2OULB

The structure of chagasin in complex with a cysteine protease clarifies the binding mode and evolution of a new inhibitor family
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
107
structure length
107
Chain Sequence
KVTKAHNGATLTVAVGELVEIQLPSNPTTGFAWYFEGGTKESPNESMFTVENKYFPPDSKLLGAGGTEHFHVTVKAAGTHAVNLTYMRPWTGPSHDSERFTVYLKAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Falcipain 2
publication title The structure of chagasin in complex with a cysteine protease clarifies the binding mode and evolution of an inhibitor family.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Hydrolase/hydrolase inhibitor
total genus 21
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2007-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF09394 Inhibitor_I42 Chagasin family peptidase inhibitor I42
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2020 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2oulB00
2OULB 3M86A 2NQDA 3M88A 3PNRB 2WGNB 2FO8A 3CBJB 3E1ZA 2H7WA 3CBKB 2C34A 2NNRA
chains in the Genus database with same CATH superfamily
4YMPA 2CIIA 2DIJA 4Q9BA 2X4QA 5J8OA 5E9NA 2H8PA 2V0AA 2GC7C 3OAYH 3ZRSA 2VAJA 2H3XC 1MHEB 1E27B 1NCGA 4TXVB 4WNQB 5DS1A 3V4LA 5GS0H 3T0ED 1L7TL 4G6JH 2F0CA 3NT0A 1UWGL 4JPSA 1U8NB 1T3FB 1TKWA 3UACA 1EJ6A 1CMOA 5B1JA 2G9HB 5L0QB 1UFUA 2CMRL 4MBRA 2JKSA 5BUPA 4KO9A 1ZLUH 3EYOA 4B3VA 3ULUF 1LNUA 3G6JB 3OKMB 4N24A 4RZKA 3TXAA 2W0PA 1TYRA 3HS0C 3HZVA 4B9IA 1CI3M 1F8TH 3CD4A 3GBNL 4C56E 2TSBA 1B4RA 2IV8A 3QDJE 3MRKB 4AYBA 4P2CG 3CK0H 1WDAA 3OJMB 3IGKA 2CUMA 2XY2A 5L9DH 3KPRA 4JPIA 1I7TA 2Y22A 1MG3C 4PM1A 1CFSA 2C4FU 4J3OC 2BS9A 5I23A 2H0EA 5EULV 2BIPA 1BLIA 5DVPA 4DZ8A 4YDJB 5E1HB 2KS0A 5K69A 2EEBA 2WVVB 4PFEA 5KEZA 4K94L 2AJ3A 3ZHDA 2V8LA 1Y07A 7TAAA 5T5NG 3EUDA 1DQDL 5EBMB 3GM8A 1Z9SB 1UB6B 3DTXA 2X44D 5BV7H 4L8DA 2FX7L 2PR4H 3BWSA 4A7GA 3VXRE 1L7IL 4O2FB 1BQHB 1E9PA 5CBAA 4GBXD 4YHNB 4P9HL 1YN7A 3V4PL 1MFDH 3OB0K 1MNUH 4JHWH 2FCBA 2XT1B 5F7KC 2NTSP 1JE6A 5C09D 4P06A 3ELQA 5I18H 4ZG1A 3MV11 1IM3D 5JLZA 2FJHA 3CHXA 3QK0A 1NCWL 2D7TH 5B3JF 4MD0B 5T1KA 5IWLA 3PHQA 3S3PA 1PU0A 3D3VD 5EBWA 4DKDC 1XMWA 2X4SB 4YHIB 4GRWB 3QZMA 3W3BA 2BVYA 2OP4H 3P0GB 1BIIA 4AL8L 3G5XA 4L1TA 2QVTA 1NGQH 3SY0B 2P4AB 1EBPA 3GK8H 3MACL 2O6FA 3VWJD 3GIZL 4Y1TA 1QKZL 3DO4A 2VZVA 1JCVA 5B38G 2YN3A 1U3YA 1A1NA 4X4YB 4H0GA 5L2JB 3O6FC 5D55A 4Y9FA 3HG1A 1CURA 5EOCH 4KRPD 1R33A 4WEBL 2EYRA 4ZUVA 4RRPA 2WUCL 2JELH 3VG9B 3QJRB 2R2BB 2YC1A 4NBYB 2VDQH 2I07A 4N6RB 3W39B 5HSFA 2OXGB 1PY9A 4TLKA 3PYCA 4TTDC 5GSVA 3UZQB 2PPEA 2VDRL 5D7LD 4Z7QB 3ZBMA 1A7QH 5HD8D 3RDTD 5C0FB 3TBVA 3L95A 5BXFB 3H55A 3JZYA 4I0CC 3O45B 5FHAH 1DVYA 4IU2B 3HAEB 2IAMD 4XO5A 1XXFC 2J8UE 2QPEB 1YVLA 1WK0A 5HI3D 4HCRL 2UXFA 3AROA 4M7KH 3ETBJ 4H8UA 4RFEA 1YDPB 4M48L 1C5BH 1H3GA 4X5QA 1PZ5B 2IG2L 3MJWA 2ZUQC 1GPOH 1WT5A 3MLRH 3WYRA 1HXMA 1T66C 5FEBA 4KJWD 3QEGL 4U1IB 4XMXA 1FYTD 3G5WA 1LE9B 3HN3A 4NZUL 1TLKA 3NJXA 1CJYA 1DANU 1GAFL 4JFQA 3HI5L 3TWYA 3ZDYF 4YZWA 3UPAA 4GXVH 4L4VE 1OGAB 5TDPA 2VO8A 4AQ8C 4HG4K 4I0KA 1PNCA 4X6CE 5C07E 4K7PY 1U8PA 1QWHA 1AJ7L 2D4FA 4KJQC 4J4PA 3ZDZB 3SEPA 1SOQA 2P47B 5KSUA 1NC2B 4DP6X 5GGTH 2Y7QA 2OL3L 5HI4C 5D9SB 2GJZA 1J12A 4FXKC 5JHDD 2XXMB 3TV3L 2VGLM 1M6UA 3P3SA 3SBWA 5JIDA 1M3JA 4N8UA 4JCMA 4M1DH 3P9LA 2R0KL 2WWMD 1CU4H 2XXGA 4QJ5B 2CJUH 3QNXB 3EXJA 3FTYA 1B0IA 4XVJH 1R5IB 5GRWA 1SJHB 1OAXH 5D2LF 1VRSA 3BKMH 4TSAL 5FM8A 4URKA 1E40A 5CM1A 2NY0D 1XV8A 4LMQI 4OGXL 2J20A 3TF7C 4ZMZA 4YAQB 5F1IA 1PKOA 4RIRA 2VXSH 5DZPA 4L2YA 4LEBA 2Z8RA 3FUNA 4I77H 3IGFA 1SJEA 1XGQA 1E50A 3S35H 3SGJA 3W56A 4JO2L 2BIQA 3B83A 3M1BA 1CLZH 1X7QA 3KPRE 3WGVB 4LDLB 1RUKH 2WIMA 5AB9A 1A14L 2YBRB 3BD5A 1M05B 2ESVB 4PJGB 1RXLA 4L9LB 2JMRA 2FQDA 3IJHB 1RLBA 2R69A 4DPCX 2CLRA 2H2SC 4FFWC 4K23L 2ZKXA 4J8QA 4KY1H 4YHLH 5IM7A 3GSQB 1Q1PA 2BVEA 4Q9CA 2VISB 2Z9TA 3BZ4A 4OKDA 5AOLA 1BV8A 1JPSL 2P3YA 1UUNA 3QFJD 4HJGB 4LOUC 4N0RA 2O72A 4MD4A 3ZHLA 1J0ZA 1PAMA 4F91B 3B7RL 4PY8J 1XB8A 3OKDB 1KELL 4UIMB 4O4YL 4A2MA 1EAPB 4PRPB 2FLRT 3IS1X 1WFUA 5F7NC 4RSVA 1FNEB 4CMMB 3QBTB 3LS5H 1IB5A 1GMEA 1WA2X 4NCC2 5D8JL 4Z78B 5F21B 3FL7A 5KOMC 3IVKA 4UT9A 2FZ3B 2F68X 3OGCA 1AOHA 3GBMH 3GD1C 2DQEL 3GJFH 3IPBA 4LQ1A 3WHE0 1RV6X 2NX5D 4G8GA 1J88A 1T4KB 2DBJA 4S0TD 1SYSA 3WIHH 5DU7A 1IEAA 2WWKO 4XNXL 1N2RB 2KERA 5D2NA 4DO4A 4HV8A 1VPOL 5EDSA 3STZB 4PJHF 4XOBA 1QO3A 3NGBB 4CVZB 4QO1A 2YPLB 3F05A 4KKRA 4D7PA 3GSOA 3QEHB 1RU9L 3CFQA 4D9QE 4PJ7B 1MDTA 2ZWZA 2NCMA 2X4RA 4O2CA 3UDWA 5KYXB 4X4XA 1UEMA 3QORB 4RMSA 3VH8A 3WAKA 3NCCB 2PYFB 5HHOB 2CO2A 4EQ2A 4GQ9H 3TVMD 3MX0B 2EDTA 1CTOA 2Y7NA 2X70B 2ZXBA 4NN6C 1BFSA 1DUZB 2ICEC 5DMKA 4ODUA 3DKHA 3S97C 3MNWB 4LLWA 4H5SB 5IF0B 3O6ML 1QFUH 3AU1A 1N0XH 1I8LC 5F7YC 5KSBB 3M7OA 3QDMB 4XBEL 4CILA 2H1LM 5IMMB 2IXQB 5EC1B 2V5MA 2WTRA 1KC5L 3QUXC 5FFOA 4RZCB 1JWMA 3O4OB 5SWQA 2K3TA 1UTDA 3K72B 3L48A 4PJ8C 4HJ1A 2JE8A 5DHXB 3AMLA 2XKNA 2YXFA 4RAVA 1UD5A 4RX4D 2DICA 2XPGA 4AKOA 4JMXA 3QPQD 1GYCA 4U3CA 4MXVF 3ZDXB 5BZWB 5GGUB 2X41A 1XF4B 1EHAA 4L8BB 4Q89A 4EN3D 4JHAL 4LSDA 3U2SB 4P49A 3KPSD 1EXUA 1T7ZA 3S96A 4IRSB 3AZUA 5ICXB 2K45A 2VNCA 1R3HB 3KL3A 4K7PL 4XC3L 1UOVA 2IIJA 4CMHC 5CINH 4X7CC 1A4KA 3FS9A 3SBRA 2GUOB 3GI9H 5A2BA 1KCBA 3HC4H 4RWYL 4Q6IA 3DVNB 3NEOA 4JJ5B 4OCRH 1K6QH 4AK2A 2NY6D 1EDYA 4ZFOB 5HXMA 1UC6A 5ADOH 5F71A 3T2QA 5DLML 1UACL 1BECA 2RD0A 3EFDH 2C1PB 3PIQA 4JRXD 1UCTA 1KBGL 2G3NA 2QADD 2VDPH 4ZDHB 2Z93A 2ZCZA 4LFHG 1OK8A 1IC4H 1NKGA 2D2OA 3LKNB 4I2XE 3IYLW 4UI2A 3W9DB 5J1AB 3QXWA 4QHKJ 2FB4L 2CO1A 2F7IA 1GC1C 1JF6A 3DVIA 1XDTT 3HKFA 3WTXA 4YXHH 3K6IA 4ZMPA 3QUYB 4ZODA 2NW2B 4OTXH 3GIVB 1JHTA 1TEYA 1YUHA 2XWBB 2H6PA 2GQHA 4GG6F 4GAJL 1VESA 1ZGLP 3QWNA 4OD1L 4AYDC 2BNRA 3HN5A 1CK0H 1EO8L 4EKJA 3FRPB 5C0RH 1ZWIA 2YHGA 4P46C 5CGYC 2PO6A 4K7FA 1IMHC 2NNAA 2VOTA 4M5SA 4DW2H 5GRUH 4MMXA 1T22B 4XNUL 1DQKA 1JF1A 3D2UB 3MA9H 4JG1H 4KK8D 3MJ8B 5GRYA 1BVOA 1AR1D 4QF1A 4K9EL 4JY5L 4YWGH 4XBPB 4XZ4A 5K93A 1HSBB 3U6RB 2AAAA 2R7EA 4FKHA 3E3QC 3FTGB 4Z7WA 5DRWA 5HDBF 4DHLA 2GTZA 4FQ1L 3AWGA 5DGRA 3UJJL 3FCSB 3QZOA 4LVHB 4J3OH 1CI5A 2ADIB 4LSVL 2CRMA 5AKRA 4U4IA 2IQ9L 1XEDA 1FO0L 2J43A 3P2BA 4LSSH 3ULUE 5CEXB 4GKZB 2WJ7A 2F53E 3GZPA 1IAIL 1L9OA 25C8H 4IJ3B 4WHYH 4W4OC 1A4JA 3KG5A 2JB6A 1KGCE 3DJRA 3FZUD 1DBAH 3KLSA 1HHHB 1MCRA 4ESKA 1HHJA 2WBKA 3LZFH 4MRCA 3TA3D 4AJVA 3NH7L 2X38A 1JTTA 5GZNC 5L2KB 1M6OA 3UAAA 2HUHA 4GAGL 5DJ2A 2YMTA 1J0JA 3PNWA 4XX1E 3V4VA 2XWJB 2XWRA 2W8CA 4UAOB 3LIZL 1YYLH 2LGNA 2R4RL 4JNXA 4WGVB 1L9MA 5FKPB 3MRMA 3PWNA 4UDUA 1W91A 1YO4A 3EJPA 2FJSA 5GGQL 2KZBA 2LVEA 1E4WL 1PX3A 1M4KA 1P4BL 4KZEL 4F9PA 2BMKB 3QE5A 5I1EH 4DK5A 3AW5A 1KBVA 2OBGA 2ZWSA 3C6LB 4X99A 2X7LA 3D25A 1BOGB 2IEPA 5J7CC 2UYLB 2WW8A 1JYWA 1RK0A 1PDKA 2BJMH 4OZFB 3X3FL 5B3JE 1SNRA 1JF5A 5IB1B 1A9EA 3VFWA 1E4XL 5JQIB 4XODA 3H3KA 4Y8AA 1XF1A 1IU1A 1HILB 1SDDB 2XKUA 3U0WL 4D0CA 2EDWA 5EUOB 2XBDA 3MBED 2QGBA 2CHNA 4IHBA 1FZJA 3WFHB 5E24E 4NZ8A 1OANA 5E6IA 1RQ5A 4AZ8B 3VXSB 5EU4A 5H4YA 2ORBL 2MMXA 2JSFA 1E30A 4HK0A 5K1NA 3QULB 3TX4A 3GSVA 4N8PA 2XWTA 3RA7L 3VG0H 2XZAH 3MVSA 2MCPH 1VZGA 1RPQA 5F8RC 2BSDA 1EZSA 3FQWA 5G5DB 4M00A 1YY9C 2N4IA 4RDBA 5JW3H 2ZOTA 3BUPA 3AS1A 4XB7A 4XMVA 4RMVA 4KH2A 4IIZA 5TDOA 4UTCA 1FE8L 3CBRA 4FZEL 3OJVC 4P2OB 3K2MC 3SGEH 2X88A 3KPPA 4L3AA 4CN4A 4KNQA 5CMAB 2L4OA 3L4WA 4TL4A 1JUFB 1JV2A 1T6WA 4WFFE 4EVNB 2WZ5A 3GKWL 5DUPL 4U1MB 3ARQA 5C0BD 4LDOB 2CJSA 1XH2A 2BY0A 4P5TD 3BLKA 1UFGA 2RALA 1X6NA 2CH8A 3COOA 1G0XA 3PHSA 3ZDYE 5JORB 3NGBC 4ZMOA 3HE6B 1ROCA 1X5JA 2PR9A 2VIRB 1T04A 4MDRA 2J1ZA 2BNRE 1VDGA 4H1LB 2Q20A 2NY3D 3FH8A 1MFMA 4AEHH 3QORC 1OF2A 5CSZA 4QI3A 1BJ8A 4YDLC 1J8HD 3SQOH 3QNYA 3ZSSA 1TFHA 4AEEA 1HEZB 4QJ3B 4NUPA 2Y7LA 4WFEE 1YNKL 1L9QA 3ZE1B 4YHZH 4PVBA 3HB3D 1YEHL 3GLZA 5IJBC 2YGNA 3QQ4B 4AUYA 4QHMB 3Q8CA 1EFQA 1KCKA 1ZHLA 3FT4A 1DDTA 2L0DA 4P2QE 2WQRA 4BUHA 5SX4H 4Z7WE 2AEPL 3CFKA 5IEKB 3UG3A 5I6OA 1Q72L 5EZOH 3W0WA 3NJVA 2E47A 1F1AA 5D2LE 3QG6A 1HDMA 1T5XB 2Z7ZA 4PJ5D 4I48A 4L8SB 1S7UB 2Y6SD 4UZSA 2EUVA 1UH4A 4N3UA 2YRLA 4UDTA 1O6VA 4KH9A 1C5DA 4H25B 4L8CB 4ISVA 1GGTA 2ZXEB 4LHQB 4G71B 3WE6B 2ROXA 3O3EA 4S2SA 4U6VL 2GJPA 3ARXA 4AVHA 4YFEA 4AKPA 3R0MA 2LLGA 2OMTA 4L5FL 3TBSB 2CCVA 1COBA 1M57B 2F8IA 1JVKA 4IOIB 4KUCD 3VE0B 4Z77A 4IRSC 4BFNA 1FFQA 1RJYA 4ES9A 5MENB 3ESNA 4W9GC 1U8HA 4X0NA 5DD3L 4EIBA 1SPDA 1WSST 2C5DC 4L48A 4NHUA 5DZVA 3A4DA 2AJUL 4XPHH 1AANA 1JGEB 1KUMA 1E28B 3N91A 3QIBC 3V2AR 3TO2A 4W9LC 3VVVA 1A6WL 1DVSA 3KPQA 5CEZH 3OMNB 5D1ZB 3DX9A 5E8PB 3H9YA 3IAGC 5GRJL 3G6JF 3KXFD 4HS3A 4LBEB 5H94B 3CN0A 5C7XH 2LU3A 3HZYA 3HBPA 1I8AA 1P5VB 1P6WA 1XX9C 4KY2A 3ZYIA 3B9AA 2E59A 1DQMH 3TCLA 4UUJA 4PRHA 5JOPE 4P8QA 4B9ZA 1WS7A 2VABA 4LHUD 2ED8A 3CFCH 1NCJA 5E1GA 3LNIA 3IAQA 3DJTA 5C3TA 4YVNA 3ZZLA 2AXJA 3QXAB 4E0RB 2HG0A 1K5NA 4KNUA 4KU1A 5ISZE 2NY7L 2CDEB 2PXYC 2YGVA 1G4RA 1G7HA 3CFEA 2I24N 3VDCA 2K3HA 1M9SA 1X5IA 2HG5A 4WTZG 4XBGB 5CLZA 1CGTA 1LVEA 3NA9L 3CVIL 5CKGA 3CHOA 1GYUA 1AZZC 1CGSH 2E6QA 2LVCA 4NQED 1X5ZA 3QJTB 4NN5C 3WG7B 5I9QB 2I25N 3MR9B 3ZKXB 3RZCA 2D9CA 3DK0A 3BHBA 5HPOA 3ETTA 4WVRA 4Y5XC 5BRZA 3V8CA 3UTOA 4HD5A 5AWNH 3CZKA 2V2WA 3SDXB 4DPBX 4EN2A 4G5ZL 4N2EA 4LVHC 1HEHC 4LVNC 2AW2A 2VXQH 2W07A 2VDLH 1RFDH 5B38A 3NPSB 4X9HA 1KTDA 4A39A 2NY2C 1BVKB 1Z9LA 3MLZH 4GRWF 1YC8A 4XMKH 1OAKL 4JZOB 4EI5D 5I15H 4DKEH 1NC4B 3T0WA 3W37A 1HOCA 5D4HA 2BNQA 1MQ8A 3CX2A 3RWDA 5CP3H 5KUMA 3F58L 1BD2D 5DC0A 1I9JH 4XPGH 5L7XL 1JERA 4CW1B 3FB8B 4Z7UA 1R5VA 3IWVA 1GTFA 3H3PL 3FO9B 4FQHB 4J6RL 3TFKC 2CA4A 5LNGA 3ATBA 3NRFA 1WV7T 2ATKB 2X3AA 5SX5H 4YQXL 4PG9A 1NSNL 4MDIB 5E2TL 4ZPVA 5ES4B 2EDMA 2AQQA 2HJFB 1CR9H 4M6ML 1PYWB 4I3RL 4XCYA 2VLKB 3QW9A 1LO4L 4M8QA 1YCSA 4NC2B 4Z7QF 3RE0A 2QHRH 1GC1H 2ALAA 3JSSA 4H8PA 5FW6A 3T6QC 1M71A 2DV6A 3B7UX 3UTTB 2VW4A 4DAGH 1GH7A 4D3CL 4OV5B 4MXWL 2LFGA 7FABH 1CDUA 4X80H 3VI3B 4E41B 2BWIA 2VXVH 4UTBL 4ZUUB 5KTEH 4HXBH 2QGEA 2AQNA 2LFEA 1JOIA 2QR0A 3C6LC 4WI0A 4FABH 3LJ3A 5EU6B 1BF5A 4G1MB 2BIIA 2VITA 3QI9B 7CGTA 3K6SA 3UC0H 2J88H 1OIOA 5B1BB 4C56D 3CPLA 3FN9A 3QDJD 3OAWA 4HIJA 3W82A 1XB6A 1AS6A 2Y3AA 5HYJA 4LRIA 1U8OA 4Z9KB 5FW8A 4KKQA 3FFOA 3ZDZF 5KBPA 5E6RB 3WFEL 2X4OA 4NQXA 3BN9D 3VQ1C 3MNVA 1U91B 4UQ2A 3HAEH 1TG8A 1ZHKB 5DD1H 3RLSA 3BZEB 4HGWB 1SBSL 4QHLA 3P9MB 3S5LG 4IBWA 3SKJH 2D7OA 3UAJD 1P7QD 4XZUB 5KVMC 1YEKL 2CRZA 1J1XL 1T0MA 1PKQB 1AGCA 1GGBL 3TPUB 3AU0A 2OYKA 2OQJB 2BERA 2C7UB 5FHBH 1U9KA 3T65A 1BW8A 4NRYB 3VXRD 5BO1H 5CIPA 1IBFA 4OF0A 5HDBE 1HWHB 4H8WL 2NZ9D 2MHAB 1MHPL 1N68A 2W38A 4G7SB 4M1GL 1JGDA 2L3BA 1QEWB 2XETA 2NW3B 3PDOB 4AT6B 2CGZA 5CCKH 3WIIL 1QA9B 1OAZH 1TZGH 4PJGF 3QWRD 3RVVD 1OAUH 4QWWC 4L18A 3DMMB 3RWFB 1J1OL 1NFKA 3GBEA 2BVTA 3UEQA 3RY6A 5F97E 4DETA 4OM1H 5J11B 2YQ2A 4WWKD 4YPGB 5EA0H 1QSFB 2K1MA 3KBHE 1JI2A 4TRPL 4ZW3A 4WNQA 2A77L 5CJOL 4Z3HA 5C9KA 2IADB 5GS2D 2PWFA 1PG7W 2F7OA 2DYPA 1B4JL 1L9SA 3GS4A 5FV1L 5IVXA 1OK0A 3QZNA 2EDKA 4XPFH 1JGIA 1ND0B 3CH1A 4YDZA 2CO7A 4JZJC 1DJWA 3CSYA 1NCOA 1SOXA 4YDKL 2FGWL 4FKKA 5CN2A 4LLDB 4ZPTB 5BRZE 3X1FA 2Y3NA 5AQ0A 5MEOB 1H3TA 1OB1B 4MAYD 4PW9A 3V0FA 1LO0L 2A1WL 2JKJA 1DLFH 3WXVL 2EDJA 2G2RB 4Q52A 1MWAH 4YDVB 2IJ0C 1LMIA 3EYQC 3EF4A 4L4TE 1HH9B 4F7MB 1WZKA 3PP4H 3RL2B 1DBKH 4YDJA 1MWOA 5JZ7D 4OLUH 4PJ7F 5I6XC 3MGOB 3VFMA 2XNAA 3EBAA 1ZHBA 3U46A 1I1AB 3GINA 1KBWA 3PL6C 3PWJA 2WLLB 4HHAB 4H7VA 4JE0A 1J1PL 1F1DA 4L4VD 5GSRB 4CVXB 3RPIB 5H37H 4O2EB 4XVSL 1AKJA 5C07D 3HNSH 3Q8BA 5I74B 2IDSA 4UMGA 4F7EA 3QNZB 3MLSL 4NLAA 4GKNB 4ZRGA 3GS0A 4MCZA 1IBGL 4BQBA 3NCWA 2V9RA 2EIZB 4LQFH 3K0YA 4M7JH 3V52H 3ZU8A 1AQMA 2EYTA 1ONQB 2NR6D 2HRPL 3QQ9D 3HFFA 5D1ZC 1TTRA 5FV2A 1HYRC 5B8CB 3MLUL 2X5PA 1TETL 3QJHA 4MD0A 4F9LA 3QQ3B 1Q9LA 2HSIA 3APNA 4PBWD 5BS0D 1RJCA 2J5LB 3RZWA 3JYBA 1HWWA 2DWEB 1XH1A 4JKKA 3KL0A 3IFOB 5IOKA 2PP7A 4W9JC 2PR4L 3PWVB 2OTPA 5FWQA 3DBSA 1P6FA 4JO3H 4JJOA 4QJ4B 5D1QC 5H35B 5JXEA 4AYMC 2J5WA 3HG5A 3NPZB 4KK6C 3KPRD 2VRAA 4DF9A 2AXFB 4D9RE 5AW7B 1P9MC 1PF3A 3B2VL 3KLQA 1JYXA 3I9GH 2GHWB 3FUMA 4NPJA 3N40F 1SHXA 5I8KL 4AJYV 2R2BA 1OSEA 1DQLH 1E2WA 1DJXA 1RUQL 4U7SA 2EKJA 2G60H 5I8EB 3UZQA 1JRHL 1MCPH 3C8DA 4HIIB 1MCLA 2YFNA 3MLWH 4HIQA 1A6UH 3U0TB 2WCSA 3O45A 3C60C 2QQNH 2C9PA 3S3DB 2A9DA 3BRGC 2CIKA 2BPBA 3DI3B 3CN4A 3IGUA 3PFUA 2R9HC 4GO6B 2E7LC 4JHBA 3R0NA 2FEDD 1KYOK 4HIHB 1MY7A 3PS6A 1RUPL 5DUML 1EO7A 3S34H 1HJCA 5FO9A 1ET7A 4ABVA 4O02H 1A8JH 4KUZL 5FK9A 1C12B 3T1FB 4GMTL 3ZKSD 2IFFH 3CE1A 4E9RA 1L5GA 3OD3A 2X40A 2ZOWA 2DJUA 3WFBH 2XU9A 3O0RH 5TE7L 3OAUH 3TIDB 1FO0A 5G55A 5T1KD 2P8PA 3F85A 3QAZB 4UINH 1MLBB 5C71A 4NT6B 4OKVA 4NKMB 3MSPA 4OLZH 1OCWH 3B3IB 3MRFA 3KLHC 3RWJB 3V5HA 4POZC 4AWJC 4EDWL 4WENB 4U33A 4HIXL 5E5MB 5FCUL 2ZX8A 1NFDF 4JRLA 5HTSA 4Y4HB 4FYSA 4D9QD 4W9DC 1BGXL 1KLUB 4OLXH 3QYMA 5D5MB 2E9JA 2V6HA 5D70L 5EZLA 5TQ2H 3MC0A 3HMXH 5KVDL 4CRPA 1R5IA 2YKLH 3LIZA 4GIAA 2AMGA 4ZO9A 3JWDL 4BWUA 4YBLB 1F3RB 2L8AA 4UM9D 2HPTA 1F90L 2ZQKA 3WKYA 5BPPA 3GNMH 3FAXA 3GXDA 2I5YH 1ZLWK 5F6HI 3G6JE 3U6XS 4UILL 5GISL 1O9WA 4XMTA 3CDZB 2ZKMX 3L5JA 3BFWA 4X6BA 4XPBH 2AI0H 3Q1SH 5FECB 1LM8V 5KANI 5ESVB 1Z5LB 3KVQA 2I26N 2W65B 1M05A 3TTSA 4L37A 4YNYB 4W9HC 1BQUA 1NM9A 4G6ML 4EUPG 1KN2H 2MRYA 3VUAA 1QHOA 3BUTA 3T0XA 4XOAA 5DO2C 3EO9L 4KBPA 5EEWA 2APFA 3MNDA 3EO0A 3VM5A 4I85A 1N4XH 4PH8A 1BJ1J 1M7UA 4NO0D 5AVRB 1UKTA 2X2HA 4OCWH 3F6JA 1TVBB 2W91A 1KN4H 2F15A 5F96L 5LO7A 2VXSL 5K9QI 4I0PD 3KGTA 2VQ1B 2KZWA 3BVDB 1N9PA 1VFBB 2DLFH 2OW6A 4QRQA 1KACB 4DVRL 1FH5H 3BKCL 4UIMA 3Q8EA 3RVUC 4PJ9A 1HXYA 2WXNA 3ISRA 3QDGD 1FVCA 2GT9B 2B20A 5CN1A 1ADQA 4CMMA 5CWSB 3SDDD 4HA1A 2VUOA 3WN5A 3DC0A 1F11B 2QFRA 4K73A 4OIIH 3CZSA 2NY1D 1OAQH 1YEIL 3QIWD 5D1XB 3NZUA 1SVCP 2AJYL 1UWEL 2JWYA 2V7HB 5DJ8B 3NJIA 5T1LD 2X2YA 2YD8A 1CBJA 1UADC 4WI9A 3NFPB 3W9EB 4H0LC 4GRWE 4HFWB 1NBQA 3L3GB 1JK8A 3CIAA 2Y4SA 3ZT6A 2ZAIA 3R1GH 3L5IA 4HUUB 4D94A 4GPVA 3DHJA 3GMQB 3QEHA 2UUDK 4B7IA 2HFGL 2R2CA 5AD0B 3EADA 5DDHA 1MCJA 4JAMA 4YR6A 5J11C 4HJ0D 4TOYL 2J6WA 3N04A 5AVZB 2PYFA 4NHCH 1S78C 4MJ5B 5ETUA 3V6FB 1T6VN 3AREA 2HT2D 3RJOA 4CU8A 2ZOKB 4NCDA 1N18A 4BA8A 4A04A 2XRAH 2A4EA 3GBML 5DC2A 2OMUA 3K5SA 3SCMB 4CC4A 4BKSC 1C16B 5F0JB 4OZFH 3E3QE 3K6OA 4Z7QE 3CVDA 4RA0C 4NRXA 1UQSA 1Q38A 3BIKA 5DRZA 3BT0A 1GHFL 5IJKA 5KSBA 4GSDL 1O5PA 5F3HB 2XVBA 2N3JA 3VSUA 1RHHA 4KTYA 4RZCA 1QYGH 4IBSA 4UYQA 3BLBA 1FGNH 4XP4H 1OF0A 3B9KB 4LPWA 2HJLA 4XO8A 5HYQA 3TCTA 3DX8B 3WFCH 2PLTA 2VN4A 5FKAB 3DSFH 3V0EA 4PB9L 5AAMA 4Y1AA 3ULUD 1XF4A 2WPGA 2V3EA 3ZTDC 4BKTC 1U3HB 1V7NH 2F53D 4Z76B 3ETBF 1UKSA 1T21A 1TYJA 3UBXG 2EXSA 2FWOB 5IJVA 1OGAE 1KGIA 2F1BA 3QZBA 4QRSB 3SJVB 3S98A 5I8CA 3T4AC 4KRLB 3ZDZE 5DVKA 1E4HA 3ZE1F 5B3SB 2Z31B 4FKEA 5HYSB 2GUOA 3DVNA 2HP4A 5M94B 3CSTA 3NJJA 4RGNB 4S10A 3KPMA 4DWHA 4LAQH 1XCWA 1IKNA 2DKUA 4R4FH 1JNJA 4F8LA 5DRNB 4QT5B 5FUCC 35C8H 5J1SC 4NQDA 1DO6A 4URTB 4KKAD 2ZCHH 4OJFL 2VJXA 3L08A 5IMLB 3LRKA 1AGFB 3N9GH 5G4OA 2GBAA 3LKNA 1J5OH 1KTCA 2V5RA 2KH2B 1CD8A 3ES6A 3DX4A 2J5LC 1G7LA 4PGEB 1E9QA 3LNEA 2IMNA 1ZTXL 1WGOA 3D69A 1OSZB 3L6FA 4H1LH 3VJ6B 1WTGT 4UNTA 4HUMB 4UYPA 1D5BB 3QUYA 2HLAB 2E27L 1CFNB 4JM0A 3AUWB 3RTQC 5AZ2L 1HH6B 3BVUA 2ESVE 2W0FB 4PJGE 1CL7I 5EO1B 1TOXA 1XD0A 3KHOA 4OD2A 1CT8B 1NKRA 1ZDQA 2D4DA 3WFDH 5LGJB 3N1PC 2WXOA 3HI6L 1IFHH 1RZ7H 2AJXL 1A9BB 1WGVA 3O3UN 5C6PB 1T22A 3MFFB 5MERB 3D2UA 3P73A 2FGZA 4MQ7B 4S1RH 4F24A 2QQKH 4GAFB 2WKLA 1I8IB 4HKXA 4XBPA 4ZFFB 1WBXB 1MCFA 1N8ZB 2AABH 2PCFB 4LCCC 3U6RA 3UTPD 1XGRB 3CZUB 3QIUB 2JKWA 1QVOA 3S36H 1MJ7H 4PRPE 1IQDA 3HMWH 3M8OL 4YIQA 2BFVL 3MXVL 1XHHA 2AGJL 1BOYA 4OJEH 1I3RB 1FL5A 1JXJA 1FORL 4J3OG 1BF2A 3FB6B 1MRDH 1B6UA 2Z1KA 4WTZA 1J9CT 1YN6B 3I74A 3VXOB 2HT3D 3LS4L 4ZAKD 3K2UL 2E7MA 5GS1C 3N3EA 4BJLA 1AXTL 3IDXH 4WW1A 4W70A 4J3UA 4DVBB 3VQLA 1XSKA 4WHYG 4YSQA 4P59H 4WFFD 1FJ1B 2R1YA 4XP6H 5DC4B 4DKAA 1YQVH 4DGVH 2YPLE 3TF4A 3MRCB 3IFPA 2OPCA 3VRIB 2VH5H 4G8AC 4PJ7E 3QHFL 4PCSA 3VNZA 3ECUA 3L3HA 3F65A 3Q3GA 1HL5A 4HWBH 3IDUA 4FG6D 5IHUH 3UGEA 43C9B 5F89B 1NPUA 3CH8A 4Y4HC 5GGVL 5HHOE 1RSYA 4U1NB 5FYJH 1JBJA 4FHJA 1YEDB 3U7YL 3GYRA 1AO7A 1MW2A 2MQCA 2VR8A 3RL1B 3SDXF 2HKAA 4HUVA 1ZA6A 3CLFH 1HHGB 4NP9A 4DESA 1I1FB 2XIIA 2J6EL 1N12A 2DMBA 4PCKA 4Q97A 1PG7H 1XGZA 3O41B 4PLOB 4MYWB 2AHIA 4LIQL 2ZP0T 1JZ8A 1GGUA 3QDME 5CS7A 4D8PB 5KSBE 5LWYH 3MV8A 1DSYA 4IEFB 4P2QD 3DK2A 1BOGA 2RCSH 3QUKB 3GRWL 1HHIA 1DVUA 2YD7A 3CZNA 4NUGL 4AMWA 3C6SB 1FVEA 1FN4B 3BD3A 1L0PA 1HILA 4IBZA 3ZDXE 5FO2A 3SQRA 1QRND 2NUTA 1MN4A 4NQSB 2XACC 3DX2A 3WFHA 5E7BA 4AZ8A 3FQRA 3NZSA 2XCMC 1MRFH 1I4FA 2V3FA 4RFOL 5J6HB 1N5AB 2JB5L 1VEMA 2WTPA 2CNZA 5DO8A 1Z9OA 2J56A 2WP3O 2VAAA 5FM4A 1TJXA 1YMMB 2OTUA 2ISDA 3T4YA 3T0AA 3UFIA 2JI1A 3NVQA 1Q0XL 2AV7A 3OJDB 5I0ZA 2VLJB 3GSNH 2O5YH 2DQCL 5G5DA 2FECL 3LRGA 3ZT5A 2KYIA 4ATTA 4CC0A 3BH8B 2IOIA 3L7EB 4FHBD 4X0KB 1NEUA 5CJQH 1CVRA 1Z66A 1KB9J 1AIFA 2WWKT 2YOAA 4KI5F 5K33A 4OAWA 2XSKA 1O7DC 4GAYB 1SDYA 3UPRA 2AEQL 2VXTH 4J2XA 5ICYB 5DJAB 3VWKC 3GBLA 3D30A 3GO1H 4QXUL 4MTMA 3QCTL 4KDTC 4ODWB 1LD9A 1JUFA 3UYPB 3T3PB 2QSCH 2RJMA 2UY7A 4A1RA 2Y2WA 4U1MA 3S5LA 3GC3A 4KTDL 5JOPD 1BZ7A 2H0FA 4KKCD 3UERA 2YXVA 5D7IB 3KLAB 4K5LA 3MODH 4XP9H 3SYPA 3JWNC 4Y4FB 2UWEB 2WC7A 4ZX3A 3HE6A 2XV6B 1FH2A 2ZNWA 1MZYA 2BH0A 3MCLH 4NOFA 1AZBA 2Z65C 3U0PA 2AJSH 4IIQB 1J05A 4AH2A 1DCLA 4FFYH 1F4XL 4IDLA 5ISZD 1H3XA 1RJZA 2LR4A 4PBXA 1I1CA 4QRAA 1HEZA 4CA4A 1NICA 3VXUD 2DY2A 1UJTA 1LDPL 3LPFA 2J1XA 1CS6A 4IKKA 4IOFC 3T77B 5E6ID 3VXMB 3QQDB 1S3RA 5BVJA 2Q0ZX 5CJXC 1GGCL 1X5KA 3BESR 3QJXA 5I82A 4LLMA 1UXWB 1SXZA 5AZUA 1G7IB 4OF7A 5IW3A 1YJDC 4W4NA 3CCHB 1SLWA 4JM4L 1BQ5A 4WV1C 5F7FA 2X05A 4XXDB 3U7WH 4HJJL 5E0QA 1BEYL 2YFOA 2W94A 1YEEL 4WUKL 1T5XA 2OXHA 2AEOA 2GAZA 4U1KB 1NEZB 1BM3L 1S7UA 3HS9A 4L8SA 3CXDL 3QZWG 2C9RA 4IU3B 1GYWA 1A5FL 5C6TL 3OR6B 3LH2L 4PLJD 2DJMA 2GK0A 5CLTA 3OQRA 3GT6A 3L3IA 4TVUA 5EZIH 5I73C 4Q2ZB 1KXQE 5I1KL 2Q8AH 5F9DC 1DBJL 4Y89A 3RVTC 5E8EB 2Y72A 1LO2L 2QVFB 3J8F7 4HP5A 2VC2L 3RUGA 3VD3A 3CFJA 1VFAB 3C9NB 5L2KE 2AKRA 1JD7A 1BYOA 3HUJA 4YUEH 4S0SD 4YN3A 1P7KA 2BSBA 1BXVA 1KY7A 4NO2A 2AXGB 5GJSL 3UEZA 5SWZD 4NX0A 3ZO9A 1KCVL 1U6AH 1JPFB 5C0AA 5ID0B 3STBA 5HJDA 3ZOAA 4LBEA 1OAJA 2ZXGA 4P57B 5H94A 2Q6WB 4OCXL 1U3JA 4QHNB 2ALWA 2OTWA 2Q1EA 3DVFA 4PP2A 2XBTA 1IC7H 1QBMH 2D7PA 2K8MA 4FCHA 6FABL 4FQXB 5IB2A 4GSUA 5K5YA 3ARFC 1T2QL 1FZOA 5CUSH 2WSDA 2J57A 4H20L 4AQ1B 1CLYL 2NSMA 4X4ME 4PRDA 3TFBA 1C9SA 3H0TA 4QAMB 3FYIB 4CSPA 1KIPB 4IGBC 2PW2A 1T5WB 4DP8X 4V1DA 3LIUA 1JZ4A 1E8YA 1FVDB 5EUOE 4YSOA 5IB4B 3ZMNA 1IEBA 4Z95L 3ZR5A 4N8VG 4XBGA 2BHFA 4GIOA 3BAEL 4WF7A 1A2YB 3VXSE 5F3FA 1F5WA 3MLYL 3F6LA 5HI5C 2ATPA 1EEZB 4FNLL 5DK2A 2QGCA 3MR9A 3RTLA 2Q8BH 3RGVA 4IBYA 1KF9B 1E4KA 4LO9A 3TIEB 4YHYB 4R0LC 5TGBA 1KCUH 1A7OH 1PX4A 1XBDA 4LSPH 4Q14A 4BFGA 3UP1A 4WO4C 4CUCA 4D0BB 1KPRA 1SXAA 1FFTB 5DC9B 3WEOA 4JBSA 1MCHA 4AV5A 2Q3ZA 3CUPB 2F74B 5CR1A 2UZIH 2FSDA 2EXWD 3FUEA 4R7XA 4GW1B 1G6VK 4WU7B 3IDNA 2DLGA 2ODIA 4QEGA 1P4LA 1BF8A 3C5ZB 1MDAA 2C34A 3T6VA 4GSQA 4WLCA 4WEMB 3K4AA 3V7AE 2WQUA 1EH9A 4AIZB 4YE0A 3EYUL 3G9AB 5EBLB 1EAQA 4APXA 2AK1H 3N43B 3FO9A 4FQHA 3VVWA 2FO8A 3GLEA 4RDQF 4HOMA 1NOFA 2ATKA 3L5XL 3HE7A 5DD5L 3EOBB 3DTDA 3GWJA 3MBXL 4W9FC 5CBEB 3KAAA 1O7SA 1T20B 4X9IA 5LXGL 1A3LH 2WSPA 2NXZC 2C9QA 5BMFH 2G5UA 4QGTA 2OI9B 1I82A 5ERWB 3CZJA 3GHBL 5EH1A 3ZE1E 5DJ0B 4MHHG 5GGRB 1IAMA 1A7NH 4PJXA 5D93B 1H0DA 4ZSOA 2DM3A 1R24A 2G5BA 1OPGH 4XP1L 1JL8A 3PUUA 1S3KH 2A9BA 3AXHA 3RWIB 4OV5A 2IH1A 2P8MB 4TTDD 4NI3A 3VI3A 5F9JA 4E41A 4MJ4A 1YNLH 5KWYC 1IM9D 1Y7VA 2DEWX 1JFHA 3NCEB 4IHOA 3I3DA 1JN6A 2MCMA 3G5ZB 1ESOA 5EEZA 5DMGC 5KYNA 2CR6A 3L3JB 3ZE0B 3C09B 1CWVA 3MRPA 4YSAA 1CR9L 4FS0A 2NSQA 4N2KA 3TBBA 4I4WA 1T66D 3VB8A 4YHML 4IMKA 4U0RB 4FG0A 4Q4IA 2D3VA 3WHXA 3Q5OA 1JK9A 3ARDB 2WO2B 3P69A 4L4TD 4GRMA 3HNTH 5I1GH 4U31A 2A6IB 1YHPA 4TQEH 5AYUL 3IF1A 3EOAB 4HEME 3HN8A 2P44B 1U91A 2ZP9A 3NK4A 1CFTB 4Y2DB 5F3BB 3BZEA 1ZVSB 1E7VA 1TEFA 4ZXBA 3B2PA 5MENE 4R7NB 5IQMA 5D5MF 5E4IA 3BWAA 4MNHA 3H7BB 4BRVA 2F19H 1KIQB 1B0RA 1C8PA 3FQTB 3RIFF 3HRPA 3TPUA 5DJXA 2ADJB 1WBYA 3MNZB 3ASWA 5IMKB 1UD4A 5ITBH 4LCVA 2GPZA 1I7UA 2UX7A 1GOGA 3H9ZA 3R06B 4XGZB 5E8DH 2AVGA 1EA9C 1PQZA 2D3LA 2Z0UA 3GMNA 2P5WA 4TM9A 3Q2LA 1F4YH 4EUPA 1F00I 2R59A 2MHAA 4N2OA 4YXLL 3LV3A 1XF5B 4IBTA 1IIKA 3T6WA 3U9WA 3WMSA 1C7TA 3BPNB 5DZ9A 4AT6A 3MV7B 4E36A 3OXRA 5M95B 5DRXB 2K8QA 1CE6B 2WWNA 3KEDA 5CCGE 3TT3H 1R0AL 5E1QA 3RWFA 5K9OA 2NUPA 2ILLA 3KR3H 1KB5L 1W0WB 1QLEH 4PIBA 4BH8A 1D7FA 3NN8A 4PJBF 3BKJL 2GFBA 2F6AA 4NAQA 4NUMA 5GGRY 4NKOB 3FMGH 4O9HL 4YC2B 4XAWH 5T3XL 3DUUB 3BPLB 3DETC 4BH7B 1LP9F 1J0YA 3AFLA 4K8RC 4IIQC 4UAHA 2VCOA 1BLNB 1IV8A 3QVAA 4JY6A 4J3TA 3EW3B 5IKCA 2DTML 3EH3B 1WCBA 2YPVL 4FFWD 4JFOA 1UG9A 4D9RD 1EWHA 4P4RA 5ALCL 1RVFH 3IDIA 4JHVA 5D72H 5IBTH 3KS0J 4ONFH 4LOUD 4NPYB 4ZPTA 1XIWA 1Y1UA 1R3JB 5MEOA 1OB1A 2EDDA 3D18A 1VJSA 3GJFA 3SDXE 1WWCA 1Z9PA 2GTWA 3REWA 5L6YL 3WIHA 3SDAA 3QCVL 7PCYA 3FQ2A 4YGVB 5DTFA 3ABLB 5I75B 3QPKA 4MAUL 1F97A 2G2RA 1MH5B 4M6NL 2WBJC 4ZFZB 1C8QA 5C0GA 4HBQA 1S7XA 1SEQH 4ORGB 2WQXA 4UQ9A 5DQJB 2W0LA 2CE6A 4ZTEA 1WBZA 5D7JD 3TNNB 5GZOD 3PHAA 5DEJA 2XY1A 3RL2A 3S37L 5J12B 4DO6A 2IPUG 2F54A 1VA9A 4GS7B 3HI1A 5CEZD 3VGAB 3WLBB 5EO0A 4QXWA 1TYEB 1ZLUK 4FNRA 5GSRA 5D71L 4XOEA 3AB0C 2ICWA 3KJ4C 1G7JA 1RZPA 2X6UA 4OZIF 2X0VA 3IU3A 3F7YA 4L3EA 1H3VA 3K46A 3WN6A 4GKNA 3ZZSA 2EVGA 3R8BB 2VLKE 5H37G 2B4CC 3WY3A 4BFOA 5IQ9B 3GMLA 3AXIA 4JY4A 3UTTE 5B8CA 4X98A 1N6UA 4WI7A 3VCLB 2P8LB 3UBXA 4CVUA 3VI3E 3JWNH 4E41E 5EHFA 3P4LA 1A1OB 1HSAB 2G3MA 3P3UA 2GBUA 4NDMB 2DWEA 3NTCH 1QI3A 4DP4X 4KI5E 4Q7DA 3IFOA 3DX3A 2R0WH 5EU6E 1NMCB 2C3XA 3PWVA 1CDJA 4LF3A 2R2HB 4KTGA 5IHLB 2R4SH 5H35A 5AW1B 2ZPKL 5JQ6H 1CGYA 4F37F 1ETZB 2R2EA 1CG9B 2P5PA 5CF3A 5AVUB 3TONA 2O5ZH 4K5PA 4OLVL 4P9MH 4LDEB 4ODHH 4OFQA 1XR8A 1YJDH 3VFRB 2NY5C 3SYOA 4G80A 4GBXC 3S0PA 2NDGA 4PGCB 5E94A 5I1HH 4E5XG 1X5FA 4KVCL 3HHSA 2WNXA 2XZQL 3LRHA 5CZVL 4HIIA 3AM8C 1TTGA 5K39A 1QD0A 1TQWA 4AM0Q 5BOPA 3P0YH 3V0HA 1AQKL 2XICA 1QLFA 4AYFB 2W95A 5CGTA 1M7DB 5DA4A 4HIHA 5CGBA 1I75A 3L4CA 1W72H 4QTFA 3PNRB 2BHZA 1AD9B 5JXAL 4J27A 1WYJA 3T6ZA 4Z3IA 3FC8A 1B9KA 1QPXA 1DUYB 5EG6C 1FDLL 4HG4J 2QPUA 3VWJC 1ACYH 4ZTOH 5T5FH 3HVNA 4F27A 4OD3L 2BDNH 2GJ6B 2HN7A 2A9AA 3B9DA 4XN9A 2H26A 1KGWA 1WUZA 2RQ8A 2RGSA 3FOLB 2XV0A 4KRPC 3HS0A 4X7DC 3WJJA 3UAEA 1MVUA 3VFPA 4DP1X 3AY4C 1RJLA 1TMQA 3QUMH 1QSFE 3THMH 1MQKH 4ZUTB 4K3DL 1DSFL 2JJTC 4A37A 5HD8C 5JXED 1F3JB 4HCIA 4HISA 4NZDA 5E9DA 1X5XA 2IAMC 3BXNB 2GB2A 4APQB 1MVFA 2OI9C 1QSZA 5CGYD 2ZCKH 3QHZH 3BZDA 4AMKL 4MS8D 1C7SA 4UTAL 2XV3A 1NAML 4G5AA 3ARRA 2WAQA 1HQRA 4KZCA 4ODXA 5I6KA 2ZIDA 4PG2C 3UBHA 3I6LE 2FX8H 3K4DA 4I87A 3I6GB 1DQQB 1M1XA 3BT2H 5IREA 3CDZA 4IQHA 2J6EA 3V0AC 3KD4A 3QUZB 1D7CA 2IANB 3A6CL 4FI8A 2PYEA 4UM8B 2XG5A 5ESVA 2IV9A 2W65A 1JGLL 5HHXL 4HKJA 3FTUA 1ZXQA 3O9WB 3GRWA 4KXBA 1FNLA 5L4FA 3K0WA 5ACZB 1A6TB 1M7IA 4GQQA 4BSVB 1NBYA 2F7PA 4Y7MA 1R3IH 4ONGL 3TYGH 5KYYA 3CFNA 4Y0GA 1NMAH 4TNEA 1OGAD 4UOW0 2QV4A 4X6DA 2QT6A 4I5BB 2NXYB 2Z64C 3QO0B 4FZ8H 1MF2H 4U1JB 2DQHH 3P77B 2NY0C 4GUPA 2WLYA 3Q8AA 1NC2D 3BQUC 3KWWA 4PY7A 3NCJL 3S6CA 3CG8A 1H3UA 3PAUA 1JGVL 1U8JA 3C2SA 1RY7B 2IF7A 3KPNB 3O6FA 3PV6B 2H0JA 5TK4A 1DBML 4NZRH 4UQBA 1ROWA 1T7VA 3O6LH 3QA3B 5EFIB 4NUQA 1S9XA 4C54A 3LQMA 3RFZB 5C0NC 2AJVL 3X1NA 3IDJB 3H9SB 3OKNB 4OSUL 5DUBB 2LT9A 4XTRC 3T3MB 5F0MB 2O6DA 5EO9B 4QTIL 3KPOA 1MCWM 2WLIB 3V6ZA 1P1VA 3VD5A 3RGHA 5KVEH 4NQQA 1LEIB 1A6VL 4MD5B 1XGTA 4PS4H 3AY2A 3V6BR 1QLRA 3GMQA 5AD0A 2VLRB 1V7ML 1ZTXE 3RVXD 1JIBA 2UZPA 1KFAH 5A2CA 2XV2A 2V2XB 2ESVD 3HRZB 1KZYA 1DQIA 4OCYL 2IWKA 2JJUA 2YGOA 4QXTA 2HWZH 1H3WM 1ZT1A 2W9DH 3PE9A 4K3JL 5J9PA 5BJTA 1AG6A 3GJFK 4KK5D 3SCMA 4KMTL 3U83A 2XQBL 1CZ8H 3BVWA 2WKOF 1L6PA 1EZVX 1QBLL 4M4RB 5F9WB 3WDHA 4WHTB 3N85H 3NIGF 2Q2LA 1CXHA 2ADGA 1R5WA 4FJZA 4HMDA 1DVFB 4PLNC 2ZOLA 2SEBB 2BXZA 2VJ0A 4Z7VB 3MGAA 3BDXA 3IMTA 3LZLA 4PRPD 2H1PH 1JCKA 1UWXH 3T3PF 1MREH 3DX8A 4IRJB 3CFBB 1AC6A 4WU5B 4K5NA 2JVUA 2Y1VA 3MUGA 5CP7B 3M88A 5FGCB 3MYJA 3KJ6L 1U95A 4B97A 1HL8A 2BS8A 1K8DB 1O5DT 3DOHA 1RZQA 4NO5B 3L2MA 2UWEF 8CGTA 1NDMA 1MCOH 3FU7A 5D6DC 3IGAB 3HPLA 4RVBA 4CADB 2JCCB 5IEHB 4P2RB 4GS7C 1OOAA 1IZJA 1N8OE 1AHWC 2JQZA 2RFXA 5F7LB 1URLA 1EEUA 5SV4A 1DVTA 1JHKL 4HEPG 3MLPA 1KBBA 1QHQA 2PWGA 4JFUA 5F0LB 3ZIYA 4ZTPH 2YPLD 1CL7H 1WLHA 5KJ4A 3QZWA 4MCYB 2EH7H 3MOAH 1XVSA 4LU5H 5HHVH 2YD2A 3MMEA 5D5ME 4WEEA 3TZVC 3QORD 1X5LA 4FC3E 5DRNA 3X11A 4XCEB 1AGEB 3CC5B 2ENJA 2OMNA 3HEIB 4BGLA 5HHOD 4MMYA 4ZJ9A 3GMRB 3INUH 2FR4A 5IMLA 2IC2A 5ESAB 4HXAH 8FABB 2EABA 4GAAA 3QPQC 5D96C 3AUVA 4FXGB 2DIAA 4H8QA 3VFUB 4F58L 1WAAA 4HIEB 3A6BL 4PGEA 3MRDB 1KWKA 5HGAA 4HWEH 1N64L 4K8RH 2BSSB 3DXAB 4EN3C 5JIKA 1D5BA 3QDMD 4F7CA 4N28A 1PLGL 4LIQE 1KCRL 1LLAA 4R83A 5I1LA 1NMCC 4NWTL 1IGTA 1HH6A 2VE6B 5KSVA 2W0FA 4YSSA 3BPCB 5F70A 2YA0A 3Q6GL 3SQBA 2VLME 2ZX5A 2UX6A 2AC0A 2EDQA 1U41A 3O3BA 4KPHL 1KYUA 4OCNC 3MLVH 2ZT9C 4JN1L 1A9BA 2YEVB 2NY6C 1LO3H 1CYGA 5IT2L 1FAIH 1OHQA 3MFFA 2ZJSH 4MQ7A 5KVFL 4PWFA 3LN9A 2B1AH 4IRSD 1WBXA 1N8ZA 3CQPA 1C1EL 4KITB 1KPVA 3BAWA 1UKQA 3IAPA 3K6FA 1XGRA 1KIRB 1YAIA 2QADC 3BZFA 4B9GA 5IFJB 2R8SH 1Z2KA 1FBIL 3FB7A 3IXAA 1AR2A 5IV2B 1QQDA 3EKCA 2CUAA 3TN0A 2HXAA 2IAAC 1DFBL 5F93C 3B34A 4RAUA 1Q4NX 5IBUB 1U2YA 1INDL 1I3GH 4ODVH 4TNVK 5E00B 4N8VA 5D1XE 1YN6A 1QG3A 1INQB 2GC4C 5IG7A 1RMFH 2XIBA 4ENEC 3H42H 1BFTA 2X4UB 5F1NB 3L3DB 1ITBB 1TENA 1TTCA 5TF1H 4ZMYA 1DJGA 1I8LA 3TP4A 2QDWA 2B4CH 4YH6A 3JWNE 3QUXA 2I7SA 3IE9A 3ECVA 3BWUC 4Q0XL 2PPCA 3IBOA 1R3KB 5KSAA 3QUYD 2APSA 2OMWA 3VRIA 5E2WH 5DI8A 1KEGL 4WJ5B 5B21A 1E0OB 4N2DA 2NTFB 3ECBA 4JFEA 4Y16B 5IW1B 3IDMA 5T1DH 4LRNL 5K1VA 3C75A 3GFUA 2PXYD 4FQLH 3BLPX 1MJJA 4TLTA 1NDTA 3QRLA 2B39A 3S4SB 2FE0A 1XGUA 5LGHH 4M43L 4HKBB 4APQC 1UA6H 2MFNA 2VXQA 1HHGA 5AVQB 2QTEA 3MRHB 1QNIA 3VRJA 4TTGA 3LHPL 2EDOA 3SO3B 4CSTA 1SN5A 3ZMRA 4JPKL 3BAYA 1JG9A 3MV9B 5E08L 4IEFA 2K4WA 4WTXA 4X4ZA 4G82A 1ZT4B 2AZUA 4UIKL 1YPZB 3FZUC 2ZSVB 1DL7H 2BWQA 2Y1AA 5EBGA 4JREB 3QUZC 3II2A 5FWRA 1VIWA 2NY5H 3S5ZA 3C6SA 2A2QT 4TV3A 4EZKA 4RRPM 3FU3A 2DWDB 4MZIA 4JPWL 4GKOA 3N43F 2NT0A 3ZX1A 4E9WA 1NGXB 5HVGB 4Y9GA 3WMQA 4BWTA 1IGFL 3C5SB 1I7ZA 2ITDB 1UYWH 4S1DD 4Q56A 2PPAA 5FUZL 4B95C 4MJIA 1AHKA 1E5BA 1F58L 4NBZB 3O8XB 2A73B 1D6EA 4GEJA 3TFKD 3FTVA 4UU9A 1T4WA 1CQKA 3IM1A 1A7PL 4R7LA 3I50H 5IGXH 1H8NA 2FSEB 3T2NL 1A6AB 5JUEH 5L2KD 2LU5A 4RGNE 3E2HB 3DHMA 3BUIA 4R26L 1YEGH 2YD0A 4K71B 1S5HB 3C08H 3Q5YA 5TK2A 4P46A 4BYHA 2J55A 3DDFA 2BRRH 3BE1H 3CMGA 3FT0A 4TSCH 2ZG1A 2QZ5A 2VLLB 3F64A 3ZE0F 1SM3L 1FNGB 4GAYA 3REVA 3WLWC 4BQ9A 5I6NA 1KGXA 5EZJB 1LE5B 4OJYA 1FFNB 1ORQB 2WLKA 3IFLL 1EXGA 1NFIA 4MQTB 3SKOA 3V55A 1AMXA 2HT4D 3EIFA 4NM8H 3PDDA 4S11A 1ZXKA 4YPJA 3C6LD 2FATL 3D85A 5D7IA 2NDFA 4QY8A 3VMOA 4JG0L 3BZ5A 4NO3B 5A7EA 1CC3A 3FTWA 1QSEA 4HU2A 5F9AC 1KB5A 1Q9WB 1S4IA 4PB0H 2BCKB 3NCBB 4R8WL 1HX0A 1TITA 3LKOB 4OB5H 4XN7A 1ACCA 2F8VA 1B4LA 3HG0A 5DT1H 3SYAA 3ZTNH 4W4OA 4MJ6A 4F20A 3HRZC 2BP8B 5EUKA 4JDTH 4P4KB 2ZOOA 1MJ8L 1P7BA 5DS2A 1MFBH 4LB8A 1MLCA 4JUTA 3VXMA 4D0DA 3O2DH 3VXSD 5HHPA 2XN2A 1CBVL 1UXWA 3SE8L 3PGDA 3JTSA 5GZNA 4ZBJA 3MROA 4IDJL 2YUWA 3CSBA 3CCHA 2CGRL 1I8MA 3T09A 5AW4B 4N8CL 4J12A 1FPTL 1R1CA 1JI1A 2BY2A 4HUWB 4U1KA 5G4MA 2WAHA 1S7RB 5JNYB 4FP8H 4QYOB 3I2CH 1CFMA 1GYAA 3EOTL 4P5TC 5LJYH 1HQ4A 3FDWA 4WFHE 3P0VL 4AYID 3JYCA 1ZV5A 3FQUB 5F7BA 4OM0L 5E8EA 3RU8L 4P2OD 5E4OA 5JDSB 2NY3C 3BMVA 2RHEA 2EIEA 3O2VL 2OK0L 3JUZA 2BP5M 4P23B 4BFJA 1FL6B 1JV5B 1T1XA 2CHXA 4QWWD 4JO1H 4QRPB 3VFGH 4UV7L 3MUJA 2VN3A 3PV7A 1IX2A 4MASA 1EHLH 4LLVB 3HB3C 4PS3A 2F5BH 1KYDA 4KFZC 4IMLA 1D9KB 4HT1H 5HGHA 4L9DA 1H3PL 5B3NA 4ZUSA 3WEBA 4L1SA 3DTUB 2XKSA 2ZYHA 1QEXA 3ALPA 3HE6D 1PFOA 2J21A 5EN3A 1OPOA 1FZMB 1YECL 3SKNA 4KKNA 1MAKA 2HAZA 4NZFA 5LAXB 4FLQA 2HJKB 4JM2B 4P57A 2Q6WA 3B6SB 4M5ZH 2WSKA 4ELMA 1DVXA 3ARUA 4E9YA 4QHNA 2X6AA 1OAYL 2XTLA 4DUWA 2VDNH 4G8IA 1FL3B 1HIML 3FO0L 2W60B 3FO2B 1S6NA 3D4ZA 3WTUA 4N0FA 1MI5B 2WINB 4FXGC 4LKXA 4FQXA 3DOSA 2PPDA 1LYQA 4X7FC 1BQLH 3SGKC 2YARA 1UXMA 4OCSL 2AQTA 4JQIL 4MS6A 2JK5A 3PGCB 1EVUA 3FKUS 3Q6FB 2XTSA 4OLYL 4WCYH 3IDGB 5E6YA 5CGMA 2J4WH 1UA7A 4X5LA 3RY4A 3IMBA 2LU4A 4YLCA 5H37A 4MMZC 2APBA 3II3A 3IKCA 3IDYB 1I9IH 1MFEH 1MAML 3QXDB 1OSYA 2W0KA 1HYSD 3O2WL 4MJIE 3BISA 2CIIB 2VL5B 3DX6A 4F8PA 2H8PB 3LVTA 5DMIH 3SDYL 3ZGHA 3AQYA 4NWUH 4EOWH 5AOZA 4JB9L 3TTYA 2JKNA 4M7ZB 4B9YA 1OCZB 5GQBA 1NH6A 4NAJA 4ZMTA 5MEND 1YMME 1TKWB 1GW6A 4M03A 1D5RA 3QJSB 2EYSA 2VLJE 1LEKA 2EDRA 2X6CA 1YMHA 1O75A 2LE9A 1K4CA 3O4LD 2VDMB 2F74A 3EYOB 4UOQA 1LNUB 2BOBA 3ILQD 1U21A 4WU7A 3NSJA 1INEH 3DX0A 5D1ZD 3HZVB 2A0LD 2R29H 5FYKL 3U4BL 3C5ZA 4PRAA 5F7HA 1FGVL 3BFQG 2BOCA 3V79C 4OIFA 4NZTL 2JI3A 4NKIL 5IQLA 4JPIB 1I7TB 4R4BB 1CFSB 1OP9A 3NCFB 3HFML 4AQAA 4G7YL 4DZ8B 5D7IE 4I3SL 1LEGB 2IO5A 4R2GB 2UWEE 3EOBA 1X4XA 4BFEA 4BZ1H 1VGKA 5EEUA 3KYKH 3D39A 1T20A 1PY4A 4MSWA 1I9RH 1M2VA 3AS2A 4Y16C 3LXCA 3DTXB 5JW4R 5T33L 4WNJA 5ERWA 4YK4C 3VFSA 5DJ0A 1RKRA 1KOAA 4OGYL 1E9PB 1HAWA 5I30L 3Q5TA 4ZT1A 3I9PA 3TJHD 3VXME 1YN7B 3FN0H 4D7BA 1VZIA 1YEJL 1RZKL 4CN6A 3B9EA 3RWIA 1PIGA 4O02A 4EBQL 1G9EA 3SO3C 1O6SA 2JKTM 5F7AA 2B1HL 1ZK9A 3P30L 3MRJA 5JLZB 2FJHB 1N19A 3BP6A 3IETA 3MN8A 5SX5K 1JGUL 4UTAA 4N90E 1MCWW 5MI0B 2XUWA 3RFRA 1NAMA 5EOQH 3QIBA 5EBWB 2R9HD 1XO8A 2YSSA 3MLTB 3TJPA 2JF1A 1QZ1A 2VM3A 3DROA 1FIGL 5B4MD 4Z3EA 4FQJL 4Y5YC 1RL1A 1MRCL 1QX1A 2C26A 3BWUF 2FEEL 1NFAA 2DYSB 3GEWB 5FYKU 1BIIB 2QEJA 2Z3FA 4RDQG 4TUKH 3G5XB 1RUAL 3ARDA 2WUBH 4RQQA 2WP3T 1NC4D 1GZPA 1NMBL 3EOAA 1QW8A 4YSCA 3I6KA 5F3BA 3VTTA 1A1NB 5FC9A 4K3EL 3UROR 3HG1B 3UADA 2EYRB 4ZUVB 4POZD 4DEPC 4AJWA 3VXQA 1H8LA 2CHDA 3FQTA 2YC1B 2ADJA 3QRGL 3QARA 1NAKH 5GSVB 2VXUL 3SD2A 4E2OA 1CD0A 2BVOA 5A2JH 3E2HC 4CKQA 3R06A 3IN0A 3FRUA 3TBVB 1RZFH 4JG5A 1OWWA 4FFZL 4LLYA 4UZGA 2VLKD 4QXGH 4YXKH 5IMOA 1AIZA 2WV3A 2YRPA 4JVPA 4Y7OC 5AOJA 5EPMA 1IGML 3D0LA 5TE4L 3UTTD 3OHXC 1TO4A 2XI9A 4XCCH 3ME0B 1K72A 1CE6A 3D05A 1CLOH 1X9QA 1PCXA 3EDEA 4N26A 1KXTA 1PZBA 4E41D 1AC0A 1CICB 2X2JA 3BN9C 4JFQB 3UCQA 3WUWG 2JH2A 4KI5D 1Y1DA 3BP5B 4YHOH 3MA7A 5EU6D 5TDPB 4XMPL 3GSXB 3OPZL 3QI9D 4EO5A 1U8PB 4KVPA 3DUUA 3UAJC 1RAMA 1NCBL 2WVSA 5DJDA 5JIIA 3IN2A 1S9WA 4BELD 4OQ1A 1LK3L 3GXNA 5KSUB 2CGYA 1XQ4A 1JZDC 2Y7QB 3KNBA 2ZUTA 4AX3A 5IY5B 2GJZB 2AQ1A 3WXWH 4G43A 3D4CA 2APVA 4TYUA 3P9LB 2KBGA 4XRCA 3H6AA 2NZ9C 2YMXH 4FMVA 4NPYA 1XAUA 5JPMA 1J8RA 1DLHA 4PGJA 1KPUB 3O6KH 3DSNA 4QNPF 4FADA 2WXGA 3RVUD 1IEHA 4CGTA 3RVVC 1R47A 1X5HA 3K81A 2FHFA 3LRMA 3QJOA 5F1IB 4RIRB 4ZFZA 3T3MF 4U6TA 4RFNC 1XGQB 2OMBA 5IESH 3CU7A 3FT3B 4JPVL 5FIEA 3M1BB 1CTNA 1ZPUA 1X7QB 2R0ZH 3QDAA 5DVOA 2FWLB 1TNMA 4QXVA 5FA4A 1OLLA 3GI8H 2Q86B 1QR1A 1TVDA 1KDIA 4ONFL 3HG3A 3MRIB 1F4WL 4ODSL 1CFQA 2MQ0A 1GGIH 4HETA 4JFWA 2CLRB 3AC0A 2ENYA 3DMMD 4QKXB 1CDIA 1T89C 3QZPA 5IM7B 1IGCH 1L9NA 2A9NH 1S7VA 2FVNA 4HJSA 3BZ4B 5IFAH 4NNXB 1RUML 2ZCLL 3WIFA 4GUQA 4MD4B 1CO1A 4R96A 2IPUK 5HY9A 1MFAH 3BDYL 1QSFD 3M6DA 4MAYC 4Z8FL 3M17A 3FONA 4YO0A 2QL1A 4G7VL 2I32A 3HJEA 2WZPD 3LAFA 4FI6A 4XP5L 2F2HA 4Z7VF 2OLDA 2H7WA 3UC2A 2BK8A 2P8LA 3AS0A 2EIJB 1PIFA 5MHSE 3QG7L 4N0YL 4A6YH 3LVEA 1A1OA 1HSAA 3G5YB 1P69B 5H2BA 5GJTH 3DURA 1WD9A 4JFFA 3KLKA 4NDMA 5EF3A 5DWUH 4HEPA 1QATA 3OGCB 3VGHA 2HH0H 3ZE0E 5JZ7C 1TTUA 3I6LD 3C5XA 4G8GB 2WQWA 3RHWK 3NRPA 4NIYE 1K5WA 3CDFA 2JCCF 1N67A 5D2NB 3VX0A 4LSRL 5BZDA 1ETZA 4HV8B 1EIBA 1G9NL 1CG9A 3L4ZA 4I18C 2Y5TB 1PLAA 5E6ZA 4AGPA 4BZ2L 1QO3B 3C5JA 4QO1B 1M7XA 1P4IL 3GSOB 1G9HA 2DDQH 2FNWA 2X4RB 1J0IA 2DQIL 4O2CB 4S1QL 4B96A 5E4EB 5GHWH 4PR5A 2JIXA 3VH8B 1B9ZA 1O0VA 2FNBA 2FX9H 2J8OA 3NZHL 4NJAL 4UT6H 1HXKA 2NR6C 4X9FA 5IQ7L 3T1WA 3KE0A 4G72B 5E5UB 4TVSa 2VDML 1I1AD 4M7ZC 5CO1A 2KPWA 5ICZA 1KYOJ 2BNUA 3EDJA 1XTMA 3IJ9A 3NSDA 3OKKA 4G8FB 4FA7B 4RH4A 1IJNA 3TCXA 3U4EB 2O4EA 3FF8A 2CM6A 3EJCA 3LQAL 3FUIA 4P3CH 3DOIA 3U2JA 3AU1B 3DBXA 5J0BA 5FYLL 4PJDF 5IUSA 1WZMA 4JKNA 1JWMB 3FUHA 3QB7C 5I8OL 1BG1A 3JTTA 3MOQA 4DN4H 3A67H 4RAVB 2XKNB 1AY1H 3SO5A 3MV7E 4QRRA 5BUGA 4G9FB 4K7PX 4U6XA 5KVGL 3A0OA 2D03L 2XVLA 5D4IA 1IT9H 3K80A 1RZ8B 1CF1A 4DKFH 2V5TA 3P0YL 4KQ3L 5CLYA 3S96B 3RTQD 1JMZA 3AWEA 4H88H 2DB8A 1ZEAH 4JGNA 4KHTH 1RPKA 3KDMA 4M3HA 4UV4H 4LLUB 3TM6A 3AQZA 5KANG 1YEFH 4HPYL 1EERB 3NIFE 2VDKH 4GLRI 3MCG1 4Q6IB 1SMAA 1QASA 5ESQA 3W2DL 1AQDA 3HZ3A 5DVNA 5E99L 1GY2A 3OZKA 3V0WL 3PL6A 4K2UH 1D5IH 1N7MH 3WO4B 3HC3H 3PIQB 4OVVA 4OLWL 4GG8B 3ZN6A 2GIMA 5KW9L 2Z93B 1BPVA 4W1TA 5I16A 1FNAA 5K9QG 4GT7A 5IWLC 2EDBA 4OF3A 3H4FA 2DZEA 4YBQD 1HC1A 1TJHL 2X6MA 2IANA 5GPRA 4XNYH 1ZMYA 2EECA 2HFEA 2IH3B 2HTLD 4Y5VA 5AKTA 2X1QA 3O9WA 1HNGA 3DWTA 4WTQA 3E9TA 5ACZA 5LBGA 4HWBA 4M6OH 1JHTB 1YUHB 4W6YB 3CVHL 4EDXA 3UMNA 4EZLA 4Q58C 2BNRB 4ZFQA 1BEXA 2XYCA 4ZUWA 3V95A 4Z7AA 4GSXA 2NZ1A 2PO6B 4K7FB 1G9ML 3PP3H 4AE1A 4IRZH 5C0JA 2Z4QB 1AZNA 4GRLA 4H4NA 4MMXB 1JF1B 1E42A 5D1QA 3WNKA 3AAZB 1MY5A 4QF1B 2R7EB 4HZLA 4Y4HD 1WG3A 2X89D 5KN5A 4OJCA 3EUUA 1IC5L 2R0LH 3TASA 3QA3A 5EFIA 4P5KB 3KS0H 5DHVB 4FQIL 4FF9A 1YPZF 4ZW6A 3WBDA 4O5LH 1FLRH 2H5UA 5EF0A 2BP0A 1PBYA 4N87A 3RWHA 3IDJA 4AG4L 1ORSA 4JFFE 3HR5A 1BZQK 4YEFA 2W9EL 5AVVB 3S8GB 3C60A 1TSRA 1A4JB 4Y4KA 1UH3A 1UOKA 2JB6B 2B77A 3GMMA 2FQGA 2QQLL 4MD5A 4KJPC 1HHJB 3TEZA 5DR5L 3GMPA 5EORL 3VDBA 4DP5X 4PJFA 4I0PC 5FAAA 1D6VL 1HE8A 2PUQT 4G2AA 3UABA 3Q1EA 1HJBC 2VYRE 2V2XA 1W0VA 3U9PH 1M6OB 2OR9H 5HYFA 5JHLL 5IQNA 5AW6B 2PWHA 4UT7H 5DJ2B 3GSNA 2VLMD 3V4VB 4LXFA 2VM4A 4HAFA 4ZOEA 2YD4A 2VR6A 3MRMB 2YAOA 1OARL 3PWNB 1XCTA 3SBWC 4B7LA 5E1AA 2COVD 1IL1A 5KG9A 2NY1C 3QIWC 2Y5QA 4WHTA 4QOKA 2N7AA 4X7EC 1J5HA 2SEBA 3NP3A 3RDTB 2Y2YA 3IPFA 1BBDL 3TH4T 5BRQA 1XF3A 4BCZA 4OBSA 3HLAB 4X99B 2V17H 2X7LB 3D25B 1RK7A 2IDFA 2KKQA 2WD0A 4IRJA 4WU5A 3UMTA 3VX1A 1RK0B 1PDKB 1QNZH 3ETSA 1KULA 1A6ZA 1A9EB 2R69L 1N0LB 4M93B 4LEEA 3BPOB 4LPYA 2V9TA 4QRRE 3VFWB 3Q8FA 3UO1L 5D1XD 3VWKD 3OR7A 2Y9RT 1SQ2N 4KTEH 5DS8B 2GJ6E 4KQ4L 4D0CB 5IFHL 1VACA 2A7BA 3PJNA 5DEGA 1HWGB 2QVMA 3CTTA 1GXEA 1FZJB 3RX7A 1KZQA 3ARGB 3BJLA 2E7DA 1TO5A 1F56A 2FWUA 2K4AA 1A65A 3EGXA 4ANWA 5FDWB 3LKPB 4HK0B 3QEUA 2CXGA 4MCYA 3GSVB 4PJIA 2WMPB 1WITA 2XWTB 4TQIA 4JR9H 3L17A 4OIBA 2C9XA 2GSMB 1NCHA 2PABA 1AGEA 2NY4C 1Q1JL 1UM5L 3IJEA 1L0XA 3RDJA 4GI9A 1RZJC 2I9TA 3FQWB 2A6JA 3OX8A 4UT9L 5ESAA 1UCBH 4IOFD 1QI5A 1EVTC 2AQRA 1FI8C 2CQVA 3SCMD 4G6AD 1RURL 5TE6H 1TQUA 2WLNA 4HPOL 5AG8A 4HIEA 5LBSH 3H2WA 5TDOB 3ULUC 2NMSA 4LLAA 3KPPB 2VO5A 2ZXWB 1YYML 4Y9EA 2IGFH 5T3ZH 2IANE 5IR1A 4AIEA 3ZTEA 1F0LA 2NQ3A 5I1IL 1JV2B 5LHDA 1QFWM 5AG9A 2YUXA 1ERNA 4ADJA 3B9KD 3BPCA 3EJTA 2JLLA 5D2NC 2L7EA 4U6HA 4MNQA 5D7SH 3IPEA 1G1KA 5EOTA 3RVTD 1ZKAA 1U3HD 2EC8A 4FDWA 3A3YB 4H26A 1U8IA 4N2FA 3VW3L 4U0QB 1F45A 3UDWC 4WK2B 4H0IA 5E4EC 3U2IA 2YZ1A 3MBWA 3QNYB 1CYXA 2TSAA 1TZOA 1F3DJ 2G5RA 1KBKA 1TNNA 3ZL4H 4EI6A 3SJVD 4F7PA 4KKAC 1FNSL 4OFYD 5IFJA 4N2IA 2Y36L 4IS6A 3DV6A 2YN5A 1ZHLB 2Z31D 3FT4B 1NEZG 2FBJH 4UOJA 3MUZ1 3CFKB 1B2WH 4RGND 2CK0H 3W0WB 1NGYA 2V2TA 2X6BA 2DLIA 1BAFH 2IPKB 3QG6B 4QNPE 3ELAT 1BX2A 3WKQA 3H9SE 3JV6A 4ZK8A 3T3ME 1IAOA 2VR5A 1SXNA 3F8UB 1C5DB 1IO4C 3L1OH 4ISVB 4X6CF 2PW1A 1TQTA 3O3EB 4P5MB 3ZXAC 1ZK5A 3KYOA 4GJTB 5L88L 1QUPA 1R3KA 2OSYA 4XNDA 2VLRE 1UHVA 4Z77B 4UQ3B 1KTLA 4JKPL 4MDJA 1UZ8B 4PJFE 3UJIH 4ZD3H 3WHE1 1JD9A 2DQGL 3N1FC 3SE9H 1RJYB 4NC0B 2E76C 3TO4A 2J72A 1S7SA 2HFFB 1U8HB 3WIAA 1SY6L 4NEHB 1KGJA 4ACPA 1JTOA 2WXKA 3S8WA 5CJ5A 4ZW5A 1DFXA 2FD6H 5CLXA 3TO2B 5HDWA 4IJTA 3VNYA 4Q6IC 4PRIA 3MRHA 1RCYA 2BZDA 3KPQB 5DYOA 3B9VA 1WVZA 3SPIA 2MEJB 3MCYA 3T4AA 5MP6L 4Y19A 4RMBA 3IFNH 3MV9A 1YY8A 3WO4C 4PJEB 2HT3C 4HQQL 5A6MA 4Z7VE 3TCLB 4UUJB 3QIUD 4NQVA 4DN3H 4PRHB 2K70A 2ZP8A 4XNBA 4G42A 4X4KA 1U3ZA 2PCXA 1WEJL 3JV4B 1BXUA 5E95B 3UP6A 4A2EA 4FFVC 1PMYA 2HVKB 4Z7IA 2A74B 3LD8C 1A3RL 1WZ1H 3BQVA 2IGLA 4TKWA 5FGCE 2IBZY 2MPAH 4BE5A 1WFTA 2EUZA 2ITDA 3MNMA 1REIA 3MRNB 1K5NB 3W1ZA 3E8UL 1ILUA 3MOBL 4JRYA 4R97C 4WFHD 1GIGH 4FG6C 2JCCE 3TV8A 4P2RE 3ARWA 3NSCA 2HG5B 4I9WE 2ITEA 1KJMA 4P5SA 1A0QL 4A7GF 2PO6C 5BNXD 4JFHE 4NNPH 4GEIA 1A6AA 1U8QA 2E6JA 4Z23A 1LGVA 4PJIE 1IAKA 2M83A 4NENA 1ASOA 3WNLA 5FUOL 4FG4A 4PGDB 3BHBB 1S5HA 2MIZA 4BBWA 1I3UA 3QSKB 5F9OL 5C6WH 3TC9A 3ULVC 1NBVL 3OZ9L 3SPHA 2VDRB 5BQ7A 3NJMA 1RIVH 2H45A 1FNGA 2WNKA 4RISH 2DJ4A 4LP4A 5B38B 4XN1A 4FFZA 2EP6A 5EC2A 1KTDB 4KMLB 5INCA 4LCCA 3WV0A 1BG9A 1TJGH 2H2PD 3TWCH 3DXAE 3H9HA 2PTUA 4M02A 1HOCB 1F2XK 3FUFA 2BNQB 1QAWA 5FA3A 3RWDB 5DMGD 3BW9A 4GO8A 4MZ2A 4ZS6D 1PSKL 5IUCA 3EAKA 1SOKA 5TPWL 3F7LA 3K1KC 4Z7UB 1OP3H 3SOBH 1R5VB 4NO3A 1X9LA 3V4VL 4XMLL 1WFJA 4R90H 1G7QA 3RWCA 4TSBH 1A7RH 4ZMQA 3FFCA 1AE6L 1T03L 2GIXA 4PG9B 1BBJB 4N20A 5I6MA 4ZPVB 1KCWA 2Q87A 1IGIL 4NC1C 5GS1A 1PZUB 1DHKA 2H9GB 1E5CA 4FQQB 4XCYB 1R9FA 1PY0A 4M8QB 1NGPL 2YUVA 3GS7A 2B9BA 1KJ2L 5TD4A 5JHMA 3E6FA 5LCVH 4KXZH 3LZQA 1H5BC 1M71B 1X5MA 4LSUL 1ZT7A 2YQ3A 2OZ4H 3WUWA 1UJ3B 1EFXA 1II4E 1YMMD 2B5IC 3WEMA 2ZUWA 4F9PC 4HUWA 4DP0X 3D9AL 2R23A 1T83C 3GJEA 1VFUA 2VLJD 4HBCL 5TJWK 4HFUL 2FT8A 2IPTH 2QR0B 3VGEA 2BVQB 4WI0B 1OTSC 4X42A 1NJ9A 3PJLA 3WKPA 2FT6A 4ZX5A 1NCDL 2VITB 3K6SB 1EGJL 1KTRL 3BEVB 4XC1H 4M93C 3BPOC 1KJ3H 3FNKA 5JDSA 3CPLB 4PWGA 1QUNA 4RAHA 5FYKE 4HIJB 4D9LH 5HYJB 3IMWA 2ICES 4TN9A 2OYMA 1U8OB 2P45B 4QRPA 3JWOC 4ODTH 4UOZA 1AYRA 4J3SA 1IQWL 4FTVD 4F1SA 1MOEA 4IYKA 2X4OB 4NQXB 3RWGA 3FHQA 1F13A 2Y07L 3MNVB 3TA3B 3ARBA 1Q9KA 4UQ2B 5E6IC 4KDWA 3P11L 1I7RB 4Y4FD 4QHLB 1HI6A 2R83A 4TUJA 1MPAH 4FP8L 3KBFA 3DETD 1FZMA 1TCRA 2Y23A 3L2LA 2F5AH 2CBPA 4DGYH 1AGCB 2HVJA 1U58A 3HJ0A 2IFGA 2BSTA 4JM2A 3B6SA 3VA6A 2R56L 1U8MA 5J6GA 3T65B 1MXDA 3VD2A 1MFCL 4WI8A 5CIPB 5HHQA 2ZAGA 4HKZB 4PLJC 1ID2A 2YAFA 3VXMD 4LNRA 3GUTB 1X5GA 3OMIB 2NYKA 3MV9E 2XTJB 3HNVH 1YPZE 3GTTA 1JGDB 3VD1A 2MKWA 1HU8A 4ZS7L 3VAEA 4A2LA 1CPUA 3I02B 2DD8L 3CQQA 3D51A 4N90D 3S5YA 1GA2A 4U2YA 1ZLVH 1N59B 4PJCA 2CO6A 3GGWA 2DMGA 2CLVB 3LY6A 4QRUA 3L16A 2KT6A 1S5IL 2FJGA 4BA0A 2X28A 2FO1A 1U33A 4G9DA 2V37A 3GXMA 2OMXB 2P24B 2NNRA 4BDVB 5JPNA 2VL5A 3CN2A 3BGFC 3PAZA 5J13B 5KZCB 2ZF9A 4NXKA 3OXSA 3VI4A 3O11B 4BZ2A 2BZCA 2FK9A 5AAPA 3S36X 3G6DH 1NWOA 2DBLH 2DYPB 4KZDL 4LAJH 5TFSH 3SDCA 5IVXB 2L04A 2YK1H 3BI9X 3CH1B 3SPJA 2CO7B 2RTTA 1IAII 1MHCA 3CSYB 4HU8A 4ZI8A 5LG1A 2BY1A 2N7SA 5LAPA 3U6XA 1ZTMA 3LKQA 1ZANL 3HCVA 2OSLA 3WDIA 2VMCA 4Y88A 1K9TA 3QRFM 2CJ3A 4W81A 5LQBL 4HAKA 5DD0H 4PTUB 2XN9D 4OZHB 3RB7A 3LTVA 4OCMC 2DM2A 2X9YA 1Q0YH 1SQMA 2AEIT 1SVZA 4QHUA 4L1LA 4PWHA 3TT1L 3LB6C 4JRFA 1Q90A 4AC4A 4J6IA 3ZMEA 1A64A 5HDRA 4R4BA 4PUBL 3TBTB 3ZL1A 4F8NA 4AIOA 5T1JA 4ES8A 3GSWA 3CLEL 4WV1A 5I1AA 5H8DA 4LCYA 4FQXD 1N5YH 5HDQL 1JFQL 3E9UA 1D5ZA 1LEGA 3QXVA 4N5UA 3VFMB 4BSWA 3HZMA 2XNAB 1RZJH 1ZHBB 5TH2A 3U46B 1QI4A 3CMOH 4D2NA 5T3ZE 3D5OF 3PWJB 1VADA 2H6UA 4LCIL 5C0CA 2ENPA 1U4EA 5C70A 3IMSA 4M62L 1AKJB 3LRLA 1BVNP 3NFSL 3OF6A 3QCUH 1BSIA 4N0UA 4F7EB 1PG7X 4NLHA 4K94C 3ULUH 4W9CC 4MCZB 3FTXA 2EICA 3BDBA 5CHNA 1U92A 3GSUA 5HHNA 2EXWC 3IJSA 1E4XI 5BZXA 1MEXH 2A6KB 2EYTB 4DH2A 4HC1L 5LUMA 2WLJA 3A5VA 4NCC1 2GSGA 3QJHB 4P9HC 1Q9LB 3KCWA 4LL9A 2ZUSA 4JDVA 1S9VA 5ADPL 1FFRA 5SV3A 2OJZL 4U1GC 3MLTA 5C0EA 1OT1A 1Y6NR 2CKBB 4X8CA 3BEWB 5I71B 3S88H 5E2VL 5A2FA 2YLHA 4JG9A 4FL4B 3ZUCA 3APMA 4ETQB 3QUMA 5DF0A 4RGMC 3ESVF 9CGTA 2BSEA 1XZ0A 2PP8A 3PXJA 5DZNA 3ZLQC 1MVYA 3GHEL 1XD1A 4PPTA 4JFZL 4YX2H 4QRPE 43CAA 3ARFA 5FB8A 4C4KO 2MTAA 3LEVL 3CVHA 4MA7H 5K9JL 4AL8C 5CD3A 3DHPA 3QNFA 5EOQL 1IBHA 4KHXL 4LEXL 2ETWA 4IGBA 1AQHA 1HT6A 5IROA 5DUJA 5I76B 1U8KB 1K85A 1FQ9C 2JKIS 4ACTA 2RAMA 1PS3A 3RZCC 2WBXA 3HOGA 1JPTL 5KBDA 5DJ6B 4FCAA 1V27A 4XVTH 2DQTH 4OZGB 2CIKB 1MFNA 2HKHL 4ZNEE 5F7EH 3UJTL 4OT1L 3P4NA 2KC0A 3SKUD 4JMNA 2A9ML 3U7AA 2FRGP 3ME0A 1MI5E 3RGBA 5EN2A 2XA8H 1TQSA 5FO9B 2WHVA 5FGSA 5LLIC 5FK9B 2KZKA 4R0LA 5F2FA 5MHSD 2YO3A 4O58L 2I60L 1L5GB 4L0PB 4I1PA 4WO4A 3SYQA 4YHKL 4Z1PA 1CICA 1FO0B 4E9TA 5I19L 2P8PB 3HA0A 2EILB 3NUKA 3BP5A 4A66A 1HESA 4OKVB 4AC2A 2BM3A 4ERSH 1I53A 3GSXA 3MRFB 1ES0A 3V5HB 4S1SH 3ZQWA 2F58L 3T2OA 3PAYA 1EUTA 3VSQA 2O6EA 4GMSL 2ZX6A 3ARDD 1OM9A 5K59E 1FA4A 1OE2A 1ZHNA 1ZLSH 4DPAX 3TJEH 2PNDA 5JHLA 3DUHA 2ID5A 4Y2DD 4Z7WF 3FXIC 1JHLH 1NA8A 5EZLB 3EXLA 3PWPB 4KKBC 4PSRA 4BCYA 3ULVF 2FUTA 1Q0EA 2XFXA 4XWGL 2ZX7A 3VD7A 1T5KA 4F1ZA 2QELA 3L4TA 1KPUA 4YFLF 1NGZA 1RSFA 2Y1YA 3BQUD 4FD0A 3RIFK 4NGHL 1LO5B 3L8QA 5JR1L 4QD2E 1XSIA 3PPSA 3OVUB 4GP5B 5KS9A 3GBDA 5JW4N 1KCSL 3KLLA 3GUFA 4X6BB 4NM4H 5DGQA 1E6JL 3FT3A 2YAEA 1TJIH 5C0ND 3DARA 2HKFL 1EJOH 5FYLE 2KDGA 4L37B 1WFMA 5KJRL 2Q86A 3KPLA 2ZSWB 4NJ9L 4XTRD 3MV7D 3MRIA 2Y6TE 2ROYA 2NOYA 1DZBA 4LRIC 4M7LH 4PU2A 3LMJL 2XJKA 3EO0B 4WUUA 5KVGE 1U93A 3MFGB 1OY3B 3QWQB 1FC1A 4GW4A 3ULVH 1MIMH 1HINL 1M9WA 4NNXA 2AQSA 2AQ3A 1VFOA 4OUOA 3WTVA 5I5JA 3GPEA 2WNGA 1OM3H 4F33A 1R4XA 4QRQB 5KBLA 5J06A 3EYSH 1HXYB 4PJ9B 5DQDL 1TEGA 1ZD6A 4LCWB 2H32A 3UZVA 1TZ8A 1FVCB 3DDGA 1JPGA 3NABH 4B9KC 1KIUA 4Z3JA 2ZTBA 4XX5A 4HAGA 5AOMA 3UTSA 3WN5B 2GY5A 5D7JC 1C5CH 1JVLA 3G5YA 5GZOC 3MRLB 3UZEA 1KLFA 4G3YL 4R7DB 4HS8L 1D7DA 2WLHA 3ZKNC 2AANA 3QS3A 3QFDB 1CFVH 1OSPH 4XNZB 4N2CA 4G1EB