2OULB

The structure of chagasin in complex with a cysteine protease clarifies the binding mode and evolution of a new inhibitor family
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
107
structure length
107
Chain Sequence
KVTKAHNGATLTVAVGELVEIQLPSNPTTGFAWYFEGGTKESPNESMFTVENKYFPPDSKLLGAGGTEHFHVTVKAAGTHAVNLTYMRPWTGPSHDSERFTVYLKAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Falcipain 2
publication title The structure of chagasin in complex with a cysteine protease clarifies the binding mode and evolution of an inhibitor family.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Hydrolase/hydrolase inhibitor
total genus 21
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2007-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF09394 Inhibitor_I42 Chagasin family peptidase inhibitor I42
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2020 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2oulB00
2C34A 3M88A 2WGNB 3CBKB 2FO8A 3E1ZA 2H7WA 2NNRA 3PNRB 2OULB 3CBJB 2NQDA 3M86A
chains in the Genus database with same CATH superfamily
1E4XI 3K4DA 4TVSa 2UUDK 1JZGA 3JWDL 3NCWA 4Z7WF 3EJTA 3SE3C 1TTCA 2DQHL 1YEIH 1Q0YH 2GFBB 5FCUL 3LKRA 3FTZA 2ZYRA 1HHGA 3HHSB 5CHNB 2JQMA 25C8L 4Z7WE 1GY2A 3VFUA 5K9QG 3PXHA 5K5YA 3QEGH 2EECA 1H6FA 5C2UB 1S9XA 2W91A 2PCFB 4DN4L 1XMWA 2JLLA 1TYRA 1NPJA 3OC8A 3QFJE 4ZDHA 4DGVL 1U58B 1JZ2A 2Z4TA 5FYKL 2CDFA 4APXB 5J3HC 3DYPA 4H1LH 4NRXA 4P57A 3ET9F 4U2ZA 3RWEA 4X4YA 2EXYC 3BW9A 3UYPB 3QJRB 1NANH 5T3ZH 3N2JA 1DJWA 4HUKB 5I76B 2IADA 3RUGB 2R1WA 5I6XC 3MA9H 1IFHH 5TE7H 4HKXA 2ZSWB 3AG3B 5DJZA 1CVRA 2ICEA 3ML9A 4JRYB 3TOPA 5B3JE 2XKSA 3U7WH 1T0MA 1DQMH 3QNXB 4N6QA 2V9TA 2FUQA 4BV1A 2NYKA 1OPGH 4WUUB 2E76C 4PJ9C 1N67A 5IWLA 3CDZA 3A3YB 3FAWA 1ET5A 3VG0H 4I0PD 5J12C 5EWIL 1XVSA 4HUWA 3PU7A 5D8JL 3TWCH 2WLLA 3CVDA 1EJOH 4R5XA 4QRRB 1JGDA 2Z8SA 4PRPE 4JFDD 2JXMB 5GGTH 3DXAE 3LNGA 1GYAA 1KELH 2I5YL 1G6RH 2MFNA 4UILH 1D9KC 3FOMB 4LLMA 2KLRA 3N06B 4U6YB 4UM9A 4ODVH 5ECJE 3U9UA 4F80A 4AQAA 5DWPA 4QR7A 5INCA 2X9ZA 3WI9A 1FDLL 3E6HB 1BZ7B 3C8HA 4QOKD 2CK2A 3T2QA 4Y19D 2NXYD 3SCMB 3IDNA 1RJLB 2D7TL 3FZUC 3D85B 4AJVA 4N2EA 3TBYB 3CBRA 4Y2LA 2Z4QA 3K71A 3MV7A 2LGNA 4IBWA 3F7LA 5I19L 5CF3A 2E47A 2IG2L 4A2HA 1I9EA 1G9NC 2EXWC 2PXYA 1UA3A 1X9UA 3IJSA 5I26A 5EO1B 3RAJH 3D05A 2AQTA 2DM4A 2VDPH 3GHBH 4LKXA 1A6WH 2IPTH 1BF2A 2XTJD 4BSJA 5JOPE 4KRPD 5JW5A 5I82A 2Z7YA 1SOXA 2Y25A 1CR9H 3QUXB 2OPCA 2P42B 4KJYB 3A67L 2VZ3A 4L4JA 4NYLB 1OP3H 5JPMC 5ANMB 1PG7H 5CM1A 1IGCH 3IETA 4LNVA 4CGUB 5FW8A 5A16A 1R0AH 3F5WA 3LIZH 5K9JH 2X3CA 3MV7E 1J5HA 4FQIL 5T5FH 4KTEH 5DI8B 5T3XL 3S35L 1SY6L 2DYPD 2DM2A 4R97C 5I1EL 4P06A 1A7NL 3HS9A 4JY6A 4U05A 1TZAA 4KUZH 4F3FB 1IQDA 3DYMA 1JWUA 3PWVA 2PR9A 5E5MB 5HHMD 3HAEG 2H32H 3ESVF 3QXVA 4QAWA 2CM5A 1IBYA 1MG3C 2Y72A 4HUXA 4KI5F 4K5PA 1FCGA 4N0CD 4KI5E 2Q7YA 3CVIH 4KKLD 4XC3L 4MDJA 5DFVC 1MJ8L 1XSIA 5I5MA 2F74B 4JO1L 3KJ4B 1DJSA 2BZ7A 3P0YH 5FXCH 1G94A 2ODHA 1KF9B 2ZCHL 1L0QA 4NIKB 1JWSB 4R96B 4D94A 2UZYA 4O2CA 4PRIB 3VQ1C 3N85H 2FEDD 1AS7A 1WAEA 4PUBH 4IBYA 1FFNA 4JVPA 3VXPA 4L37B 1ACYL 4GOSA 4R4ND 4DP8X 5EHFA 1I7UA 5I30L 1YAZA 1MIEH 3TBTA 4B5EA 3D09A 3QWNA 2AQQA 4YSTA 4PVBA 4JFEB 1OCRB 3QIBB 4MX7A 2XNAA 2YA0A 2HJLA 2D3LA 2RTTA 4XVOA 5SWQA 3JWNC 1VGEL 1I8KB 4F2EA 2YC1B 2XV2A 1ETZB 1AXTL 3WIHA 4OQTH 1NCDH 3W39A 5IVZA 4OTXH 1IEBA 5B3SB 5IB2B 1ZSHA 4M3KB 1BAGA 2JB6A 1JNNL 1NGPL 5IEHB 2YPVL 2APFA 3LQZB 2YD0A 1TVBB 1C12A 4PGDA 4XMLL 2EE9A 4F8OA 4QXUH 3KWXA 3V9CA 1ML0A 3V0FA 3FTSA 5AAMC 3ZTNL 3VXMB 4WAFA 4PGEA 4MMXA 1U3NA 4NM8L 5AW0B 4WW2F 3P4LA 5MERB 1P5UA 1RVFH 3RVTD 4U1IA 2CDEB 4YSDA 1MCOH 2VZ1A 1NEPA 5L4FA 1FAKT 4R26H 2MNJB 1FI8C 4QRUA 5D1XE 3NSXA 3KPRA 3ZO0A 4LSSH 1W16A 2DLFH 3BAXA 5FYJD 4YLCA 5TDPB 3CFCL 4LSQL 1HYSC 4XGZA 3ARWA 2CUHA 1XEUA 3OGOE 4P2YA 5HSFA 1KT2A 2JVUA 1M57B 2P8PB 3FQUB 5EO9B 1DUYB 1FVEB 1ZHNB 2EDHA 2QHRL 3KNBA 4LLQB 1VFUA 2H0FA 3NT0A 2NX5B 4ONFL 4HPYH 3ZX1A 1O0VA 4JFTA 1N12A 2RBLA 4MNQD 5C3LD 2HCZX 3PWJA 5C70A 2QSCL 5DVNA 2X1PA 4AV4A 4CC4C 2VRQA 1BJ8A 4YDKH 5C0IB 3HJ0A 2WBJD 3D0LB 1S7SA 1USQA 2Y36L 1G7HB 1NSNH 1RQ5A 2G60L 2QKIB 3X11B 3O4LE 3KWUA 3H2QA 4IOIA 3W57A 4MVBD 2BNQE 3FT4B 4R7XA 2X6AA 3SE4C 1FNSL 1BQKA 1YEHL 1M7XA 2CXKA 4G72B 3BH9B 2D31B 3MHZA 4QXWA 4QHNA 1MCBA 1ASOA 1X4XA 3UTTB 5E03A 1FPTH 2ALWA 3BWUC 4G6KL 3ROLA 4G7VL 4NKIH 4O2EB 1MAML 1NOLA 3T0EC 3DUSA 2A74C 4M5SA 5CZVH 3WKQA 3QUYC 5IQMA 4P4KD 4P2OC 32C2B 1SJHA 3ZE0F 4GUPA 4YXHH 1AKJA 2QLYA 3O6LL 4JQXC 1SVBA 3MMEA 3TPUB 3ULVD 1F6AB 2YRZA 3CXDH 1BZ9B 1XGUA 2O6PA 4HZAA 3T09A 3CPUA 1T22B 4WF7A 4WW1A 2H3NB 1NC4A 2CIIA 4N5UA 1P7HL 1RZKL 2GJJA 5FA4A 1OLZA 4F5CE 4DEUA 2BDNL 2YPLA 3MGAA 3FSVA 1AO7A 3W56A 3A21A 3COOA 2R7EA 1WT5C 3FN3A 5I17A 4NZTH 3VWKA 1N19A 2PR4H 4HV8B 2YJQA 4QHLA 3GBNH 4PS8A 3FU9A 2ZUQC 1FNGA 4GKNA 3T1FB 4HCGA 3KPTA 5E8PB 3RJQB 1G1KA 1U8KB 1VA9A 5F3HB 2VDRB 4XMKH 4M62L 4AMKL 5EIIG 1GW6A 1SLUA 1H3XA 4J3BA 5BJTA 4BWUA 4AJYV 4LAQH 3DBXB 4FNQA 4PJ8D 1HHHB 3VNZA 3CHOA 4GRLD 5E9AA 4H8VA 1KIQB 1FG9C 1O7VA 1E67A 3LH8A 4NQSA 4L0ZA 1ODUA 4WUKH 1A9BA 4GG6B 4B9PA 3RDTA 1EPFA 3WYRA 2HVJA 5IJVB 4PJCE 1RUPL 5DRXB 5E6IC 2Y7QB 1DSFL 4WI4A 2KDGA 3LEYH 3QQNA 4LSTL 4N0FA 4OJDH 4EI5A 4RMWA 1WA2X 2CA4A 1IGYA 4BJLA 3A6OA 1IZKA 3KYOA 5EZLB 2DQDL 1DJZA 5I1HH 1WWCA 1YZZA 1XF5B 1IKOP 3WFEL 4IRJA 3VI3B 2BHFA 2UZPA 5JXEA 3D39E 1CTMA 1KB3A 3TYGL 1OARH 3P4OA 3DRTA 4I18B 2ZAIA 3ARRA 3BP4A 4UIMB 3THML 1JN6A 4U2YA 3NJJA 3WL9B 2EYRB 5ABDE 3DA0A 4M1GL 1P1ZB 1P9MC 2F5AH 1SVZA 3BFQG 1PQZA 3C2AH 3BP6B 3SYCA 4N3TA 3FMGH 4MZ2A 5A2LH 4ZMVA 5D7IB 2YAOA 3WGUB 2VN4A 1F86A 2H0EA 2WUBL 2VWEE 1U9KA 1S4IA 4IBQA 3TNMA 2HRGA 4ZX3A 4OBSA 4F1SA 4XXWA 1FH5H 4ZYKA 4X7EC 3U46A 2JJUA 3O8XD 2KT6A 4G8IB 3U36A 2IPUK 2N1KA 1MOEA 4HUMB 4JLRB 1U8PB 5C0RL 1TKWA 5GS0D 4KKPA 2I60L 5IJKA 4G8AC 3H7BA 3H54A 4BFFA 4I0PB 4NWTL 5EU6E 2ATAA 1NUDA 4D7PA 4OFYD 4HSAC 2E6JA 3HZYA 4JFDB 4LCWA 1O9ZA 3JUZA 5D5MB 2K6YA 3C60D 5I1GL 2QSTA 1GVIA 2OSWA 3VXOB 4AJWA 3P9MA 4G2AA 3WDHA 1WFUA 4F57L 1Z0MA 2BP0B 1JYVA 2X1OA 2FB4L 3G3LA 4XPAL 5GZNC 4MLSA 3HG1E 1VADB 2CRZA 3GB7B 2VW6A 4K07A 4QOKB 4Y19B 4W4OC 2NXYB 4PJDB 3D69B 5LNGA 1PZCA 3WFHA 1ACCA 3MFGB 4PRAB 4YDIH 3CTTA 2BY0A 3MFFB 2ZYIA 1JYWA 2ZQKA 5GISL 5LKNA 1JGUH 3K8KA 3WAKA 2XTJB 3KD4A 1E6JL 2WLYA 2KC0A 4KRPB 2HFFB 1FZOA 2F53A 2WCSA 1FYTA 4BRVA 1E4JA 4P2AA 1XH1A 4H5SA 3MLYL 4KK6C 3L7FB 3V4VB 2LAAA 2ENPA 3ZQWA 2H0PA 2WLIB 4I9WD 3SE8L 5F7FA 2VXQA 3OSVA 5FDYA 2NY2D 3FRPA 1V3MA 1R5WB 3VMNA 3IAPA 1UVQB 3VUAA 4OVVA 3K7UA 1ZHLA 1ZXKA 5BS0D 2ZKHL 3NZHH 1KPVB 2VDQB 1T0NB 2DYPB 2BIPA 2IFGA 3EDJA 3DX9B 3CSBA 3RWDA 3WJJC 5EU4A 4YSEA 4FS0A 3E2HB 2IFFL 5ESAB 3SGKA 4ALAC 4C4KT 1TJGH 2BOCB 4NDMA 1ZT1A 3G5ZA 1BFSA 4W6YB 3ECBA 4NQTA 5HHMB 1KN2L 4X0KB 1MRFH 1B90A 2VM3A 3CHSA 4H0LC 3UTSA 3LTVA 2H1PH 4GAJL 3U4AA 2ZOKB 4KQ3H 2Z31A 2JV6A 3C6SB 2Z91A 4JDVB 3SPCA 3QBTB 5IT2L 5KYNA 4WSJA 1PZDA 1S7RA 1DANT 1I3RA 3GRWL 1NIEA 2YAQA 1FO0H 2B1AL 1RUAH 4V1DE 2BRQA 2ZXCA 1G7IA 3NSFA 3FH8A 3KYNB 4YFLF 1MHEA 1OAZL 3FCSB 3N1PC 4LRIA 1C1EH 2FX9L 2IDQA 4BHUA 3EF7A 3EO0B 3JWDC 2FD6L 3MTRA 1YG9A 3HAEH 3QDJE 4XMPL 4LKCA 2GT9A 3EJYD 1IC5H 1G9ML 2FJGB 4AGLA 4C83A 4CU8A 2VDQL 3W38A 4MXWL 4BH8A 4OIBA 3P54A 2ZCKH 3BVVA 4MAUH 2VR8A 2ITDB 1FIGL 4GI9A 1D6VH 3IDGB 2HKHH 2DRUA 4OV6F 4IJ3B 1AJ7H 2BVPB 4XPFH 2LAGB 4NCC2 3M1BA 5GZOD 5F1NB 5B39B 2R8SL 3IFNH 3A5VA 4BZ1A 1CYXA 1AHWC 1OAUH 2YAFA 3PQYA 3ZR6A 2GSGA 4L5FE 4PRHD 2D9QB 5KSAC 2I25N 5I6MA 1Q0XL 1S9WA 2V3FA 2TRYA 3OX8B 4E41A 1PJWA 1N7MH 5T3ZD 1X9LA 5E94B 4UQ2B 5EMYA 4S1SH 4G1MB 2XG4A 1U41A 4NQUA 3T8XB 1JDDA 3DTXB 1DJXA 3Q8FA 5F88A 5LGJA 5E99H 1QSEB 5D1ZD 1U8LA 2PWDA 2AGJL 1BECA 1HL8A 4PJFB 4KVNL 1B4JL 4PTUB 9CGTA 1P6WA 2GITA 1JTOA 2P47B 1UT9A 5LNDA 1Q1PA 1D5RA 3BAJA 3MOAH 3SBQA 5EBLA 1ZLWH 5IKCA 2EDOA 4Q9RH 4OIIH 5B4MD 4MXVF 4RA3A 4PTTB 1VFMA 4AMWA 2C3XA 1GXEA 4KPHL 3VU1A 3MJ7A 1G7QA 4URTB 2O5YH 3HC3H 3T08A 4U31A 3QG6A 3PFUA 3I2CH 1GW0A 5F97E 3X14B 4KK9D 3ILPA 4NKDB 1X5KA 3PIQA 2CKBA 3UPRB 4NHCL 1A5FL 4XI5C 1I82A 3AADB 3NCXA 4MNQB 2YA1A 1EZSA 3WTXA 1UZ6F 4WI8A 3MXWL 1JF5A 1MF2H 1H8LA 1Q90A 2B8OT 2V7HB 4G70B 4WTWA 4FTVE 4ZW7A 5AZEH 1LO2L 3IK2A 4NNXA 2C1OB 2OCFD 2A2QT 3SOBL 1JGEA 4OJCA 5D7SH 3UYRH 1M3JA 3B43A 4ACTA 3SGEH 5GHWL 1XF4B 1MQKL 3UTPD 2VH5L 2WQXA 4NO2B 3CCHA 4P49A 3RX9A 1VEMA 5FYJL 3CX2A 4NOFA 4GXVL 2X44D 2DLIA 2OMNA 5KVEH 2CMRH 4MAYD 2BSEA 3FQWA 2CJUH 3ECVA 3O3UN 3SCMC 3VYNA 2XXFA 4GT0A 4YBQD 4OFVA 4PJAA 2YN5A 5ALBH 3Q05A 2KL6A 4WTZG 3JT0A 2HB0A 5BRZE 4YE4H 1B0WA 2GTZB 1DBJH 1LK2B 4RMTA 3NJVA 3VJ6B 1OK8A 4AIOA 2BSTA 1CFTA 3MLVL 4DVBB 4I5BB 4BKLA 3QUXC 3ALXA 5DMKB 4DFIA 2Q8AL 2ICWJ 3GIZH 1IL1A 4AT6B 2D4DA 4CW1A 2I07B 1BF5A 5ICXB 4K3JL 2P8LB 3EDDA 1MHCA 3ZKNC 4ONGH 1FC1A 4HIXH 4N22A 4MNGA 3RURA 5KSBB 1LEGA 3HN3A 1SLXA 1BZQK 2P80A 3NGBB 5GSVB 3R0NA 1E30A 1BVKA 3NH7H 4OLYH 1ES0A 3FQ4A 4YHML 3I6LD 4AK1A 4MB4A 2IDUA 4KBPA 4OFIA 4TUJA 5D2LE 5H2BA 3ILQC 3UP6A 2H3KA 3V6OC 1V27A 3NIFE 2QFPA 4KY2A 2ZCLH 1U95A 2YS4A 4I87A 4PJ8B 2VDMH 4GRLB 3X13A 5FB8B 4J6RL 3ULVL 3C5XA 1RZJL 3KJ4C 1U33A 4JRLA 5T1JA 3FU8A 4P99A 3WLWC 3DV6A 3H9SD 2FWOB 3ALWA 4LPXA 4DP9X 3GEFA 3NEEA 3AXLB 3ZTJG 1AYOA 1BEXA 5CD5C 1KACB 4LPYA 2NNRA 2ZOLA 2V9RA 4WWKD 3QDGE 3M07A 3L3GB 1A22B 4LEXH 4AQ1A 1CCZA 5LQBL 3V52H 3MRJB 2OR9L 4JO3L 3QIBC 2A9NL 2VNCA 3ZIYA 2PWEA 1MIML 4NENB 4FYQA 2P3YA 3OXSB 5F9DC 3ALPA 3CDGB 5IESL 3SEPA 1S7TB 3CHQA 1RLBA 2ZPKH 1UURA 1OAJA 4ZS6D 4L8SB 4UDUA 2WQ8A 1GC1C 1GCFA 2JB5H 1U8MB 1G7PB 2H2SD 4WI6A 1S7QA 1Z32X 3DGGA 4RMSA 4X5RA 3VI4F 1A6AB 4PJGB 1UKTA 1WITA 2HX8A 4RRPM 4ZFZB 3SBWA 3NN8A 3VI4E 1X5HA 1EEQA 3LHPH 3O8XB 2AEQL 4HC1H 2PCPA 5CU5A 1G7MA 4MQ7B 3NCBB 2PP8A 3GXDA 4UIKH 5EUKA 1A64A 2H0JA 4XP9L 5C0FA 1U8IB 3D4CA 1MHPH 3NRPA 2DLHA 1JERA 3BDYH 1XSKA 4TSAH 1QLFB 1N0LB 5PCYA 1QNZH 3P1VA 5I6OA 1E9QA 1P53A 1E28A 4L9LA 1TJIH 2FATH 3PWPA 1W72A 3LH2H 5ITFA 1R5IB 3C60B 1XAKA 3DOSB 2B59B 2DWEA 4I0KA 2YMOA 5DRZA 3GDBA 3KGTA 2E8ZA 4M7LT 3CLFL 3GSQA 3OL2A 3TVMA 1P2CA 3GXFA 3MRBB 1T5WA 4Y8AA 3HS8A 1MCFA 4JN1L 2NQ3A 3T4YB 4MSWA 3UTQA 5HYEA 3RI5F 2NW3A 2OXGA 5BNXD 1CFQB 1YEKL 3ARBB 4WI0B 1NGYA 3UJTL 1QKZH 4XN9A 2KH2B 2XN9A 3MJ9H 3H6AA 3LCYA 3RQ3A 3VD4A 4FHJA 4KHTH 1E4KC 3HI1B 1JNHB 1N3NA 1NCCH 3DK2A 3ARDA 3LHAA 1JG9A 1VGKB 1RZKC 2TAAA 3BPLB 4G8EB 3T6VA 3IDMA 2QFRA 1GGIL 4X6DA 2BOBB 1LP9A 4IMLA 5GS0L 1K9TA 3HVNA 1EAPB 2QKIC 1SXZA 1OTSC 2CUAA 3E3QC 3EAKA 3P02A 2RCSH 3EFOA 3MV9D 4BSVB 5GJTH 4MFHA 4Y4FA 1CL7L 1GS6X 3V0VB 2G5UA 3PAUA 2NY2B 5IVXB 1UJ3A 1JK9B 4L3EE 5BS0B 3EFDL 1X5AA 3K0WA 2CR3A 2DQIL 4NQVA 4XP4H 2YD5A 5F9OL 1XGYH 1PY9A 2NCMA 3E0GA 1IEAA 4JGMA 1U36A 4HQQH 2AAVA 4J6IA 4X6DF 2AQPA 4BXVA 2K8QA 1LP9F 1KIRA 2FJUB 3GSRB 3BGMB 1BHGA 5FO9B 1RFDL 5F7EL 5HJBA 5FECB 1WCBB 2VABB 1UZ8A 4P46A 1RZGB 3IMSA 1LJMA 3S37X 5IJBC 1QD0A 3MRQA 3BH4A 1UD5A 4PJIE 1I1FA 2VTFA 4FA8A 2WUCH 4OZGA 5EPMB 3QIWA 4N90E 2MPAH 4X99B 5JYLA 2WWMD 4PIBA 5F89B 2ARJA 5IFJB 3HOGA 1VFAB 1U3HD 5DJ0A 1TYEB 2GCYB 5JW4R 2QZ5A 3ABZA 1HVXA 2IQAB 4EDWH 3DOIA 5FYKE 2IDCA 3CFJA 3VFOA 3L08A 4EUPA 2X87A 3Q2CA 3VFPA 5F72S 4KY1H 4MZRA 2CPCA 5DZOA 5DO2D 4Y4HA 5I0ZA 2F5BH 2APBA 4FNPA 4E5XB 3IGLA 1FN4A 4NUJA 1RH8A 3SDAA 4JPWH 3S5ZA 4QKTA 1KXHA 3G6JE 3GMOB 3FO0L 4X8XA 4JB9H 1BDYA 1NOFA 4LLWB 3B7UX 1PF3A 3VD0A 2ATPB 3H1ZA 4DAGL 1G9EA 1LL1A 1BAFL 4LHUA 4Z3FA 2VN5A 5E2WL 4DKFH 1UH2A 5EU7E 2IALB 2GJPA 4KHXL 1CF1A 5EZPA 3P9LA 4X7CC 3RA7H 4PRHB 4XVUC 1EEYA 4G9FA 4H1LB 2A9MH 5CIPH 1E65A 2R69H 3GHEH 3PHOB 2B15A 4R3SA 1F97A 2CLZA 1OK0A 1XTLA 4NWUL 2FH6A 2VOTA 3CN1A 4UUJA 1MFAL 5D1ZB 1F1AA 3L1EA 3MNWB 4FC3E 1OHZA 1ZXQA 3D34A 3EJCA 1PY0A 3BSZH 3H55A 3NTCL 4GI8A 5FW7A 5GRJL 1BOGA 3NMEA 4JKKA 2H8PA 4X5XA 3M17B 2WO2B 3ABGA 1YEIL 1RZIB 1Q0YL 3K72A 3HPJA 4R5VA 1YUHB 2C5DC 2O26U 2ZOWA 4GRWH 1QUNA 5F7DA 4I18C 4F7KA 4HJGB 2R2BA 1T7ZA 1G6RB 3QEGL 4OZ4B 1HZHH 4OLUL 4ZBJA 5T1DH 5FWQA 3LD8B 4WUUE 4LPVA 4RQQA 3WUWG 3K1KC 3LN4A 4XCEB 3LKOB 5DJ8A 1AQMA 4FLRA 4APQA 2WIMA 1CD1A 1AI1H 2N3JA 3GMNA 4R0LA 4J12A 3UZEA 3S0PA 4TPRH 5LHDA 1C5CL 5T3ZL 1WFMA 1T2JA 5T3XE 3SQBB 4AEIH 4U6XB 3GF8A 1IFHL 2RQ8A 1Q9WB 4OB5H 4X8JB 1BQHB 4CADB 2OW6A 1UWEL 5TDOB 4G8FA 4XRCB 2VISA 2BX5A 2APTA 2YOCA 5CILH 3UAJA 2VDPB 3U7WL 4WO4D 1DQML 1VKXA 2GG1A 4I0PC 1ZDSA 1PAZA 2HTLD 2UX7A 4Y9FA 5F1SA 1OPGL 2RIKA 3ARPA 2FX8H 4PV8B 2XZZA 1UD3A 4FNSA 1U3JA 3VO0A 4XN4A 3TWCL 1X6NA 3VXSA 4D0DA 1VFOA 4MJIA 1XAUA 3NZ8B 4EO5A 3VFNB 4JVUA 1KELL 3L54A 2ADJA 1WQVT 2VITB 1G6RL 4KXZI 1MW2A 4OCSL 1JGVH 4KUCD 4UILL 3SSGA 5FOJA 4ODVL 4WFFD 3A4DA 1KB5H 2NXYC 4KXDA 1KY7A 2GUOB 5BW7A 2J21A 5CBAB 4WK2B 1M53A 1C5DA 4QRTA 2H32B 4Z77B 2PNDA 4QJ4B 4GQZA 2FDBP 3MREA 1KTKE 2QVFB 2AXHA 5J4MA 3HVDA 1PBYA 2C9XA 3SDXF 4OAWA 1AHMA 4G8GD 3TXAA 2VQ1B 1KPRB 1CFMA 2XTJC 1ET8A 4X5WA 2BIIA 4KRPC 3RAJL 3SDXE 3CH1B 1AGCB 1N2RB 3MRLA 2V17L 3SD2A 3GHBL 3QPQD 2VDPL 2X70B 1A6WL 2IPTL 2NRDA 2FCBA 3O0RH 3L3HA 3VFMA 4ZUUA 1CDUA 5BVJB 5KYUA 3V6OE 1CR9L 2GIXA 4XP6H 4N2KA 5I24A 1A4BA 4FFVD 4L1HA 2X1WL 3MYZA 5CP7A 3O3AB 4M48H 5DQJA 4L18A 2YLHA 1PG7L 3FTYA 1IGCL 1R0AL 2EINB 3LRLA 3LIZL 3D2UA 5IMOB 1IGIH 5K9JL 2JKRM 4BFNA 1N5AA 3B5GA 2YRPA 2BHUA 3BKYH 4KTEL 3E2HC 4I8DA 2CR6A 2A7BA 1WWWX 1ZLUK 3WKYA 3ZTCC 1YUKB 1GS7A 3KEHA 1CE1L 5TH2A 1R3IH 2NZ9D 5IOPB 4RGND 1SM3H 4N0CC 1ZLSH 4KKLC 4OZIA 1D5XB 4TNGA 3BWSA 2IAMD 3L3KB 1Z0NA 2YGVA 3FB8A 2XA3A 4LMQI 4I0CC 2EDNA 4FG4A 1AACA 4FCAA 4HP5A 4P5MB 1A02N 3H9SB 3WJLC 4YFDB 1WAAE 3EIFA 3QEQE 3P0YL 3FQNB 4Q8BA 2FEDC 5E6YA 4F8TA 2EEBA 2LU4A 2P5ED 3OR7A 4WWKB 3T6ZA 3IVKB 2UYLB 3N85L 4R4NC 3BEWA 1YEDB 3AWFA 4Q9CA 1FP5A 4Q6IA 1F4XH 1TO5A 3K2IA 2PP7A 1BX2B 3N44B 2MHAB 5SWSD 3R18A 3WUZA 3HE6D 3TV3H 3ZSTA 5HPOA 5F9WB 1MIEL 2DQUH 1U8OA 2XWBA 3BPNB 4TOYL 5E1AA 4GIPD 3CPLA 1RUQL 2X3AA 2HVKA 4NNYB 3HG2A 3HZMB 3IFOA 5MI0B 1BA9A 4IJ3C 3SKJH 2Y22A 1K4CB 1SN0A 3LPWA 5AB0A 1UATA 3ZKMD 2AJSH 4PPTA 1UB5B 2NY6D 4V11A 2GJZA 3UXFA 3W0WE 4DZ8B 4OQTL 1NCDL 1YNKH 3ZTJH 2R0ZH 5ETUB 2HRPH 4UTAH 1HJCA 2N01B 4DK5A 5EZJA 4B7IA 4JG1H 5C0EA 4RBPK 6FABH 5M95B 4CN6A 1RZPA 4QXUL 4IRZH 1BREA 1KXTA 1CGYA 4I4WB 4OZHB 3WFCH 1R3HA 3S88H 3RVTC 3HG5A 3KPSD 5HBBA 3RY5A 2P5PA 3P77A 1JK8B 4JFOA 3TF4A 2GSIA 1TZHA 3W2DL 1NFIA 3S3JA 3EDFA 4U3XA 1ZT4B 3HPLA 3L3OA 5DVKA 1AIFA 1MCIA 1YMHA 2WLNA 2LLLA 4XBMA 4Y1AD 5CWSA 3AAZA 2H1LM 2ITEA 3BUTA 4R26L 2XQ0A 4LSSL 4W9JC 4Z78A 2DLFL 4QTHA 1XB3A 4GINA 3R1GH 2DIAA 5GGSY 5FW6A 3L4WA 2HT4C 1A4JB 3MRHB 1FG2A 3AW5A 3C5SA 1HHKA 1XXFC 3F7VA 2BH0A 1Z9LA 4WTQA 1A8JH 4G42A 1UGKA 5ID1B 3FT3A 1A7RH 1CI3M 4KK8D 3TO4D 3H3PH 4PBDA 2O6CA 4FYRA 1UB6A 2CCLA 5CLZA 2CO6B 5JR1H 1SN5A 2BC4B 3QQXA 4NI3A 4CVXA 3RX5A 4YDKL 3X12A 5I1DA 5EULV 5C0DB 4H8HA 3VVWA 1ITBB 3MV9B 2WZ6A 3I6GB 2YD9A 2GW5A 1NSNL 4LNRA 3E9TA 3REWA 5AL0A 1DCEA 3DVNA 5FGSA 3BOVA 2X2YA 4WSKA 3Q2WA 3POCA 4L05A 1SLVA 4BUQA 2DMGA 3OLEA 4R7DB 2BCMA 2E9BA 2OV0A 3A0OA 3NA4A 3UROR 3U6RA 1YMME 3IKKA 3I74A 4IBUA 2IMMA 3OHXB 3BAEL 4JFPA 4DFHA 4ZUSA 4FQ2H 1KGCD 2F61A 2IBZY 4AGQA 4NKIL 5DD1H 3CFDA 1QR4A 4NQDB 5CZVL 4JFHE 1X5YA 5JIQA 2MTPA 5BUPA 3B2DC 2ZUXA 1FGVH 2DQGH 3EO1A 4V2BA 5JHDA 1RZJC 4YXHL 3E8UH 5CJ5A 3VD2A 3T8VA 2VDLH 2WYHA 2AV1A 3CXDL 4F2FA 5CP3A 3N42F 2BVQB 5SX4I 3SO5A 5ENWB 4C56A 4PREA 3IMBA 2VLRE 2J8UB 3RY6C 2Z3FA 4AYBA 1J8HD 1LTXA 3GJEB 1NMCC 1NGQH 1U3HB 1V54B 3QEHA 4M5ZH 3AC0A 5K9KA 1GTNA 2EDYA 3VFVA 3CQQA 3MRPA 1Y6KR 3VTMA 1FRGL 2C9PA 3VRJB 2X4QA 3AM8A 2VERA 4NZTL 1Z5YD 2P46B 3PABB 2PR4L 2QQNH 2IWEA 3PJSA 1DBMH 4GG6E 3GBNL 2FBJL 3V6FB 4NZDA 2GIYA 3NGBC 2BMKA 2GHWB 3KH3A 3T4AA 4C56E 2WBXA 3ME0A 3A4FA 3S98A 4CVUA 4U7SA 4XMKL 2FWLB 3FQRA 4AEHH 1EFXA 2X89A 2EYSB 4NRZB 5TE4H 2BNRD 3U30B 2W07A 2IDSA 4PJ8C 4JRXD 1MCWM 4GRLC 4GMSH 1N8ZA 1SYSA 4LAQL 1HQRA 2WHVA 5GGQL 1H15B 2EO9A 4LZKA 3VI3E 4KOCA 2R1XB 4HGWB 1QEWA 4WUKL 2XRAH 4P48A 3U1PA 3CC5A 2OJ1A 2FR4B 1XH3A 1NBVH 4HS6A 3EUUA 3LEYL 1EZVX 1FGNH 1ZGLP 2O72A 2GK2A 4MZ3A 2W65B 2DBJA 2FHBA 3M88A 4WFGD 3IJ8A 1OCCB 1IBDA 3SY0A 4MASA 1ZJBA 3TJEL 5ID0B 1RPUA 3ASOB 5I1HL 1QRND 4UQBA 1DN0A 3GTNA 1JXKA 3B8SA 3UJJL 3BMVA 1SHMA 3DROB 5HDBE 5IY5B 5KZCB 1HYRC 2NXZB 4IEFA 1GZHA 1NC2D 1FJ1B 1SXSA 2VLJA 5J1TC 4HK0B 4RESB 4HJTA 4MLIA 4L8SC 5CUSH 5HDWA 4ADGA 1JAEA 2F5AL 2EE0A 5E00A 1YY8A 3C2AL 2VAAB 5DD5H 3FMGL 1YPZF 2AZAA 2A3TA 2WM0A 2X9YA 4N5ED 2ALAA 5D5ME 3CBJB 4Y4KA 2WTRB 4ES9A 1YPZE 4PM1A 1QFWM 4J28A 3WMQA 3O8XC 1I9RH 4C58B 4L8DA 3FTUA 1FFOA 1XXDC 5DT1H 5C0AE 2D03H 1FH5L 5IG7A 1XF3A 3KZ8A 4ZJ9A 5GS0C 4I3SH 3DI2B 5LBSA 4AI7A 4WO4B 5HYSG 3MLSH 4X9FA 3US9A 4PJDE 2MQ3A 3M46A 4PD4J 5LG1A 4XC1H 4ZRGA 1EBPA 3QULB 3CK0H 3C60C 4W9DC 4UNTA 3AQDA 5DHEA 3KE0A 5HI4D 4ANXA 2EIKB 5FM5O 1ACXA 1J9QA 3QYMA 2NCEA 2OMVA 3F83A 1LYQA 4WCYH 4AK2A 2K0RA 5T1LD 1G4RA 2ICWA 2WZAA 2LVEA 3TEYA 4OCXH 5E8OA 1QUPA 2VZVA 3K6FA 1BG9A 3BP7A 4G9DA 3ARBC 1S7UB 1ZSDA 2RFXB 5F9AC 3SB3A 3RILA 3N43B 4X4XB 2GVYA 2Q7AA 3JXAA 1CICD 2WVUA 3MROB 4GSRA 2YN3A 3ZYZA 2YIHA 5E9DA 3IRCA 4BK5A 4YDIL 3ULUF 3IU3B 3BPLC 1M1XB 4G8GB 1QABA 4S2SB 1PYWA 3MJ8B 2R4RH 4MS8D 1NCGA 2W38A 3RPIA 2WXLA 1WF5A 1FO0B 3D8MA 1MDTA 4A6YA 3KXFE 1A6ZB 3U2SB 4PJ5A 1G4MA 4K9JA 4DSYA 3F58L 2DL2A 2NY2C 4JREB 3BDXA 3GQFA 3RIFF 2GUYA 3W5NA 2F15A 3NIDF 2E7DA 1BW8A 2OJEA 3HAEB 1RPKA 3VAEA 3NIDE 4BDVB 3IXTA 4Q0XH 3UZQB 1HSAB 2R0KH 5FUCC 4JQIL 5I0YA 1MI5A 2VYRE 2Y5QA 1SUHA 1F42A 2BS9A 3PNRB 1BQUA 5DZVA 5C0GA 3N91A 1EGJA 5BOPA 5CLWA 2EDWA 2CBOA 3T2NH 3S3BB 1TJGL 2KZWA 5DJAA 3QR0A 5JPNA 1CXHA 4UT6H 3D52A 3U48A 1KG0B 1MRFL 4RGNB 5BZWB 2DD8H 3VFRA 2H1PL 4WU5B 5DK0A 1JGLH 3DO7A 2IAMB 2P52A 5G5DB 5HGHB 2HJKA 2NW2A 5CKAA 5CS7A 4ZMQA 1F3JB 4PVLA 4D8PB 1GZQB 5HTSA 3RGHA 1DZBA 1J8RA 2FHFA 2PP9A 3O3DA 3T3MF 4F37F 4Z3GA 1FO0L 3PV6A 1N59A 3F84A 2WNGA 3T3ME 3RWGB 1T04A 5KBKA 3V5DB 4HLJA 2P5EB 4L3AA 5A40E 4WNQA 3ZT6A 3NSDA 3V0AC 3C09B 5FPIA 3NJIA 2R29H 5EH1A 3UBXG 3EJYC 3FT2B 3U0PA 1V7NH 1C1EL 1SDYA 1UD4A 5I1AB 5SWSB 4LL4A 3HE6B 3QXWA 5B1KA 5D2NA 3T6QC 1IC5L 1NWOA 4F7EA 2Z64C 1QBAA 1FFRA 5FYLH 1JPFB 2ZCKL 4ANKA 4FOMA 4MAUL 5GZOC 2NY6B 2FEJA 3O6FD 1D6VL 2HKHL 3TZVD 4MBRA 1AJ7L 4PJFE 4XPFL 3FFCE 3JTSA 4P4RA 2RAMA 3EYOA 1RAMA 3IFNL 1WWAX 4IKNA 4LOVA 5DDHB 1GYUA 1CPUA 1OAUL 1MXDA 2VUYA 1PDKB 4DKEL 4JN2A 5ERWB 1MN4A 3DO3A 4JE0A 1FZKB 5TFSH 4E68A 1N7ML 3QUZA 5LNEA 3ESPA 3FRUB 1HNYA 1EUUA 2ZKWA 3EF4A 4LDCA 1JZJA 4RWYH 5D1ZC 2EDQA 5JIKA 3QA3A 1Q4NX 4WGWB 3CZFB 3KPSB 4W9LC 1BQ5A 4TL5A 1AHKA 1W6WA 4FMKA 5E99L 4JFZH 1TETL 1GGTA 4AZ8A 2DWXA 4AIEA 4Y1AB 5C9KA 5B4MC 3AGWA 3T3PB 3MOAL 5IW6A 2XFXA 3TEWA 2E8YA 3O11A 4N87A 4ETQA 4QXTA 4Q9RL 4OIIL 1T7VA 1VACA 2W81C 1M2VA 3LD8C 2Z92B 1A4KA 5HHNA 1SDDB 1MCLA 4KK9C 4Z76A 4LHQB 2O5YL 5DHXB 3HC3L 1IJNA 4L4TA 1ZGLM 3I2CL 4ZX5A 2RJMA 4MRCA 1EX0A 4I1NB 2BSRB 5L7XH 5AW9B 4YC2B 3FFDA 5JO5B 1MW0A 1AGBA 5DFWH 3DPBA 3C08H 1NMAH 5C7ZA 1DDHB 4XOCA 2K4AA 5GGVY 2VKWA 1PLAA 1EAQA 2XWTB 1U8NA 3ARQA 1MF2L 5HVGB 1CE6B 1AZUA 1N64H 1KJMB 2VO5A 3S48A 4YJZL 2BERA 3SBPA 1GHFH 5AZEL 1HH9B 4C59B 3UYRL 3ULVE 5D7SL 2ZWNA 5E2TH 3T1WA 2X4OB 3QZNA 4KH2A 4JPKH 2YEZB 2YMXL 3C8KA 1GIGH 1PNCA 5INDA 3CN3A 4GAGH 2YR3A 5DU7A 2UZIH 5HY9B 5KJRH 4BUGA 1AGDB 3DX3A 3FQXB 1YC7A 4U3SB 3ML8A 5KVEL 4BGDA 2CMRL 4DO6A 1IFRA 4YBQC 5K1VA 2MIZA 4UM8B 3V5HA 4GW5B 2JJWA 1Q72H 1QFHA 4M61A 4C4UA 1UWFA 2LLNA 4PCYA 4IKKA 3B5HA 4S1RH 3SE3A 2UWEA 5KSBE 2X4NB 3Q8AA 3B9EA 2XOTA 1I7ZA 2DLGA 3EJRA 4NHUA 1J8HB 2CCWA 5JLZA 5FV2A 1BBJA 1TTUA 4Q7DA 3KDPB 1MJJA 4QRPA 8CGTA 3KWVA 1G0XA 1I8IB 3K6SB 5GIRB 3D3VD 3AS2A 3GIZL 5CGTA 2CGZA 3H2PA 4HIQA 5GGVH 3RJOA 1UA7A 1S7WA 1T2XA 2UVFA 4U1MA 2J5WA 2F1AA 2UWEF 5MEND 5KYXB 5EIIB 1BD2E 2P49B 3B4NA 2QGBA 4ZFOB 3GBDA 3GXMA 4MQTB 4ONGL 3ORJA 4X6BB 4HAGA 1AZZC 2X4UB 3DK0A 4M6AA 3VE0B 1KBPA 4MGXA 3NH7L 4OLYL 5MEQB 1D6EA 4JNXA 2BNRB 2ZX7A 3GS0A 4N2IA 1Q8MA 4I2XE 4JRXB 5I73B 4PJ9A 4X4MA 5B8CA 4PS3A 2WQVA 4N1CA 4JM2D 1KXQE 3KPOB 2ZCLL 4PJ7A 3G7TA 4N0UA 5D1QD 4X5PA 4F7MB 3UOAB 3CJJA 3QFGA 4CILA 2WB7A 1E8XA 4YXLH 3V0WH 1CLVA 2KS0A 5EFIA 4BFIB 4DNLA 1J5CA 1I31A 4ZXBD 5IBLD 4F91B 1NBZB 1X9QA 4WWKC 1TCRB 2XICA 3GNML 1MCCA 3W82A 3IAGC 1GY1A 1X5GA 3RL1A 4M3JA 1CT8B 1QRNB 3V52L 5F9WC 4ZUTB 1GGYA 3BPNC 2BK8A 4XE0A 4ZFOL 2EACA 4M7JH 2QHLA 4NKOB 4XCNA 3K1DA 4E9VA 5MI0C 3P4NB 1AS6A 1NC2B 1IBGH 1WAPA 5IHBA 1XEDA 1IM9A 2PTTB 1CDIA 4ZS6C 3MRDB 5DA0B 4JFFA 3HBPA 2VZTA 4JHAL 3DURB 4JRFA 2H2SC 2R2HA 2IH3B 2ZPKL 3L4CA 4M6MH 4J4PD 4HG4J 2IV9A 1H6TA 4J1UA 2GJ6A 5I9QB 2JB5L 3CZUB 5JPMA 4LDLB 3MNVB 5C0BA 2UY6B 1SMOA 4BH7A 2QGDA 1L0YA 4JDTH 3GUFA 1HHJA 1RERA 3ZW3A 1SDAB 2NY4D 1LO5B 4MKMA 4PV9B 1M42A 3NK4A 2ZUVA 1X7QB 3KHQA 5HDQH 4HC1L 2WK2A 1O6VA 2WLZA 1O6SB 5IROD 3CH8A 1JSYA 3DVIA 4UIKL 3NOIA 1WSST 5KS9E 1MHPL 5C09A 3BDYL 3KCWA 3ZU8A 2WMPA 2A73A 4TSAL 4WEBH 3STBA 1GTFA 1EXGA 4DP5X 4MB3A 1TJIL 2FATL 5J6HB 3UO8B 3WS3B 2YPKB 3ZIMA 1I9JH 4LL1A 4G43A 2HP4A 5AWNH 4QGTA 1VLXA 4R6UA 1LM8V 1TIUA 5T1LB 1WBZA 4B9ZA 2UUDH 4MCZB 4GO6B 1MCNA 4KZDH 3IPFA 5I0VA 3WY2A 4Z3TA 3CE1A 2IPUG 8FABA 1NL0H 4I9WE 3WN5B 5I2IB 1HSBA 1LILA 2X7LA 3N3EA 5DD3H 4P3DB 3JZYA 5GRZA 4BWWA 4HS3B 1CICB 1KEGH 3QQDA 4KNTA 1WPCA 1OSPH 3HRZB 3LS5H 4CMMB 1JXFA 5I1LB 5KYYA 4HWBL 5MHSD 3MJ9L 1AMYA 3OAUH 4MD5A 4YSOA 2QVKA 2QVMA 3ARFD 4PGBA 5FF6A 5LAXB 1HJBC 1NCCL 1FV1B 2KZKA 4FXTA 4YIQA 1GCYA 1AKPA 1R19A 1HL9A 3BRDA 4K4KA 4QMEA 3VD9A 2D0FA 1SF3A 3O4OB 5I0DA 5IK3B 1L3NA 2RCSL 5L4JA 5GJTL 4BM7A 4IU2B 3S4SA 1CBVH 1BXUA 3KJ6H 3QXDA 4E9LA 1IEHA 5TPWH 3HUJA 3DOHA 1M1SA 5FK9A 1EMTL 3NAAH 5ACMA 3ZDXE 1SEBA 4Y1SA 4A2DA 4ZMZA 1S2EA 3G5YA 3Q06A 1XGYL 3OHXC 4ZPVB 1A3QA 3P4MB 1P4BH 4HQQL 3PWNB 1A3RH 5AAMA 4O02H 2NYYD 2XG5A 5DK2B 1VZIA 5KVDH 4PU2A 5DCCA 4KKRA 4I3GA 1WVZA 3KR3H 3OKEA 4GKSB 4LCUA 4HXBH 3II1A 4IK6A 4PEEA 1CLCA 1VCAA 4WZ9A 1D5MB 1JTPA 1K5NA 1KTBA 3SPGA 4PJBB 2PYEA 2XWJA 3K8MA 2WUCL 3F7PC 1U3HC 5EOTA 1AOHA 2BCKB 5KN5A 2R2EA 2JQAA 2E46A 2WJ7A 5F7WC 4PLKD 5L4IA 1F58L 4EDWL 3L9RB 4KNQA 5DO2C 1JUFB 1XIWB 5E23A 4Q9QH 4IIQB 4D9LH 4X6CF 2Q6WB 1QACA 2F5BL 1UFGA 2GBAA 4OF0A 4X6CE 3LIUA 4M5YH 4UDTA 5I28A 4JPWL 4F7PA 1GAFH 4CC4A 2FYYA 4GRWB 2AW2A 5FYKU 3IPEA 3AZUA 4JB9L 2MH4A 3U30C 4IMKA 3O6FB 3BRFA 2G75A 3TZVB 3KDMB 4NJAH 2A0LD 2IPKB 5A6MA 4U1LB 3LKNA 4URKA 4DKFL 1PIGA 2KQMA 4CBPA 1LWHA 3Q3GA 3HHRB 5JDSA 3RA7L 1E5UI 1TQTA 3G04A 3SE4A 1QPKA 4XVTH 1PGRB 2A9ML 2OS7A 3V4UH 1I1AD 4N24A 2R69L 2UY7B 1IAMA 3QRFM 4YSQA 3KPLA 1OE2A 1Z9OA 3MO1A 1LE5A 1HILB 4ZAKA 3IE4A 4R4BA 4XNZB 3NFNB 4TN9A 1MLCA 3NCCB 5MP6H 1V3JA 2IV8A 1YNTA 3L1FA 3T0EA 4H26A 2A74A 3QUYA 3QH3B 4HHGA 3BSZL 4JO4H 2K45A 4DUWA 1OSYA 1KB9J 4OLVH 5KVMC 4JQXA 1A3ZA 3CLWA 4TUOA 3MZGB 2HLAA 2NXZC 1NCWH 1CTNA 5GGRA 4XAWL 3ZZLA 1Q9LA 4K3DH 5AKVA 1HXMA 2N0MA 4ZSOA 1A65A 4HVBA 1DP0A 4HKJB 1R3LB 2CGRL 3U4EA 4ZW5A 4YEFA 1PG7X 4M7KH 1YNTF 1HZHL 2VMEA 4ODXB 5KG9A 4POUB 2BVUA 1XR9A 1MELA 1KB5B 2CAKA 4FQXB 2VLLA 1WT5A 4MNHB 1LDPH 3UTPE 1AI1L 4NQCE 1P6FA 1UACH 4U1HB 4QY8B 1TVHB 4N9GA 4TPRL 2DB8A 5DUPH 3B37A 3WIIH 5C0JB 1R47A 3P73B 4AEIL 2J25A 4WFED 4BD4A 3J07A 3A6BH 4OB5L 1CVSC 4WO4C 5J57B 4ZMPA 3PWLA 2ADGB 2HTLC 1KBGH 4GAYB 3PHQB 5I8CB 1KPUB 5DJCB 4PWGA 2W60A 3QHZH 5F2FA 1NAMH 4TQPA 4H44C 1KYAA 4ZOAA 1HKLH 2EADA 2FX8L 2DBLH 2GI7A 1WC7B 1OM3L 2BP8A 1JV2B 1RK1A 4B41A 4B97A 5FDWB 1JZ6A 2XVGA 2AQ2A 1PD6A 5E6IA 2A1WL 2PPAA 3CFEB 3OD3A 3DETD 2IAND 2EZ0D 2VXQH 4LBEB 2B08A 4QF1A 4S0TD 4QRSB 4YDJB 3V6ZB 1WFTA 2ORBH 5C9JB 5IQLA 4BFKA 2BIOA 3QPQC 4EUPG 3TM6A 4BZ2H 3QHFH 3P3TA 1JZ3A 3RJDA 2BVOA 4HMCA 5IB4B 3ZDZB 2R4SH 2CR0A 4JREC 4L4VA 4FFVC 3CSYA 3OKDA 1G7LA 3D3VB 3EXLA 3TBWA 5K39B 3MOBL 4OCLC 2F8VA 4P23D 4NRYB 1SMAA 3KPQB 4M48L 5MENB 2R1YA 4LVEA 4F33A 2FEEL 4YXKL 5AB2A 1QI3A 4B3EA 1YJDH 3N1QC 1A6UH 3BKYL 3CZGA 3EFFB 5EN2A 4C47A 2P24B 3MX0B 4RA0C 5FYLD 4TVPE 2NZ9C 4GSUA 4RGNC 2E6QA 3RX7A 3LZNA 4O2FB 4L5FH 1MNNA 3POHA 2MCG1 4WU7B 1BJ1J 2IAMC 4JM2B 4PJXB 1R3IL 1ZLSL 3I3DA 5D7LB 1RHHA 1YECH 5D1QB 2ZAGA 5SV4A 4Z7OF 2JIXD 4P2QA 4P04A 4X6EB 2O5ZH 3O0LA 1MFVA 2VB5A 2FL5A 3G5VA 5I0XA 1KFGA 1TEFA 1XGRB 4ZXBB 3BZ4A 1XGPB 5I8KL 4MA8L 3DECA 4XP1H 5CJ8A 4OU3A 3C09C 5GZNA 1I1YA 4Q4EA 1NCTA 1WIOA 1NIBA 3OVUB 4W4OA 5B1CA 2HMID 2SODB 3K2UL 5AD0B 1RSYA 3MUZ1 4MMZA 7FABH 5LXVA 4PWJA 5EO0A 3HE6C 1CGUA 3EYQD 2IOIA 3OKOA 2APXA 3Q8CA 4PRPD 1F4XL 3DXAD 1J8SA 2QSQA 5KBNC 1JHKH 4Z0XB 1WZKA 4GKLA 1EANA 1SJEB 3VSVA 4AKQA 3G5XB 3ZKMC 1GJIA 3OKLA 2NY6C 2CIKA 5EC2B 4EZKA 2EDTA 1AQDA 3SKJL 3EGDA 2NMSA 5I66B 2AJSL 1OHQA 4NSKB 1WZLA 1UXSB 4JPSA 2R0ZL 2HRPL 1X5MA 4UTAL 1DEEB 4UOZA 3HN8A 2DQMA 4YHKL 5J6GA 2AI0H 3Q6FA 3KCPA 1WZ1H 3U1QA 2KLSA 3GSVA 1D2OA 1E4WL 3QQ3A 4JG1L 4P5KA 2NY4B 3L5JA 4L2LA 1P84J 5I23A 1JF6A 5LB1A 3TWYA 5JOPD 2IGTA 3WJJA 1LNUA 1FL3A 2JCCA 5ISZA 3MJWA 4IRZL 1URZA 3WFCL 3S88L 3M8OH 2NY0D 4QUOA 4TLKA 1LO4H 2AQSA 4ZMLA 4ZQKA 2J1ZA 3DIFB 3MR9B 3U83A 2X1XR 2L7EA 3MV7D 2R0LH 2WOYA 4QO1B 3ZLQC 4FQHB 1E2WA 4AVJA 1RU9L 3SE9H 5BV7H 2J6WA 3MKKA 2JCCF 3QPXH 1P69B 1A14H 3BAIA 4OKVB 3MV9E 3R1GL 1NFDF 3OF6A 1NCAH 5MEPB 1MFUA 1T1WB 1NFDE 5AW1B 1FL5A 1IAOA 2OXHA 3BPOB 3WHXB 3AUVA 4YC2C 4KK8C 3K2KA 4XN8A 4AUJA 2KZ1B 5SWZE 4KI5D 4E2OA 1WS7A 3BYYA 1GRWA 4CJ1A 4NT6B 3QNYB 5CD3B 3H3PL 4MJJA 2CA3A 2Y7SA 2JTDA 3D25A 3ARFB 5D9SA 3V4PA 5CEZE 3K74B 2BRRH 5GGSB 2VDLB 3NQIA 4QXVA 5JR1L 1XBRA 1J12A 4Z9KB 3PDDA 2JJVA 3GSXB 4HCRH 4HKZA 3L9EA 2WVSA 5C07E 3BFOA 4AWJC 4ODWA 4U1GB 2Z7UA 4JPQA 4NQEA 2MNWA 1M05B 1AHWA 1QLRB 1V7ML 2OMBA 2HX9A 2CPUA 5E9NA 5I16A 1JWMB 5KSAA 3TT1H 2J8UE 4LF3A 2HZHA 2X4RA 3ESNA 1MZYA 4JKWA 1U8JA 2FGWH 2K6WA 2NUPA 1WBXB 1W91A 1NGWA 4ATTA 3JUYA 3SJVA 4ZW3A 4JG9A 2F54E 4L3FA 3C5ZA 4PJHA 1CQKA 1FGVL 2DQGL 5E8DH 2H26B 2OZNA 43CAA 5I1JL 3HHSA 5CHNA 2JE8A 2VDLL 4KKCD 4A04A 5AG9A 2DWDB 2PCFA 1J5OH 5FKAA 2W9EH 3DGDA 4ICWA 2E7LC 4JJ5B 1NGQL 4DZBB 4M5ZL 4F2MB 1VPOL 1KFAH 4APXA 4JKNA 3BJ91 2L7QA 1NZRA 5AUMB 5ICYB 4IU3A 3UYPA 1DQJA 4PJHF 1PFOA 4K55A 5I76A 1ID5I 2ILLA 3BUYB 4OI8A 3RUGA 2QQNL 5D1XD 5K59E 4PJHE 4J3WA 2MEJB 1DBML 3LPPA 5DJ2B 2JJSC 2ZSWA 4LU5L 1WUNT 3QI9D 4U1NB 1X4YA 2I7SA 4JRYA 2HFEB 2OZ4H 5JW4N 3QNXA 2DJUA 4AH2B 4QGYA 4XNQB 4XN5A 3JWOH 1SVCP 5I73C 5IMLB 1TDQA 4AEHL 2EEFA 5TE4L 2DOCA 2YUXA 5IM7A 5J9PA 4GMSL 4I7ZC 4IGBA 4QRRA 3RUGF 3IB4A 2JXMA 5IHLB 1I1AB 2UXFA 3KPRD 1T1YB 1SY6A 3OB0K 4UNIA 4ELDA 2XRAL 4DOHE 4NO3A 3E6HA 1KCRH 1BZ7A 1HS6A 5GS2D 4YZWA 3SCMA 2PWGA 4FLSA 4CN4A 4ZTOL 1RJLA 2BNQD 2H47C 5HPMB 2YAMA 4DKAA 1VEOA 3D85A 3L95B 4LSUH 4KX8A 2GEQA 2P5WE 3VFTB 3OZ9L 3FTGB 4MB5A 2E74C 1K72A 3WUWB 5CEYB 2XJLA 5EO1A 1ZIAA 1BGXH 2G3XA 3EZJB 1JHTB 4D9RD 4N4YB 4OD2A 3U0WH 2VSMB 3SD5A 5DO8A 3SDDA 3BXNA 3VQMA 2IO5A 1F13A 2CNZA 1M7UA 3CFQA 4JCWA 1XL4A 5CUSL 4KJYA 2BSSA 3MRFA 4NYLA 2X4TB 5HXMA 4O58H 3IXAB 5ANMA 4N5EC 1W80A 2ZXWB 5DD5L 4EQ2A 2EP6A 5DI8A 4FQLH 1CMOA 3IDIA 4HEMA 1PL3A 2HFGH 3X1NA 1I9RL 2AEIT 3V9EA 5DC2A 3RDJA 1AR1D 5DT1L 4IHBA 2D03L 5C7XL 2FECL 4F3FA 4I3SL 5E5MA 1T21A 3B8YA 4MA3B 3NP3A 1E9OB 1HNFA 3MLSL 4UYQA 4Q56A 5AZ2H 1D5BA 4GKZB 3IJYB 2DPKA 3KLAB 1XMEB 3EH3B 5HI4C 4XC1L 3OC5A 4DKDC 3SIKA 2YPVA 1AKJD 1DBBH 3FONA 2CK0H 4RCAA 1MVYA 2F74A 3CK0L 3MOQA 4G8GE 1CL7I 1TQSA 1QPXA 4WIQA 1D5IH 5JXAH 3QJQB 4WCYL 1SOQA 1JWSA 4FE9A 4HH9A 4R96A 3V0EA 4PRIA 1IAKB 5DJXB 3HLAB 1YYLH 4NUMA 1ITCA 2A9DA 3QVAA 2IANB 4OCXL 3WN5C 3G6AB 4FLHA 3ILEA 2X42A 4DGIH 4L37A 1KNOA 5FCUH 4LESA 3HRZC 1KB9K 5LGHH 2AAAA 1NCNA 5DZJA 4NN7B 2KBGA 4JFEA 3VRIB 4MS6A 3QIBA 4MS8C 5CKGA 4Y7MA 1ED3B 4DGVH 1QO3B 4JKLA 4ETYA 1I8KA 1EA9C 5FYKH 5GS3A 2R4RL 2YC1A 3OBAA 4UQ3B 1ETZA 1MVUB 3WS6C 3O4OC 2QTVA 3DHPA 3KYAA 1RJYA 5GRVK 5IB2A 1AQ8A 2W88A 5EV7A 4KDTA 4AYSA 4P23B 5B38G 3PXLA 3LQZA 3KLSA 4FFYH 4LDOB 1TVBA 1DBKL 4XO3A 4MD0B 4EZLA 3RGVD 5C3IA 4Z7WB 1MFDH 4M29A 1JZ4A 4PB9L 1BEYH 3KLQA 4KJPD 5CZKA 4PG9B 1RJZA 4ZG1A 1C08B 4Q0XL 5HJ3B 2EEAA 3VXMA 3V0IA 2P5EE 4FJYA 5EWIH 1PKQB 3HE7D 4EI5D 2B20A 3OKYA 5MERA 4EUPH 3T2NL 4ORGB 1WHOA 4EAEA 4JZNB 3WE6B 4P8QA 2CDEA 4I48B 1UWGH 4UT6L 3R4DA 2DD8L 5SWSE 2NNFA 4JBSA 1JGLL 5A2JH 4OM1H 1NCUA 2JIXB 4M03A 4IBTA 3RB5A 1HHGB 3AU1B 3FU3A 4IRJD 1FDLH 5TDPA 4ATWA 3W5MA 3QJXA 1FFTB 2P8PA 4HGMA 3FQUA 4P9HH 5EO9A 1XGTA 1I7TB 4GQRA 3MLWH 1ZHNA 2R15A 1X5ZA 1ZHBB 4QHKJ 5KYWA 4LLQA 5I19H 2X0VA 2NX5A 1XIWC 5HP5A 4P57B 4EMZA 4IIQC 1F3DH 3PDGA 1B0GB 3PDOA 5HHOA 3TJHD 4KKAD 1PMYA 4X4YB 4KDWA 4PRPB 1V7NL 3DXAB 5A1AA 3V7AE 4X5QA 2F7QA 2QDVA 1GOFA 1E4KA 3ZQ9A 3MBWA 4HKXB 4ADJA 5C0IA 1VF5C 4L29B 4F9LC 1TLMA 3FDWA 5FCSH 5FYLL 3UC2A 3HG1D 1G7HA 3TZVC 1MWAH 3A67H 3NZSA 1QA9B 1U2HA 2H6PB 1S3KL 2QKIA 4NC0B 3X11A 4AEFA 5DUMH 3RFZB 3FF7A 1EDQA 1NKOA 4FQIH 2AK4A 3VRLF 1FF5A 3BH9A 5I1EH 1EXHA 1MW3A 1DVFA 1BIHA 4YSUA 1BLIA 2E7MA 1II4E 1RL1A 4FERA 4XNZC 5C0CA 3UTTA 5TFSL 1PZ3A 3WAJA 3VGGA 1JRHH 1NANI 2ZSVB 4DF9A 3ILDA 4JZJB 3E38A 2NY0B 4ELMF 1TTRA 4QHKI 4XC3H 3L2NA 32C2A 3IDNB 4ELME 3RVUD 5FYJU 3TPUA 1QNIA 1LGVA 3MV7B 1BZ9A 2AF2A 2ZUSA 4X4KA 4QRAA 3AMLA 1T22A 4L8BB 4CRPA 1KCVH 2PCXA 3HNVL 4LKXB 3IS0X 5C0CE 3S96B 4DN3H 4XCYA 1EQWA 5IF0B 3DMMB 2VERN 2F53D 4FQXC 4PY7A 2Z7ZA 4KQ4H 1JPTH 5BUAA 2KERA 1T80A 5F6IB 4HV8A 1ND0A 3C6LD 2QV2A 3QZWA 3TONA 1E40A 1WD8A 3F62A 3IETB 4TQEH 5B1JC 5A16B 5L7XL 5LWYH 4OD1H 3MV8E 1CFSA 3B1UA 2WCGA 4K7PY 4W9ZA 1BLNB 3MCKA 1QOKA 4G3YH 3ASNB 5E8PA 3BUBA 1LEKB 1NMAL 3SGDH 2YARA 2OMTA 5F3HA 4JY6B 4DWHA 1OKEA 4N8CH 5I1IH 2VIRB 4YAQA 1IQDB 3VGAB 5E8EA 1JWUB 4BELD 4KITB 1A9VA 1NGPH 3ZE2E 3MRKB 3GLAA 1N64L 1UYWL 3DBXA 1GHFL 3LYRA 3QDJD 4NXSA 2E86A 1KIQA 5M7QA 5E2TL 3RWIB 3VACA 4KXBA 2X4PA 2X2JA 4JPKL 4ELKB 5IJVA 1GIGL 4XBEH 2YQBA 3O2DA 4JDEB 5DRXA 2ODIA 5DF0A 2Y5TB 4GAGL 3GJFK 2UZIL 2PUQT 5BO1H 5KJRL 1AH1A 2X6MA 3QISA 3MRIA 3QJTB 5E4IA 2EIEA 4ZS7H 2UZYB 5GQBA 2ZUYA 4ZMXA 5F44A 1R3JB 5EZLA 3OAZK 4HSQA 3WMPA 3CHXA 3DO4A 4PP1D 3VSTA 2WO4A 3MLZL 4GH7B 1XF5A 1Q72L 2N0KA 2RMNA 3UEQA 3QJHB 1JPSH 4AKOA 4ENED 4S1RL 2BINA 1IT9L 2J4WH 1UG9A 3EOAB 5CJQL 1X4ZA 4X2UA 2N7AA 2AEPH 4I18A 5SWQB 1T3FA 5D4HA 1N8OE 2QHRH 1H9VA 3WL9A 2EYRA 4E0RB 1P1ZA 5DJDB 3TESA 3QEUB 3MV01 4WW2B 3BP6A 1IEBB 4K7PH 5D7IA 5EUOE 4OSUH 4O9HH 4C8XA 4XOAA 2EXTA 2QSCH 1A1MB 3DWTA 3HFFA 3MRMA 3PQYD 4K9EH 1OSZB 5ADPL 5D1XB 5GGVL 3CHRA 4CU7A 2VR3A 2QL1A 1C12B 3QI9B 4PGDB 1GKEA 2A77L 3ZYIA 4GUOA 2C3VA 2XWXA 3DIVA 4KV5F 5EC1B 1TNMA 1ZE3H 3WOVA 3V5KA 3W81A 4JLRA 1O5PA 1U8PA 2W92A 4PGEB 1DE4B 4MMXB 5AVSB 1A4AA 1ILUA 4YHPA 1TENA 2A4EA 1ONQA 5D7IF 4U1IB 3TC9A 5KOMC 5D1QC 4JFDA 4AIZA 4BWTA 1XFPA 4NP4H 4QRUB 5F7NC 3KPRB 3QQ4A 4G6KH 4LFHG 4ZXBC 2PYFA 5IBLC 3VXOA 3V0WL 4KTGA 2BP0A 1PNDA 4XGZB 3RPBA 1XCWA 3O45A 4PJEF 1VADA 4QOKA 4FTVD 3SKOB 3WIHL 4Y19A 4POZC 3KS0H 2R59A 4PJEE 3D69A 2BNQB 1WS8A 4FGMA 1CLOH 1FNEB 5DC0A 3BO8A 5KAQF 2IWGA 1CQYA 2GAZA 3DIDA 4Y2OB 1A3LL 2WAHA 3GS4A 3EO9L 1QTSA 4QDGA 3D6GA 3WY3A 3TF7C 4AEEA 2XYCA 3EYFB 3WTWA 2EILB 1RP9A 2ESVA 3BQUD 3OB8A 3I02A 2J12B 3PL6D 3RTQD 4DHLA 2B4CH 5BXFB 1IBGL 2XWCA 5DMIH 3E80A 4UF7C 4J4PC 2ZKXA 3V4VA 4LCCB 4KAQL 1CS6A 1QTYT 1E6OL 2Z9TA 4U4IA 4HIEB 3RNQB 4M6ML 4L23A 5EN3A 3O3BA 2YSSB 1ORQB 3EYVA 5HYSB 2DMCA 4HYTB 2NY4C 4W6XB 3QRBA 4WEUD 4M62H 4NN5B 4LSPH 3L9BA 4JDTL 4QHNB 4DP0X 4XX1G 4AMKH 3KW7A 1AR1B 4WHCA 5ESAA 2BOCA 5IROC 3ZUNC 1CTOA 3ROLB 5HGDA 2BSED 4X0KA 1QWNA 5A2CA 2VR5A 3DUSB 5I5RA 4W9KC 4XHJC 5JA8B 4UWQB 4WFHE 4JDVA 5KVFL 3PWUB 1AKJB 3U6XS 2G5BA 4WEBL 1XGUB 3HA0A 1DSFH 5C86A 1HCYA 4WW1B 4EZJA 3EYUL 2G30A 2CIIB 5IHWA 5AWNL 3L3IB 5FA4B 4Z3IA 3WJLA 1WBYA 3KVDD 5FHBH 3FSZA 5IW3A 3IKCB 3KYNA 2QEJA 2DQDH 5BQDA 4KZDL 3FCSA 4B96A 3BPOC 5E1GA 4O02B 2CLVB 2NZIA 3EO0A 4GXUM 3WFEH 5DD3L 2CDGB 4QHLB 3H2WA 2DDQH 1CBJA 2FJGA 4XNAA 4TNVK 1KEGL 1ZS2A 3ARFC 3M6DA 4I77H 3BRGC 4CSSA 3VXTA 2X28A 3UGXA 2ZP0T 5IQ9B 1VDGA 4AQEB 3WLBA 2ZJSH 3VGDA 4AYMC 2ITDA 3F01A 3IDGA 3ETTA 3EZ8A 3GMQA 4ZNEA 2BVPA 1BSIA 4U1GC 5IHHA 2WUBH 3ATEA 3P3RA 4XCFH 4XMVA 5B39A 4HOWA 1BPVA 4R8WH 3HCVA 2HT3D 1DTUA 1EZUA 3RGVB 1CBVL 1TU2A 4OGAD 3OX8A 1ET7A 2EDKA 3NAAL 3LXAA 4YK4B 2I60H 2BZDA 2NYYC 3T8XA 3VD5A 1WEJL 3R06A 2FO4A 3DTXA 4LK4A 1GMIA 1IB5A 4XNMB 1P4BL 3HE7B 1QSEA 1TFHA 1IGYB 4O02L 3ZMNA 3FQ2A 5JIDA 5KVDL 4OF7A 1U4EA 4UYPA 4PTUA 1SF5A 2QQQA 3KR3L 5I1GH 4O00A 4HXBL 1B4LA 3LNFA 2BVEA 4IRJB 4XPAH 1OGAE 3NACL 3UBXB 4PTTA 4C4KO 3P4OB 3DRTB 3X3GH 2X4SB 4OQ1A 4PLKC 3H3BC 4HJ0D 1YEJH 1JN6B 4BA0A 4J3OF 3X14A 3BI9X 5I75B 3BC9A 4NKDA 2DH2A 1CFBA 2CHXA 4OF5A 4LASL 1UOLA 3UPRA 1LQSR 3WNKA 4MNQA 2FWSA 4Q9QL 2XQYK 5DHMC 3BP5A 2AK1H 3B7YA 4D9LL 2C4FT 3VXQB 5ECGA 2FSEA 3BVNA 4JPIB 2EKSB 5EBGA 2IBBA 5F1KC 3HG1B 2V7HA 4RGOH 3ZDYE 4PLNC 2A0LC 4GXFA 4AC2A 1G9HA 1TKWB 5DQDH 3U4KA 1XSJA 2EE2A 2C1OA 1OAYL 3LZFH 3H7BB 4NJAL 5IQ7L 1KCSH 2ADYA 4KGJA 2J2ZA 5IB3A 1XF4A 1ZLUH 2BXZA 1WGOA 4HUVB 4G7YH 3IJHB 1I1AC 1YN6B 3PWPD 4XVTL 1XBDA 1Q1JH 3TTSA 5DHYB 1FA4A 2JKNA 3G9AB 3GSUB 1KN2H 3FHEA 4MD4B 1CK0H 2K6ZA 1O9WA 3LKPB 4YZFE 2PABA 2NPLX 3LZPA 3FULA 5IT2H 4IOSD 1RULH 4JFUA 4RETB 4L3ED 3GRWH 3E7JA 5BRPA 4JO4L 1NAMB 1MJUH 5K9QI 4OLVL 2WCPA 3L5WA 1P6AB 4P2RA 3F12A 3JZ7A 3KL3A 1LK2A 3VJ6A 1NCWL 3HC4H 4JFYB 5JIMA 3RY6A 4I5BA 4NBZB 2F53B 3H4HA 1MFBH 3LX9A 2ZICA 4M7KL 2AZUA 3H0TB 5IB5B 2VGLM 1G9MH 3OJDB 4P9MH 3C6LB 4AT6A 2I07A 2X6BA 1MFMA 3L7EB 1CN4A 5ICXA 1CF8H 1LDPL 1OGTB 5HI5D 1QG3A 2P8LA 3TASA 1ZHLB 3EGXA 1P7QD 1UACL 4N2MA 3UIYA 4N90D 4QXGH 3TBCA 5DUPL 3WIIL 3FCTA 3RWDB 5EU4B 5K69A 2ZP8A 4HFWA 4ZMAT 3A6BL 2MCPH 3FKUS 4MCNA 4Y5VA 3VFSA 3WFZA 3KWWB 4MB1A 3ARZA 3ZN6A 1KBGL 5FYKD 4RBPH 4J7RA 1IVTA 3RYMA 3S6CA 4PJ8A 3QDJB 1EWHA 2ED6A 4GRLA 3QHZL 1NAML 4KO7A 1HKLL 2DBLL 1SJXA 3HS0B 5ACLA 3F2LA 2ZUUA 4XO4A 2FWOA 1FFQA 4HBCH 5CXPA 3LQMA 3AXLA 2RR3A 5CJXC 3DETC 1G7IB 4PWIA 5K1JA 2EZ0C 2BW5A 4KVNH 2EDLA 2IGLA 4PJ6A 3D3VE 4CC1A 1D5ZB 2AITA 4BE6A 2VXQL 1B9ZA 3DX0A 4X9YA 4NN7C 4FNLH 4Y4HD 4HUUB 1FC2D 4NENA 3Q1EA 3K5SA 2I9TB 2ZWLT 3SDAD 2UX6A 2ORBL 2G0LA 3CDGA 4ZO9A 4BZ2L 3QHFL 2FIRT 3BGFC 4AGOA 4JZOB 4L8SA 2OR8A 3NEXA 1U8MA 2AJZB 4P23C 4UQAA 3IM1A 3PQYB 2Q76A 4EVNA 5KBLA 5JOFB 3QORD 1A6TB 3K6NA 4PJGA 4ZFZA 3MXWH 1S9WB 2V2TB 1S6NA 1MZZA 2BIHA 4YHOH 4F15B 2QMKA 3O8XA 1M7DA 3OMZA 4QD2E 5JNYB 1ZRUA 4QYAA 1LO2H 1YJDL 1A6UL 5H4ZA 4MQ7A 4LPWA 4Z6AT 1H3WM 4HAFA 5LGJB 3KYKH 3GMLB 1U8IA 4U1JB 3W37A 2O93L 1A66A 1U8LB 4Q2ZB 4WHYG 1N0LA 5LXGH 2YZ8A 2GITB 2YHGA 1ZJAA 4PJGF 2CNYA 1R5IA 3C60A 3DOSA 3UJIH 1YECL 2B59A 1MFNA 3CVCA 4AG4L 5IFHH 2V9QA 5D7KD 4M93B 3O81A 3MRBA 3IAQA 4FTVB 1WO2A 4PLOB 3T4YA 2HMIC 3QG6B 1PW3A 1GS8A 3VU2A 4XP1L 4TNVF 2OTPA 4JKPL 4LCVA 1PU0A 4UQEA 1E2VA 3ARBA 3EYQC 5D6CB 2Q3XA 2GK0A 4WI0A 3A22A 3PIQB 2CBPA 4LGSB 4APQD 7FABL 1KGJA 4RAVA 3FN9A 1NKGA 3Q2LA 3HI1A 1JNHA 3MLVH 5FGCB 1JHKL 1URIA 5K33A 1VGKA 2E4TA 3BQUB 4G8EA 2ZZUT 3PRZA 2HX7A 3L4XA 4GLRI 3PL6B 3RTQB 4AVKA 2BOBA 2AJ3A 2VCOA 1EAPA 2B9BA 5BV7B 5DJYB 5L9DL 4BSVA 3RFZC 3GZOA 1N5YH 2Q7NA 4PLJD 1VHPA 4MWFB 5IVXA 4H0HB 1O7DE 4N8UA 2XDHA 4OM0H 1KXVC 3CHPA 3GZKA 3VFWA 5CAYB 2AI0L 4YSCA 5C8JB 2NOYA 3FO1B 4YL9A 3TJPA 4PGCB 1TTBA 1TPXB 4F9PA 3DRQB 3IMWA 3NBNA 4N3UA 2O61B 4JZJC 3BGMA 3FB5A 1QFUH 4UI2A 4DW2H 2NY0C 5FO9A 1E5AA 1WCBA 2VABA 5FECA 3ULVH 3FK3A 4U1SB 3TA4D 4HKBB 1RZJH 5C08E 5TGBB 3GTVA 5IVXF 4Q58C 2F9BT 2X88A 1NPNA 5MHSE 4LVOB 2F8IA 2VL5B 4UZSA 2WINB 1L6ZA 1SEQH 2F58H 2R0LL 1HEHC 5I5JA 5EPMA 2EDJA 3KBHE 4IRSD 1JPEA 3GO1H 4NCC1 1VJSA 3DMMC 3SE9L 1Z66A 4YX2L 2J6EH 3DSNB 4JMNA 4BKLB 3QPXL 4GW4A 5D2LB 1A14L 3NIFB 4Y16D 5F6IC 1NCAL 3F8UB 4KI5C 1HAUA 1FNAA 5DZ9A 1MIMH 2Y7NA 4KZEH 2YAHA 4E5XA 1G87A 4BK4A 4ONOA 3US0A 2J5LB 3GMOA 1LEGB 4GQ9H 1IC0A 3W9EA 4LLWA 1UC6A 3VGAC 2ATPA 2X9XA 5HHQB 4KX9A 3ECUA 4HCRL 3D08A 1SN2A 5GZOA 4TUJB 2HJFA 5HVWA 1D3CA 2CGYA 2IALA 1IFGA 3UERA 4Z18A 1LD9B 3GGWB 4PRHA 3U79A 4Z7NF 3X13B 2JKLA 4P05A 4I88A 5I6KA 4FQQB 4DEWA 3TT1L 1LQBC 2OYMA 3DV6B 1O6TA 4KROC 4J3XA 4LLAA 5ESVA 1CLYL 3ZZSA 4JQVA 4Y5XA 2AEWA 5D1ZA 3MNWA 2FGWL 4F2ME 2ZOLB 1CI5A 4WWNA 4WJG3 4BQ6A 3VXUE 2Z0UA 3AT9A 3SYOA 3CZJA 5BOJA 1QLEH 2MNUA 4D9QD 3FOLA 2O5XH 3B2XA 3QK0A 4KKCC 5E8DL 3VI4B 3CLFH 4AYDC 5I15H 4JY5H 3FB7B 5GGTA 1NCBH 4Y5YA 4HJGA 4JN1H 1KOAA 4XB3A 3OGCB 4NFDA 1JZEA 1G6RA 4OZ4A 4FJ6A 2EEXA 3US1A 2FHCA 1J5OL 3AS0A 4FHKA 2W9EL 4WW2C 4D7BA 2R56H 4B3VA 4XCEA 3DVGB 1DDTA 2DJSA 4UDUB 4KXZH 1KFAL 4HWZA 1PFCA 5D1XC 2N7BA 4XCCH 4HDIB 1S7QB 2ZWSA 5AOLA 5EDXA 1CYWA 2DEXX 3QI9C 1DFXA 3SQBA 2OJZL 4WK4B 4Q97A 2V2WB 4U6XA 4X8JA 1Q9WA 2F19H 3D07A 4WJ5B 4CADA 2A9CA 1SXBA 4MMXC 2OZ4L 3ZL4H 1GA2A 1G7MB 3CN4A 4Y9EA 1XDTT 3T0AA 2B0SH 3JWOL 2UXTA 1NWPA 4GYBA 4PV8A 1MCQA 2KYIA 5EZOH 5F9OH 3OG4B 3INUL 1E28B 3PWPB 1H6EA 1TQVA 1X5LA 3Q48A 5ITFB 1WZAA 3FTWA 3LIZA 3NZ8A 5DGRA 2K78A 2OMUB 2DWEB 2YGPA 5T5FA 1HXKA 2AXFB 2OQJB 1ZLDA 4Z3HA 4WI2A 3EJZD 3GSQB 4EKJA 3MGTB 3DSFL 2GUOA 3CDCA 4Q6KA 1T5WB 3HNSH 1KCRL 4XODA 3VH8G 2VJ0A 3QUMA 2HSIA 1I75A 4L3EB 1OW0A 1MLBB 3B9VA 3I9PA 2YLKA 4UOJA 3CSGA 3ES6B 3SPVA 3EBAA 4LSUL 2K7QA 1FWXA 3VNYA 3OLDA 5E4OA 1AE6H 2VW4A 4ERSH 3FUEA 1YMMD 4GP5B 3BPCB 1BGXL 2I85A 1AGCA 3F04A 1N2RA 1QHOA 2WD0A 3U0WL 1I3GL 4X6DB 2X70A 2MTAA 3LRSB 1LP9B 3TIEB 1M9WA 2XC8A 4LCCC 4ILDA 4NJ9H 5IZ7A 3I85A 4O5LH 3OPZL 4JFHD 4X7SH 4HF5H 2BY2A 1M7IB 2L8AA 3O3AA 4O58L 4PJIB 1L6XA 1DN2A 2LT9A 3LZOA 4NAQA 5IMOA 4NN5C 1C7SA 1P7QB 3TO2B 4OH2A 4MJHA 3VSUA 4NQVB 1UT1A 1AR1C 4RDQG 4FQLL 5DS8B 1BAFH 4XN1A 4N26A 4BE5A 4YLQT 3OQ3B 5CFAA 1Y07A 2YD1A 2OMYA 4CDHA 1EO7A 2JK5B 2C1PB 2YBGA 4MMYA 3ZL2A 2IANE 2K1MA 2CJSA 4AL8H 1TSHA 4OQTA 1F5WA 1D5XA 1MKFA 1RMFH 5AZ2L 4Z0BH 3ARVA 3L3KA 1QSVA 4MAZA 4TNEA 43C9B 2AXWA 2Z7WA 4OLWH 4NWUH 1KBWA 4HK3J 3I9IA 2WOBA 4P5MA 3H9SA 3V6BR 3GXUB 3EOBA 4C56D 2APWA 4HGKC 3FQNA 1D5IL 1KIPB 5JXAL 4K94H 5DJ0B 4G59C 4PAZA 4WWKA 2WY3B 5LAPA 4AGNA 1R4XA 5D70H 3IVKA 2UYLA 1YYLL 1XH0A 1YEDA 3PP4L 3VFOB 3GC3A 4EUPB 5DEFB 4M00A 2LTQB 4DGIL 2MHAA 3BFWA 3HMXH 5LGHL 5BVPH 2BWQA 3PLYA 1NDTA 2K8MA 2O6EA 3MLPA 3OKKA 1GJUA 4OLUH 4X9HA 1VB9A 2GJRA 2P9RA 1OT4A 3SDAB 5HYJA 1CWVA 3TV8A 4NNYA 3HZMA 5FYLE 4G80B 4XPGH 1K4CA 1PKQE 2ZOTA 2DLTA 2A38A 5IFAH 1UB5A 1UXMA 2ENYA 5F7BA 4DZ8A 2YRBA 5ETUA 2DTML 2FIKB 1C5CH 1B6DA 1SFHA 3S7GA 3RGVC 4G7QB 4J3UA 2VQUA 3QORB 4KJPC 1FH2A 4FFYL 5BZZA 2QPUA 1UWEH 1T5KA 3N40F 1MFDL 4YK4C 1BEYL 1DVQA 5T5NF 2QDWA 3HE7C 1W2KT 1KBBA 4I4WA 5ADOH 3FNKA 3UCQA 1SYVB 1LK3H 4LDEB 1H9DA 2EVIA 5JIPA 4U6HB 1JK8A 2UVEA 2BFGA 1MWAB 2YKLL 3SKUD 2VWEC 2NR6A 2MOVA 3Q9QA 1ZT4A 1UWGL 5FFLA 4X5XB 4IRJC 4OCSH 1DLFH 4B6ZA 1RP8A 5DTFB 3MAWA 4OM1L 3K72B 4PYHA 3HNTH 5C0AD 4HZLB 3SDCD 2NLJB 1MEXH 1VENA 1VZGA 3DX4A 3TNNA 3BD4A 2VSCA 1J5IA 3HG0A 3SGJC 2R2BB 1KYOK 4AV5A 3CVHH 2VLJD 3WFBL 2MKLC 1E5YA 1KJ2H 2OA9A 4HCFA 4P9HL 5I75C 2NSQA 3D5OF 1A4JA 1OGPA 3TJHC 3MLWL 3X1BA 4KKAC 5L2KA 3U2IA 4DPBX 3FCUB 4Z7AA 4APQB 4OW6A 1CD1B 5C6TL 1F02I 5E70A 1IV8A 4UZUA 4WHYH 3ARSA 3LV3A 1HWGB 2CO6A 2NQDA 1JBJA 1QFWI 2V17H 2A83A 5A7EA 2BC4A 4AQ8C 1PZ2A 1ZMYA 2P7TB 3T6XA 3UAAA 1I85C 1AGEB 5C0DA 4KWUA 3WMSA 4DGYH 3I6GA 4W9CC 1MWAL 3RWCB 2F18A 1X5FA 4PR5B 2J71A 3GIVA 1RXLA 4PRBB 5DUML 4XP5H 4GSXA 4OI7A 1DQKA 2E4FA 4GSQA 2V7NB 4R7DA 1PG7W 3KPPA 1WYJA 3SDXB 2WBKA 1ERNA 3NCMA 1BVLB 3S8WA 1CE1H 3BD5A 1RZ8B 3NCJL 4QHMA 3OHXA 3ZGIA 2DQTH 3KXFD 1F11A 1JRHL 3QZOA 4JG0H 3UTZA 2H5UA 4NQDA 5CGBA 3RVUC 1C5DB 3ZZ1A 3BZDA 2R9HD 2CBQA 3GI8L 1TEGA 2HA1A 2I7OA 4I3RL 5HGGS 1DVYA 4N2BA 4CBZA 4G7RB 4H20H 2YWZA 3GMRB 2BVQA 4IRSB 5ENWA 1KCWA 3G9VA 3MODH 1KCVL 3PAVA 1HEJC 1RZ7H 5HGAA 5E6RB 1TVDA 2QQLH 4FL4B 1U3HA 4F8LA 1YAIA 1J11A 1ZANH 4DN3L 4Y16B 1CDGA 1BG1A 4ZUUB 3C6LC 3VRJA 3WG7B 4NI6A 4RRPA 1E8YA 5FAAA 4GQQA 3PABA 4KQ4L 1JPTL 4QT5B 3GSNH 1JXDA 3BUIA 4TOYH 2KMWA 1G1YA 1F4WL 3D18B 1P4IH 1RUQH 4TQEL 5LWYL 4OD1L 4FEIA 2XHNA 2DQCH 2EYTB 1N5AB 4NFBA 1H19A 1MNUL 3QEQB 4G3YL 1EH9A 3SGKC 3WTSA 3EGSA 3MA7B 6TAAA 1WLHA 5I1IL 4N8CL 5D4QA 4NRZA 2Z1KA 3Q13A 2OMXB 3CUPB 1XB8A 4J3TA 2WLHA 1JZ5A 4I9XA 2NY1D 1H15A 1WIUA 3HS0C 4XPTH 3H9HB 2R1XA 1IAIH 2ED9A 2G2RB 1FHGA 4MCYB 4GIAA 3RKDD 3I3BA 2YMTA 3TL5A 4TVPH 1AGFB 3I9GH 2JJTC 3PYCA 5J1SC 3BJLA 1YJDC 4XBEL 1H5BA 5JHMA 2XWRA 3V7AG 3W2DH 5BO1L 3WTUA 5CU9A 2VDKH 2GIMA 3W0WB 3CZLA 1M6OB 4ZS7L 3FFCD 4J8QA 4PP1C 1T1ZB 5PAZA 1I7RB 4AW7A 5ID0A 3QCVH 3QDMA 1ZK5A 2Z8WC 3L3JB 3CX5J 3N50A 4JUSA 5ESQB 4ENEC 4NQXA 5D72L 3VDBA 2BVYA 3BH8B 3FQTB 3GT6A 5LGYA 1JPSL 3CU1A 3DROA 4FF9A 1XZWA 3BVXA 2LU3A 5E1AB 1HKFA 3CPLB 2FZ3B 2J4WL 4HK0A 4N8VG 4YSRA 1NGXA 2AEPL 1L9NA 3T8MA 5CSZB 1S3RA 5LBVA 3L2MA 2FBRA 1J9RA 4UT9A 1A2YB 2CLRB 4JX0A 2VAAA 5H4YA 5KVGE 3L1OH 5CGYD 4K7PL 4OSUL 4O9HL 4WWOA 2PW2B 2WZ5A 4TUKL 4K9EL 2ATKB 2WTRA 4HJIA 2C3WA 3KPRE 4TLUA 4TMPA 4F15C 5C0EB 2OTWA 3FCGA 2K70A 3B2MA 4HXAL 3QWQB 4MJ6B 4R2GD 5ALCH 4XVSL 2YD2A 1DJYA 1KXTB 4WO4A 3AT0A 4HIIB 3CWGA 2MWCA 4HS8H 4TUUA 5KOVC 2JKWA 3BSGA 5CMAB 4LFHD 3B56A 4K3HA 1TZHB 2BZCA 4OGQC 1PPIA 5J8OA 1T2QH 5KVFE 1I8UA 3QULA 1DSWA 1UD2A 2EVFA 1EAOA 3NJLA 1N68A 1U92A 1CDBA 1CD0A 4D9RE 3BAEH 4NP4L 3B9KD 4M93C 2DIEA 3C12A 1CFNB 1NGZA 4DO5A 5EBWB 4G71B 2OW7A 3T2PA 2X53A 3V7MA 2OM5A 2RFXA 4E42A 4L4TD 2DQFB 3UCRA 1HHKB 1AMXA 1CLOL 3ZE0E 3ELQA 4RVBA 1PAMA 2ZF8A 1HHIB 1VEPA 4EI6B 2OP4H 2MCAA 3PJLA 3BQUC 1M1XA 1HQ4B 4S2SA 4ECNA 1YMMB 4XO9A 3PL6C 1JJUA 3N55A 4QEGA 3RTQC 5K1NA 4CVXB 3MJ8A 3TGXA 5BV7C 4HUCA 3OJVC 1FRGH 3QZWG 3X12B 4G1EB 4X9GA 4LAJH 5HI3D 2B4CL 1YDPB 1UM4H 1LVEA 3FUHA 1ECYA 5DMIL 5JIHA 4H7VA 2Z93B 5LN8A 2FBJH 3OR6B 4UOW1 4YOKA