2OV1A

Crystal structure of apo form of znua with flexible loop deletion
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
260
structure length
260
Chain Sequence
b'DAMDITVSIPPQQYFLEKIGGDLVRVSVLVPGNNDPHTYEPKPQQLAALSEAEAYVLIGLGFEQPWLEKLKAANANMKLIDSAQGITPLEMPGRLMVADPHIWLSPTLVKRQATTIAKELAELDPDNRDQYEANLAAFLAELERLNQELGQILQPLPQRKFIVFHPSWAYFARDYNLVQIPIEVEGQEPSAQELKQLIDTAKENNLTMVFGETQFSTKSSEAIAAEIGAGVELLDPLAADWSSNLKAVAQKIANANSAQP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Periplasmic binding protein component of an ABC type zinc up
publication title Possible regulatory role for the histidine-rich loop in the zinc transport protein, ZnuA.
pubmed doi rcsb
source organism Synechocystis sp. (strain pcc 6803 / kazusa)
molecule tags Transport protein
total genus 90
structure length 260
sequence length 260
ec nomenclature
pdb deposition date 2007-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01297 ZnuA Zinc-uptake complex component A periplasmic
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 2ov1A01
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 2ov1A02
1M1NB 1TOAA 1G21A 2OV3A 4G09A 2XDQB 1M1YA 4INPA 1M1NA 1MIOA 4NNOA 4WESB 4OXRA 3ZKAA 4BBPA 5JJ5A 2XDQA 5HX7A 1KAHA 3U7QB 4WZBB 3ZK8A 2XQVA 5BVHB 1K2VN 4DBLE 2PS0A 5BVHA 4FI3F 1K7SN 1FP4B 2AFIA 2OV1A 2QI9F 2R79A 3R5SA 5BVGB 3TNYA 5JPDA 3ZK7A 5BVGA 3G9QA 5AFSA 5M34A 2PHZA 3R5TA 1KARA 1M34A 4OXQA 4CL2A 4OVKA 3AEUB 4PAGA 1PQ4A 3ZTTA 2X4LA 2OSVA 4UDNA 3MINB 2RG7A 2WHYA 2PRSA 1N4DA 2YNMC 1PSZA 4TKUB 4ND8A 3LI2A 2MINB 1QGUB 4WZAB 3HJTA 1N2CB 3GI1A 1N4AA 2MINA 3AETB 4WESA 4FNAA 2OGWA 4GICA 3K1AB 2XH8A 3MWFA 3AETA 4K3VA 3U7QA 4WZBA 4FILA 4XPIB 4HMPA 5CX1B 4UTPA 5JOQA 5CR9A 3AEKB 4H59A 4WN9B 4XPIA 5CX1A 1FP4A 2PS9A 4N01A 4PM4A 5B58T 3BE6A 3PDIB 4HN9A 4LJSA 4WN9A 5M2QA 3PDIA 1L5HB 4UDOA 4HMOA 3CX3A 5FLYA 3AEUA 2XV1A 3MINA 4TKVB 4M7OA 5HDQA 2M6KA 4UTOA 4TKVA 4TKUA 4NNPA 1EFDN 4INOA 2PS3A 3EIWA 3EIXA 4WZAA 1QGUA 3AERB 2Q8QA 1N2CA 3AERA 2Q8PA 5M3BA 4B8YA 3K1AA 1G20B 4MX8A 3AEQB 2AFHB 3PSHA 3AESB 3AEQA 3MWGA 1QH1B 3TLKA 4MO9A 3AEKA 3AESA 5GGXA 5M29A 5JG7A 1KAEA 4LS3A 1G21B 1N2ZA 3ZK9A 1M1YB 3NU1A 1K75A 5KOJB 4HMQA 4FKMA 3MFQA 1L5HA 5KOJA 4MDYA 2WI8A 1ESZA 1XVLA 2XUZA 2M6LA 5KOHB 2ETVA 2AFIB 5KOHA 3MD9A 2O1EA 1QH8B 1K0FA 4H0FA 1M34B 4IRMA 1H1LB 1QH8A 2YNMD 3PSAA 3TEFA 3HXPA 1G20A 1H1LA 4WNAB 4G07A 5I4KA 5GGYA 2AFHA 3UJPA 2XY4A 1MIOB 3BE5A 4WNAA 3HH8A 4MLZA 4ND8B 3LHSA 1QH1A 5KHLB 2R7AA
chains in the Genus database with same CATH superfamily
1TOAA 2W2KA 4WCFA 3DB1A 2J0UB 4REQB 2XDQB 1BJRE 1Z7EA 3CW8X 4OXRA 1HE3A 4PZDA 1RZRA 1GGJA 1D7OA 2JD0A 3I58A 2OZVA 1PTJA 4H7KA 2JEOA 3ZQUA 2E4UA 4LDNA 2J0EA 4MARA 3HB0A 3RC9A 2JAUA 3VNRA 4R71A 2ZTVA 3AL3A 1PR6A 3LL7A 2IYZA 2YXPX 3OFND 5K0JA 1R0LA 1AN9A 2Z1MA 3CRNA 3KOYA 1FP4B 1HLFA 5FOTA 5I3ZA 5I9IA 2IS6A 3E3LA 4B8ZA 1C0PA 2H5IA 3HN7A 5KMGB 4CIXA 3UGJA 2FZLA 3MMXA 5LZ2A 5M34A 4NH4A 3FYDA 3FCAA 2IKQA 3H2YA 3L6OO 1N2EA 4M8LA 4MW9A 3QW2A 5HZKA 2D06A 2QRVB 5TIIA 4HS4A 1TCAA 1NU8A 5I7HA 1JQAA 2WSMA 2XBLA 3EXFB 4W5HA 1BOOA 3VC1A 3WWCA 3OOSA 3H42B 1I7SB 1ZZGA 3RBZA 2H9YA 4R5MA 2D8MA 3GD7A 3G8DA 3D81A 2I71A 4CTMA 2OD7A 3ODPA 3LBNA 1XKXA 3GB9A 5AVYA 2QD1A 2EKQA 5DN6A 3PXUA 4YECA 1S4QA 4LVCA 1DEHA 1KO4A 1U9JA 4G26A 1WPRA 2PVCA 3ER6A 4WK2B 2NPFA 3AYXB 5JC8A 3GARA 2R1TA 1KZYC 1IUPA 1IXSB 2YHIB 2Z2IA 4XGKA 4ZPJA 1VYTA 1YOVB 3UOAB 3OT1B 4DSZA 3VISA 2VN8A 1U04A 3AJ8A 3ZKWB 4N7RA 1T4MA 2CSUA 2PZ8A 4FFDA 2Q7XA 2X41A 2BFOA 2ZQZA 4JJKA 2JW5A 2VSYA 4G0PA 3R0JA 2YWXA 1E18A 1X7YB 3AI7A 3PFCA 4GGOA 4HP8A 4HRXA 4I3FA 2VDPB 3U4CA 4BFLA 5HOQA 3FKQA 2D5LA 2GN2A 3F98A 4XA8A 4CR8A 3STVA 4UTVA 1EKXA 4MYHA 1IWOA 3PPXA 4ZKEA 1AM4D 4Q34A 1J2EA 1SELA 2IDMA 5DTMA 1U7HA 1QHSA 1UM9B 1WDLA 4JOBA 2EX4A 3LUJA 3OZDA 3RAEC 5LMCA 3QBDA 2V3CC 4F5YA 1A50B 3VMFA 1K06A 4XR9A 3TZ6A 1CF9A 4PZLA 3TL3A 2FVYA 3H5IA 4UHCA 3WWDA 4B6PA 5AVSA 3JQBC 3VKFA 3TLKA 2PUAA 1WY5A 3CVUA 1E1MA 4NIMA 4PLHA 4Q12A 2E1PA 1E3MA 2D4HA 2AV6A 5BW6B 1VB3A 4FU0A 2WT8A 4LRTB 2W6ID 5H7XA 4BNNA 3MYYA 4LDJA 3QFCA 4AJNA 4BZWA 3EVAA 3BDAA 4AROA 4C20A 4IVNA 2VR1A 2FGJA 3O93A 3R6DA 1QP8A 1YA8A 2MR6A 3N2ZB 4UVHA 4A5OA 2V98A 1KI2A 1KH3A 3HBFA 3GDHA 1B7GO 1FL9A 1WSAA 4F86A 2OAEA 4DA8A 2UZ4A 2HBRA 1UMBB 1W46A 1V35A 2NSHA 1AHHA 3AFOA 1A9XB 2ZYHA 3H9CA 3KSZO 4G63A 2Y68A 4RHYA 4UZSA 1JZTA 1H1DA 2BISA 1Y8QA 2GYVA 5EJAA 5IVIA 3RGGA 2AJDA 4RNDB 5B3AA 3VVBA 2ZR7A 5JEEA 2NZYA 6ABPA 1G4UR 3UJPA 2WU4A 4K8OA 2EF1A 2VWGA 2QAIA 4X1KA 2BFMA 3BXZA 5JZSA 4GWGA 5FP0A 1L4MA 3HKBB 2WP0A 2PZKA 5CT9A 1E2HA 3DBVO 4NE9A 5A6SB 2PMEA 5DCYA 1UK8A 2I87A 3C7DB 3K9WA 3WIBA 3KSBC 2RAPA 1B3RA 3HB4X 3HE3A 4MQBA 3ZCSA 1HR0B 4KQ1A 1XP5A 1PJQA 3R0QA 4BEWA 5B57C 1R6BX 2ZJ6A 1WXQA 3KPWA 3T3OA 4AY2A 1MG0A 4NFSA 4O5AA 4AULA 4IFBA 2FWRA 4C2AA 2JZCA 4X85A 1R9JA 2MSEB 2X8BA 3ASZA 1TJ4A 4MO2A 1ZM2A 4YFYA 5HPYB 4EHKA 5JCOC 1C3JA 4LHXA 3MCUA 1T5BA 3QX9A 2XGMA 1FIUA 3WYNA 4HQ0A 2FG7C 2ONYA 3LXUX 4K1XA 4L5BA 1TAQA 3A1FA 4W99A 2RKBA 2ZE5A 3CIOA 3T94A 1N2CE 1P18A 1TT5B 2Z95A 1XL0A 4BEJA 1GPH1 5KKNB 1Z0KA 3I2HA 4CMEC 2K7FA 1QF7A 3FG9A 3G9TA 1BDHA 2PBZA 4E2FA 4RJ2A 3EC2A 4Z1OA 2Z5FA 2XUGA 2WUDA 2PAAA 3N74A 4OEHA 4G4SO 4C1BA 4BFSA 1Z5VA 5DX0A 3LJKA 4FX2A 3G7SA 4DQ0A 3Q8LA 4L4ZA 3ZIAA 3N1UA 4EGCB 3ACDA 3BDVA 3A4MA 4LSMA 3U3JA 5BMVF 4F9FA 5FNVB 2QR2A 4OBXA 5FA8A 1MA3A 2HF2A 2JFQA 5DBHX 1VG1A 2CDBA 2P8JA 1Z4OA 1OI2A 1LSUA 4OH1A 4UARA 2MR5A 2AQHA 2QRNA 2RGYA 4MITA 4UE6A 3V1YA 3HKDA 4A26A 1AQUA 1A4XA 4MHOA 5JNLA 1ZGCA 3LMKA 1GQYA 1RPAA 1SBHA 1V5IA 1RAEA 4UTOA 4Z4EA 2CLMB 1Z0DA 1W1WA 3V2UA 4MA0A 2WSSA 1QIMA 1KJQA 3EOZA 3PHJA 4QDUA 4YEDA 4JBXA 4NPHA 3RRBA 1Z6YA 2QTHA 4PX5A 1WUIS 3HBMA 3CVVA 2E18A 1E6MA 1V25A 3UT5A 1FA9A 5IJZA 3AVXA 2R00A 3RFVA 3AW8A 4QQKA 5AW6A 5EKTA 1J06A 3WX0A 1TQ8A 3JD0A 3RFCA 4GOKA 4I1IA 1CQJB 4I6EA 3ZS8A 1MB4A 4G1FA 2YJ3A 2W6NA 4WLNA 3MOIA 1KJ9A 1LLDA 2IPLA 3FYTA 4FYVA 1RWOA 3T1OA 3M3HA 3K6KA 4R9UC 1WQ3A 2R44A 1PZGA 1V8FA 5K6RA 3OVMA 1U0OC 3WICA 2GAJA 1C3OA 3ZE0B 3OM1A 1P4AA 5DB4A 4E46A 1IK4A 1F8XA 2QV0A 4D9MA 2G0NA 4E2XA 4XIYA 1KBOA 4MR9B 2AYXA 3M82A 4Z1MA 1LA2A 5JNRA 4PVCA 4PYRA 4TVOA 1Z73A 2ZAOA 2O8VA 2Q1YA 1C9JA 1ZEMA 3CEPB 3OPQA 1EUCB 4KGZA 5A1TA 6GPBA 2C8LA 1K27A 4C3VA 4EKYA 1Y9JA 2ZCVA 2IXGA 3V4VB 2IDKA 1PZXA 2A0FA 3HXPA 1X7WB 1SUWA 4KIFA 1KS2A 5I7VA 3BZBA 4FWIB 1G8GA 1QLWA 1Z39A 2QL9A 4NFHA 5FBVB 5LMNB 3KT3A 3B53X 4HUQB 3HFGA 4TLMB 1T5SA 1YZKA 3QG1A 1U0HC 2OLJA 2G70A 4EGAA 3SXPA 4BLSA 1P81A 1VCMA 4MW4A 4D9IA 3VPXA 1GUFA 2ESRA 2ZTMA 2OA0A 1NI4B 4ZIRB 4NNOA 2GX6A 1XLWA 3D2AA 4M1TA 5K51A 1NNEA 5BRAA 2ASEA 4X6UA 2RC5A 4P4TA 4FYHA 1NVXQ 3DLAA 3AX6A 4OH7A 1OH6A 1K2VN 1TVMA 2BSAA 2NQTA 3CPHA 2H1FA 1N5DA 2BFWA 1Q17A 1CSEE 1TK9A 2EKPA 2QMQA 3D3JA 1EXWA 3ZVLA 5BR4A 4IVQA 4O25A 2QQ0A 2RHMA 1E66A 4RHTA 2X77A 4BV3A 3PTLA 1XTIA 3ZGZA 4Q1BA 4MQEB 4ZK2A 4M98A 1ZA2A 1XMPA 2VK4A 5DRTA 5GONB 3L04A 2ACEA 3GRPA 4UEOA 1NT4A 1QJCA 3TBHA 4O2BF 4XQEA 2F4VB 5EKXA 2OSVA 3QLEA 4BHTA 2H2DA 3BXEA 3ZJ5A 4UU7A 3BFJA 3I2IA 1AKYA 1CWUA 3H6HA 2I62A 3S8YA 4N5HX 1OTXA 4MV5A 4J94A 2R6HA 1VE5A 4LE2A 1E6LA 1PR5A 3AETB 1DAOA 3B6MA 2J7KA 5C8ZA 4MWSA 4H18A 2NIPA 4S24A 2GZ3A 5A5EA 1J4AA 5CM9C 4J1NA 4WA8A 3IJRA 3T3HA 3K0SA 3ZUPA 4GZ5A 2YZKA 2WTBA 2AFVA 4Y6GB 1M0WA 2FF7A 4L0DA 4Y9SA 2FZKA 1JDBB 1U0BB 1JEAA 1TCVA 2G0TA 4M7PA 3F71A 1B26A 1HI9A 3C15C 1Q44A 3RKSA 1YQGA 3NOQA 2QB5A 4U7JA 1KY3A 2RHOA 3IAHA 1Q0LA 2ZDQA 4XWAA 1K89A 3BK1A 3VU9A 2QORA 4LGMA 3O4FA 1LRJA 4EMTA 4A2PA 1EFDN 3GEMA 4JCCA 3HO1A 4B34A 3MHPA 2DHEA 5K1ZA 4IYRA 4LDAA 4ZDIA 5I4BA 2OECA 3ZD7A 3WJ1A 2D74A 3JQ7A 1F9EA 1PHRA 3FLBA 1TX4B 2F9LA 5TQ2B 5TS2A 3ILXA 2Q50A 3ROFA 3ND7A 1FQKA 1M1YE 1XCOA 4EW6A 4N1AA 4TTVA 4K9OA 4JOSA 4LS3A 4BUJA 2WW8A 1ZIPA 2XGSA 2P7IA 4Q7KA 2ZUSA 3DONA 1XMOB 3RVRA 4OK5A 3A1VA 3DR5A 3OCUA 1NJ6A 5FPSA 3RC8A 4PR0A 4EY5A 4MVJH 1BAPA 3IUMA 4IGFA 5K20A 1VJTA 1Z45A 3UK2A 1MA0A 3CPSA 3FDXA 2M98A 5HMMA 1J0XO 2LP4Y 3DT9A 3RDPA 4R2IA 1NE2A 1EFVA 1NBWB 2PNFA 1YAHA 3QLJA 4QDJA 4XDYA 3N2KB 3PUIA 4Y2XA 3UXYA 2BDEA 3NKFA 4L76A 3WYBA 1RCUA 3BAFA 2IP2A 4B82A 1A8HA 1S6YA 3QBJA 3DXYA 1J8QA 3AILA 3UICA 2Q7OE 3FUCA 4KXUA 4WJLA 4NKRA 4QEDA 5BSGA 1GD1O 1BDIA 3NEAA 4K9RA 3RC7A 4D3XA 1RXWA 2A1UA 3H9EO 4EKGA 4G5SA 4IJQA 1SGWA 4JJFA 1GHTA 1MD9A 5BN3A 1EJ2A 2RGBA 2P67A 3TZQA 4GPZA 1F2TB 1LSJA 3T5GA 4QQFA 3IUJA 4MS4B 1YHNA 2BD0A 4C6TA 1IRIA 1TU3A 5I7AA 5ENVA 1PI3A 2GKSA 2XNHA 2RGRA 2HBQA 5KKCA 1EZZA 4RQUA 3GJZA 1YB4A 5EWJB 4UNPA 1G59A 2JG3A 5EPEA 1U2ZA 4IKOA 4OHWA 4MIKA 2HRQA 2I4IA 5KTKA 3REGA 1U7PA 1Z29A 3DUFB 1EDZA 2SKEA 4EFNA 5CFOA 5I6DA 5AUQA 1JG4A 2OORA 5ALSA 1RDFA 1AQIA 4XB1A 1E7SA 5D1HA 4QXRA 5FR2A 5I45A 3FR7A 1UJNA 3PX3A 1T4DA 4BQNA 1X6VA 3GPLA 3NHBA 3BMOA 4Y30A 3E5RA 3F0TA 4P58A 1L4KA 4POAA 1YACA 3AIMA 3RIEA 1NF2A 5BWCA 3LCVB 1LXCA 1RC0A 3T54A 4LSWA 3DS8A 5JD4A 1XTRA 2BGWA 4DIBA 4XUDA 5ILQA 3ZHOA 4F72A 2FLVA 2O7RA 4LOKA 4BAZA 2XX3A 3HABA 4CEHB 2BF4A 4LY9A 3EJWA 3EZ2A 1NBIA 1FFCA 1RFLA 2FN7A 3IXQA 4Q4AA 3WOVA 3T4XA 5A4MS 1A8IA 4H35A 1ODTC 3NTRA 2VHCA 2CFCA 4J0DA 4DCSA 1IHPA 2CLOB 3AM5A 1LLQA 4MUJA 1YA6A 5LIRA 1OY1A 2YDYA 2AG1A 1Z4MA 2DUJA 1V8PA 3HA7A 3ENNA 5YASA 4BN5A 1T0HB 1W96A 5EZYA 2FQXA 2NWQA 4EYGA 1PGJA 3AVTA 2Q8QA 4HRAA 3RSGA 1W0KA 4QYIB 4EO9A 1N2BA 3KJIA 3KOMA 1RXIA 4NAVA 5KTSA 4XTRA 3MB8A 2QE6A 3OU6A 4IH9A 4L72A 5C8YB 5JAZA 2PUCA 3SR4A 2JFVA 5TS3A 3GH1A 3V8NA 6REQB 4C7OB 2AOXA 3ZIUA 3KWLA 3QSGA 5FB3A 3IVAA 2BM9A 2Y71A 3FOWA 5E95A 4AFNA 1C9NA 4FR0A 1QRSA 4JL6A 4WNYA 3ADOA 3AF0A 4AMVA 2C4VA 2C94A 2Q6KA 2NV2B 1GL6A 4MIYA 2UZIR 3V9AA 1QYRA 3KB6A 1BDMA 3LRXA 3Q2OA 3DZCA 2FZGA 2WHXA 2BYTA 3HCRA 2R97A 3RODA 3VR6A 4A6PA 3GJQA 4F46A 5FO1A 2VRCA 5LSAA 1ADFA 4DLLA 3AIIA 4JLKA 3WDKA 4DA9A 5JDIA 2VBIA 4ZZ1A 3P9NA 5KNBA 1BU5A 4DSTA 1KI6A 1VPDA 4I4TF 1XD2B 4NYIR 3PDCA 1FEZA 4GPIB 3RAJA 1FU8A 4W82A 3SZRA 1OC2A 3P2MA 4QJBA 3IEVA 1JJFA 4L57A 4PZUA 4LI0A 3UUFA 1WAMA 1RYBA 1XN4A 2HU7A 3BOSA 4FGWA 5BN5A 2WF7A 5IABA 1S0UA 2Y8EA 4MXDA 4MI3A 1TJ5A 3QA9A 2R7AA 4G0QA 4OB7A 4PPQA 4UEKA 2H0QA 2VK8A 3O95A 1NP6A 3H1BA 3TGLA 4REQA 2GXQA 2XDQA 4YHHB 2VTKA 4UUMA 1JFTA 1WKCA 1NN5A 1Y8AA 2VCEA 3H5AA 3IAAA 4KFUA 1P1HA 2AN3A 1P5JA 1YE3A 3QMWA 3ZE6A 4IDBA 3PG5A 1TK3A 2EXXA 2MU1A 2FSGA 2ZSJA 1WXGA 2JIPA 4N6NA 3PCRB 4NBKA 4W8HA 4ZC8A 1QOZA 2W4MA 1W8IA 2BFCB 2HY7A 2QX9A 3N8KA 1N6HA 4AL4A 4E5UA 1ISRA 4WDQA 2HMTA 5CDUA 5FPTA 2NVUB 5IYZF 3CB4A 1J6UA 3NHPA 1H8HD 2CD7A 3OLWA 3KJGA 3QEKA 4IFIA 3UF0A 2PUGA 4KQKA 2BEWA 5A0TA 5JPIA 2FSVA 2QQGA 3EXFA 2ORYA 2HZ7A 4GPD1 1FSFA 1HE2A 1Q0PA 1N5JA 2JJ2D 3M8KA 2FHSA 3R9IA 4BNYA 3DZFA 2JGNA 3DLTA 2P2ZA 3PE4A 2C07A 4Z3DA 4BFCA 2XTMA 3GF4A 1D6SA 4WCDA 4YAKA 4A15A 2TS1A 3K0CC 1R37A 4V0MA 4HMPA 5FJJA 2AXEA 1YK0A 3IQHX 4ARAA 1PSDA 3OEYA 4PONA 2ONJA 3U61B 3EA5A 4JKYA 4DMKA 2IH2A 1ZN2A 4P35A 4LK2A 2YHIA 3G0DA 3JQGB 4YJFB 1YOVA 5EFZA 3I01A 2I3DA 4ASUA 4F6RB 1R9NA 1DJQA 1IXYA 3NGMA 1UXOA 3BIXA 1RAGA 2QRJA 1FDUA 2BFFA 3FVQA 1L8LA 4I8IA 1T2VA 2IHBA 1X7YA 2M6KA 4PGHA 2H4ZA 2W37A 5HDBB 4BBJA 4Z4CA 4F91B 2FY8A 1OKKA 1IXKA 4PIPA 1P0FA 2AN9A 4F2PA 4YRCA 4PO8A 1KAQA 1UBGA 1RWPA 4NY1A 5DO9A 5A9SA 2PGXA 3IURA 3T7CA 3K1AA 3D3KA 1TIBA 1D2NA 1H4VB 5IHXA 3OBIA 2PGJA 3CM0A 3FPEA 4BGUA 5DBIA 4CUKA 1VL2A 4YCAA 3C5WP 4WKBA 3ZLTA 5K99A 1N6LA 5HKKD 1I30A 4D46A 3LHDA 3C70A 3ZV7A 3QKRB 3M6MD 3OCYA 3UK1A 3O8RA 4K87A 4LYYA 4OP1A 5B58C 1ULUA 3DNMA 1BJKA 4JQCA 5CG1A 4MA4A 1UPAA 4YCDA 5JAUA 3A9SA 4RDIA 5KEIA 1TKRA 2OB1A 4BB9A 2R6AA 3AHDA 2CWWA 3B5EA 3OZUA 4JP1A 3GFTA 5AI8A 3U0BA 4DN6A 2DETA 1KO5A 1Q0RA 2H2WA 3ZGLA 1O87A 2XB8A 1RKXA 2XXBA 4H0CA 4U6NA 4H3KB 1IEQA 1FC0A 3QEMB 4JU9A 5AJYA 3W77A 1HE1C 3PQ2A 3A9RA 1DXQA 4M0KA 5SY9A 3SZ3A 4L78A 2WMDA 1U98A 2AMJA 1KKLA 5IZ4A 3F4BA 3BHMA 3THWB 2KQUA 4F3CA 2ZR0A 3ZE2B 2CFTA 3LHSA 3WLEA 1RYYA 3CC8A 3EQ9A 1XYYA 3R6LA 1M8KA 2IYOA 4G0XA 4OFWA 4ZXFA 3DCIA 4HH4A 3K6RA 1Q0HA 2D8AA 4WAUA 5D3KA 3HKBA 3U1VA 2PRJA 4P36A 1O77A 3BGVA 1GGKA 4ZPXA 1E3LA 3WSVA 4KBGA 2DPMA 3SC6A 1SG0A 3THXA 2HHAA 3BUSA 3FKSD 3CX7A 4HNQA 4CT4B 4DBLE 4I4CA 1XKLA 3PX7A 3ENKA 2CBGA 1TLFA 3NUZA 5T6BA 5JPDA 4URFA 2V7PA 4Y9RA 1IMOA 2XWBF 3IS3A 1MAAA 2YRXA 2WYHA 2WG2A 3OD5A 4FMCB 2FW8A 4V3CA 4EUKA 5AVZA 3FGNA 1OSNA 1TECE 2V7TA 2G9UA 4IVPA 2I7CA 2XF2A 3ANMA 3TEJA 1GZ5A 2RGCA 1OZ0A 3AFMA 1S7CA 3B2NA 5EMJA 3ZTTA 1MGPA 2MSWA 2VCHA 4JOCA 1W36C 1QRUA 2WTEA 3Q4GA 3H2GA 4RF5A 3MT0A 4TMWA 4RK1A 1D0SA 3HL4A 2V74B 5FUWA 3SIRA 3G1UA 4PLPA 3WRYA 1N4AA 4HYTA 3U1TA 4WFJA 5ER9A 1KTIA 2LVBA 3E81A 4IF4A 3UENA 3IESA 4RPKA 5G2OA 5FUQA 4QUIA 3P9PA 4ZEXA 1AA6A 1GQRA 1SBTA 1VG0B 2CJWA 2ODTX 3R9KA 5HR5A 5JOQA 4RLFA 3HHPA 1SUDA 3FSRA 3ZOZA 2CVHA 1WUKS 2PWPA 4LMAA 2W6OA 4B6RA 1UOQA 3CLSC 4ZCLA 3VJLA 4DJEC 4E1VA 3RQSA 1ZH2A 4HO1X 3SZOA 4FD3A 1AV6A 3IL2A 2J5RA 2GUWA 1U7TA 2WTNA 4LTDA 5CAEA 2FUNB 3VR2D 1VXOA 2PX2A 3IQZA 1J5PA 3UHPA 1KC1A 1ENZA 4CKCA 5CK4A 2JFOA 5FULA 5KJ1A 1YI8A 5LOVB 1IN5A 2HTFA 1NN1A 1SBNE 3U3OA 2XB2A 3NIFB 2GOYA 1L7BA 4GZMA 1YJXA 4L75A 4ZALA 3U60B 2XW6A 3G0HA 3EEOA 3IB6A 2NGRA 3BCSA 4EPYA 4XDHA 1G8FA 3OT5A 1NAIA 2I29A 4QM6A 1JBKA 4GQIA 3I04M 2Z57A 1G0OA 3EXIB 3H8VA 3LUDA 3E9RA 3UNXA 4RNCA 2COKA 2Q5HA 4QPNA 4YRZA 1R4ZA 2GK3A 1L1QA 4EJSA 5FIUA 1S4MA 1XZFA 2HSGA 3PTAA 1T1GA 1UZAA 1R3UA 2XNDA 4QC2A 2OHIA 4KWEA 1QKKA 3T7RA 1E1QD 2CLSA 2G9ZA 4F8JA 4YP6A 3V1NA 4TUYA 5K4GA 2VAWA 3GEHA 3LP5A 3UUWA 2OGTA 5KSPA 4BMYA 1O89A 1CJKC 1EZ1A 4ZYVA 1C30A 2NV0A 4OD0A 4UPVA 2QLNA 3FPAA 4ECEA 1JECA 3DPIA 1GVNB 4N5DA 3L8MA 4QULA 1KYVA 2EBWA 1U0FA 5C7IO 3LUCA 3M6XA 4ITUA 5JALA 2IH5A 2AMFA 2YWRA 2Q2OA 1MEOA 3FHCB 1YCDA 2DF8A 4XYMA 5IDYA 2VT2A 1PKEA 1ZBDA 2YNMD 3CWCA 2OHVA 1ZICA 3FAZA 3ZWQA 3SC4A 1M5UA 4XLTA 2A9FA 5CVJA 4AF8A 4K26A 5AYVA 5K3FB 4BLWA 3CCFA 4RV5A 5I4CA 3EEBA 3K6SA 1DC5A 4PLTA 5JEDA 2Q5IA 2BCJQ 1QH1A 2GERA 3FB4A 4WBXC 2NZWA 1KZ1A 4G09A 3F1LA 1B73A 1DQNA 4NENB 1WBBA 3WMEA 5C3UA 4ZK6A 1LDBA 4LRUA 2R60A 1NI4A 4ZIRA 1BMFD 3OD1A 4EQZA 4TMKA 2UAGA 3GVPA 3IEPA 2CV0A 2ECOA 1AF4A 3GJ5A 2GCOA 3V8VA 4AB1A 4GVXA 1KOJA 1XZDA 3UT0A 3IR5A 5FDFA 3AGQA 4DG9A 4I9NA 1HT0A 1NUHA 1LNQA 1Z5NA 1VG9B 3ESXA 5CP8A 3OOYA 4IMIB 5FOQA 1LV7A 2WMOB 1GG9A 2Z2YA 3M5DA 4JMLA 4RY0A 5DM4A 1KFBB 5EJGA 5K3CA 3VSEA 5IPFA 4J0GA 5GONA 3C3BA 2J87A 3H2JA 3I9V6 3ABZA 1D07A 4WN3A 1T9CA 5DW3A 2PL5A 4DIKA 4JA2A 1OAAA 3VA7A 3QF4A 4OUKX 5LDGA 2YBDA 4F92B 2WVGA 1F0KA 3JPYA 4R9NA 2JAWA 2YJNA 2GK6A 2OCLA 2ZBEA 3GUUA 4IWNA 1HZZC 2ZYGA 4ZVRA 5B6IA 1X7HA 3FNHA 5F3DA 3SSAA 4BZZA 1PJ3A 1UT5A 4WOCA 1LU9A 3AETA 2BHRA 4FFWA 4K3VA 3W5DA 1CR4A 2PYDA 2XTNA 3LYHA 4DJFC 4MRPA 2WA1A 3IELA 3QX3A 2BCGY 3D31A 4Y2SA 1SIWA 5A05A 4D45A 5JYEA 1G5HA 1M10A 2VTEA 1NVVR 3IE0A 4ES6A 4XWYA 4ESHA 2XZDA 1DMRA 5LP6B 1IZ8A 2CNBA 2FI1A 4TMZA 1Y63A 1RXYA 4L8WB 1KQPA 1RABA 4EOGA 1NN3A 4GL2A 2B34A 5FEMA 4YT8A 1RXCA 3HKEB 1LPAB 2QP9X 3TDMA 4WVLA 3ZCXA 5E1MA 5GZ3A 1WETA 2O06A 4O4LA 3WDMA 2J9FA 1R0KA 1PEYA 3ILSA 4ZVNA 1L1FA 5L6MB 5HCIA 2V65A 1QBKC 2GZSA 4Y1GA 2QGFA 4W8GA 3WLPA 4UTRA 1YVPA 5HZMA 3KKZA 1KI3A 4IUDS 4KVGA 3ROTA 2KBFA 2C3PA 1LTKA 3U80A 3VKUA 4DB4A 1JZQA 1GL9B 2BGRA 2ZRNA 2JL1A 4IIJF 2JJQA 5D6NA 6PFKA 3MFYA 4B73A 1EJ0A 1QKIA 2G7ZA 2QQFA 3VV2A 2PG3A 4XPZA 1Z8FA 2P2SA 4MR7A 5K6AC 4V24A 2OD9A 4RJIA 3FNBA 3NHZA 1M6NA 2PX0A 2QU7A 3BB3A 3PJDA 5CGQB 3ODGA 4ZO6A 1YE5A 5IP5A 3UC9A 1OE0A 2DC1A 1KRXA 4CMCA 4I50B 3UMGA 3M83A 4BQEA 4A0GA 4AY3A 3MWEA 5IT0A 4R8LA 1JJBA 4PAWA 2C9OA 2YIVX 1KKMA 3T0GA 3RRZA 4OYLA 1J00A 4MYSA 1G2IA 3MD9A 5CXSA 4TLEA 1PEKE 2AL7A 1NRJB 4GXTA 1U8AA 1H1LB 3G2KA 2VJOA 3N2KA 1OGJA 3E7XA 3I6YA 3UCFA 3DMTA 1M2FA 3DDZX 4AZ3B 3O0TA 3DBRA 4I36A 3KSRA 4AP9A 5LQMA 1RJWA 1X2EA 2HJVA 2QDXA 2VJCA 4J9UE 2Z1NA 2WKQA 4MYTA 3USCS 2PTGA 3PWSA 3R5HA 2PJZA 1P2FA 5JJ5A 1X13A 4HHEA 3LVQE 1ZOLA 3W78A 3L18A 3FZQA 1ZJ6A 2JGLA 4OHKA 4QOSA 8ATCA 3UKDA 4LF6B 2A5JA 3L2OB 3WGTA 1F2TA 1JNXX 2XD9A 2WTUA 1OWMA 2A33A 1Z7WA 3C1AA 3JQ9A 5AJUA 2Z2KA 5FOXA 2O8FB 1CY2A 3C6BA 3ZU5A 1T1JA 4EY4A 2J4CA 3I6BA 1JPUA 2O1XA 1E3WB 2F8LA 4RYLA 4TSFD 1R5BA 3PXDA 5EGSA 1C2YA 5EWJA 4KFTA 3LF2A 2DBVO 2R11A 5DT9A 3FX2A 2AQKA 1Z2CA 3KAQA 5BUZA 3DUFA 1KK2A 1L5WA 3HFJA 4QE3A 2F1HA 5B1HA 3EARA 4AG3A 5L3VA 1BH6A 2VBFA 1ISMA 1MJGM 2W2NA 2DMRA 2VNSA 1ULAA 4EFMA 1MTZA 2VS1A 3M5WA 4G86A 3QMMA 3P94A 1U3FA 1XTJA 2OEPA 2XUDA 3MWFA 3EK2A 3DAHA 2BT4A 3SQOA 1IBMB 3B7PA 4W5RA 2B2CA 5GWXA 1IPHA 4IH4A 1TQHA 5LYYA 2EJWA 2J3EA 2O5RA 3GA5A 4GZLA 2YV2A 2H0AA 3P96A 1V6AA 4GC5A 4IIFA 4V0NA 4XWWA 2WIDA 1Y7PA 2V45A 3AF4A 3WJ2A 1VKRA 3ZHZA 2GVNA 4HI0E 3U3ZA 3NNNA 1QIKA 2JCYA 4QUKA 4CEHA 2JHCA 1Q7EA 2OHFA 1BCRA 4JNCA 5KQMA 1CU1A 3PDJA 2F1IA 2PCLA 3GIWA 1SY7A 1Y5NA 3VR5A 3UBTA 1P9LA 3MELA 1ZXBA 2ZRDA 4BQRA 4E0BA 1II9A 2QZZA 1PQPA 2CF5A 3H9QA 4FQ8A 3Q10A 4YJ3B 4QELA 1YS4A 1ZS9A 4ML3A 2NX2A 3KZ1E 4JR0A 2VNIA 1DTWB 1E8DA 3QWFA 3TZCA 3WA6A 1IEXA 1KO8A 3ZR4B 4O2LA 3HRHA 4I14A 4BVFA 1AQYA 2WYIA 3BICA 3PC7A 4F4UA 3GUYA 3QXGA 2Y1DA 2G76A 2COEA 1UBMS 2OCAA 4QU9A 5EIFA 1U8EA 1G8YA 3SF0A 2MDTA 4B1FA 4DMMA 1Y0BA 1K3UB 2BHTA 1T0BA 3Q8KA 4W7HA 2V1UA 3STWA 4NCAA 4C30A 3BYZA 1LC0A 3MJVA 1CUGA 2WJWA 5BMOA 1S2MA 3WMRA 4AJKA 1ILWA 4NCJA 5AW8A 3JVEA 2MSCB 3RUHA 3TXXA 1YRLA 1TMKA 2Z43A 1Y82A 3O2QB 4RFSB 1RM0A 1IC6A 4QFMA 4Q4HB 4UEJA 5AW2A 3KQHA 3DSRA 2FK7A 2WYOA 3EWNA 3FMIA 4KPYA 4ZJYA 1XZQA 4J75A 1XD2A 2BW0A 2GZDA 1CJVC 1F9AA 3PXXA 4BWFB 4N0PA 4D8XA 3NBMA 1ZD9A 4WV3A 1P72A 1UWCA 1E63A 4GYJA 2GUGA 4YC7A 5EJ4A 2OAQ1 2O05A 3NPAA 2EQAA 4DDMA 2AX4A 4QXOA 1VP3A 3CW9A 1K8QA 1KP9A 2EFJA 2JFHA 4H6WA 3RS9A 4IOJA 3U7EB 1PWYE 4IQFA 5BSFA 1VZ3A 4V0ME 4M49A 5CB4A 2GJ4A 3W6OA 3AFIA 1S89A 3M6FA 5DTIA 4HDMB 2YWHA 1W1IA 3DTVB 3RS4A 1C9MA 2ZI6A 4TV9F 3V5NA 3ZDRA 3BD9A 5DNVA 1DBPA 3GLGB 1D7AA 3OE7A 1EQAA 3C5VA 1CULC 1Y1LA 3C85A 3L0CA 4DTCA 1E4YA 5F23A 1VG8A 2LKDA 1Z2OX 3TKAA 3CGWA 3ZK7A 3H3JA 4A8HA 4JB0A 5AM4A 2C3OA 3DVRX 3HJNA 4FZRA 5E4TA 3NG1A 3TIIA 3T3IA 4BLTA 2ZZMA 2VJPA 3QBVA 2DULA 2JBAB 4JS0A 2BFCA 4RH1A 5CB8A 3GT3A 5JUWA 2R8YA 1UEXC 2DJIA 2R86A 3LC1O 3QXCA 2NG1A 5JE8A 1QAQA 2HZBA 3WQSB 2NVUA 4FNGA 5AJZA 4EHBA 4PLFA 4ZVVA 4IIUA 3A05A 1X3SA 1BU8A 3OMXA 3T1TA 1LWNA 4FN5A 4XCQA 3QEBZ 1WP4A 4ZVKA 2DFNA 3S4YA 3IAEA 2ZATA 1KYWA 1CZLA 1JP7A 1R5OA 4M76B 3NAZA 4XB2A 4GZ3A 4NV0A 4B7UA 4DNPA 2A88A 4YCLA 3EQ2A 1FRZA 4G2NA 2P62A 1E32A 2B8WA 4E6EA 4Z3OA 1RXSA 1AIPA 1ISIA 3CHYA 4PFQA 1D4FA 1PAUA 2Q3BA 2NZ8A 2Z4SA 3FUVA 3HJHA 4C6RA 3R3SA 1RIIA 5A3VA 1U6KA 1WB6A 3HDGA 5KSOA 3CU5A 1O95C 1T29A 4UQOA 1CJBA 2JFGA 3WLIA 5DASA 4KE6A 1N34B 3JQGA 4LF7B 3ETNA 1BS9A 2GBIA 3SJZA 4F6RA 5FPHA 3KR2A 2EX1A 1HDOA 2X40A 3U7RA 1PGNA 1ZSYA 4Q9HA 1NXQA 1NDHA 3C8DA 4C0BA 4PYIA 3NS7A 2ZWPA 1JGTA 5AR1A 3RIGA 3VGJA 1YV9A 3KHUA 4LIPD 5CPFA 1EK2A 1CX9B 5AVKA 5EJIA 3ZGVA 4E15A 5A04A 4R51A 1SK8A 4BGDA 3BBLA 4K9NA 4M0LA 1AURA 3U16A 2EEZA 3H1GA 1DDIA 1Q91A 1PYDA 4I6GA 4ED9A 3K96A 2W2OA 1ZQ9A 4CJXA 2Q5FA 1AXEA 4IUYA 3GVXA 1XC7A 1R5JA 1LEHA 1JSXA 3MJTA 2Y0CA 1BEUB 1NKTA 4GMHA 3AI2A 1SNYA 1XU4A 4L9SA 4URYR 2IA5A 4Y0VA 1GR0A 2ZVDA 3F78A 2K4MA 3H97A 5FBHA 3GMSA 2XJ4A 3OZTA 1NLUA 1VHTA 1WCWA 4XDZA 3SBXA 4KNWA 3PD7A 2IS1A 1AQLA 5DOZA 2XUIA 1AT1A 3H9UA 3F6RA 1HTTA 2OLKA 3AFGA 4GR5A 5E4FA 1N5OX 3A3PA 1YTLA 2A1IA 3EXEB 1RLIA 1UR5A 3TQOA 1Z13A 1FYWA 3F7MA 4S35A 5B53A 3HGTA 3WXMA 1P80A 3KVRA 2P6RA 3C24A 1H42A 2CNKA 1JU4A 3H4IA 2VUTA 3H9GA 3IRUA 3GPIA 1I6WA 3JAWA 3IIMA 3NBKA 2OVBA 3RU2A 5DBOA 3NBZC 3TTTA 4ZGGA 1D9ZA 1NDQA 5A3SA 2ZBVA 1XJ0A 4IXDA 4G1MB 2J9YB 2H4YA 1DXYA 1IHDA 1T3LA 2AN1A 3JR7A 4M8NE 1JG7A 1F2UA 3HO8A 1OLUB 2YHUA 1HTWA 1MP0A 3D8RA 3FSJX 1LFAA 4MVYA 4DEYA 1SVOA 4YDHB 3CJRA 4WEOA 3S6JA 4DLZA 3WNZA 1H2EA 4UCFA 5E0KB 2VEDA 2B0JA 3FBGA 3M5PA 3UKJA 1ZIYA 3E0QA 4B17A 4QBTA 1O58A 1UBFA 2JGFA 3LZDA 1TXGA 2CHGA 1NMSA 4QXQA 3B1XA 1QRTA 1W5TA 3KE8A 4L16A 2BZSA 1APBA 1TYEB 1HT1E 1KNXA 1LW6E 2MSLA 1QGYA 5F52A 1TYAE 4HGQA 1GIAA 2VUSA 2GTPA 1C7RA 5I9NA 1JN0A 5ALVA 2WJVA 4Z51A 7GPBA 5KX5A 2FQ1A 1PZFA 5JMOA 3EAQA 2XD4A 3A25A 3LUHA 2AH5A 1CD5A 4OHCA 4PZAA 3ZDXB 3KK0A 1E9DA 2J3KA 1WPXA 3P45A 4I08A 1JL3A 1LLUA 1GAWA 1ZUIA 2QNIA 3HY6A 1YK1A 2W0SA 4I4LA 1EE9A 1NX9A 3JWIA 4ZOBA 3OIDA 5DTJA 4J6FA 1B6RA 1WKVA 1DEKA 2GARA 3CEMA 4IKPA 4V39A 2WJHA 4D9NA 4ZHQB 1NFQA 1XRPA 2I66A 1E59A 1XUOA 1DIRA 3BMXA 3KYJB 1UZUA 4ZQIA 3SAJA 3IA7A 1WOYA 1ZCJA 2IHKA 2Q0XA 5C8DA 1H4SA 2HWUA 3ZY5A 5B36A 1K3FA 2CUTA 4UTPA 2GBLA 2DUMA 1AK9A 2YRWA 3DDSA 1DAPA 4Y2GA 4EI7A 2NTVA 1LGYA 1XDGA 1X1CA 1J2TA 4JXKA 2X4GA 4P0QB 1X7DA 5GJWC 2C0CA 4M38A 1CUBA 2PRKA 2IZ5A 1KC3A 4JJGA 4IEIA 2ZTSA 2Z83A 4IDDA 5FWYA 3RAGA 2WWGA 3HO6A 3L8HA 4L6CA 5KAPA 5JWRA 2IYFA 1P2VA 1VSVA 3C8UA 4ZZ2A 3A1EA 3PNKA 4E5YA 4CEIB 1GUDA 5LOVA 4M1YA 3W5VA 3L6EA 2AJ8A 2DFDA 2VXOA 3AU9A 2WZCA 4NMHA 2QG6A 2VKTA 1N8NA 5M3BA 4MTLA 4HOYA 4RZSA 5AOAA 3VTAA 4KE9A 4ZO9A 1EE1A 1V39A 3CSUA 3HVIA 1W6UA 4J29A 4N0DA 4BJHB 5JRZA 3U4HA 4DV3B 1VHQA 1X1TA 2DU8A 1QB8A 2R5FA 2H2IA 4C5BA 1MN6A 4IY1A 1H3FA 3HFSA 1ZEJA 1EVIA 5EWLA 2IGBA 4WOKA 4DCOA 1RBQA 2DKFA 2VHEA 4U8GA 1RCFA 2ZYDA 4IHJB 3L06A 1M1ZA 4YR9A 3X1JA 3NP7A 4CBVA 1RYFA 5JO9A 4AZ0B 3OESA 1DV1A 4X66B 1KU6A 4WUVA 3W7BA 3PK0A 5DHFA 4X45A 3A2LA 4GVLA 1E0SA 1XEAA 4G97A 4NVRA 1X7XA 4BNKA 4ZDKA 2W8ZA 2ADOA 2FUEA 3O1JC 4X41A 4RD2A 3EISA 1SC9A 3B6JA 4URVR 1EQ2A 2IL1A 3NRJA 1G5TA 4LBYA 1QXSA 2V97A 2B1RA 3X44A 2QJTA 2DKOA 1ZJWA 3RRNA 3HJCA 3N0XA 5DYYA 2C0PA 1FF9A 4JP5A 1E1RD 4C4PA 1CY4A 3CISA 3CVJA 3LD9A 4GYYA 4GKBA 1YGYA 3MNFA 3T5TA 1ZRNA 2Q2VA 3NASA 4D4GA 3JS5A 4PGFA 2FVXA 4YQFA 1QBGA 2I54A 4HGZA 5K3FA 2FPPB 5TQVA 1IOWA 4GYWA 4IIHA 1QHEA 5B1IA 1SWVA 3ZE7A 4AUKA 4YRSA 3RK0A 1H2XA 4ENSA 3LQFA 1HC7A 4YV1A 5LU8A 2D7DA 5I3CA 2BMFA 3ESCA 4NENA 1KMIY 4RTSA 1H22A 3U7HB 2HA7A 2RK6A 2NO4A 1NVUQ 2IW3A 2EAUA 2W8BB 1TEXA 4KHPB 1DAGA 3PNYA 4Q3BA 4CM3A 3IPXA 2VA9A 4X62B 1G8JA 3DL2A 3N9IA 1VOTA 2BSXA 1IUOA 1K08A 1YB7A 3TX2A 1XTZA 3F8WA 2COUA 2FMFA 1RACA 3R3VA 1WCXA 4OIFA 4ZARA 3OPYA 1WD7A 4KLRA 5BV8A 3LQRA 2IYPA 3DD1A 2P4SA 3B6ZA 3LL4A 5IC6A 2QUIA 1UIMA 3PHIA 1Y3AA 1PSZA 2IXDA 4BCCA 4QNRA 3SYTA 4MEBA 4PO3X 1U63A 3MILA 2J9XB 1VPWA 4ARIA 2RJ3A 2DHRA 3ICOA 5GQSA 3OSZA 1I24A 1T0JB 1U7OA 3PR3A 3D8SA 5IJ0B 3NBYC 2YIDA 3K5HA 2PK3A 4B6EA 3N0TA 5JXHA 3BC1A 1IUNA 2IPOA 4KC0A 4OHMA 4RIHA 4I66A 5M7EA 3BMNA 2Q1TA 3DXZA 4LMBA 3JZIA 5CX1B 5LNK1 4KCGA 3HCOA 2DR2A 5KTYA 4XLZA 3FWYA 4QU5A 5T3YA 5B58T 2DFPA 4QL3A 5DW0A 2QG9A 5C8XA 1SVWA 3E4CA 1IL0A 2QZ4A 3S1AB 1YR2A 2AJLI 1KPHA 1Z5WA 2ZRIA 1EG2A 2AA3A 2FKAA 2R1VA 3EXG2 2ECKA 3DBLA 2CEKA 2SCUB 3K9LA 4LYHA 1UP6A 3NWBA 2P68A 4X7RA 1XF1A 3X1DA 1P0MA 2GDZA 4R05A 2C8VA 5DBEX 1B16A 5EA2A 4GDFA 1JXAA 4G89A 3CZRA 5LZ4A 5EYPB 3D8HA 2XE8A 5EUMA 4TQGA 3SYKA 3RSLA 5H68A 2W43A 4BP3A 2YJ6A 4ZT5A 1CHNA 3FZGA 4GGMX 5F1PA 4B8YA 1VMIA 5KC9A 3M4JA 4ZJUA 3L7YA 3Q15C 3WK6A 2Q5EA 3KG2A 3FOEC 3CKLA 2DQ4A 1ODFA 1U5BA 2B21A 1VJGA 1NQTA 1T26A 3HSYA 1NQXA 2Y1CA 4IMRA 5F1OA 5IW8A 4GOLD 4D79A 2X22A 1MKYA 1SB9A 3GG2A 1TKAA 2BR3A 3AQ4A 2P79A 2ZE7A 1QE5A 2R3SA 3A4LA 3CWZA 3R5FA 4N5NA 1B8PA 1F0PA 1E79A 2I2XB 2OILA 4AMGA 5HM8A 2A9KA 3AHCA 5JPCA 3GFSA 3SG0A 4AECA 4YT4A 2ETVA 4I50A 2DHCA 2YS6A 1XF9A 3JSXA 3LT0A 2GQ0A 3F7TA 3MCZA 2W7TA 5CM8B 1YJ8A 2IPMA 2JK1A 3IB3A 4M6WA 2BGMA 1J8VA 1Z25A 2AG6A 4G67A 4KWTA 4UVDA 3ETGA 3LX6A 4AU1A 3LQ1A 1H1LA 3V4SA 1EVKA 2QE7D 4EF5A 1ODIA 4U7HA 2GPBA 4LE1A 3TWOA 3FNGA 3FF4A 1HLDA 1SJ9A 4JUBA 1K8XB 4NG5A 4CDMA 3DC7A 4AZ3A 4OB8A 1V9CA 3MJSA 2NUPB 2O2SA 3LC2O 4RSGA 2XCLA 4EG6A 1NYLA 1VSQA 3LDUA 2APJA 1XDBA 1SVIA 3WO0A 3DE5X 2Q4OA 3D6MA 3ZY4A 3I53A 3FAKA 3SFVA 1E69A 4X64B 4AVYA 5FV4A 5FWAA 1KK1A 3L6CA 1M6WA 2EFGA 2YYAA 1RZRD 4I0WB 3OTGA 3NVAA 4HQ6A 5CG2A 1P5RA 2O2ZA 3IT2A 1I3CA 2R8ZA 4PSKA 2ISCA 1TTTA 5AKYA 3FROA 1CC1S 3NVMB 3R24A 3HEBA 1RHUA 2BONA 1CIVA 4HPJB 3W5CA 1JR4A 3K2QA 1KH1A 4OIMA 1HXHA 2XI4A 5IZCC 4JLDA 4LF5B 1ECGA 1RPJA 3G2NA 5FD8A 4KXWA 1L7XA 2CXRA 1FP6A 2JKZA 2HJSA 3ESZA 4K8RB 5AH0A 4BOYA 3ECAA 3U3DA 4IP0A 5EZ5A 5BSMA 5ENZA 1NLZA 3AFHA 1OH5A 3QEOA 2RKWA 1UBOS 3DHNA 4XPIB 1WPGA 2C03A 4R8KA 3UTCA 4N7JA 2PA3A 1EUZA 1TC1A 2IXBA 3NQ41 3LDGA 3R7BA 2QENA 3U7IA 1F2DA 4RESA 4Y1FA 5DN6D 1NKSA 1TYDE 5BSUA 1N6KA 1KQGA 1B1CA 3RPEA 3I73A 5HFJA 5LLDA 2WUFA 3CLHA 5CVCA 2ON6A 3DMPA 4R8RA 3L7AA 3T1HB 5EIXA 1DRUA 5DXFA 5FBRB 3SC2A 2FR1A 2WU0A 4NMXB 3QUQA 5HYVA 1UXKA 1O0SA 1Q74A 1PT5A 4I3HA 3UK0A 2FW7A 2AJBA 2AN4A 1XMJA 5HQ3B 1WSWA 4G4GA 1GDTA 1I4EB 2ODNA 2W2VA 3O4HA 4Y7DA 3JXEA 4YP5A 4Z7NB 3FTCA 4Q19A 3ITDA 3MYRA 4YQEA 4Y2HA 3UV7A 4RMNA 2PMFA 3MWJA 1VM6A 2QY6A 5LU9A 3BWXA 4LX0A 2FRXA 1GNVA 3NM4A 5CDHA 5BPFA 1ZJJA 3UW3A 3EZ6A 2H9AA 3QQ5A 1V5EA 4XGRA 3MAAC 2FQYA 3I6QA 1MAHA 2WV7A 2ZIAA 5FNVF 5DLYA 1NQVA 1Z5ZA 16PKA 4EY7A 2OFOA 4GC9A 1U8UA 2A84A 4HH3C 3EZYA 1M2EA 3WGYA 4IIEA 2JGIA 1L8OA 3GOHA 4ZU6X 4M1KA 1JE1A 1I33A 2H85A 2XUZA 3A6HA 2PH5A 1GGFA 1M0SA 1WXHA 2I33A 5ALWA 5KNDA 4AKIA 4D8WA 4DA7A 4YAIA 4Y9DA 1ETHA 3UA4A 4RFSA 3DEAA 1IPFA 1FDRA 1R16A 3DOIA 2PSDA 3JWEA 1JVSA 4M1ZA 3HYLA 2WG0A 4J03A 1D2MA 1VMKA 1SHUX 3KUKA 1RBMA 3H8SA 5EWMA 4QREA 4KLCA 1BD4A 4KB5A 4XIFA 4JT2A 3SYLA 3TZHA 5J4KA 4Y2TA 4Q16A 3BB4A 3EY4A 3QBTA 3AL2A 3PI6A 3IP1A 4JT4A 3EVFA 1QIGA 3L0BA 2OV3A 4DHWA 4J6EA 3ZWAA 3A10A 3V1MA 4BMDA 2CF6A 4KUGA 1NVEA 2Q3CA 4Q1AA 1MV8A 3IQIX 2O6LA 5E7IA 3UCEA 4K1LA 5F78A 1NUPA 1V4BA 4KDCA 2C4KA 1CETA 3T5MA 3MWDA 2O2JA 3ACCA 1P2BA 3RSZA 5IU6A 1HQYE 2VUHB 5BOVA 2YMLA 1YMVA 3OF2A 1XALA 4FD2A 4GLJA 1QX3A 2DT5A 3RLIA 1ESNA 1X1SA 4Q3KA 2PBFA 5HIMA 2X19A 3QLVA 1VSTA 2IYXA 4FNMA 3EDRA 4OM8A 5DP1A 1BXGA 5KVVA 5D87A 3QYJA 1FYXA 3QV1A 2JCSA 2KM1A 4Z2YA 1LDEA 1YC2A 2PL9A 5TQ0A 3BGOS 4D82A 1EFCA 2XMZA 2VUIB 4PHTA 1C0IA 2XJ9A 4YAOA 4CUJA 1XZIA 3ML1A 1XDUA 2NSLA 3LHIA 4M9CA 4U1RA 2O23A 5AVUA 2EJUA 4C04A 2CBZA 3AZOA 1DHTA 4C4YA 2A9PA 5LQRA 4OREX 3JQAB 1FSGA 4OQMA 4DJTA 2C9BA 3CNNA 2HCTA 4JUDX 1Y37A 3QU7A 1V2GA 5LYJA 3ANYB 1UBLS 2AKYA 5K45A 3VO8A 3ANSA 4WTOA 1NUSA 5F4BA 4YJGA 13PKA 1M2HA 4FFNA 4KH1A 1QUFA 3GYBA 4JKIA 3VDRA 4CIDA 1TW3A 3E3NA 3BTUA 3M6IA 4JI6B 2XOXA 1ORDA 1Z6TA 5GONF 2OSBA 2VTDA 4COKA 4E3WA 3BWCA 2AZDA 1T6BY 4MVJG 1E1NA 3FKJA 2CMHA 5FLYA 4RDHA 1ZGJA 4NZZA 4B43A 1DAMA 2QMYA 3KALA 2DWPA 4MPJA 1HNZB 1E9SA 2NU8A 1UC8A 3D02A 1XA4A 4MAMA 5HS4A 2PANA 5KJ6A 2XAUA 2IF2A 1MT3A 2XOEA 1WV0A 3WGMA 4UHHA 4HT3B 2AI2A 2BGGA 3TCKA 1FNCA 4YRTA 4JQSA 5ARBA 1LK7A 1E4EB 5KYYB 2IYNA 2NYAA 3SPXA 4UNRA 5JISA 1Q1ZA 4PYLA 2WSSD 2QLBA 3IEMA 5TC4A 2JASA 3KLBA 4V2UA 1UFQA 4RHFA 2W6JA 3DE2X 3FSEA 5B55A 4CKZA 1AS0A 3SHFA 2G5PA 1YVUA 1AK1A 1LPPA 2QKYA 4RQAA 3D6VA 4RKQA 4JI1B 3V4ZA 2CZGA 2A2ZA 2XMRA 3AY3A 2P41A 1IATA 3OQPA 3HXMA 3C98A 4P80A 4K3UA 3MQFA 2OO5A 4TTPA 2HRRA 1QK3A 1S3SA 2R8XA 3MW8A 1GZ7A 4I4NA 5CU7A 4B6OA 4BBAA 3IJEB 3EXEA 4M7RA 1U0GA 2H2HA 3WMFA 2HA2A 3M1AA 2XKKA 4QU0A 1JXOA 1B8OA 3I6MA 3PPYA 4O2AB 4RORA 4JYZA 2GZAA 4BQFA 4UFOA 3LRTA 4Z4QA 1NMEA 3LUAA 1GA4A 2X0NA 1HDGO 3IDZA 4F2HA 3IAFA 2XGGA 2HX1A 1F17A 3KKLA 3UJHA 1H3NA 1V16B 4RH0A 3VM6A 3VZDA 4F21A 2ACWA 3WMWA 4S04A 1E6KA 3D54D 4UAJA 3F4KA 2ZETA 1OLUA 3PJRA 1CNFA 4QYWA 1JLLA 4MKHA 1P8AA 4LCBA 4FLEA 1K3TA 3FGOA 3PNPA 3HY3A 4MKIA 4A8PA 4NCIA 1HRDA 1Y3IA 4EX7A 2QZJA 5K8IA 3G9ZA 2QD5A 2QRHA 1MXFA 4FE4A 1CLUA 2H1LA 3EVBA 1XLTA 3K0HA 3QELB 1GZUA 5K05A 3E0XA 2NZ2A 2ZWAA 3WLKX 1I2CA 3L82B 1ESMA 3PUZA 1BXZA 2PU7A 4XVQA 2FW9A 4DEXA 1JG2A 5JQGB 4UZEA 4Z4GA 4J8PA 3DHYA 4E2ZA 3DMNA 1K4YA 4MINA 5BWNA 1P73A 3CN9A 4V0QA 3UHAA 1QP7A 1MRNA 4XDGA 2PXAA 2I0FA 2JIDA 1FJ2A 3NIBA 4G81A 1SUEA 3TOCA 1Z4LA 2ZRKA 4YJHA 4AAYA 3N8NA 4IDCA 4LNAA 3UUGA 3UXHA 3O8OB 1TQ2A 4F45A 1RYDA 2AOWA 4B35A 2GRAA 5G41A 4CCSA 2XRMA 2W4IA 4ZHQA 4B4DA 1QP0A 4MRAA 1QRDA 4MP8A 4CM8B 1Q12A 2RMKA 4BQQA 2EYUA 1PVDA 3I2KA 1YR3A 4RD4A 3L8YA 4C3OB 5LD2C 4E4RA 1CEEA 4E5NA 4CCYB 1UXGA 2C31A 3LX8A 4ENTA 1MB2A 5BQPA 3B36A 3CG4A 5IN4A 1R12A 2EP8A 5CYFA 1PVOA 1E9VA 1P19A 3RRMA 3KQQA 4NLLA 5AKZA 1Z82A 3ABQB 5JSZB 4LXTA 3UPDA 1OOEA 4N3BA 1TYZA 4IWXA 4Q3EA 5LC1A 1TPYA 4ZT7A 2BGLA 3WGKA 3ADDA 3K20A 1JWAB 3I2YX 4QJ4A 3HEMA 1E5DA 3PFNA 7YASA 3WADA 4U7FA 4N48A 3ZLVA 3C97A 4GBED 3KYDB 2HMWA 2GSDA 2JI6A 1ZWLA 1JIXA 1E1YA 1JKMA 2DTXA 4PNPA 4Q1FA 2D2XA 3UMMA 4QFBA 3DLBA 4QVKA 2B61A 5AK0A 1PJSA 2B92A 3CX6A 2VJBA 3NBAA 5ALRA 1N77A 5BN4B 2QD4A 4IDHA 3M7IA 1XT6A 4Q24A 3RAFC 1OXSC 1F6WA 2FN8A 2PFSA 3KTOA 2GI4A 4FJ2A 3AL0C 2D5IA 1XAIA 4XWOA 1ZQ1A 3HGMA 1U65A 4LRXA 3OLZA 4WGGA 3DFKA 2RE8A 3EH2A 4H16A 5CVEA 3Q3JB 4XUCA 1EXMA 3BHJA 2M6LA 2GA8A 3PRYA 3OZRA 5CIQA 5TGDA 1TM2A 1P3JA 3RABA 4AK9A 4BNFA 2ODAA 4E3ZA 5BV2P 1VBNA 3WGOA 4GBJA 4ND1A 1YNOA 4TGLA 3WR5A 1KEUA 1W0JA 1X0VA 2EBFX 2FEWB 1U2EA 2GCGA 5DYWA 5E9JA 3UMJA 4PTYA 5BN1A 4IRMA 1REQB 1NXVA 2JFWA 3TVDA 4YMHA 5A5FA 5C8YF 5DN9A 2J3LA 4CTOA 1QZZA 3P0FA 4I9HA 4EI2A 3RS0A 1JAHA 1XAJA 1Y1TA 1QR2A 4HK4A 1Y1RA 2AXQA 5ICEA 1XHFA 2ZKLA 3FSGA 5CH5A 4NDAA 4ENPA 3EMDA 2I1QA 4X0EA 1IE3A 4XWTA 1KJWA 5H81A 2OCDA 4ISBA 3WFIA 3I76A 5AHWA 1GPLA 2VDRB 3S44A 2C0QA 4RLQA 4NESA 2FPPA 1U3VA 2HHHB 3NC0C 3ZY6A 1Z0AA 2HSJA 1VL5A 4QGFA 1L8AA 1XQVA 3VSBA 4EA8A 1RAHA 4PHFA 4ENRA 2DSTA 1L1EA 2B8NA 3IQGX 4OF4A 5J5AA 1GLGA 4F12A 5KQGA 1M2VB 2Y93A 5AKXA 2C1EA 1KEWA 3NV7A 1XU7A 3EIQA 4M0PA 4W9NA 3V4LA 5F51A 4D4LA 1J90A 2D1QA 1YFJA 5CJPA 5AUOB 4W5WA 1Z5GA 1SH7A 4GP6A 4LEIA 4PINA 2Z6VA 5BNFA 5H4HA 1ULHA 1TU0A 2RHDA 4J1TC 1IIRA 4PYOA 1F8FA 4F3KA 3S99A 2OG2A 1B0AA 1G18A 1JKJB 5KTTA 2OK7A 2WD7B 4XYEA 3AI1A 1KPGA 4MIEA 3HJGA 5DM0A 4CL0A 1M8GA 4B3JA 1CUEA 1D6JA 1VMAA 4BYGA 2LCIA 3AOGA 3DAGA 3SE7A 1CS0B 2ZSUA 2FW6A 4I1RA 4R3WA 3BREA 1BX1A 1LRLA 3M3PA 1LB1B 3COVA 2VLBA 2GNAA 4X6LA 1YMUA 1DKRA 2RH4A 2KB0A 2VHWA 4BNMA 4BJ1A 2OCKA 3BGSA 1FE8A 1SZCA 4ZI3A 4YBZA 5BOSB 3UAYA 5IJ0A 5KVCA 3IO5A 3LPNA 3SZMA 1GZHB 1A77A 1U1GA 3OY7A 2ZPTX 3N86A 4I6JA 5CR9A 4BX2A 2A4KA 3PIIA 1MJ5A 4TLDA 4KIWA 5CX1A 4PR3A 5ED4A 4CL3A 5KYGA 2FJ0A 4KAFA 4ZVOA 3MTDA 4U2DA 3LK6A 3THOA 1NJ2A 3ZN2A 5KQSA 3QWBA 2TRSB 1ZH0A 4ZRMA 3D6JA 3S1AA 1YFLA 1M1UA 1DBIA 3WA7A 4FNOA 1J9ZA 1IY1A 1CRPA 4A73A 3MJ4A 1U7WA 4DV4B 1ZU5A 1EDOA 5KVAA 2G1KA 5EHGA 4ZDWA 4ZCMA 4JXJA 3QU2A 5AD1A 5KYNA 4MWDA 2HLPA 2ZIXB 2PU5A 3R8FA 3E1KA 2EJVA 1JFFB 3I5AA 1XMXA 1T2AA 4FLFA 4U7GA 2AFHB 3VUFA 3L92A 2ZJFA 4RLHA 5KNCA 3NOOA 3C1OA 2FRVA 2XB4A 1A9YA 4HQFA 1P5FA 4I7EA 4HFJA 1QLHA 1W0KD 3MF4A 3FPSA 2O1WA 3O0DA 4YCMA 2ZB7A 1ODSA 3D64A 4H27A 3NU1A 1TQ6A 2JCVA 1PG2A 2EKZA 3UB3A 3C6XA 3DMGA 1KHTA 1ZSNA 4FINA 3D0QA 4E5KA 1FU4A 1MENA 3L0DA 2MWMA 3EEIA 3MGGA 4MWEA 4OJYA 3ICWA 1YF3A 4MCHA 1K5GA 4I1PA 1YVEI 3MCWA 1XVVA 2EX0A 4ND6A 4Y6SA 2PTHA 3R1IA 1RLJA 1LWOA 1JR3A 4UPDA 3LW7A 4PRZA 4UUPA 3IVRA 3PHLA 4JI3B 4RMIA 4DIUA 4DS3A 1QS0B 5MN5A 3VR6D 1Y4ZA 1X8XA 1YAJA 2RCYA 4L5YA 2VRCD 2RK4A 1KRWA 4I5DA 3ZHQA 5KNBD 3FA2A 2B4YA 2GTHA 3L6DA 4F3YA 5IJXA 5L53A 1N5MA 1KDRA 2QZSA 4INAA 4LJKA 4NWIA 4RK6A 3H05A 1P7CA 2EIHA 4J0KA 3LWBA 4LGVA 3QUTA 5EIBD 2Z8XA 3SBDA 5I9BA 1OFUA 3FF1A 4Y0AA 4P53A 3SU8A 5B1YA 1OXXK 2JLZA 3WZLA 4LE0A 3HK2A 1GKLA 1NIJA 2HFJA 2QVYX 1SXIA 3KBOA 5A6VA 4IOLA 1NSTA 4B6JA 3O9VA 2R65A 3TQHA 4FCWA 3AFNA 5TV2A 1GTL1 2GN9A 4GOND 4I1YA 2Q4TA 1XO1A 3HSSA 1XFAA 2Q49A 4B4OA 2XQIA 3EDMA 2NADA 1UC4B 1HZJA 5HW0A 1B14A 3H9JA 1RRCA 1BGXT 1R88A 2DWQA 3TG2A 5J3JA 3PQFA 5BUQA 4OBBA 4YRMA 2R7KA 4BEBA 3EQ8A 1V45E 3MTBA 4MUMA 1I3KA 4OJKA 5EXEA 5GP1A 3TLZA 1ZNZA 4ZTZB 3HUEA 1ID8A 1ZMTA 1Q1EA 2VBCA 5F1KA 3RF7A 1MO4A 2XMDA 2I6GA 5FPKA 1I2ZA 1BIFA 1X86B 4LZZA 1AMNA 3ET5A 1T0UA 5JATA 1PQYA 2B9VA 5KTMA 1UKZA 4WOBA 1E96A 4MQUA 5IS2A 2WHPA 1G8MA 2JI7A 2WHQA 1RPNA 2ARKA 5LUBA 4IL5A 1B8NA 1X1RA 3OQ1A 3GLVA 1XRQA 1T2DA 4JVNA 3FWNA 2FN4A 4XPIA 2YIJA 4D41A 4P5EA 3LC7O 2BMDA 1SXHA 1PJTA 1DIHA 1D2HA 2OOSA 1SXQA 3H1EA 1RWKA 2JGDB 4FMCF 1TLLA 3D3QA 5ERXA 3ZZUA 4EPRA 1NVKA 2CMFA 1SQSA 4EZBA 2FFAA 3IP6A 3DOOA 4CV2A 4TYYA 4L3OA 4OI1A 1SCAA 5TVGA 1YHYA 1YIOA 4QYSA 3OM8A 4KZKA 3D7MA 2Y1XA 4LZJA 4YQYA 2UZ1B 1QF9A 4ASUD 4H15A 4NTZA 4P2BA 4INZA 1QZTA 2JLSA 4TL9A 2QPLA 4O1HA 4AZWA 3ZWNA 1W4CA 2LW7A 3VH2A 5A3JA 1SR8A 4EARA 1H1TA 4RE6A 2G5TA 3R0VA 4B0PA 1XEXA 2WJGA 4EDHA 1CDDA 4NYJR 1OKKD 1YBMA 2Y3IA 4C4SA 3RJ9A 1MCZA 3WL5A 4EJMA 4ODIA 3WC4A 2IBTA 2GJKA 1JHOA 3IHTA 4TROA 5F64A 4XM0A 2BBOA 2YC2C 4ND2A 3VYSB 4CQLB 2WAXA 3G0CA 4BUZA 1HMPA 1RMQA 3R8XA 1EB8A 3ROPA 4AIRA 3TDNA 3OFNA 1B4DA 3BF8A 3ROXA 3SI7A 5FUYA 3X1KA 4KQ9A 4TTIA 4O3MA 3RVPA 2X2EA 2BHLA 1Z7YA 4JEHA 4Y0NA 4WIAA 3P5SA 3ROZA 2CHUA 4FLMA 5JCJA 5JXWA 4JOQA 1K6EA 4YMWA 5JTTA 1YZHA 1Z2AA 1ZG3A 4D0GA 3SIPA 4UOEA 2CHEA 1ZJ5A 4EHNA 4PGGA 4H1VA 1W8DA 4R1PA 2EU8A 3EEFA 2GWHA 2OB2A 3OURA 3P2OA 4L27A 3K73O 3ZOKA 3IP8A 5JNWA 1RPZA 1CUFA 1E89A 4YRRA 4KOEC 4RTLA 2ZEJA 2VDWA 2O2CA 2YOGA 1OF1A 3EE6A 4UM5A 4W5QA 4XUEA 3KOUA 2VAXA 1GAEO 1JYSA 4CI9A 3GP5A 3DUWA 1LW7A 1LQTA 5ARDA 5INTA 4KODA 2XUPA 4UHEA 5EXTA 3WRVA 4YGYA 3UT6A 1ZAYA 4BNXA 3KB2A 4FFRA 4HD8A 3OP1A 3N3AC 4LC9A 1MIHA 1G2PA 3ANLA 3R0XA 4XJSA 4FVTA 5EHZA 3EA4A 4QBFA 3ZJTA 1CJSA 5FTKA 2BKVA 5JH7A 3JX9A 1T8PA 2GD1O 3NV9A 2PMWB 4PSAA 4Q01A 5JAHA 3CRQA 5JTUA 1Y81A 4WZBB 1BVRA 5H70A 3L5OA 2OYSA 4RX1A 5KJCA 1Y6ZA 1GTJ1 2FP3A 2VP4A 3PQ5A 1VCOA 3GFQA 3WV4A 2HRBA 2CV1A 1XZNA 2O3RA 2QI9F 1RYMA 3AP1A 3SMQA 1B0PA 3L7NA 3WE7A 3WL7A 2VDKB 4D6XA 4DARA 1IULA 1CRZA 2ZI3A 5AFSA 3NCTA 4N6GA 2IELA 1JX6A 5CFLA 1VIMA 1LTQA 3ZDZB 1U2PA 2DH5A 2Q1XA 4R2HA 3SYMA 3TLAA 2XQJA 2HBYA 4O4JB 1BC5A 4DRYA 3OOEA 3GDOA 4TMYA 3AHJA 1E0DA 1GNSA 1R8XA 3MJDA 1C41A 5JZVA 3LCRA 3LT5A 1ADCA 2FUCA 3NH6A 3U5ZB 2D62A 4RY8A 2GRJA 2XXAA 2QMUA 2Y92A 4UDYX 2ZXUA 4HFMA 1VJCA 5DH9A 3T5PA 2YN2A 4UZFA 4QXAA 1SKMA 1JVBA 4M21A 2HJGA 4JXZA 2L69A 3TUJC 3JQAA 2C4HA 4I8XA 2BKLA 5CX4A 3PITA 1OBCA 2CVFA 1CJCA 2HK9A 1TEVA 2XDAA 4RQTA 5K0EA 3D4NA 1Z9BA 4FGLA 4WY2A 3G3EA 3NAMA 1QUEA 1SKQA 4RXMA 4GKAA 2BEUA 3PQ4A 2N9UA 1T9ZA 4OA8A 1LDGA 1TZKA 3P9YA 3MM4A 4CIYA 3FWZA 1GWNA 1LS6A 4HX9A 5THQA 3DCYA 4IDOA 4KVFA 2AW3A 3WJAA 2IWHA 4AN1A 3HWRA 3RYFA 3E27A 3B70A 4PS1A 1P4RA 2OO3A 3QFHA 2Z3ZA 4TTAA 3EVZA 3AJ9A 1YOBA 5G4KA 3RLFA 3YASA 4BQIA 1QTIA 1Z5UA 5ALJA 2WYWA 2INGX 4NHOA 4C76A 4YP7A 2I6QA 1JJIA 1P8JA 1YT5A 4FHGA 4JDPA 1VLHA 3KEOA 3O4IA 4PVDA 4ZTBA 2OWDA 4CF6A 1M5RA 1TT7A 3GDFA 5KYYA 2W42A 1PNRA 2R8EA 2AMYA 3TLGA 2E82A 5JZOA 1T36B 5H9VA 2PUBA 1S8NA 4LBVA 3O82A 1G21B 2YZNA 5DCWA 4W7IA 5G02A 1JFSA 4BMPB 1JG6A 4HH1A 2FPGB 1RQ2A 2BGTA 4LV5B 1TRHA 2L2QA 1L5HA 2ZSKA 1H6BA 4PICA 5LP6F 5EJMA 5F73A 2O3JA 1G8SA 2FPLA 2IQIA 2JJ8A 1YQXA 3P0RA 1O6ZA 1NMQA 1ZJZA 4PRLA 2XNDD 1BVUA 3ID6C 5AJTA 3KEMA 3J81k 3GW8A 2LD4A 1YE8A 1VI6A 4KJXA 1IZYA 3OLCX 4KXVA 1G6Q1 1XSEA 4H0FA 4FJ1A 4C89A 8OHMA 2E4YA 4ADSG 4O2AA 1PBNA 3GBSA 4S1NA 2DVMA 1GARA 3GVCA 3TINA 2ZSFA 2G1JA 4M0UA 5BUSA 2QVXX 3KBBA 2CDRA 4AP5A 2BGJA 4AY4A 5CFRA 3ME5A 5CH3A 1KH2A 4O4IB 1RPTA 1HNWB 1FRFS 3G79A 2OP0A 3GN2A 1XNJA 2XQFA 2YV4A 1NSYA 3GU3A 1XAHA 4LVUA 4XYLA 1QOPB 2ZREA 4IDPA 5SICE 5ALXA 3QE0A 3DMRA 1UODA 2MYPA 2KWIA 3L49A 2HK7A 2VAMA 4FPXA 4XFKA 1TVCA 3OLYA 4ARCA 1XVIA 1U3UA 3USES 4KOAA 2A86A 4GWLA 4I50F 3O8QB 2ZYVX 4HX2A 4DSNA 4OK3A 3SIXA 4DZTA 2IYYA 2FMXA 3M6WA 4RXUA 3L5KA 2A9RA 3TYXA 3TN7A 3KZMA 3SHOA 1PUIA 3SJAA 3VI4B 1D03A 4L28A 3UUEA 1CDZA 1OTHA 1G3QA 3AWIA 3DE1X 4JJZA 2G8LA 4HLDA 3QG5A 4B3MB 2F8MA 4GLFA 4P3YA 4D9GA 2QRGA 5MF6A 1DV2A 2IOYA 2XZTA 3GLHB 1JIQA 1ZC4A 2H2GA 4PN7A 1J22A 3FFAA 4Y9UA 4B2LA 5FR1A 3DVSX 3ETLA 3QFSA 3UMFA 2WQ6A 5DMXA 4P98A 4C4OA 4X1OA 3O8OA 2X0EA 3HJTA 4WGFA 2IDZA 2TECE 1YUMA 2FWMX 2REOA 2NXNA 4G8DA 1CLEA 4FDAA 4IDAA 4B4UA 4E7OA 5E1DA 4UOQA 2AOUA 5AK5A 3W2HA 1I3LA 3OPVA 4LKOA 2OWEA 4MRMB 3UHJA 2QTCA 4F4HA 2HQBA 2JLAA 3LVFO 3CRZA 1KQOA 3RCBA 3RU3A 2QUAA 2HLHA 1GYPA 2IUEA 4LXUA 3L3BA 5IKEA 4KSCA 3RNLA 1MR3F 3UAXA 1VQ1A 1ZM3A 3QLUC 2OXCA 5K2MA 3TECE 4N7BA 4BO9A 4I19A 4U5QA 3BHNA 5JSZA 4E31A 1F8UA 4HYYA 5DGTA 1EA7A 3C3AA 4AJ4A 9LDBA 4BEVA 1UBJS 4Q3OA 5LNK6 4C0JA 2OUIA 1K7XB 3WWYA 1FFSA 4GG1A 4E21A 3K2BA 5HEKA 2VQDA 3CZPA 3N2NA 4HRYA 3KYDA 1BMDA 5ESRA 1I3MA 1YR9A 2QRKA 3S7TA 5LBIA 3GLFA 2F3QA 8ABPA 5AVTA 1QIHA 2NT4A 1NW4A 4HQKA 3AOEA 1VLQA 4OPMA 1N6IA 1CUAA 3SSMA 1KEPA 2FSUA 5H1YA 4H31A 1SD1A 5AMXA 5LQSA 2G25A 3ZWDA 2QD3A 3AK4A 4MUKA 1RM5A 3MB5A 3ZK9A 4R1NA 2FN9A 4I5GA 4A27A 5CFZA 2HW8A 4YBRA 1SC3A 3INNA 1MAVA 3ZHSA 3DKVA 4D44A 4BKRA 5JY6A 5JJKA 4BU1A 4YLYA 1KK3A 2VWPA 4OKSA 4IKEA 2OFPA 4W7SA 1PFYA 2NQ8A 3A6PC 4DMLA 3DW1X 2C4TA 3DYBA 3Q6NA 3MGAA 3QKSB 3FOCA 3FCEA 2ECQA 5KYUB 2ZAIA 3UMYA 5FEUA 3Q0EA 1RLOA 1JDTA 4JSRA 5THXA 4OA5A 4YJ3F 5EP2A 4UQLA 4IW3B 3BS4A 2ZS7A 4ZEOA 4EGQA 3ZTWA 1IHYA 2WLTA 4P1ZA 3AZQA 4C0WA 1FZTA 1LVUA 1BJTA 1B2LA 2XA9A 4H6PA 2ZOSA 3G2OA 2W98A 5KDLA 4R0MA 5CYGA 2PXCA 3RC1A 3W8EA 4AS3A 1TVEA 4FOTA 4JSTA 4M1QA 2CXNA 1Y42X 3GPBA 4RD0A 5I9SA 1UXHA 4W8OA 2DR0A 3FMVA 4KK4A 3V8MA 3G6KA 5C1BA 1LF0A 3AJEA 1R9GA 1TFRA 3ANNA 3LY7A 4QJIA 4EK9A 3JCZA 2H1RA 4IINA 1N36B 2CT8A 5BVHB 3LLVA 3QBEA 1UDRA 1F60A 2C5BA 1CR0A 2X8WA 3SCZA 4CKBA 2Q3MA 2H06A 3V33A 1X2BA 1E5QA 1LLCA 1T2NA 2WYUA 3DO5A 121PA 3EGDB 2HNAA 2GEKA 3QM1A 1U8ZA 5DYTA 5EERA 4ABYA 5GADl 4G1BA 4D9CA 3ZLJA 3LIIA 3AM3A 1B0UA 4DM7A 3C7TA 3CLRC 1LFDB 3PRJA 4PQFA 4PAOA 1ZKDA 3DVAB 3MN1A 3OZVA 2WWWA 4BECA 4WKOA 3PRHA 4D0SA 1V1RB 4QAQA 2RG7A 3A36A 4HBGA 2PVPA 2WD7A 1L5LA 2BFBA 1T4BA 1DP4A 2I2WA 3WKEA 5HE8A 2C4MA 4TS9A 2B82A 1I4TD 3OQ6A 4PFKA 4Y3UA 4EUFA 3PX2A 1UQUA 2PZBA 3VYTB 1E6CA 1CS0A 4FCTA 1NMZA 2Z0MA 3H1PA 4JYMA 5CUQA 1XZMA 1PRYA 3WMXA 2ATIA 5BOSA 1JPJA 1JFLA 4WXRA 2C00A 1G64A 3LCMA 5IMBA 2QJOA 4AY5A 2ZBGA 2B30A 3CSDA 3R40A 4MW6A 3RS5A 1IAVA 4LJSA 4CDGA 3I6IA 3MCVA 5FA6A 3ZPXA 1DJNA 3DF9A 3DKIA 1F6DA 2X0IA 5IVDA 5ITZB 1F7UA 1RVDA 1XLVA 2GLXA 4OHOA 5ALHA 3L07A 3IPAA 1XOIA 1EZ4A 1JR3E 4HLUA 3HJAA 3EFHA 3B8HA 3P9KA 2Y0PA 1M66A 3WYGA 5FAXA 4BO5A 2R8OA 2C4WA 2B1QA 5TT0A 1FNNA 2LUOA 1G9TA 1OD6A 3ZDDA 1JFRA 1XEFA 3RRXA 2HGZA 4C08A 5HTKA 1SC4A 2R6ZA 3D8UA 1OASA 3GUHA 4DLXA 1V95A 4IDFA 3QNMA 4GMXA 5DE3A 3V8RA 4AW9A 4BX3A 4CG2A 3GQBB 3MMPA 3RS3A 5JJBA 1SN7A 3ND5A 3DPUA 1FLVA 4Z0TA 2ZIXA 2J08A 4L02A 4L5CA 3A1SA 1JFFA 1ULTA 5DGCA 5GVRA 3WB1A 4UHBA 2IVZA 3THYB 4TYWA 3I83A 4XGIA 1QQ6A 3CH5A 3JQRA 2ZRMA 4RPGA 5BQXA 5FTLA 4LZNA 3ZWYA 4JBIA 5DHQA 4XLLA 1JLKA 1GKUB 1T10A 4IUBS 4HMQA 4K6KA 4E88A 4JHXA 1VJ1A 3DZDA 3M6AA 5C46F 1ZA1A 5ICCA 2Q9AA 4P4SB 5JV5A 2LCFA 4L9WA 2GVZC 1YFZA 1H66A 1GZDA 3FB1A 1JH9A 4X1YA 1L5MA 2H17A 3LCUA 3EG5A 3IP9A 3W8RA 4D97A 5JLJA 1TZMA 4J16A 2G9RA 5LA6B 4AX4A 1S5PA 2AR9A 2D3TA 4LMRA 3EAGA 1QS0A 2FDCA 2X3YA 3SS9X 1F0YA 5CBPB 3KDAA 2NO6A 4GOOD 4N3CA 4ON9A 5FCDA 3ZE8A 1MTOA 1UOOA 5E0OA 2NACA 4EHJA 2I4OA 3AB8A 3DE7X 3EIOA 4ZTUB 4N76A 3VVMA 3K1ZA 2ZSDA 4Z5XA 1U2GA 1E0JA 1OWOA 1XTTA 2L19A 4BYMA 1M3SA 1C81A 4RL4A 1FTNA 1IVNA 5T41A 4HXFB 3H13A 3LNTA 3FFTA 1IXRC 4NE7A 2NAFA 4OHYA 1N5RA 4IWYA 4FS8A 4WLFA 5BV7A 4IX1A 2O8DA 2A3RA 2VK2A 5IAKA 2EGUA 4HDSA 1GJRA 1KY5A 2ZRHA 2QLMA 4E07A 4HAZA 3MQ2A 3K70C 3V7WA 3DDNA 1YJAA 1CJUC 3ZU3A 4B6QA 1X80B 4FFBA 3UA3A 3VTZA 3SQLA 1JDBC 4HXYA 4ZI2A 3Q5DA 2QN8A 2F43B 3BSWA 2VLIA 1FMCA 3OE7D 4GE0A 4M22A 1UDAA 3KPJA 5AESA 1U02A 2C78A 3MQ4A 3AMVA 1MMFB 1IM2A 2HXSA 2W2QA 3L01A 1DIBA 4TKUB 3KX2A 2IOFK 4MROA 4EFLA 5BV0A 1SXJC 2P6NA 4AUEA 4S0XA 4TWRA 4DUGA 3NFRA 1L8XA 2FOLA 4ZOLB 5ABPA 1W7AA 3A9WA 2F3TA 2PMDA 3JYLA 3HM9A 4DVGA 1OROA 2FPXA 4BVLA 1C1DB 4MLPA 3U7QA 3U9SA 5EP4A 2AF4C 1AO3A 2DY1A 2Z8YA 2VJMA 5PGMA 4AS1A 2X8AA 4ZMBA 1KGSA 5EINA 4EAQA 1DXOA 2XMSA 4A91A 2V0CA 1MZVA 2FZVA 3FTNA 2HSWA 3KQMA 4GBGA 1JWBB 2Y1LA 2X5KO 5SYMA 1UZNA 3DMFA 3H8WA 3IIEA 4H1UA 2I6FA 3R3JA 2ATVA 3W2IA 1Q83A 2JGDA 3IMCA 1FCJA 2Q5OA 5IKOA 4CCAA 1E3SA 2UYQA 6CHYA 1DL5A 4OHFA 421PA 3DOFA 2CLLB 2H59A 2NM0A 3GT7A 4HBZA 5CLIA 1I3NA 2ZIZA 3AHIA 1OU0A 2II6A 1S8FA 4LGCA 2JZOA 4XW2A 3RS7A 3T4PA 3AVWA 3IAM6 4ZREA 2HT6A 4AKEA 2XKAA 1L5NA 3RW9A 2WM8A 5ILOA 2VYCA 2WP8J 3AONB 4MVJF 4RJJA 1BE6A 1M2NA 2W90A 4A2WA 2JLUA 4ND3A 1DI0A 1U2TA 2O3UA 2P6OA 5HF9A 2GZ2A 4RVSA 4AMYA 3VC2A 3D7SA 4G1CA 4TZ6A 4C7MA 3G13A 1ZN9A 1P1KA 2FSHA 3KYBA 4Y6PA 4Q37A 2IHUA 3M9LA 1EXNA 1UBKS 1IZ0A 4R40A 1KBQA 1QFYA 1RMYA 4E7PA 4URWR 1CK4A 5JDCC 2RHWA 3E61A 3OJWA 2AQIA 2Z08A 3EEQA 3FTEA 3BTOA 2HDOA 1UBHS 3IQWA 4I9FA 1RNLA 1MQSA 1GAQA 5DJ5A 1VJ5A 2HHJA 3B9QA 3MJEA 1Q21A 3QEJA 3IFSA 1IOVA 3KUUA 5E7QA 4CQLA 3MFQA 4BVBA 1BCSB 1AE1A 2K87A 3IX7A 5K0SA 4ZVPA 1KJ8A 3DFZA 1HY3A 2P1ZA 1C50A 4YRKA 1FRVA 4MKGA 2HMAA 2FG5A 3JWPA 4RVCA 5IRCD 1NOJA 1DUSA 2H8GA 2VT3A 2AEFA 2PCJA 3Q7EA 4MTCA 1O5TA 3DBIA 4O4HA 3RNOA 1E1KA 1UMCB 4LECA 5EE3A 2WWXA 1D09A 1ORWA 2WNHA 3TSCA 4Q4JB 4EYQA 4C01A 3AKZA 2RAVA 3GY0A 1Y33E 5AKKA 1RE0A 5EUCA 1N2XA 4N18A 3CG0A 5I8ZA 3PXGA 5L9AA 4FYPA 3U44B 3WFJA 4TLLB 1JALA 1FXWF 1G8HA 2VYNA 1ZI6A 2WUWE 4DIFA 4FZ3A 4WLEA 4IHJF 3KELA 3ZW7A 2GYYA 4B4WA 4JBWA 2FLWA 2JI4A 3VR6H 2J6CA 2EG5A 4IXMA 4Q3LA 1U9IC 2EYQA 3QGMA 2V9ZA 3D3WA 3RBVA 3NEPX 5KNBH 4IDGA 3Q9LA 4QLOA 5EIHA 1GPAA 3ETDA 3DV0B 3L79A 4LFBB 4B46A 4JFRA 4X97A 3BXHA 1QQ7A 5G3YA 4LRYA 1SUSA 1P4JA 1Y6JA 1NW5A 2D2EA 2WF8A 4QGBA 5IF9A 3PQ3A 3DGFC 3KV3O 1TNDA 1G19A 1ATIA 1M34A 2FFQA 5D86A 3TGPA 4R1OA 4JLBA 4JLWA 5KWEA 1PR9A 3DEIA 2X4LA 4X7BA 3CE9A 1L7RA 2YZGA 1XCMA 4O4JA 5AIAA 1NY5A 1U28A 2AUNA 1E2BA 4ETIA 3EBOA 3EGEA 1HFKA 1ZD5A 4QLAA 4HV4A 3B5JA 1N2CB 2Z9DA 4IOMA 2W2LA 3NKLA 4XIJA 4A92A 1MDBA 4YS6A 1P6XA 5SYNA 3ONDA 3BWDD 3KVOA 2PNJA 2I6UA 3H4VA 3IILA 1F3LA 2I1WA 4K6GA 4PX3A 1UKBA 1U2DA 3AC0A 2UVDA 2R68A 3VH3A 4NFLA 1N1EA 4QYTA 1UK7A 3G8AA 2WV9A 1NQ5A 1PNVA 3CLTC 5DLQC