2OULB

The structure of chagasin in complex with a cysteine protease clarifies the binding mode and evolution of a new inhibitor family
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
107
structure length
107
Chain Sequence
b'KVTKAHNGATLTVAVGELVEIQLPSNPTTGFAWYFEGGTKESPNESMFTVENKYFPPDSKLLGAGGTEHFHVTVKAAGTHAVNLTYMRPWTGPSHDSERFTVYLKAN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Falcipain 2
publication title The structure of chagasin in complex with a cysteine protease clarifies the binding mode and evolution of an inhibitor family.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Hydrolase/hydrolase inhibitor
total genus 21
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2007-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF09394 Inhibitor_I42 Chagasin family peptidase inhibitor I42
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2020 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2oulB00
3E1ZA 3M86A 2H7WA 2NNRA 2NQDA 2WGNB 2OULB 3CBJB 3M88A 3CBKB 2C34A 2FO8A 3PNRB
chains in the Genus database with same CATH superfamily
1OTSC 3P3TA 2H3NA 1QKZH 3AAZB 4NC0B 4P4RA 3TH2T 3TA3A 1CYGA 1SOQA 3JWDC 2NLJB 2QLVB 4D8OA 4DF9A 5IUCA 5DJYA 4HAGA 2QADD 5BZWA 5KVEE 4KJWD 3MROA 3H0TB 3T4YB 1VIWA 5T5FA 1T83C 1IC7H 1OAQL 4H25A 2FD6H 1S5HA 5L4JA 1NFAA 3OB0H 1MJUH 4OLEA 3IDNB 4D3CH 1UKQA 1HNFA 2FK9A 5IKCB 2P9RA 1AXSA 4YFDB 4GUOA 4L0YA 3KJ4C 3ZE2F 4JY6A 4UUJB 2PLTA 2ZONA 3MXWL 3Q44A 3C08H 4UIKH 2FVNA 3VA6A 1IGMH 5IEKA 1ZANL 5JHLH 4QJ5B 4K9EH 5DD0H 3OLIA 3TBWB 3VJ6B 4UTBH 4JLRA 3T71A 3I2CH 1U8HB 4EZLA 3R06A 3LZOA 3X1NA 4BSJA 4GMTH 1A5FL 3WEOA 2DM7A 4FNLL 4UCFA 4AIZB 1BA9A 1CD1B 4ZUVA 3TIEB 4BCYA 1JYXA 2NYKA 4POZD 1HT6A 3NRQA 3QJZA 1W0YT 2WLNA 2I07A 3MFGB 5A6MA 1K8IA 3AG2B 4P9MH 1FORL 1U8PB 3FZUC 1DQTA 2FZ3A 3JQOB 1EVUA 3STZB 2OZ4H 3FU9A 3FPXA 4DJMA 5ESQB 5IJKC 2ZUYA 2NQCA 1E90A 4PTUB 5IV2A 1XB6A 2IANB 4PW9A 2AI0H 2H6PA 5LBSH 1M05A 2GJ6E 4JRYA 1GTNA 2ZCHH 3STLB 1XIWB 2IDQA 2ZOUA 4DPBX 3QUML 1D3CA 3R1GH 1J5HA 1WAEA 4RRPG 1IZKA 2CJUH 4E0RA 2MQ0A 5AD0B 1QSEE 3P9MA 3U36A 4NN5B 2VERN 2VLKB 3AT9A 1TF4A 5AW0B 1AG6A 3CBKB 2DN7A 4Y4HC 3R8BB 3S88H 5D7JD 4E9YA 2QELA 3X13B 2BNQD 8PAZA 2VSKB 3GMRB 2PYEA 4ZX3A 3GI8H 2K9FB 4JM2C 1RZ8A 4LHQB 4NKOA 5K39B 3T2QA 4P9HL 1H8LA 3GF8A 2A83A 3J07A 4YVUA 3WLBB 2UWEB 4XMLH 5HHOA 2WIIB 4YEEA 2ARJQ 3PL6A 1F90L 1UM5L 4R8WH 4L8DA 3CFBB 2VITB 2ZE0A 4JM2F 4LOUD 4J8RA 4UQDA 2UY6B 3C5JA 2YGNA 3HW7A 1NGZB 1J1XH 3NIFE 3CFDA 4FJZA 4M5YH 4ORGB 4TXVB 5IQ9B 4BCZA 3EYVB 1YNKH 5CLXA 1P84K 4IDJL 3EJTA 5D2NA 5CEZL 1GHFH 3EADA 1XGRB 4MX7A 4PMEA 3CSGA 4DERA 5C0EA 1ZIBA 4HIXL 5C1MB 4FI8A 4Z7VB 5GS0H 3OR6B 4HUCA 5IIEA 1I1CA 3O3AB 3BDXA 4PQXA 3E0GA 1B6DA 1V55B 2BWIA 1BLIA 4AVHA 5ADPL 2PPFA 3TV3H 4TVSa 3FYIB 3DHMA 4V33A 1MHEB 2GHWB 5F7UA 4YMPA 2OMNA 5EBLA 4GT0A 1ETZA 1LL1A 3UO1H 5TDPA 2Z65C 4XMWA 4YSOA 1P7KA 1AQKL 4JFPB 3IFNH 1DR9A 4I1RA 1PEZA 1AE6H 3FBKA 4KKNA 1IQWL 1L9RA 4ZYKB 4J4PA 4QGYA 1IGYA 4E9RA 2K4WA 1DJHA 3HZKA 2BIMA 4PIBA 4ONFL 5HJ3B 3R7QA 2WXPA 2NMSA 1CICB 1M7UA 1DL7H 3MKKA 5KSBA 3QNZA 1S9XA 3ML8A 1C12B 1HSAA 1IAKA 3B2XA 4PY8J 3OMZA 2X6VA 4UMGA 3DMMC 2FDBP 3NRFA 2JSFA 3M8OL 5ABAA 1JV2B 3RVTD 3ULSA 1IKNC 3LDBB 3QPQD 4IHOB 3CFMA 3QARA 1ASQA 2XZQL 1L9OA 2R0ZH 4L2YA 2OXHB 2NDFA 4PJ9C 5D1XD 3DX4A 3KNBB 2JQAA 1HWWA 3N41B 4L1SA 4LLUB 5F9DC 5IW1A 5IB1B 2QADC 4M43L 1ND0A 2BWQA 2D03L 5JHDB 2NY0D 2GJ6B 3OMIB 5K1NA 5E8OA 5AZUA 6PCYA 3F7KA 1ZEAH 3D12B 4CC4C 1U8QA 2IQ9L 3DUSB 4ICXA 5E00A 3L8QA 5FX3A 1U91B 1EAOA 4DKAA 1ZGLM 1Q0YL 2BERA 4KJPC 1DQVA 4GRWH 1IBYA 1E5CA 1UACL 1T0NB 1GJIA 2WKOF 1TZHB 2WTOA 3L4UA 4K5MA 2GBVA 3NT0A 1URLA 1AVAA 1JTPA 2COVD 1ZDQA 1DJYA 2BW4A 3P4NB 4OGYH 5E9DD 3SBRA 3TEXA 1L4IA 5I74C 3HI1A 2VLRD 4DHLA 3GSUA 4Y4FB 4X5XA 2VDQH 1QEXA 1XZ0B 5CZXC 4EI5C 4L8CB 1N0XL 4RA0C 1FAIL 1VZHA 3QUHA 2AKRB 1S2EA 3VM7A 4OJFL 3CZUB 4GFXA 4B41A 2O72A 2E0PA 5I8CA 1BAGA 3X14B 4ENZA 4OF0A 5DVNA 5FDWA 1UYWH 1J9CT 2ZP8A 2JJSC 3IDIA 1A7OL 1NBQA 3OZ9H 3QIUD 4L29B 4WWKD 1FGNH 4ODHH 5CJOH 5DUJA 1J0ZA 1HJBC 5HHMD 3QQ9C 3KLHD 2ZXQA 3U7AA 5D5MB 1JUFB 2D73A 4A37A 4BZ1L 1S46A 5D4JA 4EN2A 1JMXA 3BKMH 4PJ7B 3EXLA 2JLLA 3IETA 4YSDA 3UC0L 2BHYA 2JNZA 4CMHB 1LE5B 5I23A 1UG9A 2SODB 5KVEL 3LN9A 5JUEH 4QTIL 5DJXA 4D0BB 1NBCA 4NDMA 3PDOB 1NBZB 3GGWA 5DQJA 1BJ1J 4MJHA 4H88H 4UOJA 3V4LA 1OXYA 3GZOA 4N0UE 4PAZA 4PEEA 5CJ8A 1UB6A 1DN0B 3G9AB 3KYMA 3NCYS 4OLZL 3TPKA 4ZSOE 4E5XB 2MTAA 1XSJA 4KH2A 3FT3A 4POUB 1YNLH 3D2UA 4Q7DA 4UIMB 1BYOA 4OR1A 1H3WM 1UURA 2ILLA 1JHTB 1MOEA 1KYAA 3RWIB 5K9KA 4LCYB 3QRBA 1A3RL 3SE4C 1GC1C 1M4KA 3ETTA 3DPBB 3L9EA 4Z9KB 1JGDA 1Y0LB 3SDXA 2FIKA 1SFDA 4ZW3A 4ZFFB 2RAMA 2YQ2A 1HCVA 5IMKA 2F9BT 5IMMB 1OK8A 5EUKA 1U21A 1KWGA 3WBDA 2IH3A 1SY6L 5IF0A 2I5YL 3JT2A 1MIML 2XUWA 3L2LA 4OBSA 2FSDA 4B6ZA 4G8AC 1Q0XL 2DLEA 3MACH 3IJ8A 2DYPD 2DJUA 2QVIA 5CM1A 1BIHA 1FL5B 4TVPD 4HF5L 2VC2B 1C16A 4R83A 4PP2A 4Y16A 5TE6L 5B3JE 3TURA 3ZYJA 1DJIA 2LW3A 3N55A 4X7FC 1GPOL 3BGMB 4K07A 5BMFL 1OB1B 1R33A 1NCIA 4RGND 3A4EA 4EN3A 1ZVYA 4KZCA 1S9YA 1A21A 1GW6A 3BGFC 4P2OD 2K0RA 4X4YA 2OTUB 3WIFA 4MAYC 5LXGL 1BHGA 2BDNH 3TA3D 4J3VA 3OJMB 4LLYA 2VKWA 3ARBD 1AIZA 4JPQA 3FTZA 3TYFB 5J6SA 4I85A 3VDBA 5I1IL 3K71A 4AE0A 4ZTOH 5D93C 4OJAA 4DEPC 2K6ZA 3RUGB 3SPJA 3T8VA 3QDAA 2PCPB 2KMWA 2YAHA 4XI5D 3LIZL 3ZGHA 1OPGL 2VDPB 1TLKA 2KH2B 1ZHBB 1H0DA 4HK3J 2EXWD 3VD2A 1O7DC 5JTWA 5E6IC 4RGOL 2ADGB 1MHHB 1MAKA 4BH7B 3IDMA 4NNYA 2NDGA 4LF3A 5CJQH 3ZKND 3HBZA 3RVTC 4CADA 1X7QA 2WWNA 2CMRH 3QPQC 1JZ2A 4PJBE 4X98B 3VD1A 3C8KB 4TLSA 3VFGL 1WDAA 2F6AA 4YHPB 3G9VA 2J73A 3FFOA 3MA9L 2J55A 3EBIA 1WS8A 3G3LA 3RWFA 4TS6A 3QG7L 5JORA 4F37F 3MCLL 2HT4D 5LKNA 2FJSA 3DXAA 3GKWH 5EOQH 1DSYA 4P8QA 4PRNA 1GZQB 5E8NA 1I9IL 4XZUB 4AQEB 1KGCD 3GRBA 4CN4A 3L5IA 3HPJA 2PWGA 2GC4C 4R97B 3AACA 2CHNA 3PCYA 5ACMA 2QPUA 1QD0A 1PLAA 2YAPA 3NZ8A 3VTTA 5BUAA 5IG7B 3ZL1A 3P4MA 1GYWA 5CS7A 5DHYA 5D1ZC 1NC2B 3KHOA 3EJZC 3PGDA 4G43A 4G6AD 3FO0L 4KAQL 1JNLL 4XX1E 2J1WA 1EHAA 2F7OA 3IJ9A 4WO4B 5F9JA 1RY7B 3H55A 4Z7WE 3V6FA 4JKLA 3V6ZB 4JRYD 1XQ4A 3UEQA 1R3HA 5F9OL 1J9QA 1FYTE 3SYQA 3UFIA 4HOMA 2HSIA 4B9ZA 2J21A 3UDWA 1MCWW 3D0AA 3MREA 1YVLA 4N5EC 1JP5A 2QVFB 4R90L 2NXYB 4H4NA 4XMPL 1I1FB 35C8H 4TNWK 2R8SH 1HL8A 1A4KB 2XT1B 2G75B 4ODSL 3JTSB 2V2WA 4PJ5A 1ZV5A 3F7QA 5TDNA 2C7FA 5M95B 4X80H 3L3JB 2PYED 3L5HA 5DC0A 4ZW5A 3FB8A 1UC6A 2VC2L 4OZGA 4QCIB 3GBML 1WZ1H 4YE4L 5I8OL 4U0RB 3PLYA 4LLQB 1OF2B 2X6BA 5HHOD 2YZ1A 3PL6D 4HDIA 5E7FA 5EZPA 3HS0C 4AGNA 4OLYL 2YR3A 4ZNEE 3CLFL 3N43F 5KW9H 1ASPA 1T1WA 3RX7A 3VH8G 4JRXE 3SE9H 3K74B 1XR9A 4XX5A 3HE7B 4ZTEA 3W2DL 5ACZA 4IM8A 4IKLA 4FP8H 4L3EE 4LEOA 5D7KE 1XGQB 1QNIA 3V5KA 3PABB 3DX7A 1LEGB 5CUSL 4KNSA 3QO0A 1V05A 4DIXA 1Z5YD 4KRLB 2A9NL 3VRLF 3ULUL 2AGJL 1WFTA 1V7NH 3S3BB 2D3VA 2NY6D 3C6LA 1AD0B 3SOBL 2VDPL 2A73B 4ES9A 5HI4D 4JN1H 2NY3D 2VW4A 1TSHA 2W92A 2ZYHA 1SPDA 3ABZA 4U1LA 3X17A 3ULVE 3ZOAA 3VSQA 2X4SA 3FFDA 3G6AB 3JT0A 4PY7B 1XX9C 3LKNB 3RNQB 1Y1UA 3OJVC 3BZ4B 4OD3L 5CN3A 1TCRB 3FC8A 2VERA 1OAUH 4JZOB 1E27B 1FIGL 5F3HB 3L3KA 2XTJD 5C71A 1MFBH 3FCTA 4MYPA 3OSKA 4QHNB 4J4PD 4XPGH 1OM3H 3EDEA 2VAAB 4DUXA 3UJTH 3HB3B 4IU2B 1UXSB 5TDOB 3F7VA 2JLPA 2ATKA 4YDNA 1MHCB 2EH8H 4P49A 4RGNC 2ITCA 4NQXA 2IOMA 4EE2A 1I8UA 1NC4B 3N1MC 5AW9B 3MRKA 2J3SA 2VSMB 5L88H 1ES0A 3MYJA 1HOEA 4JO5A 4WFHD 1WBZA 3VW3L 3ILQD 4PP1C 3RTLA 3ARBC 1HEJC 4LDLB 4O4YH 3RZCB 4N2OA 4UU9B 3GLEA 2XY1A 3MRFB 3CSTA 4G9FE 3T0EC 2DMGA 1KGYE 4Z7WB 1T0PB 4XHQA 1A1NB 4NNXB 2C9RA 4MGXA 1Z66A 4LDCA 5AZ2H 2W0LA 1R5IA 4KO7A 2IGLA 4PVNA 4ZS7H 3WE6B 4PI0A 3TLRA 1EXUA 3HS9A 1JXKA 3MV8B 4NHCH 5LQBH 5EC2B 1CGXA 2ORBL 4RISL 4AGQA 2EXWC 4K23L 4ZDHA 1IKFH 5IJVA 4FMKA 2ARJA 1WF5A 5ICZB 3MC0A 4KPHL 4EEEA 2WJ5A 5I28A 1OSYA 2BS71 2EDLA 1XR8B 2ZXWB 4JDZA 1OCWL 4PJXF 1BFVH 1MVUA 1OGAB 4N0RA 3GSNB 3EDKA 3ZKNC 2DDQL 4L9LC 4KXZI 4MFHA 1LDPH 1FSKB 1IVTA 2CHZA 1QZNA 4NO0B 1RIUL 7TAAA 3P69A 5FO9B 4F33B 2WTPA 2VMDA 5H2BA 5TQ2H 2XFXB 1I9JH 4TLUA 1BFSA 4HXAL 1OTUD 1NDMB 1HXMB 1SLUA 3MA7A 2YUZA 3QJFA 3PWLB 4AL8L 4BFFA 3AABA 5A6IA 4XBEL 2HT4C 4WFEE 3WEAA 4UV7H 3QFJB 4OLUH 5FM5M 4FQXB 4NZ8A 1WIPA 3VYNA 2HLFC 5CR8A 2BMKB 1VGKA 2QPSA 3I85A 1E5YA 1IAMA 4WW2B 1A6PA 2P26A 4MJ2A 5IEHB 5KSAB 4RSVA 3QJXA 2QHRH 1RHHA 5CP3A 5DJ8A 5LGJA 3TONA 4AE1A 3O0RL 5AL0A 1BD2A 5I1GL 3HHSA 4S1SH 3MNWB 1NCHA 1G9ML 1SXZA 1XMEB 1TJHH 3B37A 2IPTH 4FXKC 4Q52A 4WKZA 5BO1L 2GQHA 5KTEL 1K4DA 1QLRB 2CO6B 4KVPA 4MD0B 1XAKA 2C1OB 2CR6A 4ANVA 3PV6A 5IFHH 1K6QL 2VXSL 5E4OA 1MDAA 1GGIH 4ONOA 1PZDA 1QEWA 3FN0L 1BFOA 4WEUD 1FH5L 1VHPA 1QW9A 2ZAHA 1MCHA 3FKUS 2RACA 3QO1A 4XB8A 3DA0A 1NBYB 2WZ6A 4EDXB 3Q5OA 4Z6AT 5BUPA 5HDQL 4HUXA 1A1OA 3D3VA 4I2XB 4MBRA 1IC4H 1FLRL 5TGBB 2VQUA 4G1EB 3ME0B 2EDHA 4LHUB 4R2GB 4OZ4A 5DRZB 3BUIA 5J0BA 3LZFL 4FQJH 4Q6IB 2Q20A 4AUYA 2YK1H 4DKDC 4KZEH 3ZKMD 4KZDL 2HVKB 1QBAA 3S2CA 1UWXK 1QTSA 1MI5B 1YEDA 3ECBA 5C6WH 4S1RH 4G82A 3BIKA 4M5SA 4RFOL 5DTFA 5CHNA 1G9NC 2GBAA 3HG1D 5GRVL 1OCRB 2BP0A 3RWHB 5I1EH 1I7ZB 2LHAA 2PWFA 4JZJC 3EG9B 4HJTA 1YMHA 3MJ9L 3WTTA 4IOSA 4Y16D 2Z1PA 1YC8A 4OLWH 2AAAA 3QR2A 4P5TB 1AG0A 3OF6A 1HZLA 5AYTA 3QT2A 1CDYA 3N3EA 2V17H 3L3GA 4WCYL 1U8IA 4EN3D 4UQ2B 3SDYL 2ERJB 3CC5A 3CXFA 1ZK9A 5DFVC 5JIQA 5FKPB 4IBYA 4GSXA 3AG3B 4AYGA 1RUML 2NR6A 5KSUA 5GRUH 3V2AR 4MJ5A 2NY3C 3S35L 4NENA 2OX5A 3IVKA 4KKAC 3FCSB 5D8JL 4Y5YC 4FX5A 2LU3A 3NN8B 4N6RB 1N8ZB 3SQRA 1CLZL 1UT2A 4PV9B 4E9QA 5E56A 1TJIH 2X38A 1A6AB 5E8EB 3CSBA 3PGCA 1JPTL 3UTZA 3GSNL 2WZPA 3C6SA 4TNWF 4X9YA 4GKZB 2HAZA 1E5AA 2OSXA 2FNBA 3RB7A 2WXLA 1WBYA 4O2EA 3IK2A 1ACZA 4A2MA 3LKQB 1W15A 5DWUL 5A2CA 4JG0L 4CVZA 4ZD3L 1KCUH 5EZOL 1IL1B 2W60B 1JERA 3OKNB 2Q8AL 2R23A 3WN5C 1KGXA 4JO3H 4X0NA 5D96C 5F0MB 2WSPA 3F05A 4Z23A 2ZKYA 1QW8A 5TE7H 1ECYA 1U8OA 1UH2A 3CFKB 2CJTA 3T77B 4JHWH 1J9TA 3MBWA 1DVFA 5MEQB 2EDDA 3PP3K 2PW1A 4R7NB 3GRWL 4OCWL 5T3XH 4IS6B 1Y1DA 4P23B 5F93C 2JCCE 5EZLA 3OKOB 3DXAD 4X4KA 1ZSDB 2EDKA 1AC6A 1U92A 1YUHA 2IXQA 3K0YA 4J7RA 4O2FA 2LVCA 2CKBH 2W0KA 4YC2B 1DEDA 4N0YH 3REWA 2GITA 5FA3B 4PD4J 4D9LH 5I1HL 3ULVL 3NH7L 1YMME 2X10A 3F65A 2EVJA 5GGQH 4P5MB 4LSPL 2X87A 4NP4L 3P4OB 4WWPA 5ITFA 4J28A 3SZKC 1TJGL 2ADJA 3UG5A 1RH8A 5EEYA 5I0ZA 1AD9A 2XPGB 4P46D 1DO6A 4U6YA 3SKNB 1UQSA 4PRPA 4UTAL 2XKNB 1ZGLA 3ZTNH 4NQUA 5SWQA 3KBHE 4F2MB 3TZVA 3BYTA 1NJ9A 3QQ3B 1WTGT 1IFGA 3HMWH 3QQ4A 3DV4A 4ZFOA 5K1VA 2EUZA 3ILPA 3QJOA 3PNWA 3RTQA 1OTUC 2ZUVA 5EZJA 4HX1B 4FKKA 4P2CG 4HFUL 5E7BA 4Z7OE 1WAAA 3AM8C 1SMAA 1G7PA 5KVDH 4Y5XA 3UYPA 2PPCA 4QHMA 3ZKXC 4FF9A 1S7XB 1OSZA 4OAWA 2VXVL 2K3HA 2E7LC 2BSEA 3SPHA 3G6DL 3HPLA 4Z95L 4WI2A 4FA7B 1WWAX 4GH7B 3GMLB 4GQPH 2V3FA 3A6OA 5D9SB 2Y72A 4UAHA 3SKUD 5IMOA 3MOAH 1OARH 3WENA 1JPGA 1RD6A 2YGQA 4OTXL 1F4AA 1ZS8B 1WFOA 5HGBA 4K7FA 4I13B 2HJKB 4KVCH 1YPZA 2FWLB 5GISH 4DGYL 4MBOA 1DLFL 1OZUA 4A1RA 1XCTB 3C6LD 2GTQA 2WXNA 4LFHG 2B1AL 1QR4A 5E94B 5F1IA 4B0MB 1IGFL 1RZ7L 4FNQA 4TQEL 2QFPA 5H4YA 2VMFA 1N4XH 4Q56A 4E68A 3ROOA 5ISZD 2OJEB 3KXFA 3CBRA 1PYWA 3RHWF 43C9B 3TNNB 4XVTH 1WG3A 1R34A 4TUJB 1YEKL 4X0KB 5DDHB 2IH9A 2VAJA 3FT2B 2APSA 3WXWL 1HK6A 1JXDA 4WEBL 2OJZH 2XQBL 2CKNA 5BRZA 1WFNA 1TT6A 5GZNA 2FB4L 4U1NB 3BVNB 3Q8EA 1XAUA 2ROYA 3SDXF 1EZSA 3GJFH 5ALBH 3O3DA 1XZWA 1I1AB 5HXMA 5E1AA 5GRYA 3WDJA 2NYZA 3ARGC 3CTTA 3D0VA 1DZBA 3FCGA 3HNVH 2GTZA 2DQJH 3PHOB 4KTDL 2RD0A 4J27A 1DBAH 1KLGA 2D9CA 4GSUA 4WSGA 3S34H 3TBVA 2A9ML 1TCMA 2BHUA 4I0PB 1ESOA 1TO5A 2WMPB 32C2A 3W57A 2EDXA 2YQGA 1T66D 5EEWA 3WKML 1QUNA 1E28A 5ESVB 3Q9QA 4DN4H 3IJHA 5EWIH 1KJVA 1TFPA 4MJJA 3CX2A 5I16B 3IDGB 5FW6A 5EO0B 4DCQA 3DBXB 1GMEA 4FC3E 4QKTA 4N2IA 2XI9A 1UJ3C 2HKAA 4M03A 4L1TA 5TTRA 1Y18B 1BQHG 3WN6A 3QDGE 1RZJH 1AH1A 1A2YA 2NY5C 2ZX7A 3BH8A 4QUOA 3BYYA 1NA8A 5EU6D 4MA1B 4ZS6C 1JZIA 2PXYB 5LAPA 3G6JA 1YY8B 4Z7OB 3FQTA 4XPFL 3TIDA 3K91A 1AI1H 1SNRA 4FXGC 4JPIB 1QFOA 1HXYB 1CC3A 1YECL 3G5YA 4PV8B 2ZUQB 4OLVH 4EOWH 3LRMA 2R0LH 3ZRFC 5IROC 1W72B 4PJEB 1U95A 1YYMH 4MTMA 4QRRB 3BQUB 2ZWYA 2CRMA 5HVFB 2VDNH 3RKPA 3EYQD 2MCPL 5CJXA 1NGWA 4D7BA 1ZA6B 5FA4A 3M7FB 5JPNC 5E1IA 3SKJH 3TVMC 2FO8A 1J0KA 3CPLB 3NA4A 3CN1A 5A3ID 4U31A 3BDYL 1WQVT 4JPKL 1B9ZA 3P0VH 1OD9A 2AJUL 3VRJB 2H41A 4MB5A 1EA9C 5E1GA 3HJ0A 1RMFH 4KK8D 4RNRA 5JIPA 5FYJE 3CN4A 2B4CH 5GS1A 3MRDB 2C26A 4IEFA 4NWTL 2W0FB 4Y8DC 5FWRA 4JCMA 2EDFA 4J3OH 2VH5H 4LRIC 4DVBA 4OLXH 1NANH 4HPYH 4G83A 2N1KA 1AR2A 4KO9A 4PG9A 4F7TA 1WFJA 5E9AA 3SKMB 3W11D 1DBBH 3MLZL 3FBQA 1G7JA 1XH2A 1BD2D 3DGCR 3M45A 1Q8MA 2QQLL 2DMKA 4LL9A 4ODUA 4P46C 4UAOC 4NO5A 2VXQA 4JQIL 3WV0A 3CHRA 3N42F 1BX2A 1ZLEA 1X5YA 4GRLB 4CRPA 4PB0L 1N5YH 2AEOA 2PYFA 3IMTA 3T0BA 3TO2A 3K80A 2PTUA 4U1JA 3PRZA 5J9PA 1VEPA 4HIEA 4FLRA 3R4RA 1B0WA 1FVCA 4PTTB 4D2NA 1H9DA 3T65A 4HD9A 2AQ2A 4G8GD 4HSCX 4WGKA 2JTDA 3QAZB 1DUYA 1CDGA 5D7IE 1FBIL 3IE9A 4BFNA 1N0LA 3K2IA 1TZAA 2AP2A 3MBXH 1F3RB 3FRPB 5MENE 4NN7C 5KJRL 2LAGB 2E8ZA 4J3OG 2PN5A 2Y24A 4XP1L 4FGMA 5FFLA 3Q5TA 1MJ8L 4XZ4A 5IR1A 2X3AA 3PPSA 3QZWB 3ZRSA 1USQA 3OPUA 4J39A 5D70L 4AVJA 2Y07H 2JE8A 3PP4L 2WVTA 2AJXL 2ICWI 3OG4B 4KDTA 2Y1YA 4LCCC 3GLZA 3MRHA 5TH2B 3FAWA 1GGTA 4M8QB 5F7FA 2ENQA 3RVWD 4OZGF 1GOFA 4U1IA 3FHAA 3HVNA 4I77H 5IJBC 1YEFH 4IOSD 3VFSA 3TT1H 1NCTA 3K5RA 5C92A 1UT9A 3F58L 1JFHA 4NKQB 1DQDH 1N10A 2KL6A 1PIGA 4ONHB 2Z4TA 5L2JA 4YBLC 1CI3M 2QVMA 3GUFA 1I3VA 4KKRA 1PD0A 1S7TB 2KDYA 4FCAA 3GINA 2NR6D 2Y23A 3LB6D 4JVPA 4LSQH 3UBHA 5I17A 2J2ZA 1XF2B 1D6VL 5FYKD 1E5BA 3U6RB 1R19A 2Z0BA 4CU6A 3LMJH 1NGXB 2E56A 2WLLB 2ZWNA 1FZKB 1LNUB 1U33A 3KCPA 4HJJH 4H7VA 1X4YA 3VQ1C 2XN9B 2X12A 3MNZB 2E59A 3BT0A 4AK1A 3G04A 4G8IA 4M7JH 1DSWA 2P5WD 5EEVA 1S8DB 2WZPD 2VR9A 3AY4C 3MRJA 3I6LE 4N24A 5FV2A 4GINA 3RJQB 1W72L 3KPMA 1CE6B 1N59A 4AQOA 2VRKA 4PJDA 1G87A 2OR9H 5HJGA 1IVLA 3DETD 1CBVL 4DH2A 3LZRA 2FHBA 4XPTH 3BFWA 2X1PA 3L1OH 1QSZA 4M6OL 5DURD 1TMCB 3BE1L 2IDTA 4ELMF 1PSKL 5HYSB 1LP9F 3ARVA 3ML9A 1OAJA 3H85A 5J1AB 1T66C 1A4CA 4UT6H 1DVFD 4YZFE 5E03A 3D33A 1N2RB 4JFFD 4WDIB 4N2HA 4DAGH 2DM3A 2WYHA 5JO5B 2E8YA 3OAYK 2FJHA 3JV4B 3LRSA 4JB9H 4MNHB 4APQC 2VABA 2UVEA 4NIKB 4E41E 1UFGA 4QI3A 4PJGE 1MRCH 2MRYA 3FUFA 2JV6A 1X5JA 3CDZB 1V27A 5DU7A 1CXFA 1OTTD 5CGYC 3V5HA 2E86A 1FO0B 2E4TA 1S7QA 4F7CB 2JKLA 5D7IB 1CXLA 2VRAA 5T1KA 4JPVH 1L6XA 1SEQH 1WEJH 3KPSA 4ZAKB 3TZVD 3H2PA 2E7CA 4OQTL 4AJYV 4EKJA 3IJ7A 1IBDA 1FN4A 4G80B 2JI1A 2V2TB 3FB7B 1IGCH 4HAKA 1T1XB 3AVEA 2JB5H 4NPYA 4FA6A 5DD6A 3CZNA 5JZ7C 5A2BA 4QRUB 1SXAA 1IV8A 3BEVA 4KK8C 3V4UL 4OUUB 1EGJA 5E4EC 3KH4A 3EBGA 4HKZA 1G9EA 3EZ8A 5E5MB 2EACA 4P99A 3OGCA 1RL1A 2KLRA 3GXPA 1CR9L 4NQEE 4OSUL 3MXVL 5B39A 5EEUA 4P2QA 4F1SA 2JQMA 4JFEE 4ODXB 4QTFA 3IYLW 2A6DB 1FZOB 3H7BB 2DY2A 4W68A 1D2PA 1E9OB 1NOFA 1AGCA 5IHZB 2IADA 1X9UA 1FVEA 2O6PA 1KTLA 1T2QL 3PHSA 4Y4KD 2XWTA 3X11A 2WBJC 1RK0B 3LQZB 5I1JH 3IJSB 4UB0L 1A22B 1HAUA 3HRZC 2Y25A 3L3OA 5KYUB 4WFFD 2R2EB 2YC1B 3H6AA 4LGRB 2OYKA 1QSFB 5JW4R 2Q8BH 1SM3L 1KIQA 1VJSA 3VDAA 1A4AA 3NMEA 3O11B 1BM3H 4HCRH 2AK1H 5EMYA 4JO1H 4MJ6B 5E2TH 3Q3GB 2BOCB 2YXVA 5I75C 1EZVX 2YPKA 3QIBB 3KXFD 2YAFA 5EF0A 4PGDA 4NHUA 3C60A 5AL8A 1KCSL 1WD9A 3CVIH 4YHNB 4ZX6A 4F7PA 1AFVH 4U7MA 2GJRA 4HSQA 4LSRH 2IAAC 2X70B 4R4FL 2KT6A 5BRZD 5GZND 3Q0HA 4FTVD 2K6WA 3WXVH 1BZ9A 3CDYA 5FCUH 1HAWA 5IQNA 2YA1A 1IAOA 2Z7ZA 5EF2A 2A9CA 5EDXA 1O9VA 3TWYA 2DD8H 3EH4B 2EE9A 1E2VA 3GBNL 3KS0J 2BFVH 1HHGA 3UH8A 2R7EA 1F4XH 2ZOLB 2PMZA 5J56B 1Q72H 2G9HA 4IRZL 4MMZA 4E41B 2XSKA 4J3TA 5EU3A 4M7LL 2OL3B 2DH3A 3NJFA 1EEYA 5FYJU 4GXFA 2FBJH 4K8RH 4WKXA 1EEQA 4CGTA 5ID0B 1M2OA 4MA3B 2F1EA 1DFBL 25C8H 4A7UA 3PJLA 2OFQA 5GS2D 4DN3H 1VACB 1FO0L 2F74A 2FBRA 2F58H 2Y06L 3E8UH 4PWFA 4TKWA 1KYOJ 3LXAA 3VFVB 2WM0A 1H3VA 1I8LA 3II3A 4PJIF 3LD8B 2XBDA 2FWUA 2Q6WA 1ZHLB 3MX0B 4PVMA 5E70A 4KK6D 2XKUA 4BQ8A 4BUGA 3B8SA 4GRMB 4NQCB 3UIYA 1DVXA 2VCOA 1CB4A 1ZT1A 3UPRA 3Q6FB 3MLVL 3OKLA 3VI4F 4KNUA 2EDRA 1MJ7L 3V4VB 2KPNA 2R4SH 3IXTB 5DGQA 4WNQB 1OP3H 1A47A 1YLBB 3BPOB 1JI1A 1XF4A 5E8DL 3UADA 4NRYB 1BMGA 2LABA 2MMXA 4ZFZB 3A21A 2V9QA 3LXCA 3U0TB 4NQEB 5BZDB 1TNMA 1A9EA 1F3DH 1U58A 2QV2A 2YBRB 3A24A 4JFEB 4LVOB 3UTTE 1BZQK 1G7HB 6FABL 3WYRA 1PEWA 3AB0C 3BRGC 1ZY9A 2WXGA 2O5YL 3II2A 1MFVA 4N4YB 3QZNA 3ZTCC 1HOCA 2YD7A 1YJDH 1T5XA 1TTUA 1QHPA 4NJAL 3MV01 3O41A 3Q01A 9PCYA 1HH9A 4KKBC 4JJ5B 1CDCA 5L4MA 2AHIA 2Y1AA 3QUZA 3H9HA 3DURB 3OB0K 1XH1A 2WUCL 2BZDA 4HLZH 3WLWC 3DOSA 1GCFA 4Y4HB 1M9WA 1E3ZA 1XH3A 1RULL 2L7JA 1MEXH 4H0IA 4JFDB 5E6ZA 4WJ5A 3CX5J 1JV5B 3DNKA 4OW6A 5D2LF 4JM2B 3WUWB 2ZSVB 4NWUL 3RLSA 4L3CA 5LUMA 1N26A 5SWZD 2GJPA 4OD1H 1OZTG 4L4TE 4WTQA 3TASA 3NJXA 4NQSB 5D7LD 4KGLA 1U6AH 5JPMB 5JXED 4PS3A 2GK0B 1Q9KA 2B3IA 2V5MA 5DFAA 3DVIA 3N1GC 1JFQH 5DHMC 1G7QA 1P4LB 1NCDH 3DUUB 4Y9FA 5F0PB 3TJHD 3VQLA 2C7UA 2IQAB 4NYLB 1IE4A 1AZZC 3VFUA 3V0JA 1I7TB 1QFWI 1M56B 3AJ7A 1OIOA 2DTML 1IAIL 4QOKA 5DVMA 1V3KA 1VKXB 1RZKH 3RURA 4KX7A 4Z8FL 2H32A 1UUSA 1HILB 1JZ6A 5IHBA 1DSFL 1D9KA 5AVRB 1CXHA 4HLZG 1KELH 1PQZA 4LARH 1GSMA 4Y4KC 2OL3L 1U0QA 1AGBB 4PRHE 1TZGH 3GK8L 3MGOB 1NCAL 4MLSA 5EULV 4M1CC 4TNFA 4WV1B 4JN2A 4OZHA 2EP6A 3BZFA 3RY5A 2NNCA 2AXHA 3UYOD 4LBEB 3NAAL 3L2MA 5DRXB 5JW5B 4JHBA 2NZ1A 1M6OB 4YWGL 4UF7C 4JAMB 2GT9A 5I66B 3PXJA 2NY1B 4F9LC 4NQDE 2EECA 4UUJA 4M9PA 3IU3B 5T3ZE 3RVXC 3FK3A 3IN0A 1ACYL 3WSQL 1AJ7L 4U1HB 1OGTB 4M4PA 3V4VL 2QHLA 4JE4B 3UJIL 4U6VL 1CDIA 2RH0A 4M6NL 4N0CD 1OD7A 5KN5A 1D7CA 2RQ8A 5CN2A 4K2UL 4BYHA 5F6IB 4OV6F 1NEZB 4ZMQA 4UT9L 4K71B 4U7SA 4JQVC 1EERB 3UABA 3EYUH 3SYOA 1AO7E 5BV7C 4H8WH 3TV8A 3S37X 2P46B 2XQYG 1KCLA 1LEKA 3NFSL 2QADB 3QNYB 1AIFB 5EOTB 3GM8A 2WUBL 4HA1A 3PS6A 1KBPA 1A7RL 5HDWA 4YFEA 2PUQT 2IAMD 5B7FA 5AWNH 3RL1B 4PRAB 4DWHA 1ZLUH 3ZE1F 4WI8A 3VH8A 1RV6X 3B9KA 4DPAX 1INDH 3AT8A 3U4BL 3S8FB 1PZCA 1O75A 4RAUB 4IU3B 3V8CA 3ECQA 4PR5B 2NT1A 4QTHB 3DDGA 4YFLF 1CYXA 3QWRA 2IANA 5DMGC 3L3HB 1HKLH 1SXBA 4FQPA 4AEIL 1R0AL 2VJXA 2NY7L 1LD9B 4PBVC 2M26A 1X3DA 4KK6C 3MRCB 4NT6B 5GSRA 2VO8A 1PG7X 4OU3A 2VLMD 4L4TB 3ETBJ 3GKZA 3PREA 1J0JA 2WLYA 3L9RB 3P9LA 2IWKA 3MKGA 3D51A 3RWCB 1ET5A 5ANMB 3FTVA 1GS6X 5T1KD 4QYOB 3DHUA 1OAQH 1M1XB 1K3ZA 2Q7AA 5HYJA 2OJ1A 1NKOA 3CHSA 3KPSD 5DEJA 3VE0B 3BHBA 3TBCA 4FQ1L 1XVSA 5K39A 5IY5B 1D2OA 2DBLL 3UBXB 3EYFA 1IAII 1F56A 3MXWH 4AYEC 2UWEA 5D1XE 5BS0E 4JMXA 1ZANH 3CFBA 2VITA 3VVWA 4N2AA 4DKTA 4GQZA 4X6DE 2V7NA 5HP5A 3V0VB 2UY6A 1V7ML 5JLZA 5DRNA 1J5CA 3OKKA 4PBDA 3A6BL 3V0IA 4IIQA 5FOBB 1A5FH 1CLYL 4P2QD 4FNLH 7PCYA 1GZPA 1P5VB 1MFDL 1FUNA 2UZYA 4TV3A 4WI3A 3KPQB 2Z91B 4JW3A 4TM9A 3LVTA 3OR6A 3GHPA 3ARWA 4NOBA 3QI9A 5FFOA 3JWOC 5D7JB 5J12C 3U0WL 4FFYL 2BNQB 1FORH 2I24N 2QVTA 2VLRE 1RIVL 3QDME 5CGMA 1ED3A 2XIDA 4IMLA 4AENA 1N5AB 2ZJSL 4U1MA 3ET9F 1IFRA 2WKGA 1WP6A 2QPEB 4H8QA 4TNVK 5B8CA 4R5VA 5CLYA 5CEXA 3WFHA 2AVFA 4OFYD 2DLFL 1MRDL 5JIDA 3PGFL 4X5WA 2VMEA 2AJZB 3DJTA 3ESVF 1HNYA 4X6BB 5DHVH 1BVOA 2J6WA 4JFPA 2NPLX 1F6AB 3PUCA 5JXEC 1E4KA 5K9QI 2GFBA 4L8BA 1COBA 1WIUA 4J8QA 1KJ2L 2AK4A 5GGSA 3LZLA 1A0QL 2FLRT 3L95B 1CG9A 3MUJA 3MBEC 4UM9A 1HQRA 1GVIA 1S7WB 1QWUA 3QUMH 4U1KA 3D39D 3C60D 4L05A 2O6FA 5I1DA 4XN5A 3VFOB 2I32A 4PCTA 5DO8A 2NNAB 1CFNB 5KUMA 2BSSB 2W9EL 3BSZA 1JV2A 2J88L 3PDDA 4HP5A 3TPUB 5MERA 5CIPB 3U7YL 4KTGA 4PJFE 2DL2A 2VXUL 3RDTA 1U3HA 3JWNH 4P9HH 3T6ZA 1GMIA 1Q1JL 3LQAL 1JGLL 5D93B 5JHDA 4KKZA 3FPYA 6TAAA 4F91B 1T22A 2R83A 2VNCA 4NBXB 3QRGL 2HN7A 3P73A 4R4BB 1F90H 1UM5H 1TNNA 2ZPKL 5BCAA 5LCVL 1TTCA 1H9VA 1R5WA 4K9EC 3U1QA 1TZHA 3GEFA 1T7XA 3SKOA 2ADIB 5ALCL 2CLVA 3O4LA 3FTGA 3P4NA 5CEZH 3VXPB 4PRBA 2FYYB 4FLQA 4HIXH 1WWCA 2L3BA 3NJMA 1BSIA 4L23A 3QORA 3VM5A 3MLTB 1NEUA 1D5BB 4ZJ9A 3ZTJH 3ZUNC 2OTWB 3WTUA 3SQBB 1P9MA 5ADPH 2Y2TA 5D1XB 1LWRA 5BS0B 5HY9B 3JWNG 2EDEA 2X4NB 5IUSA 3WO4C 2X6CA 2NY0B 2XZAL 3E7JA 3ARDC 4G5AA 4M3JA 4PCYA 4Q14A 4X6DB 3NDZE 3UZQB 3WTVA 5I5IA 1SJVA 2GCYA 2DL9A 1DQLL 1AQKH 2IAMC 3I9AA 5J6GA 1RVFL 1LE5A 1ZA3B 1IQWH 5FWQA 3NJGA 4JFSA 4HWEL 4HH9B 3UTSA 4ONFH 4UTCA 1FV1B 4X7DC 2MWCA 1SGKA 1CXIA 1IC1A 5E9DB 3EO0B 1CD9B 2XWCA 1G1OA 1DN0A 2VLRB 3AS0A 3DROB 3L54A 2X0UA 3M8OH 4HWBL 3UYRL 4E5XA 1TVHA 1DJSA 2OMXB 2V3EA 1L5GA 3AS1A 1JMZA 2QPDB 1MFNA 4P0DA 3ZTJG 2XZQH 4ZZKA 3JV6B 2B1HL 4ZUWB 2X9XA 2ALWA 3QUZD 3QIUB 4TLTA 4OFPA 4WWKB 1FL6B 4BZ2A 4NO2B 4PSPA 1QHOA 1TKWB 1WUZA 2YZ8A 3HMXA 4LEXL 4LCYA 4M43H 2D03H 5HHMB 3VNZA 3Q06A 2ZXDA 2WPGA 3HN8A 4H2CA 3AU0A 5EO9B 2WN2A 4NERA 5KVGL 2PW2B 2OMBA 2RQEA 1Y0LA 2HFFB 2IQ9H 3S5ZA 3VFWB 1Q0YH 3NK4A 2ICEA 5FO8B 3DIFB 3UPCA 1UACH 2C4XA 3BKYL 2EVIA 5JHMA 3MJ8A 3O45B 5I15L 5FM8A 3ELQA 5KS9E 3LNFA 4DGWC 3P30L 1Q9WA 3ARFA 4HJ0C 4WSKA 4PRID 1TU2B 2W5PA 2NZ9D 4S11A 4N9GB 4OI8A 1FL5A 1SMDA 1JZ7A 3GIVA 4HYTB 4UWQB 4X8XA 5GJSL 5GS0C 1A7PL 1RIHL 4J3WA 1CVRA 4ZW6A 1N0XH 3SODB 3TFKC 4F9PC 4QPEA 4WU7B 1FAIH 2J6EL 5JNYB 4P06A 3KCWA 4P5KB 4OJFH 4QOKD 4BK5C 4OCNC 1HDMB 4U0QB 1A7OH 1D9KD 2BRQA 4DFHA 4W93A 5DS8A 2OMTA 2F0CA 3CLEL 3Q6GL 5CSZA 5F88A 1PX3A 1OLLA 3U6XA 3MLWL 4GAAA 4WUKL 4BZ1H 4UQCA 1DQKA 3P3UA 1HQ4B 2KZBA 2WSKA 3F5WA 3UC0H 2HX9A 5IB2A 2DJMA 1IGTA 2A74B 3BZEB 5KVEH 1AKJA 1UH4A 4NZFA 2EDTA 3RY6C 2HH0L 3CFJB 1G0XA 4QTIH 3D4GA 3QA3A 3QXDA 4AKPA 2P8PB 1RUQL 1DO5A 2VW6A 4MA7L 4OIBA 1ZHBA 2D7TL 4RZCA 1BAFL 1SVCP 2DYPB 2FECL 5G5DA 2JVUA 4OLZH 4ZFGL 2HCZX 4Y2DA 2ADGA 3WY1A 4H8VA 4W81A 4ZMPA 5C0FA 4KROC 3L1EA 4IW4C 3FSOA 5F2FA 5HI3D 4YLCA 3FULA 5HHOE 4P2OB 2OXGA 4NUJA 3RI5K 3CUPA 5J57B 5SWSA 2BZ7A 1A3RH 2H3NB 5I73B 5DVLA 3RFZA 4P4RB 3K46A 3TA3B 3ARBB 3UXFA 2D3NA 1GKEA 4DO6A 5FECA 5GIRA 4FQ2L 3SDCC 4GBXD 4QEGA 5BZWB 2QSQA 3MROB 2ZUUA 3WDIA 3WHE0 5IFJB 3PWUA 3I50L 2YUWA 5DD3L 4W4OC 1Q38A 3PJSB 4H25B 5D2NE 4BD4A 1S5HB 3DK0A 3D52A 3GHEL 2H3KA 2BXYA 3DYOA 5EU5A 1SY6H 3IJYA 2I5YH 1MIMH 4NAMA 3H4HA 2G3ZA 5ADOL 1MHPL 3FSWA 1Q0XH 4JY6B 2BVOA 4ZO7A 8FABA 3TF7C 4GRWF 1DDTA 4HF5H 5TE6H 4HC1A 4MD5A 1Q94A 1GPOH 3NFPA 3EOBA 3QWRD 3L4WA 5BMFH 2WYZA 3T3ME 1NM4A 3K3QA 2QR0B 4JLRB 4KOCA 2VLJE 1W9XA 4LMQE 4CUCA 2OW6A 3R06B 5DD1H 4I1PA 1ZHKA 3EJQA 3OKYA 3GSRB 4J3BA 4KVNL 5LXGH 1QA9A 2XXCB 4ZTPL 2CAKA 1E7VA 4ZUVB 4ADGA 3NACL 1NTDA 1A4KA 3O6FA 3JTSA 2I07B 3K6FA 3OBAA 2BVTA 4O51A 5I1IH 5KSBE 1K8IB 5HYJD 1FCCA 5FAAA 3U4AA 5E4AA 2FZ3B 3L3JA 3LIZH 5DQ9A 5J1SC 3PNRB 4ABQA 3O6LL 1EK3A 4WFHE 1PFOA 1JN6B 4RGOH 2JKJA 4PJAA 4FXKB 3WS6C 2CNYA 5IVXA 5HGDA 2H6PB 1M05B 4JRYB 3W1ZA 5HI5C 2CDGA 1JIBA 3CZEA 3IFOA 5E4IA 2BC4A 4EJ1C 4H5SA 1ZSHA 4JHAL 4ZUUA 1E4XL 4OJCA 5IK3A 3ERXA 3PQYE 4E0RB 1MUJA 1SYSB 1ZV9A 2K1MA 2MJWA 4D9RD 1P6WA 4JUTA 3VFGH 1MW2A 2H1XA 3P9MB 3U36B 1L0PA 3MA9H 4JKNA 3DK2A 2FNWA 5G4OA 3SE8L 3O9WD 3QG7H 3MCLH 3IS1X 1KT2B 1PZ5A 4MQTB 4MQ7A 3ZBMA 3QI9D 2W9DL 2MKLC 2QZQA 4GKNA 4L48A 1SJEA 1I9IH 1TYJA 2PYEB 4C4KO 1V10A 5EBGA 3QUYD 5C3LD 3ARYA 1RZ8B 3H9ZA 4N0FA 3IBEA 1ZV2A 4G59C 2HLAB 4EQ2A 4PY7A 2A83B 1HS6A 2YWZA 5KJ7E 2PABA 4YR6A 3VFPA 5HHOB 3PL6B 3RJDA 5LJYH 1IM9A 4Z77A 1H3GA 2E74C 2LLLA 3FO0H 4KAQH 1JNLH 4L8DB 3E2HB 4J8RB 4JZJB 2AK4D 2DEYX 3LN4B 1UD4A 2NZ9C 3C5JB 3F85A 4PJ8A 4E9TA 4ERSL 3SEPA 3CFDB 5E2VL 3P2TA 5F9OH 5T1DL 4M7KL 4UOW1 4UM9D 4XBGA 2WWOA 3DO7A 3OLDA 3NSXA 1OSEA 2EDYA 3KPRA 4R0LA 4WUUE 5ELIA 1E50A 4I0KA 2EC9U 4XWOD 1QFWM 5C0EB 2IDUA 4MX7B 4R90H 1QWNA 1SLWA 2FQDA 2HLEB 4Q6KA 4B27A 3GBEA 1TEFA 1JHLL 3VXUA 4QRAA 3HJEA 4AK2A 5IIEB 2NY6B 1R24A 2E76C 4NKMA 4ODSH 3G5VB 2BOLA 3KYKL 1XBDA 4Y1AA 3MJ9A 1MSPA 4KXZH 4O9HL 1E42A 2O4EA 3RDTD 1U3HD 4LCWE 4WENB 2DI8A 3L7EA 4MZ3A 1HYRC 2VC2H 3A22A 5EBLB 1S5IL 3GBMH 3QEUA 4YE4H 1ETZB 2EDQA 2XBTA 3K1DA 1KNOA 3NJVA 3QC5X 5H4ZA 5C0DA 4X9GA 5TDPB 2Z64C 1GZHA 1P7KB 3EGDB 3QPXH 1ETB1 3D7PA 4OLYH 4WI9A 5FO2A 2XY2A 3CLFH 2XTJB 3T2PA 3NA9L 2R2BA 5F9WB 3TA4D 5LWYL 1IGYB 5FLVA 3W2DH 4J3SA 3NCXA 2XG5A 4KRPD 4UM8A 1Q9OA 4YGAB 5IREA 2WXHA 5FKAA 1X5AA 2F53D 3DOIA 4D0DA 4N2CA 3V6BR 3O4LD 3QNZB 4QMEA 1S9XB 5KSBB 1HSAB 1IAKB 5IWLC 5HI3C 1TQWA 2D8KA 4RETB 2A9NH 4OZIA 3ULUH 2AGJH 3OHXA 3QORD 3ULSB 1OCCB 3OGOE 4NO0A 3SOBH 2VDPH 2XFXA 2N3JA 1LDSA 4ZW7A 2GI7A 5IW1B 4GBXC 3BPLC 1TMQA 5C0CA 1ND0B 3GLDA 3SGKA 3TWCL 5E8OB 1BFTA 1WZAA 4OD3H 4OM1L 5DJAA 2ZUWA 2CIIA 1U8QB 5E00B 3PWPE 1FIGH 4WW2A 3QUXD 5ABZA 3VI3A 2WWMD 1E4XI 1HWHB 3D09A 3VFNA 2WXOA 2YSSA 4Y5VC 1U30A 1Z9SA 4GSQA 5HPMA 1HVXA 4BE6A 1OKEA 1RK1A 1OY3B 4WTZA 4G5ZL 1JZ4A 3ZYZA 2VDLB 1FA4A 3GSUB 3GIZL 2B77A 2ESVE 3MMEA 4YJZL 1JRHL 2AXFA 1ZK5A 2EEXA 2DQFA 5KAQG 1LK3L 5JA9A 5IV2B 3VW3H 5I8CB 4NUPA 3NIGE 1GGBL 2X4QA 2ISDA 3PIQA 5FDWB 4MD4A 5D6DA 1S7SA 2OPCA 4XAWL 4D0CA 4EDXA 1KYOK 2MEJB 3CDCA 2HT3D 3U2SB 1ZPUA 2V2XA 1UXWA 2LT9A 4S1QL 3RX5A 2APXA 2LOEA 4PJHF 3RI5F 5I24A 5DQDL 5EB9A 3PV7A 3D87B 1RPQA 1DVSA 2ORBH 4LIQL 4RISH 2Y36L 4JGUA 1MI5A 4K23H 2VIRA 1U8CA 4LL1A 1NCUA 4KPHH 5DO2C 2W88A 3GGWB 3MTXA 3JVFC 5DQJB 2JIXA 1JWSA 2A0LD 3ARFD 1OCWH 3FQRB 3DXAE 4NC1E 4Z7UF 1JYNA 1UB6B 3SDDD 1DTUA 3KYMB 1JD7A 2CRIA 4PWGA 3T6XA 4YSSA 4B7IA 2DDQH 5GXBB 1GTFA 2GEQA 5TFSL 5IJCC 1F00I 4OFVA 4HK0A 3FT3B 3HE6A 3D2UB 1RIUH 2Q3XA 3EJJX 5C07D 3I9GL 5L2KD 2ZYIA 2Z6FA 1FNGA 4WTXA 4HXAH 2VDMB 4QRQA 1U42A 3CD4A 4U3SA 4AL8H 5K9KB 5FKPA 2DB8A 3O9WC 4XBEH 2Z8VC 1FC1A 1IARB 1JGDB 5C0BA 3SDXB 3QUYC 1OVZA 2FIKB 2J5LC 4CSTA 5DA0B 4Z7AA 5HD8C 3NN8A 1J7VR 3ATEA 3KH3A 3HUJA 4LSTL 1NCGA 1DBJH 1AANA 1AKJD 4FI7A 1ZIAA 3BT2L 5F7KC 3WMQA 3ZL4L 2Z31D 1A6AA 1ZLWH 1CIUA 1SXCA 2CJSA 5EUKB 4CSZA 3O0RH 5FGBA 4YHYC 2HX8A 2AW2A 2IH3B 5IF0B 1G9MH 4CKQA 1PZAA 4GKZA 1SF5A 1HKFA 3CX5K 2Z9TA 4YHOL 5BO1H 4PJ5E 5KTEH 3LKQA 1P5UA 4IKIA 3CK0L 1QLEB 2B3RA 2D4FA 4Y16B 1GYUA 4PP2B 2I27N 2W60A 1K6QH 4HIIA 3VYPA 2VXSH 4LEEA 4AXWA 4RFEA 5AW1B 4XWOC 4ANUA 1KEML 1MREL 1FH5H 1D7DA 4EN3B 1I9EA 1ILSA 3UZEA 1S9YB 3S97C 4X4YB 1SQ2N 1QBBA 3IKCB 1ZD6A 5SWSD 3WIFB 3W5NA 5INCA 4J2XA 5HDQH 4HEPA 4QR7A 1NH6A 3ZZ1A 3A67H 1FLRH 3HN3A 4LLYB 4URTB 1L3NA 4OFKA 4FHKA 3CBJB 3LZFH 1MLBA 2Y2YA 4YPGB 2VDRB 3G5WA 2DYRB 3UBGA 1C5DA 4FULA 2YD1A 1X9QA 2TSAA 1G7IA 5K5YA 3K71B 4DEUA 4KZDH 3OKOA 1GGCL 1ZSDA 3EJYC 2ICWA 1MPAL 1NFDA 4NFBA 4RFOH 2VDLL 1S9WB 3WFBL 4NFDA 3QZPA 5DHEA 1JRHI 1ITBB 3NIGB 1H0DB 1H3XA 1RPKA 3AU1A 3EDJA 4H0LC 4HUWB 2G5BA 4KKLC 5C8JB 4HLJA 1JYWA 2I9LA 1JPFB 1X5XA 3PPEA 1HH6A 4WCYH 1OSPL 3IDMB 3SDYH 2M2DA 5D1QA 4Q4EA 4G6JL 2A2QT 2H1LM 5GRZA 3BW9A 4CADB 1JNNL 1RUMH 3KYNB 3OM3B 2YN3A 1KOAA 3LNIA 5B4MD 3S35H 1BVNP 4HS8L 4UOZA 4HX1A 3BAKA 1E5UI 5D8JH 3RWFB 1CFTB 3VO0A 5JORB 1D5XA 4GSDL 1CLZH 3O6FD 3DXAB 1OCZB 2UY7A 3U4EA 3CFUA 1UGNA 2XCMC 1DBML 2ZXGA 4I89A 4PRNB 3GJFK 5E8NB 2UYLA 3WJMA 4BQ9A 4U6TA 5A43C 1GAFL 4GUQA 5DXWA 1NFIA 1JPTH 2YA2A 5F6HI 3GSNH 3HPJB 3CVHA 4ZW8A 1MZYA 4KTEL 3QUXC 1DQJA 5F44A 3NZ8B 3ZDXE 2TRHA 5FXCH 5DWUH 3DSNA 2LFGA 4YSRA 3P4MB 4JG0H 1J05A 5DHYB 4ZD3H 4G43B 3VAEA 4GP8B 1OT1A 5EZOH 2VDML 4P46B 5F9JB 2Q8AH 3MR9A 1J5DA 4XX1G 2ZT9C 4AUUA 4JFHE 2QL1A 1SN0A 3GEWB 1R3HB 5J7CC 1C7SA 1JK8A 2YEVB 4KY1L 1ZS8A 3VXMA 1RKRA 2J1ZA 1P69B 3ASNB 1DANT 3MREB 5BQ7A 5ILTL 1J9RA 1OGPA 2I7SA 3KPTA 3HZYA 4P5SA 1KB9J 3GRWH 1T89C 3KHQA 2JJWA 4MWFA 4JQIA 2CK0L 2LGNA 1RJZA 1OAXH 5TDNB 2WD0A 2FBOJ 1IRAY 5L8JB 5J11B 4KI5D 3FB8B 2B0SL 4M56A 4U1GC 5I1HH 3ULVH 3NH7H 4ZOAA 4OZGB 3UP6A 2LFEA 2UZXA 3P4LA 4LSPH 3UCRA 4NP4H 4HDIB 4FFWD 1IM9D 1TJGH 2GSGA 2HRGA 1GA2A 4RIRA 3IFPA 2BK8A 4UTAH 1Z5HA 1T1WB 1NEPA 3MV7A 5JIHA 3U30C 1XR9B 5A1AA 5ACZB 3O3BA 4PJ8D 3SDDC 1FFNA 4LEOB 1JGVL 3OWEA 2WB7A 5IFAL 3V5KB 4IRSA 2VDRL 4PGJA 3DX7B 3KPRD 3RA7L 1KWKA 1MCRA 3QO0B 4MKMA 4RFNB 4GIOA 4FABH 4A38A 3GXTA 4IJ3C 4NZDA 1IEAB 2L7UA 2XJLA 4HFUH 4KKCD 3C6LB 3QCUL 1BD2E 5C2BL 4M5TA 4AYFB 4Y1AD 2NXZC 1N6UA 2J7LA 2LU7A 2X6AA 2GABA 1BGXL 3IXAA 4I3GA 3ZDYE 3FO1A 1L0YA 1R17A 5I16A 4U1LB 1V3JA 1ADQA 4BZYA 2VXVH 5EO0A 3C87A 2X4SB 3FFDB 4Z7IA 3G6DH 4Z95H 2G3XA 5FB8A 1KEGL 2Z31C 3FS9A 2XVKA 5JQHC 3E8VA 4I4WA 4Z5RA 2A6JA 1HC1A 3H9SA 1ZMYA 3L3KB 3FW6A 3FCTB 4A04A 3D3VE 3OSVA 4DOHE 3FFCE 2GB2A 1NAMB 3WFDL 2AZAA 4XNZC 1NBVH 3CH1B 4LHUG 1MNUL 3F7VB 1JHKL 5GZOA 2ATKB 2QDVA 5AOMA 1E9QA 3DX0A 1HE8A 3MDJA 2K7QA 2XV0A 3IAQA 3BP6B 1BM7A 5T33L 1LWJA 2EDBA 2ITCB 4NQXB 3ELAT 5L4FA 2FJGA 1FQ9C 1DLFH 3VWKA 2P5EE 3MRKB 3P9WB 2WLJA 3PFQA 4PSRA 4PJEA 4D9QE 2B1AH 3ALXA 1ES0B 3QW9A 3MYJB 1IGFH 1RZ7H 3MCKA 1WBZB 3K81A 4JFOB 1SHWA 4TQEH 3VWJC 3FB6A 1PU0A 3HZMA 5L7XL 1A6ZA 4HJGA 3CFEA 2DICA 2Y7LA 4J3OD 2Z92A 3CPLA 5DUPL 5C0CD 1A7QL 4LPWA 1YEKH 3VRJA 2R56L 4RMBA 4XNBA 2J8UE 3QBTB 3QCTL 1R5IB 4RZKA 4WEBH 4YLBA 2XQBH 1T7WA 4OCMC 4AEEA 1EXUB 2FB4H 3GBLA 2LTQC 2HVBA 5EU6B 1XEUA 5FYKE 5IJVB 3MRPA 4MHHG 2ARJB 4WO0A 3W5MA 3B5GA 4QHKI 1HSBA 4KY2A 5C3IA 1OWWA 3IFLL 5DR5L 5J4MA 2YJLA 3G5ZB 4JDZB 4XO4A 3LKPA 1MVUB 5BJTA 2OR8A 4KTDH 4PRDA 1BXXA 4GRLA 4NQTA 5MHSD 2A9MH 1F1GA 1H5BC 4AQ1C 2W81C 3WKMH 5H2BB 4XPBL 4DUVA 3HC0A 1CT8A 3HAEA 4P4KA 1UD6A 3O4OC 3M1BA 3QJFB 4JKKA 2VDKL 5K9OB 1DJXA 3ZHKA 2MSPA 5DA4A 5CEYA 4L1LA 3DVFA 2YA0A 2CRZA 3B3IA 3V9CA 3VMNA 4ABWA 2H8PA 2VSCA 4H1LA 4O02A 3OR7B 4TTDD 1KCRL 3JV0A 1VGKB 5DI8B 1AZUA 2RHEA 5CNHA 3B2DC 5C7XL 1I85C 1NGPL 3FRUA 3C5SA 4PU2A 5LBVA 3PWVA 3PF2A 4XO9A 5HYEA 3L4ZA 3O8XD 5DJ8B 1OAZL 2DLHA 1OW0A 5JIKA 1BD2B 4XPFH 4KK9C 4WKZB 3WJLA 2JIXD 2LVEA 1YECH 3LV3B 1K4DB 3SJVD 3OQ3B 4N86A 1ZTXE 4X5RA 1WJ3A 1NIAA 3MFFB 3PV6B 3BSGA 3F7LA 4NRZA 5EZIL 3HE6D 2WVVA 1XL4A 2CDFA 2E46A 3FQ2A 1BFOB 2EC8A 2MCPH 4HPHA 5AB2A 4F15C 2AQRA 1WICA 2AXGA 3QO1B 2YS4A 1EJOL 3M7OA 3BKCL 1FNFA 3BDYH 4JPKH 3QK0A 5AAWC 1XMWA 2P8MA 1A1OB 2AJUH 4HUXB 4D8PA 3T3PF 3CHXA 4PRPE 1YEIL 4DOHB 1FFTB 2J12B 3GTNA 3M46A 4OZ4B 4NWTH 4EIGB 3JVGC 1NAML 5EV7A 5C0BD 4KI5C 1BVLA 1WWBX 1QASA 3TEYA 1FZKA 5FW8A 5T1JA 4HKXA 1JJUA 4BWWA 2BP8A 5GGTA 4IMKA 1YEDB 3ECBB 4NBYB 4ZXBA 3MLZH 1WA0X 2NTSP 3BIKB 5DTFB 4KHXL 5CHNB 1IGJB 1H8OA 1QFHA 2QQLH 1EDYA 5I5JA 4KI5F 4Q2ZA 4PV1C 1YMHB 2WZAA 1WT5C 4PB0H 1UCTA 5IHHA 5ESAA 3HZ3A 1BZOA 4TNGA 2PP7A 3LQMA 4GLRH 4UMSA 4BWTA 2DQEL 3L08A 4HOWA 4X42A 3L3GB 1TR7A 1U8IB 1ZCRA 3ZVVA 2IPKA 3CC5B 4GQ9L 2KC0A 3S36X 5DC4B 2FH6A 3RU8L 2F68X 5HYSA 1FBIH 1Z9PA 1K2DA 2EXYC 2CGRL 3MNDA 5KSUB 4KHTL 4MJ5B 4LOFA 5B21A 4ABUA 5I76A 1AHMA 4ZPTB 5EU4A 1BYNA 4NENB 1XHHA 2OX5B 3IAPA 4ACTA 5KJRH 3IVKB 3CN2A 1YAZA 4XP1H 2R69A 1RZJC 1MJ8H 2X4OA 5FGSA 2OMUB 5EBMA 4DP7X 2N7AA 1ASOA 1VENA 3FTWA 1X6LA 3PGCB 5D70H 4MXVE 3PP4H 2P5WB 3UTZB 5LB1A 2E9BA 3C6SB 2AJXH 1F0LA 3UTPE 4HHAA 4Q9RL 4W9LC 4O2EB 4DP8X 3JUYA 5DLLA 3D25A 3QXWA 2QKIA 3CDZA 3Q13A 3S4SA 3KM1A 4CVZB 3KXFE 3D48R 5AW6B 4KWUA 4F7CA 4K5OA 2R23B 1IFHL 3MN8A 4FYQA 3ETBF 5D1QD 5DURB 2VXTL 5EIIA 2Y3AA 1U8OB 2XVGA 1A8JH 2HJLA 5J13C 3MBWB 3HC2A 2B2XL 1DVFB 1IKOP 1D6VH 5LO7A 1WA2X 3QHTC 4AH2A 1DVQA 4LLMA 2B4CC 2PW1B 4JFFB 1P84J 5I0VA 2VM3A 2EJ1A 4J3OC 2AMUA 4GP5B 1NCBL 4PPTA 2WQRA 4KUCD 4OZIF 5EZLB 4B9CA 1U92B 2IXQB 2OMWA 3IWVA 3HC3L 4OH2A 3PWNA 1R3JA 5EC1A 2HUHA 4NN6C 1KLFB 1NLBL 1PG7W 2GITB 2H0FA 4H20L 4Y9CA 3REWB 2MQGA 3S37L 1W72H 1KJ3L 2BVQA 5DFTA 3THML 4J3OF 1EMTL 2BCMA 2BJML 2P42B 5ITFB 1ID2A 2ADJB 3H7BA 3EOTL 3C2AL 4W9DC 3SQOH 3U9WA 1AD9B 1MCEA 1AHWC 3JTTA 2J43A 4U6YB 4BRJA 1UQSB 2DLGA 3MJ7B 1ZGLB 1CBVH 5KBDA 1URIA 1NOAA 1N67A 4X6CE 3VI3F 4U1SA 2FSEA 1LMIA 4M6OH 3AFLA 3TZVB 3BE1H 1KV7A 1NJ9B 2XLLA 3LCYA 4FYRA 5E6RB 4RMRA 1PSKH 3VXMD 5ID1A 1A02N 3QQ4B 1DVUA 3QEGL 2VM4A 3DV4B 3AREA 4ZFOB 3ILPB 3MAWA 4M48L 3PNWB 3RTQB 5EZJB 4N26A 3G6JE 1C5BL 5CMAA 4A39A 3GI9L 2V9TA 1CUOA 3EGSA 4ZFQA 4Y5XB 3UYPB 2DV6A 3Q3GA 3ZO9A 2LQRA 4QHMB 4RESB 2JKIS 1U41A 1I7RA 4JZNA 2KI6A 3FF7A 3U7WL 4C56E 1PG7L 1OSZB 4NO3B 4OAWB 4RGMB 1VFAA 2HKFL 4XXCC 2X40A 1OP3K 2PP9A 3HPLB 2AJ3A 3C8HA 4YHNA 4B9FA 4DK5A 4LXFA 2IDFA 3O8XC 2HJFA 4YDVA 4W9ZA 2FAUA 1P2CA 1CTNA 3X3GL 2F1BA 3MV7D 4LLAA 4Y4KB 1HTYA 1XV8A 5F7BA 2A1WH 2DLTA 1CE1L 1IIIA 5FYKL 4OQTH 2ALAA 4G6ML 4K7FB 4IRSD 4YX2L 2FEDD 4HBCL 2E7DA 5H37A 1YPZB 4Y7MA 4K8RD 1T83A 3AC0A 3D4CA 3HG4A 3FH5A 4G8FA 1Z9OA 2O1AA 3VB9A 4LVNC 3CSFA 3P2DA 3TEUA 3V4UH 1ZVSA 3ROOB 3KXFB 4LVEA 1PYWB 2H45A 4FG6D 4GAFB 1TSRA 1PY4A 5I0XA 3PXHA 3K6SA 2H0JA 4OSUH 1CR9H 3BZDA 3MXVH 2CD0A 4ES8A 4G7SB 1DN2A 5JIMA 2H0PA 4U4IA 5SX5H 3F2LA 3B2VL 4YIQA 3UMNA 2GJJA 3D50A 4FTVB 1DCEA 1AR1D 2AQSA 3MX0A 4BH8A 3H9SD 3OJ2C 3WY4A 1ACCA 1XBRA 1M1SA 3OKDA 1I53A 4E9VA 1CDHA 4ZOEA 4GAYA 3HUJF 3O3DB 3Q6FA 1B0GA 2ICCA 3ARQA 4NKIL 1PJ9A 3CXHJ 4GIPD 3N5AA 4UB0H 5E1AB 3IXTA 1F2QA 4MNQA 2CPCA 3D0VB 5GZOD 2EIEA 2GTZB 1YEJL 3U2IA 3BAIA 5I18L 1KLGB 3VWKD 1SM3H 3KLLA 3TBVB 5HPOA 1ZTXL 3O6KL 3BN9C 32C2B 4NM4L 4HJSA 2NQDA 1N6QL 3F8UB 1KTRL 1QUNB 4DUWA 5BZDA 5HHXL 1E28B 3LVEA 1YYCA 5DJ0A 3IJHB 1KJVB 1TJMA 4L8SC 4GG6A 5IJKA 3MPCA 2DI7A 3V55A 1F13A 2ZYSA 4Z76A 4I48A 1KDIA 1ANUA 3TN0C 1KCSH 1RZQA 4YSTA 3UGXA 4OGAD 4R4FH 4B3VA 3FQXA 2W8CA 3F83A 4PJCF 1J9SA 2XQYK 1A2YB 4YQXL 1SMOA 2PCFA 5DT1H 3BH8B 2OTPA 3L9BA 1RUKH 4PY8I 4ZFOL 1AOHA 3G6JB 4M1DL 4NNPL 1M71A 3GBNH 4N2KA 3IGKA 2DWEA 3FQTB 4M8UA 1KPRA 4Q74A 4XH2A 1NFDF 4M02A 3G5YB 2C9PA 4Y4HA 3UTQA 4IOIA 3RKDD 4IRZH 1GOHA 1KBGL 2P7TB 1KLUA 1L9SA 2XPYA 4JM2A 4M7LH 1U95B 1R3KB 4P07A 3CPUA 4XWGL 4W9IC 2ZOOA 4P04A 2VN5A 1NGWB 3K6NA 1N3NA 5KBLA 1DFBH 4P4KD 3KEDA 5CN1A 5FA4B 1P1VA 2V9RA 4OF6A 4PJDE 2KS0A 2O6CA 1FO0H 3KVPA 2EICA 1FVDA 2Y06H 2FEJA 1H3TA 1XD0A 4RNRB 1SF3A 2OSYA 4FG0A 5CCKL 5GS1B 3MLRL 3AUWB 4JCWA 3L48A 2B5IB 4OZFA 4AYID 2QZ5A 3PHAA 1U2CA 4DVBB 1A9VA 4LSDA 4F7TB 4KUCF 3K4DA 3MLVH 5C70A 3BD5A 2WQSA 1MJ7H 4M3KB 4WWNA 4V1DA 3TX4A 2F8VA 3OG6B 4ODUB 1MFCL 4FN0A 3QYMA 4NO5B 4MXQC 1BX2B 5E8DH 1ZLUK 3VNYA 2VUYA 2PYFB 1EFXD 4YSEA 3TO2B 5EU7C 3OAWA 1ZKAA 5AW5B 3MGOA 4U1JB 4G11A 2EE0A 4W9GC 4HIEB 4XCFL 3VXSD 5E2JA 3W0WA 5J9PB 3PAYA 4NCC1 1FVCB 2OI9C 1HHHA 4Z7QB 6FABH 3T65B 2CH8A 5LVEA 4LBEA 1HYSD 1CU4L 1PJWA 5D7LB 1DUYB 2D31A 5K1JA 1BZ7A 2G5RA 1E5ZA 1N0LB 1NMCC 2O5YH 1CGWA 2ADFL 3FQ1A 4FFYA 5FUCE 3ZMNA 5DMKA 3RVUD 1UATA 3R0MA 3RL2A 4JUSA 4L18A 4NJAH 3X12A 5IR1B 3EHBD 4N8VA 3DDFA 3H9YA 4K4KA 3IF1A 4MJIE 4LDOB 1LO3L 2CIKA 2R2HA 4ZXBD 4B9PA 3DMMA 3CZGA 4FDWA 4PWEA 1CDBA 4AI7A 4F1ZA 2WUCH 1J1OL 1IKNA 2ZWZA 2EADA 2NY4B 2SEBA 3MRHB 2VLLB 3E3QC 1RULH 2CNZA 4PJ9A 1MAML 3VFSB 3MSPA 5KOVC 4NWUH 4ELKA 2WKOA 4K8RC 1AIFA 1ZT4A 4HUMB 4OD2A 4PS7A 3GFUA 5B1JC 5JW4N 5L2JB 4PS4L 2OAAA 1T1YA 3QJVB 4KXCA 4A68A 4CC4A 3QWNA 3X2QB 1KTCA 2BY3A 4JY4A 3BI9X 4RMQA 5F1SA 5I17B 3RL1A 2J2ZB 3IU4L 4HV8A 4FNTA 1OEZW 2B08A 3EGXA 1CDJA 2L4OA 4NLHA 4X8GA 2Z4QA 2KERA 2G3MA 3V4PH 3KCPB 2A4CA 2DTMH 4PR5A 1IAIH 3NCMA 4JKMA 1TTGA 2HTLD 2O5XL 4Z8FH 2YAEA 3BFQG 3VGAB 1QSEA 3G04B 4G8IB 5F70A 3UCQA 3RGVD 3V0FA 3MRJB 4EI5A 3MRCA 3KPMB 2HT2D 2OL3H 1N59B 4F20A 1O5DT 3GK8H 3L9RA 4PJDB 3WGVB 2JJSA 1EDQA 1JL8A 1NCAH 3EYSL 1TTAA 5ANMA 5CLTA 4YSPA 3MLSL 2HP4A 1UWEL 1NCNA 3EO9L 1MFMA 3NAAH 2IAMB 2P43B 1G7MB 1KXQE 5EUOF 4YWGH 2EE6A 2IOOA 3EF7A 1ROWA 1BMZA 2EVHA 1EDHA 1ACYH 1YJDC 3WSQH 4A67A 5L0QB 2R29H 4Z7NF 5A2FA 3V4VH 4DKEL 3UJIH 2KLTA 4EUPA 3HG0A 1JCVA 3LRSB 1N9PA 4U6VH 4M6NH 4N2MA 2VABB 2VXQL 1JF1A 3H53A 4OGAC 1PLCA 4K2UH 5IB3A 4FE9A 1OANA 4UT9H 5KYWA 1HX0A 2ZICA 5HDBF 4M4RA 4P2YA 3KW8A 2A3TA 3WFEL 2XTSA 5FOBA 1S3KL 4XXDA 4UZGA 1P5VA 3H3BC 5K33A 1KULA 4OKDA 1S7QB 4P3DB 2C9SA 3NFSH 2MHAA 4BGDA 4Q8BA 5K9JL 5GGVL 3U83A 5T1KB 3SE4A 2WUBH 5G4NA 2XOTA 3BDBA 3KPSB 1A7RH 4LVHC 2VZ3A 3AZUA 4N90D 1NIFA 1FN4B 2QQNL 4BKTC 3ARED 1X5FA 1S7VA 4HOXA 2NNFA 4NPYB 3U4BH 1JG9A 3EW3B 1CFBA 2NUTA 4G42A 4P2RD 5DD6B 4DSYA 2ED8A 1F6AA 1QG3A 3TEZA 2WINA 4QWWD 4Y9BA 4YDLC 3BEVB 1FZMA 4YFLI 4AEIH 1RZKC 4WU5A 1R0AH 1PMYA 2NY7H 4YGVA 4HKZB 1IU1A 7CGTA 2FD6L 2YEQA 3HLAA 3OGCB 2WLMA 5B39B 4OJEH 4P2QB 4FFZA 3GMPA 3B1TA 4A2LA 2NYYC 4QY8A 4IBUA 1AGCB 3HA0A 2IADB 1LEIA 1OTSD 1TFHA 1FVEB 3DGGA 1KTLB 3UROR 4MAYA 2XWTB 3X11B 1MY5A 3SBPA 1M53A 2CGZA 3TBYA 5JOPE 1YO4A 3L3OB 4FQ1H 5TF1L 4CAGA 2DBLH 3RVVD 1M7DA 3N91A 3QIWC 1KY7A 4KRNA 3WNNA 3CVDA 5B38A 4F5CE 1KIQB 1CYWA 1PBYA 4P05A 2XQ0A 2YFNA 5KEZA 4GEIA 3BWUC 4XN7A 4AGOA 3DX9A 2PPEA 3FU0A 4UQAA 2A5UA 1V7MH 2YPKB 4JREB 4DP2X 5F7YC 5E6IA 1JNHB 1Y07A 5KVFE 3K8LA 2HG0A 4NUGL 2BCKA 1JS4A 2J8OA 4PGDB 2ADIA 4NHUB 4PUBL 2I60L 3A6BH 3C60B 3BMVA 4NUQA 2WCPA 3WUWG 1JYVA 4ZPVB 1CLYH 4GI9A 4F7PB 2ATPA 2CPUA 3VSVA 4H8WC 2FYYA 1U4FA 1MFDH 1J18A 5D7EA 1BZ9B 1MCJA 1UD2A 5A2JH 2IWGA 2ZUTA 4ZRGA 4Q58C 4HS3A 3LOWA 1OALA 1IAOB 1B2YA 3U0WH 4MMXC 3TO4C 5BOPA 1MWAA 1MNNA 1RIVH 4RMVA 4MNQD 1HHGB 2ZJSH 4MA8L 2R7EB 3R7RA 2PR4L 2G9HB 4DZ8B 3HR5A 2DLFH 4GRWB 4MMZB 1MRDH 5GRXG 3PGFH 3FUJA 4JL2A 2YPVA 3B2PA 3KR3L 2MNUA 3QNXA 5EU3B 1LO2L 4TNEA 3O0LA 2CO7A 3QH3A 1EEYB 1NDGA 2ZAIA 2ZG2A 2ZP0T 2ITDB 1UVQA 2PNDA 1KJ2H 2QTEA 3BPCA 1A0QH 4N0UA 1HHIA 2P80A 5D1ZA 5C0NC 2F74B 2BVUA 1J8SA 1UT1A 4NBZB 4ZSOA 3HG3A 5CEZE 4N1HB 5E9DA 4QAMB 2Y22A 4OZHE 2HTLC 5EHFA 5PCYA 1OF0A 2X42A 2Q6WB 3DROA 5I9QC 2CQVA 2W9EH 3RGVC 2J88H 3HOGA 1H6EA 3NIDE 3U7YH 1ZT1B 3JV6A 1UB5A 3UPRB 3IDYC 2BH0A 3SBQA 3OKLB 2VXUH 4XBPB 3IGFA 3MOQA 3IDJA 5AENA 1FL6A 3OHMB 1XIWD 2R39A 3GD1C 3Q43A 3WY3A 3LQAH 1Q1JH 1JGLH 5DZPA 1XF4B 4XN9A 1O7SA 3LRGA 3QRGH 3LEVL 1EGJL 4GW4A 2LU5A 3JTBA 2EEBA 2ZPKH 5HHPA 3IE4A 1OM9A 5LCVH 1NEZG 1A9EB 2IGFL 3TCXA 1FC2D 1PVHA 3HS0A 2OSWA 2N7SA 2W9LA 4I0CC 5ALCH 3U1PA 1E6JL 4B53A 3CU7A 3VG0L 5DK3A 4ILDA 2WXFA 3MLXL 5MEPA 2VR3A 1HOCB 2OV0A 4IRJC 1T5XB 5HYQA 5IHUL 3CSYA 3O41B 1OT2A 3SYAA 4XPHL 4E9XA 2BHFA 3VGFA 4XC3L 3QUZB 3H9HB 3ZDZE 4V1DD 4R96A 4F24A 2CG9X 3P02A 1AMXA 3DOSB 4BELD 1XH3B 2XZAH 4YXKL 2IANE 2HKHL 1NMBL 1MF2L 1FE8L 2EZ0C 4WJ5B 2W1NA 3PXLA 2E47A 3UOAB 1DQLH 3OAUL 4ZNCD 3QYCA 3JYCA 2WLZA 3FF8A 1RVFH 4A63A 4XTRD 3RAJH 4L3CB 3L5WA 1RERA 4HWEH 3V52L 4ZMXA 2L04A 2OBGA 4BCXA 2FGWL 4TSCL 4B9GA 4CJ1A 3PAVA 2WQUA 4M93C 4TSAL 4XN8A 5AEAA 3B3BA 3NVQA 1Q9KB 3I02B 2HFEA 2IV9A 5C08A 1G7QB 3NGBB 5HYJE 2C7UB 4I9WE 3UG3A 4QO1A 4HWBH 2JF1A 2LV4A 3UYRH 5KVMC 3EAKA 3VFUB 5IBUB 1P4UA 2F7QA 2FEEL 3L1FA 4QOKB 3KYAA 4ADJA 2B1HH 2H32B 2Y1VA 4PJBA 3UBXG 4GFTB 2CSPA 3DMMD 2UWEE 3CMOL 4YNYA 1D9KB 3JWNC 1PQZB 4LEXH 4XBMA 3T4AC 2P5PA 3QZLA 2OMVA 4P9HC 4ZUTA 4FCHA 4P3CL 3C75A 3BH9A 3ARBA 4L5FL 4PJ9D 5KVGH 1FHGA 2WB1A 3SO3C 5IB4B 2PWDA 1VDGA 3T0EA 1MH5A 5FUOL 5CF3A 3K0WA 4JN2B 4OZHB 1F3JA 1X5IA 3BZFB 3RVVC 5IFJA 3MZTA 2WBWB 4GI8A 3PJSA 3BKYH 1TENA 1OV8A 3DUHA 1GKOA 5I15H 4H0HB 4N1EA 4Z7VE 4PJXA 5EN2A 4AW7A 2GT9B 5LN8A 3NIDB 1D5MA 1YC7A 1DHKA 4KJPD 4YSQA 5CIPH 4A2HA 4WI0A 1TUPA 1LWHA 5GJSH 1A7PH 1RIHH 4FADA 1FYTA 2EVGA 3C9NA 4WK4B 3O6ML 2J6EH 4Y1TA 4LP4A 4BJLA 1B88A 3GNML 1DUZA 1QSED 2QR0A 2FJUB 5KN5B 4L9LA 2ZIDA 5CCGE 1XXFC 3TCTA 1TIUA 1Z3RA 4X7TA 5CZXD 4OF5A 5E6UB 4EI5D 1UZGA 2AC0A 3Q6GH 3CLEH 3T0VA 3GSRA 3MLWH 4WUKH 2AK4E 4ANXA 5F0JB 3EJPA 1LEKB 4HWZA 3BPLB 4MSWA 1T0MA 4JFVA 1C08A 3VGDA 3QQ9D 3MRGA 4LGPB 2HH0H 1V3MA 3BCFA 4D94A 1UGKA 1RUQH 1ZLVH 2AS5M 4FNPA 1O6TA 5CGBA 4MA7H 1Z2KA 4Z1PA 2D7TH 3VH8B 5DJDA 1QABA 1BAFH 3WL9A 3B9KB 1TJXA 4BFRA 2Z8SA 1JN6A 3ZDZB 4ZFGH 4N5UA 4L3EA 1F11A 2H26A 1NCWL 1KZQA 4FXKA 1W0WA 5JHDE 4LSSL 3I3BA 3VD7A 7PAZA 1FL3A 1VPOL 3RWEA 3MRIA 2WGXA 4NCDA 5KVFL 5GSRB 4GG6F 4Z18A 1SYSA 1F18A 4NJ9L 3P9LB 3NPSC 2GIYA 4FQ2H 4YHLL 4G9DA 4Y19A 4WFGE 3W81A 1XIWC 3H42L 1KT2A 4Y1SA 3I50H 5DD3H 3O4LE 4GT7A 1BF5A 5DUBA 3D85D 5HYJB 1F8TL 3S8GB 1L9QA 3GHEH 4KXDA 3VGBA 4HUVA 1MCBA 2X41A 3BHBB 1P6FA 3N40P 3AQXA 3ARXA 5E6SB 4GAGL 5IBLC 3WAJA 3US0A 5G55A 3AG4B 4NN5C 4NPJA 4Z7UB 1ONQB 4PYGA 1A6WL 4X4XA 2HLAA 4MS8C 3EYFB 1MHPH 4E2OA 5ADOH 2FEEI 2WK2A 1EHXA 3UACA 3F12A 4QRPA 3WIAA 1KBKA 3KLDA 5KBKA 3RRQA 1L9TA 1QTPA 5I6PA 1UZ6F 2A4ZA 2QLYA 4JZJA 2V7NB 3LN4A 5D5ME 2VM9A 1JWMA 2CR0A 5JLZB 5DRNB 2QPFA 3OKKB 3G5XA 4PJ7E 4GNKB 3MRQA 4IBSA 1VB9A 4KVNH 2PPAA 4XMXA 4IIQB 1TLMA 4ZTPH 1ZLSL 4PGBA 1LQBC 1PY9A 1GZPB 1G0YR 4RQQA 4AYBA 2UZYB 3IMRA 5AVWB 3UTSE 3NACH 4KDVA 3I9PA 2BINA 4G9FA 5IT2L 3G5VA 2J4WL 2L7QA 2WXQA 3QI9B 4G3YL 4MAYD 1LO4L 4GW1A 5LXVA 4PLOB 1ED3B 4IMLB 4JM4H 4H13C 4M7ZB 4AENB 4U1MB 4Y5YA 5CJQL 2MH4A 4XTRC 3ORJA 5B8CB 3Q7JA 5CEXB 1C9SA 3O6LH 3WFHB 2XC8A 5JQ6L 1BEXA 1E3XA 4X5WB 2AJYL 5BZXA 4PLKC 3PU7A 4A7SA 4MRCA 3EGDA 4Q9BA 2X53A 3GXMA 2GFBB 4L8BB 1TETL 5JR1L 2AK4B 5GGSB 3IPEA 4GXUM 1XH0A 1CG9B 1QRNA 4P57A 4XNMA 5E6ID 2HTKD 5DGRA 4UM9B 1HQRB 5CJBA 4U1KB 2X44D 1E4XH 4XCEA 3WN5A 2H2SC 5I1DB 1OQOA 2R4RL 2VQ4A 3I3EA 5AG8A 1IBGL 1KUMA 4OFIA 4TUOA 5I6LA 4TVUA 4PWKA 3SE8H 5MERB 1CMOA 1CICC 2W9DH 1RUAL 2X1WL 4FFVC 4PREB 3RDTB 2BIQA 1U3HB 3K5SA 1RZGA 2QMJA 2CLZA 2YHGA 1Z5LA 1ZVHA 3FOMB 4HJ1A 2C1PB 3K8KA 3LDBC 4X7SL 3SGJC 4G2AA 1FG2B 4M61A 3NZHL 1JTOA 1UZ8A 1T22B 3VCLA 2HN7B 3P73B 1A6VL 3HNSL 2XU9A 4A6YA 9CGTA 2Q1EA 4R7VA 2R8SL 3RP1A 1R5WB 2Z93B 4J23A 4AEHL 4ERSH 4KRPB 5E2VH 5BXFB 4PBXA 2G0KA 5T1DH 4M7KH 3S8WA 2P80D 4XPAL 5D1ZD 3SKOB 4ZMYA 3EJZD 4MCZA 3NPZB 3C5XA 2E6QA 2X3CA 2O6EA 2CLVB 2HG5A 2ZF8A 3FTGB 3O4LB 4PRBB 1XF3A 1MLCA 3FSZA 5T5FH 2FLMA 3ULUE 3RUGE 4U3HA 1JHLH 3ZSSA 1G6RA 3MRRA 4RVBA 3QORB 3R8QA 4A2GA 1OCOB 3KYKH 1NC2D 1PLGL 3T8MA 1ZE3H 4N5ED 2K45A 4O9HH 3BC9A 2KHAA 3HC4L 4A2DA 1ZLWK 5SV3A 2WAHA 3FQ4A 2YLHA 4BKLA 3AM8A 3K4ZA 3S5YA 3CFCL 4Y4FC 1S5IH 3U2SA 4HGWA 3LYRA 4UNUA 4K7PX 2GCYB 1UUNA 5AOKA 2WQ8A 5J6GB 5SWSE 2R15A 3NA9H 5D7SH 2E7LA 1ZGLP 3SYPA 5LWYH 1GS7A 4DQOL 4EIBA 3CXHK 2I69A 3UTSB 2QDWA 1WFMA 3TF4A 3OKEB 4B9KC 1S7RA 1KB5A 4CMHC 1UH3A 1J10A 3FQRA 3VTMA 3KWTA 1EXGA 1IBFA 3O2DL 4LL4A 4XOEA 3LKOA 3A47A 5MI0B 1FIEA 1TVHB 5HVWA 1PKQA 2OYLA 3V7AE 1L5GB 1IGIL 2AQQA 5D5MF 3CU1A 5B7MA 3NIFF 4MXWL 5B3NA 4PWIA 4YVNA 4DGVL 1F5WA