 5HGHB 3NRFA 2VL5A 4IBYA 4NOFA 3VG0L 4CMMB 3QWQB 2CJUH 2H0EA 3BAEL 1B0GA 3MXWH 5DA0B 8FABB 3OPZH 3FT2B 4IMLB 5KYNA 3Q3GA 4G83A 3MRHB 1ASPA 2E0PA 5SX5H 3FTGA 3QYCA 2JI1A 3LS5L 1T89A 2Y23A 1E4WL 3C5JA 1AANA 2R27A 4NSKB 5HJDA 5C0AE 3VXRB 2PABA 1NGWB 1V7NH 5ISZD 4Z7UA 2ZCKH 3FTGB 1BZ8A 5GGVL 4WJKB 4EZMA 2IQAA 3JT2A 2BJMH 4HD5A 4DGVH 1YEIL 2P5EA 5FW8A 3T3PF 4ZUSB 4YXLH 4JE4B 3FTXA 1QLEL 1WFIA 5FFGA 3G5XA 3B1TA 5KWYC 4XNXL 3ZKXB 2EE9A 1FNEB 1AY1H 4MZIA 1OTSD 2IPTL 1FVDB 4ATTA 3F7RA 1Q0XL 1FORL 3FUEA 4N8VG 5DS1A 1E4JA 2AI0H 2WVTA 3WIFA 1ML0A 3FO0L 1FL3B 1DZ0A 1CICC 3BZ4A 2EC9T 2WTOA 3DVGA 4Y1SA 1KN4L 1KJ2B 1KCSL 1WISA 3D85A 1HJBC 2X1PA 5IMKA 5C0BB 1RIVH 1OWWA 1HFUA 3G5XB 3Q05A 3GXFA 2DMKA 2UUDK 3L1OH 4K5LA 1PD0A 3NFNA 3AQYA 2AK4E 4LLAA 5E2VH 4JN2B 5J11B 1FE8H 1J1PL 3TONA 3WFCL 2VIRA 3WLBA 2NY0C 5BRQA 5F7MC 4AC4A 2OZ4H 4JPVL 1DSYA 1WD9A 3D06A 4WUUA 3RY4A 5ES4B 2CR0A 2L4OA 2V33A 2ZCHL 3ARBA 1DLHB 3KPOA 3LRGA 4MB3A 3S48A 2E86A 4YWGL 2NNAB 4NJAL 4CSPA 4NPYB 1KNOA 1C5BH 4H1LG 4HKZB 3TFBA 4HLEA 4W9HC 3ZO0A 2ZJSH 2VLRB 1A7RH 3C5JB 1QSEA 4AVIA 1VZGA 3EOAB 1TPXB 3PQYA 3TP4A 3V0DA 4EI5D 2BOCA 1MW0A 4JPSA 1UOLA 1RMFH 4CAGA 3LZPA 1Z9MA 2YEZB 4NYLA 4Q74A 4Z7OB 5A7EA 5IQOA 1CD9B 1EZSA 1NCHA 2ZYIA 3NCCB 3JVFC 5E6IA 2MMXA 2WMPA 3HE6D 3BDYH 4CRPA 3AWFA 3EADA 1JZJA 2WB1A 5I6XB 2WVVB 4MNHA 1SNRA 4LVOC 4RFEB 2Q8AH 2IPKB 5DMKB 1QRKA 4E42A 5T3XH 5BRZA 2FWSA 4K5PA 1SJEB 1DQMH 3V4VH 1E2WA 1KBPA 1A8JH 2GUOB 3M1OA 2RHEA 1TTFA 3MBXL 5MEPB 3WY4A 3K1KC 1AYRA 4UV4H 4F1SA 4AENA 5K59F 5I6KA 1OD9A 3AXLB 5H35B 3BRFA 1DEEB 5CINH 2AANA 4LEBA 2NY0B 4M29A 1SMAA 1XWVA 4QOKB 4OZGA 1NM4A 2IMNA 4WSGA 4DGWC 4Q9CA 2E9JA 2ZXQA 2V7HA 4PVMA 3VU1A 4B9FA 4QYOB 4QXGH 3ZKNC 3JBG7 4TQEL 5DZOA 1CMOA 3T77B 5IUCA 4TRPH 5J56B 1QAWA 1WWAX 3C2AH 3V0GA 2G3ZA 1ZTMA 4GINA 4NHUB 4OLZL 4UIKL 2IQ9L 1QP1A 4HJJH 4HXAL 3TN0D 4I8DA 3WFBH 1UENA 1JI2A 3FOMA 4TNWF 5DO2C 3GNML 3PGCA 4FZEL 1A4AA 2YGOA 3ME0B 1MJJA 1QLFB 1IC4H 2CO6B 2G5BB 4X7SL 2BSED 3ZMRA 1ITBB 4IIZA 4JMNA 4RMRA 2FSEB 1K3ZA 3PREA 4JPWL 3GSXA 5LBSA 3BKYL 2IAAC 3NN8A 4RFEA 4XN8A 1MRDL 1TZIA 1GYUA 1J1XL 2C26A 4P9ML 5GRXG 2WTRB 3K0YA 1TTUA 2EECA 2IGLA 3FFCE 2IGTA 2BP5M 5HDLA 2DLHA 3L3KB 3OGCA 1JD7A 2EIBA 1LO4L 4JKLA 4X42A 1YY9C 3MRBA 3O11B 2DM3A 4D0CA 3C6LC 3LH2L 4XHQA 5CLXA 1QRNB 4XMUA 3DO4A 2H6PB 2E75C 4PJFA 3EFOA 4Y8DC 4P5TA 2P26A 1UM5H 5ECGA 3WE1A 1IB5A 3BAKA 3EJQA 3FCTA 1MPAH 2XSKA 4GRWE 4JANB 1AD0A 1LO5A 2YGPA 3ARBB 1X9UA 4Y4KB 2Y3AA 5GZND 5EWIL 3VCLA 32C2A 4Q89A 1PYWB 2X4TA 5KSVB 2NY3B 3MV9B 3U0PB 1QW9A 2FJFB 3B4NA 2A4ZA 3C60D 3IDMB 4Z7WF 2WLMA 3APCA 4Z7VE 3GJFB 2CU9A 3FB5B 3P4MB 5CGMA 2IEPA 4TF4A 4ICWA 5KBMA 1NCWH 4ES9A 4FXGA 1YC7A 3ZMEA 3W1ZA 1HX0A 1C5CL 3VFNB 2DQCL 4XNUL 2D0GA 1GHFH 1NC4B 2HLFC 3KXFB 4F8QA 2F7IA 3TWYA 3FHQA 1MLBB 4N0UA 1USZA 4P4KB 2G75A 4L1TA 3EYUL 5ALCL 3WIIL 4KY1H 1IAIM 1QFPA 9PCYA 1EVTC 3CU7A 2XWJB 4J3OH 1X4XA 3MGAA 3FO2B 4NNPH 4YHZH 1U95B 1G0DA 1GZPB 1SHXA 3UDWC 5T33H 2Q7YB 4QJ4B 5I8EB 3JV4B 4XBEL 2YGVA 1UOVA 2VZ3A 2LLLA 1CQKA 4NQTA 1IGTA 4NQEB 4AJWA 4PRAB 5EOCH 3DDGA 2YD4A 3QFJE 2Y9RT 1D9KA 4UIMA 3QIWC 5IJKC 4G8EA 3LCYA 4J27A 2YAMA 4N2BA 5MEQB 2A9DA 4X6DE 5CWSB 2VT0A 1H3PH 1TDQA 2WQUA 3QEGH 4J12A 4Z76B 3RGVD 1IQWH 1NEZA 4LEXH 5E8NA 1B4LA 3B34A 1KCUH 1LDPH 1BF2A 2LVEA 1CS6A 2Z8VC 2B5IC 3LOWA 2BIMA 1FFRA 3QUZC 3KM1A 4LASL 3TWCL 5C3IA 3H7BB 3MRFB 3F6IA 1AXTL 3TN0B 2GIYA 1MI5B 1QFOA 2OA9A 2QQQA 3SDAA 2J5LC 1UM6H 2YRZA 3MRKA 3MQIA 4HIQA 1OLZA 4PQXA 4CSTA 3DHUA 1CF8L 1KJVA 2O61B 3NJIA 1P2CB 3KW7A 2APSA 4G80B 2Y36H 4GI6A 3LNHA 4I2XA 2W95A 4HCRA 3O8XC 5L6YH 5AZ2L 2C9XA 1G1CA 1HQ4B 3NJNA 4MKMA 3MJ7A 5L2KD 4U1JA 1JZ4A 1ZLVK 3II3A 5FX3A 5HYEA 4GUPB 3QCTH 1XIWA 2UZXA 3WUWG 2V7NA 3BAJA 4LCCC 3A47A 1DQJB 3VFSB 5L4JA 4M7JH 1TLKA 5JYLA 1AR2A 1C7TA 1Y1DA 2B0SL 5A40E 4LP5A 4NENB 1NKGA 5E5MA 3B9KD 5BO0D 1YN7A 1CFBA 3UO1H 2YAOA 3Q6FB 2JKLA 4I13B 2WB7A 3IFOA 3V0VA 5T3ZE 2XNAA 2EVHA 4AMWA 4EDWL 4RGNB 3L9RB 5HHNA 5T3XD 2A9ML 5J11C 2I25N 3ZDZB 2YRBA 3P4MA 3UBGA 4LLVB 4KO9A 5FKPB 5IVOA 1BQHB 3VI3A 1OT1A 2XTJE 3H53A 4FNLH 4XVUC 1CIUA 4F7EA 4PLKC 5ILTL 4WW2B 4LAJH 5IUSA 1EX0A 4ZFZB 2G5RA 5I1KH 3FQ4A 4ETYA 1KGCD 1KTJA 5FYJD 3MRMB 1N5AA 3FT4A 4NO3A 1AD0B 4F7CA 3C5SA 4Z95H 5ENWA 1CK0L 1CGWA 1E28A 2ZG2A 5BRZE 5F9WB 4R6UA 3LB6C 4XMWA 4YN3A 1C16A 1EFXB 1KTDB 4PLNC 2C1OA 4X99B 3JWOC 4WENB 3ELAT 4RAVA 3ZKMD 5D1XB 3S36X 1JYWA 1PKQB 2FX8L 1Q9WB 3P77B 3OJDB 4HMCA 4W9EC 1JZFA 3ATBA 1P9MC 3KLKA 4LCWB 5DFAA 3O9WD 3RG1C 3OKEB 1SOKA 2J88H 4GIPD 3T6VA 5BNXD 3KBHE 1T2XA 2A0LD 3NN8B 2XV2A 3Q2CA 4WHYG 1CB4A 5E8DL 3ERXA 3V4LA 3ARFC 2MIZA 2RGSA 4PJ8A 4MJ2A 3AG3B 3LNEA 2X2JA 5B4MD 1SJMA 3E8UH 3DC0A 4A1RA 3GBLA 2SEBA 1E50A 2MTAA 3WJJA 5I0ZA 1MREL 2DB8A 1XO8A 4JDTH 4ZMAT 4P2RE 2CRZA 3DX4A 3P0VH 3V4PA 2GBTA 2ICEC 5CZXD 4R4FH 1H9VA 1PJ9A 4L29A 3U4EB 2BRRL 4DUVA 1J9RA 2ZWLT 3NVQA 5KSAD 4H1LA 2O4EA 4RWYH 3BIBX 2CBTA 3FT3A 2LV4A 3ATDA 1CCZA 3MRIB 4UAOC 1G7MA 4MCZA 3AU1B 4M3KB 4PGBA 1GGIH 4WGWB 3LZNA 3QQDA 4KTDH 5C1MB 1X7SA 3B2VL 5TE6L 4OM1H 1UWFA 4DTGL 1JNHA 1XF2A 5G5DB 2WZPD 3ASNB 4Y1AE 3IB4A 4QHKI 2RFXB 3C6EA 3H8NA 4Z7VF 5DS8A 3PJLA 4XC1H 3GI9H 4U1NA 4KKBC 4L8SC 2OK0H 4ZXBA 1GCYA 4TNWK 4AE0A 1XTLA 4ODUB 2WUBL 3GKZA 3ESMA 3GLZA 3WTVA 1BIHA 5DWUL 2ICWA 2Z91A 5BUGA 3IRPX 1MFBL 1MJ7L 2UY7B 4P5MA 4UNUA 2JKJA 4E42B 5K9JL 4W6XB 3FQTA 1BQLL 1M7IB 4IOSA 4FDWA 1ZTXL 3P9MA 3V8CA 4HWZB 3SJVA 1XGUB 1DVTA 2DQDH 4M93B 4YSCA 3UADA 4N9OB 4W93A 1EAPA 2H4EA 2YEZA 3L4TA 5C6PB 2APTA 2EIKB 1HEZB 2QEJA 3ARQA 4PRBA 2DKSA 1YEHL 4F8PA 2AQPA 3PWVB 1U21A 5B38A 2WXJA 5GSRB 1IVTA 5DHMC 3TNMB 2Q2EB 2UX6A 5FUCE 4A7UA 3JTSB 1FGNH 2AP2A 2H45A 4UQEA 3MXVH 1UH4A 3NZHL 4IBTA 4NQCA 5A1AA 2GTZA 4H20L 4HH8A 3Q1SL 3C6LB 3OR7B 2BOBB 4I87A 4ODTL 4ADJA 1PDKA 4TV3A 1NMAH 1SY6H 3ZYJA 1X5FA 4Z0BL 1XCTA 3TVMC 2F54E 2E47A 1YMMD 2O5YH 5FYKU 3ZU8A 1ADQA 4TVPE 2ZCKL 3PV7A 1TQWA 2XVKA 5JPMA 1NOLA 5C7ZA 4G80A 3FT1A 4RISL 5GGSY 1JZEA 1A4CA 1O7DC 2M8XA 4OH2A 3QRLA 4NC1C 3WNPA 2X4QB 4G9FA 2C3GA 4P4RA 1HYRC 2I9TB 1BZOA 4OR1A 25C8H 4XP6H 1B4JL 5J6GA 1WFOA 1EEQA 4GRLD 1IC1A 2IWKA 1ZT4A 2HH0L 2VDLB 1Y1UA 1RXLA 2E3VA 3LN5A 2YMTA 1QO3B 2YC1A 3L7EA 4PJIE 4L4TB 1FORH 2AKRB 1FLTX 2WTPA 4F93B 3DK2A 4P2CG 1WWWX 2BVPB 4AQEB 4AV0A 1UA6H 2ZSVA 3QDMD 3L1OL 5MI0B 5J12C 5DO2D 5EIVA 5CP7A 2X89D 3NEOA 2NY1D 3ARXA 1G7LB 2ZF9A 2AGJH 4I1RA 1T6WA 2B1HH 5E1QA 3VXTA 2Q7YA 3PDOB 4MYPA 5IQ7L 2J1KA 4JG1H 5DQJA 1PGRB 2OJEA 4LU5L 3AT9A 1X7TA 2A3TA 2ICEA 4KRMB 2BP0B 3BUYB 1NBQA 4N5UA 5C0AB 2QT6A 1L6ZA 3EYSH 3BP7B 1S5HA 4NJAH 5IHUH 3TZVD 3WI9A 2ZKYA 4OZ4B 1IM3B 3VO0A 2B4CC 3BWAA 5FO7B 2M1KA 4UZGA 1XR8A 1J1OH 1NIEA 4I0PA 3WKMH 5DURD 1TJGH 2AJZA 2PW2A 3NFPB 1R5VA 3B3IA 4IGBD 5CJQH 4ZO9A 2OXHA 3QDJA 3BVWA 1YPZF 4JLRB 2VMJA 2WJ5A 4HFWB 4RGMC 1ZKAA 2WBJB 2HN7B 1ORQB 3AUWB 4OCXL 3OF6A 1XH0A 3UYPA 1RPUA 2UWEF 4UTAH 1W8NA 4HSQA 4JJ5A 4L8SA 3TF4A 1KB5A 3UIZA 1DQQB 4MWFB 2BY0A 4ZMYA 1MAML 1FO0H 4OIIL 1CDUA 5KSVA 2IDFA 3ZUCA 4OD3H 4JFEE 1BQUA 3FO1B 3LEXA 1MCPL 4LSTL 5EEZA 2CHXA 1PZBA 1SDDB 3TCLB 3WKNA 3HZYA 4JRXA 3AG2B 3QO1A 2C3VB 4JPKL 3BUIA 5CINL 4S0SD 4UOW0 4AM0A 2VZ1A 3QWOB 4K0OA 4GXUM 1AO7E 5INCB 1QBMH 1HE8A 2VSDA 1D9KD 4NZTH 4YHPB 4U0QB 4M3JA 2QELA 3FSVA 3CCHB 1SJHA 4I9WD 3VGGA 3ILQD 2NXYD 4G8IA 1HNYA 1QSEE 1P7QD 4AQ8C 4EKXA 1U8OA 3CFEB 3V0FA 2YMXL 2FECL 4N1EA 2RALA 4WV1A 4JKMA 5C08E 1SPDA 1S7VB 2UVEA 3L3JA 4MA1C 2BCMA 1FIGL 4JFZL 5IJCC 3BEVA 3VFGL 4A7SA 2ED8A 2FHCA 4RMSA 4N4YB 3P0YL 1FFPB 4HOZA 3EO1B 5C0EB 4MAYA 2FBRA 4P2QE 3MODL 4XPAL 5E1HB 4FF9A 3S5LG 1GW6A 3FUJA 2NR6C 5JQ6L 3IBOA 4L1DA 3ZRCC 4R84A 4N3UA 4FKKA 3NCJL 1SMOA 4XMZA 1OTTC 2YSTA 3MO1B 4JPWH 5PAZA 5MEOB 3TBBA 3QQDB 3AW5A 1OPOA 2DDQH 2E9BA 4Y5YB 4YSTA 2L7QA 3SGJA 4ZOAA