2OV1A

Crystal structure of apo form of znua with flexible loop deletion
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
260
structure length
260
Chain Sequence
b'DAMDITVSIPPQQYFLEKIGGDLVRVSVLVPGNNDPHTYEPKPQQLAALSEAEAYVLIGLGFEQPWLEKLKAANANMKLIDSAQGITPLEMPGRLMVADPHIWLSPTLVKRQATTIAKELAELDPDNRDQYEANLAAFLAELERLNQELGQILQPLPQRKFIVFHPSWAYFARDYNLVQIPIEVEGQEPSAQELKQLIDTAKENNLTMVFGETQFSTKSSEAIAAEIGAGVELLDPLAADWSSNLKAVAQKIANANSAQP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Periplasmic binding protein component of an ABC type zinc up
molecule tags Transport protein
source organism Synechocystis sp. (strain pcc 6803 / kazusa)
publication title Possible regulatory role for the histidine-rich loop in the zinc transport protein, ZnuA.
pubmed doi rcsb
total genus 90
structure length 260
sequence length 260
ec nomenclature
pdb deposition date 2007-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01297 ZnuA Zinc-uptake complex component A periplasmic
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 2ov1A01
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 2ov1A02
4MDYA 3TLKA 2RG7A 3HJTA 4PAGA 3CX3A 5BVHB 2XV1A 4TKVA 3ZK8A 2XY4A 5KOHA 1FP4A 1M1YB 2R79A 4HMOA 2YNMD 5CR9A 2PS9A 1KAHA 3R5SA 2XDQA 3NU1A 5JPDA 1H1LB 2AFIB 5M29A 4MO9A 4LS3A 2YNMC 1N2CA 5FLYA 1TOAA 3HH8A 5GGYA 3MFQA 1QGUA 1M1NB 4NNOA 2M6LA 1L5HB 5JG7A 2PS0A 4HMPA 4IRMA 4FNAA 1XVLA 3TNYA 4XPIB 3G9QA 4TKUB 5BVHA 5JJ5A 4MLZA 4TKVB 5KOHB 3AERA 3AETB 4ND8B 3EIWA 3AEKB 1N4DA 2Q8QA 3MINA 2M6KA 5KOJB 2WI8A 3K1AB 4GICA 5JOQA 5CX1A 1FP4B 3PDIA 4INOA 1QGUB 3ZK7A 2XDQB 3PSHA 3AEUA 2OV3A 2PS3A 4XPIA 4K3VA 4H0FA 4TKUA 1MIOA 4UTPA 5HDQA 3TEFA 3AETA 2PRSA 4DBLE 1G20B 3U7QA 2QI9F 4WNAB 3MD9A 4UDNA 3MWGA 2XQVA 5KOJA 3AEQB 2R7AA 2XH8A 4OVKA 4OXQA 3AESB 3K1AA 5B58T 4FKMA 4MX8A 3PDIB 1G21A 4B8YA 3HXPA 1K0FA 3AEKA 4WZBA 1QH8B 3MINB 1PSZA 2O1EA 3BE5A 4M7OA 4WN9A 1N4AA 1K7SN 4NNPA 4WESB 5CX1B 2XUZA 2AFHA 3EIXA 5M2QA 4LJSA 3GI1A 1N2ZA 1M34B 4HN9A 4WNAA 4WZAB 5BVGA 1K2VN 4HMQA 2OV1A 3LHSA 1QH1A 5HX7A 3AEUB 5GGXA 3AEQA 2MINB 1KAEA 3AESA 2OSVA 4CL2A 1MIOB 4INPA 5KHLB 2WHYA 4UTOA 1G21B 4G09A 1G20A 3PSAA 3U7QB 3LI2A 4OXRA 3UJPA 3ZKAA 2PHZA 2Q8PA 4WN9B 1H1LA 4N01A 1KARA 3MWFA 4H59A 4WESA 4FI3F 1M1YA 2AFHB 2X4LA 4G07A 1M34A 3BE6A 1M1NA 4UDOA 4WZBB 1QH8A 4BBPA 4PM4A 5AFSA 2ETVA 3ZK9A 1EFDN 2AFIA 2MINA 5M3BA 3ZTTA 1PQ4A 1N2CB 2OGWA 3AERB 3R5TA 4FILA 4ND8A 5I4KA 1K75A 5M34A 4WZAA 5BVGB 1L5HA 1ESZA 1QH1B
chains in the Genus database with same CATH superfamily
4HATA 3ZLBA 3KPVA 2H6EA 4PYMA 3IKMB 1Z56C 2C94A 5BW4A 1XPOA 4JP8A 2VPIA 4N7BA 5KJ1A 2Z3VA 1HI9A 3A1CA 4KDCA 1LPMA 2R79A 3H2ZA 4HDRB 1JSZA 4PTZA 1LFDB 5ALRA 5DYNA 1YFJA 3BMCB 5EY5B 1NR1A 3B2QA 3EYAA 3ZJ5A 1BU8A 4ARCA 1EGAA 3G59A 2PH5A 4AJ4A 3L04A 5JCXA 1W59A 2AJ8A 4GPEA 4NWIA 4UREA 4E4TA 1GRNA 2FEXA 4XWTA 4YJ3A 1E2KA 2B0CA 4BN5A 4NBRA 4H77A 1QGOA 5IG2A 1QHIA 1UWCA 1R0XA 2VTDA 5LZ2A 1UBTS 2Q4RA 1TRKA 2OLJA 1TAUA 1VRCA 1WB4A 2HLDD 2D8AA 4JR2A 3FCXA 3UCFA 1P4JA 3AF3A 5KJ6A 3THXB 2CLFB 1QONA 2QMQA 2QV7A 2BKAA 2PUJA 4J4TA 5TX7A 4GOND 4C78A 4Q1VA 4WXHA 3ER8A 1Z3IX 1EJBA 3PC6A 1RNLA 3AY0A 3EXEA 2ODNA 3RQSA 1K97A 3PFKA 4O4HA 3VH2A 1GQYA 1R3UA 1WLYA 1R6XA 3QITA 1J0DA 4TXMA 1MXHA 3LUPA 4EI8A 2XR1A 2H8GA 5H83A 2DBRA 1CIJA 2W9XA 2CUNA 1J0BA 3OIFA 4US1R 5JCOC 1US8B 5E6RA 3TOZA 3WIOA 5M04A 3F6PA 3HDVA 3LX5A 1WDMA 1X2BA 2P2SA 1GCIA 3GT3A 3H1GA 1RVDA 2I2AA 1PS8A 1RLUA 1ITZA 1M2OB 1Q1QA 2J5XA 4I1YA 1TA9A 4PZPA 3RS2A 2BTQA 4MV0A 4DEXA 4KV9A 3LUHA 4AT1A 2O8EB 3NYWA 1U99A 4TUYA 2VDJA 4TUYF 4CDMA 3HBAA 4PZAA 1YJAA 1SRQA 4WV3A 2DYKA 4EG5A 2G1KA 1MEEA 2BGLA 2DTXA 3EMDA 1JU4A 3GBVA 4U5QA 4B8WA 5L4LA 3GMTA 3ANMA 1Y1PA 4FONA 3J7TA 1XA3A 1NMYA 3QEOA 3OJCA 3O4VA 2GOYA 4FYIA 3R5JA 1OSNA 2E4UA 3QW4B 4A8JA 4RLFA 1YI1A 4PSDA 2W90A 3FPEA 2RAVA 1G3QA 5IHPA 4P93A 1WUJS 3UUGA 3W3ZB 1BTOA 3K4PA 4ZHQF 4UPDA 3K9BA 2IZ7A 4ZVOA 3UJPA 4RVNA 5IULC 2CT8A 1PVOA 3OEEA 2XB9A 2WU3A 1RXWA 1OE0A 2GHIA 4EQ6A 2ZJZA 2ZI9A 3C45A 2HQBA 2QLMA 2O14A 3TUIC 4H1TA 5CAEB 4DMLA 1OC4A 1Y9ZA 3L7JA 1A76A 5AVXA 2PZKA 1VMKA 3NHJA 1RQXA 2V7GA 4PINA 5BSTA 1PNQA 3DZFA 1JDTA 4DIFA 1YQXA 2X2OA 1W36D 4UPEA 4P54A 4PPFA 1N2CE 3G49A 4PO9A 4JGBA 3ZCXA 3ACBA 4E1BA 5JALA 2IYFA 1PL6A 2YYSA 1VJ5A 3U5ZB 4FKBA 4EYKA 1O6CA 3JZAA 1TVCA 5ECDA 5BWCA 1H4QA 1C8BA 3I2IA 5BNFA 3KKMA 3QENA 4R68A 2VH5R 3ZHUA 4WACA 3ZUGA 3Q3CA 1M2FA 1U3CA 4WN3A 2Q6IA 3R5HA 1X94A 4MV6A 2VZ0A 1RRGA 3GY0A 3IT1A 4F6LA 3UJDA 3EE6A 5D6OA 4CTNA 5HIKA 4E5KA 5M29A 3O8BA 4JBGA 1EX9A 4EHJA 4Z4GA 4DAEA 2D5LA 3DWIA 3P2OA 1JQJC 4E6EA 3UMBA 4D96A 5FADA 2WICA 3F5DA 1AQNA 1R5JA 2CB0A 3H2JA 3HJAA 3SR4A 1AU9A 1H1DA 2C4VA 1VA4A 3E8XA 5WRFA 3FXAA 4GXRA 1MB3A 4NZ9A 2IV2X 2GCIA 5IKMA 3DH0A 1JKIA 2VPPA 4KSYA 3HXKA 4YRCA 1GUZA 4OHZA 3IE1A 1A04A 1ZM4A 1ZMXA 1XTKA 4S1NA 3SYKA 5C37A 5I7WA 4KO2S 1XJ0A 2HF8A 1SR8A 5CJJA 1S0UA 3R5FA 5HF5A 2YIVX 3CF2A 5H3CA 3C5HA 1GADO 2LV8A 3GCGA 3MWYW 4RIEA 3GBPA 4HR7A 5AIBA 4OLBA 1ISPA 1JZSA 3NV9A 4GKVA 3QBVA 4H4CA 1T4BA 3NHPA 1VHDA 4QXOA 2UYGA 4X41A 3W9BA 4DV5B 5INTA 2YRFA 1GGNA 4FFOA 4EJ0A 3WGIA 5CDUA 3T38A 5IP5A 1IY1A 2XAUA 4JEMA 3F1KA 3GIDA 2Z30A 1DI0A 3BQMB 4KXXA 1XTRA 3SNKA 4M0CA 5BQPA 5SZKB 1SFRA 4UM5A 5ALQA 4EJ2A 1ONBA 4GLOA 1VGVA 3K1JA 2CUZA 2MR6A 4BVLA 1CWUA 2ZJBA 4D99A 1CDEA 4J4HA 4TLEA 1AS0A 4XGNA 1XB2A 3LWBA 4NYIQ 3OHPA 1CUUA 4ND4A 4I9FA 2IIVA 3M34A 3ZHTA 2A9QA 3D6FA 4G4SP 4IPTA 4YAEA 2AZTA 1U4NA 1FPMA 1G8AA 1VB3A 2L69A 2QSUA 3NORA 2H0QA 3PC3A 4KQXA 4G2TA 2W2VA 3LLVA 3L4JA 4QM7A 5EZYF 5B1DA 4C06A 1NW7A 1IK4A 2XWJI 3QBDA 1VA5A 4M9RA 4ZOQI 3IILA 1DG3A 4PSKA 5I7OA 1HYHA 4I14A 5K4HA 5LWHA 1G21E 4QBTA 1YVUA 4EGAA 4KUHA 5E6UB 1PWZA 1QIFA 3R7FA 4E1VA 2P62A 2NU6A 1VL6A 2PHZA 1BQ3A 2XZTA 3T5TA 3TZCA 5K20A 5BN5B 3B1FA 3BGOS 2O2GA 2UZ0A 3CWCA 1Y34E 2C54A 1R6BX 2JAWA 2O2YA 5IF3A 3REOA 3UVEA 3E5RA 1H2BA 1QKKA 1YS2X 2W6JD 2ZBPA 4RL4A 2QRVB 4UDOA 4DCJA 4RX1A 1AC5A 4BFXA 3MCTA 4MR7B 3MWJA 2YUTA 3ZHXA 3OQJA 2XMQA 4CR7A 4QUBA 4BNMA 3KLBA 1YRBA 3AERB 3T5GA 3RVLA 1QE3A 1PJCA 3VC7A 2YWDA 1GD1O 1VKHA 1MBZA 3DHWC 4E4RA 1VYTA 2D00A 2FLKA 5CT6A 2V6FA 5AWFC 1IUKA 3BZWA 1WMEA 2YBDA 2L17A 4HS9A 1P91A 2IUSA 4MJXA 4TGLA 1L7MA 4PCVA 1NXPA 1SKYE 2C7QA 2BFOA 5TDHA 5H0IA 5A5FA 1ODFA 4HFRA 3F4LA 3N0RA 4F9EA 1QUEA 1ZQ1A 3IP6A 2GAIA 2RGXA 1FLVA 5IJ9A 1L5QA 1H2ZA 1M8GA 4QJ4A 4WERA 3ZWVA 5BV2P 2H1FA 1I94B 1NW8A 3H2HA 3QY9A 4N03A 4R9SA 4EPYA 3DAPA 3AIOA 4OBWA 3KSDO 1EWRA 4DR3B 8GPBA 1HQYE 3O2JA 3WYBA 4CM9D 2OZVA 2NV2B 5IT4A 3GH1A 2JLUA 4ER3A 2WHPA 5AUPB 1DVRA 1IPFA 3NV7A 5KYWA 2X0NA 3N2LA 2CHQA 2K4MA 2JFBA 3F49S 2DSNA 1Y8QA 2WF5A 4PYJA 1BWSA 4N5MA 1YS9A 3PDWA 4HGPA 1OBFO 5B3JC 5EMMA 3VR3A 2IU4A 2V96A 4JI1B 3COJA 3A4TA 3RIEA 2X19A 3ADBA 1QGUB 4F6CA 3WGNA 3BXXA 5DHTA 4NSNA 4I9NA 4A0HA 3DBVO 4HNAB 1T5DX 3VU9B 3BGWA 2ZWIA 1T1JA 4FEYA 5CFPA 5CB4A 2AK3A 4NYJQ 1KMCA 4BMXA 4DBLE 2EQBA 1IEWA 1DMRA 2O5EA 3GJ5A 1PP4A 1G8PA 4YRRA 3PNYA 4TQGA 4WKPA 5IK2D 5DO9A 3ESAA 1TCBA 1SCQA 1PGNA 1YQDA 3CEPB 2F2TA 3K1AA 1ZUWA 5COAA 5JH7A 2I99A 2GJKA 2IPLA 4DEVA 5K6TA 4H31A 2IYWA 3MUOA 4IUCS 1TZKA 4DMRA 1QG0A 3GAFA 4G9GA 2WUGA 1QH8B 3AMVA 4RORA 4XR9A 4LZOA 4EHNA 3NHUA 2VLIA 1I51A 1N75A 3NIDB 1HYBA 1XCGB 3L7IA 2P9FA 1HLDA 5F77A 1E3IA 2PZGA 2COUA 1PD1A 4ER7A 3I23A 4OQFA 4D4MA 4MVJE 5JASA 3KYBA 2F7SA 1QF9A 1O58A 4REOA 3T0GA 4XPZA 5J4YA 2FSPA 2HADA 2C2WA 2WMYA 1XRMA 3A31A 3UB2A 1RADA 1R5NA 1VQ1A 1RLJA 5HFJA 4F5EA 1TVMA 2PO5A 3BTVA 5FQOA 2WRZA 3LFHA 3F1LA 1YCFA 3BUSA 2VA8A 1UQRA 2J6CA 5E1MA 4X90A 3BA6A 1GT6A 3NWPA 3WDLA 2QLLA 5IT0A 2PQ6A 3KJXA 1J2TA 1FFXA 1PNTA 1RTKA 3B8EA 5IMBA 4HFNA 3CPJB 5BSEA 3NWEA 4Q4AA 1C0EA 4W4TA 2F6RA 4OXIA 3ZCTA 4J29A 1L4NA 4FYJA 4YUVA 3AM1A 2HSDA 3EVEA 3WMGA 1Q0LA 3OTHA 3FPAA 2C07A 4JA2A 1J8FA 2ENWA 1NMEA 1PSDA 3GNTA 5IAGA 4EX7A 4KGVA 4H1WA 5KYKA 3HKBA 2IXAA 3PKJA 4S04A 2HUPA 3F71A 2YRWA 1DJNA 3AHHA 1C9DB 2CKDA 4JC5A 3Q9NA 1KO7A 3ZOZA 3D8SA 5B5SA 3KPJA 4RNCA 3F9RA 3GL9A 5J23A 1E6LA 4R1TA 3ZBQA 3HN6A 5D87A 2XOKA 4HH4A 1R2QA 4IHKA 4GVLA 1I2ZA 4J4BA 4QU0A 1RM3A 2OHGA 3U56A 1XMIA 1ANKA 4FK8A 2GUGA 4MW4A 5PGMA 2FEOA 4ZKDA 3KUCA 4YP9A 4JJIA 3SZRA 2QQ0A 1ZJZA 2I65A 2XKAA 2XE6A 3AFMA 3GNSA 5FNVF 1HRDA 4V0MA 2Z2YA 1GKIA 1QGUA 5J3JA 2CXUA 3VRHA 4FGSA 4IUBS 2BJWA 2ZTMA 1OLXB 2BBOA 3AH8A 3MTJA 4JN6B 4R1QA 1UH5A 3GJ0A 2PFGA 3JVDA 4LZLA 1KHHA 3LZDA 4EVQA 4A2QA 4E4YA 5BQXA 3ZJYA 3C85A 1EQUA 1YNOA 3QLVA 2RGBA 1XZJA 5C1DA 5B3AA 2X41A 4KREA 2UZIR 3V4OA 1GPNA 1N9ZA 4CQMA 4AKIA 1UK8A 2J0EA 2Z57A 3R6WA 1ZKMA 3AF0A 1QQBA 5IAAA 5CX1A 2WIBA 3UJCA 3A27A 5DPMA 1TK2A 1U2DC 2V7TA 1YD7A 3IVXA 3CTPA 4X00A 5GM1A 3T52A 2FMTA 1H2EA 4G5QA 2WU8A 2C7BA 3FX2A 1PR5A 2PXXA 4DCSA 1FNCA 1X77A 4LXGA 1JYSA 3V1YA 4XTRA 3IPXA 3NFRA 4RA6B 1U1EA 4RWZA 5DGHA 4DB2A 1L1QA 1TX4B 3AF4A 4HFMA 4I99A 1AA9A 3G82C 1XZQA 4RTMA 3EQ2A 1A4XA 2PU7A 2WUDA 5JJLA 4IZIA 1ZRMA 1J9EA 3LCMA 2H1SA 3I61A 1TJYA 2FV8A 3A6JA 2BP7A 4UBIA 4YJ3F 1DKOA 2JCYA 1M0SA 2VJLA 3NBQA 4RCVA 3TR6A 5C35A 3P9CA 1U2PA 2IXBA 5K0SA 3A32A 3B3JA 1P1CA 3OMLA 4LZNA 2HHHB 2O2HA 1YR1A 3NIFB 1A9TA 1NV9A 4G5FA 4S0XA 3PGJA 2DWCA 1BN6A 1OX4A 3CLRC 5BN1A 2FPIB 1QH1A 1T6BY 2NT3A 2Z8ZA 3B1JA 3OQIB 2O48X 4UTVA 1XNHA 1IHPA 2FUG1 3IUMA 4N65A 1TEVA 2N0SA 2PUWA 2QLJA 2YY6A 3SYNA 4PZ0A 1WS6A 1E5XA 3M3DA 3ZBUA 2HK9A 3E9CA 3O2SB 1KJ8A 2FW6A 1W36B 4FOSA 3PXCX 1UMCA 1ZBQA 5BUCA 3AZOA 4UMDA 5KNLA 1WL8A 2IP2A 2Q8NA 2YHUA 3SGLA 1ZG3A 2WKPA 4DLNA 3MJDA 1E18A 4I55F 1SKYB 1H3NA 3EFOA 1R74A 1ORTA 4RJLA 3KETA 1O87A 2H2HA 1NOIA 3HN2A 4FMDB 4FXOA 4IDPA 5HF8A 4XEUA 3H6GA 4FMPA 1X3SA 1CS4C 1VCHA 4Y9UA 4PC3A 1TIPA 2HT1A 3RLIA 5J40A 1YI8A 3KLPX 2Y1KA 1A7JA 1WKVA 3BWDD 4NMXB 3AZPA 2IEZA 2ZR0A 2CSUA 1B0PA 3O3OB 2CVZA 1I2MA 1M73E 1BOOA 1ID8A 3PTLA 3NWJA 2PWAA 1GAWA 3DP9A 1M7BA 1A9XA 1I2BA 5H1YA 5HCNA 1NY5A 3GAZA 2ADMA 4YLYA 1DWUA 1URPA 1UBSB 1CUZA 2ZUBA 3UK1A 3K0FB 1KMHB 3B1VA 3ESRA 3PCTA 4XIGS 2OBFA 3L4BC 4KQKA 3ISJA 3KZNA 4KKXB 4KJXA 4ZEWA 2D2EA 1N2SA 3B52X 3H42B 4Q00A 4F45A 2QRVA 1XLVA 1K7CA 1EM6A 2M6LA 2JIZD 1I3OA 16PKA 1H6DA 2VP2A 4NENA 4WT7A 3SX2A 4MYHA 5CBKA 2IU0A 1WTAA 4YFVA 1L5LA 2P9ZA 4AZTA 2YJ6A 4IXDA 3F6SA 3L93A 1NLUA 3TINA 4D8UA 4RA6A 3L79A 1MXFA 2ONCA 1KP9A 2GF2A 2Q3FA 2WZCA 2CK3A 3HU2A 3KAJA 3HVRA 1HYQA 3A4YA 4F2HA 4EDHA 2F3RA 3BD8A 3MBOA 2PXCA 3K9FC 3ENVA 3FW1A 5B4UA 3I04M 2QVYX 3KNZA 1O77A 1XAGA 1ZRHA 4UHEA 1CUSA 4PZ9A 3RKRA 4YR7A 3LZ6A 3D9QX 2XB8A 4IFTA 5REQA 2HLHA 3TDKA 3UMGA 4JQSA 4V1CA 3WAJA 2MYPA 2BZ1A 1CQXA 2F8LA 3I6BA 2RSLA 1WVGA 3JYLA 3VU1A 3UIEA 1XZHA 1A5BB 4ZK6A 3BWCA 4HTAA 4A7PA 4B6EA 4WKGA 2C2OA 1WMAA 4DDTA 4FOOA 3ZJUA 5ERGB 2WVJA 2JLYA 3ANYB 1E69A 2BSXA 4PC7A 4ZGWA 3K92A 3WQSB 4KI0A 4M8SA 4X24A 2P8JA 2P35A 1KTVA 2V3CC 2GFQA 2GZ3A 4FFVA 3BA1A 4FKMA 2BPOA 4NR0A 1L8QA 3CZPA 4LGCA 5ALKA 2R6FA 3AP2A 4WCFB 5DBIA 2OB1A 3RDPA 2AMVA 3FPJA 5AVKA 2F64A 1DWOA 2ZREA 3M6LA 4QFCA 5NLLA 5EMHA 3COPA 4MQ4A 1QB8A 5T3UA 4LJ7A 4NV1A 1XZPA 4QJIA 3EN0A 3T7CA 4EQ6B 2VNKA 2D5IA 4E3ZA 1M67A 4DV4B 4GE3A 1AB6A 4BP3A 4YECA 3W3AD 3QUAA 3NBUA 3DMFA 4TV8A 4WNAA 4DM7A 4H4EA 8ATCA 5JUWA 1AUPA 1FYEA 3PK0A 1C7RA 3RAGA 1L1RA 4JKOA 5T8KA 4K6OA 4HSEA 1WCWA 2IKSA 5JMWA 3HG7A 1QFSA 4JKYA 4QPDA 2GI4A 2IEAA 2WIDA 3CH7A 3EULA 4ZCPA 4FM9A 1ODJA 2ZE7A 1GUAA 1F7VA 5CLGA 2ZUSA 4TVSA 1AZSC 1YT5A 1YRYE 3O95A 4ZAXA 1HUQA 1Z68A 1IN8A 3QKIA 3ZV6A 2J3QA 3JARA 4H7DA 4QFMA 5FI0B 4CL3A 4BWGA 2PPVA 2VHXA 1BFUA 1MO6A 2FW1A 2QE7A 5CX4A 4LBWA 4TLMB 3U3RA 3U4GA 1FRVA 1S8AA 5DLYA 2GPNA 4ATNA 2W4IA 3JWJA 2MINA 3RS3A 5U4QA 1QYCA 4NJEB 1W5EA 3ZTWA 1E99A 3AR4A 5ALSA 4ND8A 1R8XA 4PGFA 1YTLA 1IATA 3G68A 5LLSA 1V8BA 2PEYA 3TBKA 3TSWA 1FDVA 2DM6A 4ZRMA 3S2ZA 1ST2A 2QUIA 3RC9A 4PSVA 1G64A 3RRJA 1QZUA 1RQPA 3WSTA 5ER6A 4KAFA 5IANA 1EFLA 2OO7A 1JDUA 2FMUA 1TVEA 2UXCB 3GHYA 1U0NA 3EPKA 1NVAA 5KUTA 1C1XB 2D2FA 4ZC1A 2FN3A 2C9CA 3SYRA 5AW6A 3NVKI 2ODPA 4S35A 1V4BA 2W2PA 4UJ5A 2IELA 2JIRA 1K4YA 3BSWA 2BZ0A 3WNZA 2XT0A 2GCOB 2J1LA 4YI5A 3CRNA 4EG6A 2OYCA 1EFTA 5I7SA 2XNHA 4TLCA 5T41A 1QO0D 2I1LA 1SVIA 5EQDA 1GAJA 4KOAA 1R4NB 1O8CA 3NOVA 3VR4A 1WB6A 1QP7A 1R4ZA 1MAAA 2XRFA 2VP9A 3H4TA 1XCOA 1L2TA 4I1OA 3D5TA 3QXGA 2R48A 4LXYA 4QDTA 1MH1A 2OFWA 3Q7EA 5IU6A 2EFGA 2ZSEA 3Q3IA 4UCQA 1EP2B 2H11A 2G36A 1XE3A 3ZY5A 4YXFA 1XO1A 4XQEA 1G7SA 4IIJF 5AM5A 5FHQA 2I4MA 4UFOA 3UKOA 1PR6A 3PEVA 5BPHA 3IMGA 5CPFA 2LRHA 2DBVO 1ZY2A 1PEAA 2JRCA 3FDZA 1DKRA 4FNMA 4LV8B 3L46A 2I4TA 3VZPA 2MSNA 4G97A 3KP1A 2QK4A 3KHSA 4MK4A 3R7DA 5EJ9A 1E7MA 3TB6A 1T1IA 3UFXA 4AX4A 2XB6A 2IC5A 3FKQA 4C4OA 4TV8B 4WNAB 2XVMA 3FG9A 1O94A 5KQSA 4XR4A 3CQ9A 4C14A 4RBNA 5ENDA 2GYYA 3BDVA 4P7KA 2LVBA 4B8YA 4RV9A 4YAFA 2OLEA 2XUOA 5F1KA 4PO8A 2X7JA 1SOMA 3QUQA 3L7AA 2GN0A 2CV2A 1V2GA 2IX3A 1DELA 4G0OA 2A84A 1FU8A 3G0CA 3GRCA 1A5AB 3KUDA 5BN5A 3SNHA 3WIBA 4DPLA 1S7GA 4ZYTA 3K09C 2CF5A 1PV1A 5CU7A 2OPHA 1N78A 5IN5A 2DULA 5EESA 4LJSA 2JGNA 2G40A 3CMCO 3VPFA 1BOFA 1R3DA 2A9OA 3KQVA 4G4JA 3DULA 4KXNA 2IOQA 2WILA 3IO3A 4HAVA 3PLRA 1WVIA 3DEFA 2Q9BA 2OV4A 3HCCA 4ZVVA 1K88A 2CMGA 3FUVA 1VGRA 4OQQA 4CL2A 5C8YB 2OR3A 3GFQA 3QFCA 4JJAA 4WTOA 4ZKEA 1M54A 3U7HB 4B85A 4DJJA 1BRTA 2W6MA 4UUMA 2EU8A 4W5HA 4MEAA 2VOEA 5E4FA 4ITVA 3H1AA 5I9IA 3AWIA 2WSBA 1M83A 1QVWA 4FE3A 1VI2A 3GRVA 2ZSKA 3QKUA 4TSFA 2QVXX 3C3XA 3K1YA 2JJMA 3PJEA 2BONA 1P2BA 3K2EA 3IP9A 3OFND 3FOBA 4LRSB 4PSCA 2CVQA 1VCOA 4Q18A 2DEUA 3WL4A 1I6WA 4RMNA 2OKCA 3HP7A 1GPAA 1SN7A 1A97A 2I1VB 2BFEA 4K9SA 1U6IA 1PUXA 4XVUA 5EQJB 2QZ9A 3P9IA 2OC4A 2YMQA 1M8FA 1Z6PA 1JR4A 1M6VA 5AVSA 1KI7A 1IH8A 4FNOA 1GSHA 3L7CA 4ZDIA 3K70B 1DMSA 4DR4B 3VOSA 3MCZA 5DNYB 3A3YA 2Q0XA 3PX2A 4TMVA 4HXGA 1SELA 4LY9A 5JATA 4LF4B 1Z0IA 1POWA 1CYEA 1UKAA 1Y1LA 3QELB 3TW0A 4LF8B 5C7YA 3P96A 1MD9A 2O23A 1QRTA 5TXGA 1XKLA 3H5VA 4W7IA 5JDCA 4UU7A 1TYCA 2ZCVA 1HT0A 2Q0QA 4QVGA 2GBIA 2IW3A 2YYYA 3LQRA 4RE5A 3LT1A 3MHTA 2WYWA 3OM9A 3OU6A 1RW4A 1AKVA 1XZCA 2GXUA 5EIOA 3STWA 4LOJA 5K8JB 3ZD7A 4P82A 4FR2A 3UJBA 2OORC 1GTG1 4LRUA 1N25A 3CYFA 2HRBA 1T9KA 1T9DA 1T26A 3BTOA 1UL1X 2A92A 3ESDA 3P9RA 3ZH2A 5JBIA 4DV2B 2SKCA 5BUZA 3TQOA 1TW3A 1U2EA 1NSYA 2GKOA 4XWGA 3KAPA 2YYZA 1QCCA 3UUFA 3UWMA 4AF7A 4E2XA 3LTNC 5CLLA 3WWCA 1YB7A 3H1BA 3P9NA 3IJRA 2FMHA 3SU8A 5C5CA 2WTNA 4R6WA 3RUAA 1I5EA 3K31A 3T7SA 2O59A 1U8YA 3PPXA 5KREA 2DHRA 3GRZA 4ZO9A 3QBEA 2OXTA 3U80A 1PQUA 3DBOB 4KXWA 4RGBA 1GFSA 3ZU2A 1BXRB 1TAHA 1UC8A 1YS4A 2ZATA 3DMNA 3O92A 4PICA 3OU7A 4IHJA 5DIFA 3RVJA 4E03A 2O5CA 2XGMA 3Q7IA 4OXXA 3ZV5A 5JANA 3SS7X 1Z38A 2DWPA 1T8UA 1MO3A 1GDTA 1T5OA 3GFRA 3KJQA 4UJ3A 3MWGA 5HZGA 3B8HA 1SB9A 1VJGA 4NZNA 2FSVA 3GJ4A 5DJ5A 3SR3A 3PEWA 2Y0PA 5HM8A 1YE5A 3LW8A 3PZRA 1ZCZA 3N8KA 3P5BA 1ADCA 1KS9A 1V48A 1D6SA 2B5WA 2M9MA 2GQ0A 3G2LA 4JDPA 2RGAA 4IIHA 4L5CA 2QRKA 4DXAA 3RAEC 1P2FA 1QO9A 4ZOLF 5F4BA 2X2EA 3FYHA 3PTZA 5KU7A 2OT3B 4AY2A 1F4LA 2ATEA 2Z9DA 4PTLA 5JFTA 4MS1B 1UANA 3QPWA 1NPYA 5C9ZA 2CXSA 4D0RA 4LBZA 1TMKA 3BMQA 3PF8A 3D6MA 1E3SA 4BECA 4M9UA 3VYRB 4CG3A 2J6HA 2AZ4A 2O2ZA 5UKDA 1SM4A 1N6KA 4G0YA 2DUNA 3RK1A 2QMUA 4BFUA 1RJWA 2QR3A 5IPFA 3CVVA 4BNNA 1ISJA 4KDFA 4UEQA 3H1TA 3WB1A 2JANA 5KPDA 1LDYA 2VHEA 4FS8A 2QQ5A 4IBOA 1J2JA 1LX7A 3P9XA 1OX5A 4X3CA 1U3UA 4CV1A 2GBLC 1DKNA 4QQ8A 4RH0A 3WIVA 4HTFA 2Q8PA 1YHYA 4G36A 1G6KA 4Z0PA 1J42A 1WSDA 2W11A 4GNKA 4UKDA 1RHMA 2P6NA 2HCFA 3VPBA 3IHLA 3QELA 5FFFA 4ALKA 3DTYA 4FE7A 5BYJA 4B7ZA 1QVRA 3Q87B 1FMJA 4IHQA 1NQAO 3PXUA 3HP1A 4PPGA 3HVKA 4JI5B 1Z7EA 3FWHA 1HXHA 2FZWA 4BPBA 4V38A 1OROA 1NXWA 5JSQA 1FP6A 1Q21A 1UPBA 2Z56A 3BILA 5L7TA 1DSSG 1E5DA 4EB6A 3PNOA 2O0LA 2UXBB 2CEKA 2Y4OA 4KO8A 4J3NA 2VP4A 2ESRA 1Q74A 2OOKA 3L7MA 4QG7A 3HR8A 3BFKA 5CPBA 3TLYA 1GCOA 5LWQA 4EKNB 3RKUA 1M1ZA 2HU2A 1PEYA 2YN4A 3HCEA 1P2GA 2E0IA 3P5SA 1EFVA 2Q1YA 1YDEA 5FBLB 1JECA 3SX4A 5MFZA 5DGXA 2REQB 3K5WA 2IRWA 1QFJA 2R1VB 2Q5JA 3GDGA 1WZNA 1U0TA 4NBVA 4LXUA 3UJHA 4P34A 3VSDA 3VPXA 1UDBA 2Y93A 3RT9A 4Y2HA 5AOVA 1NBIA 3FTNA 4BEJA 4K7JA 3DMRA 4EEXA 1QCYA 3ZC3A 2HHJA 1B8UA 3TMAA 2PX2A 2R6DA 1OAOC 5FI1B 2HBYA 2UDPA 2R4UA 3AM3A 3LSTA 3HA3A 1EP3B 5CT8A 5TT1A 5FCDA 2XA2A 3W2FA 1TM4E 2RHTA 2ZVPX 4G01B 1WY5A 2M6KA 5CITA 1NXXA 1HSZA 5DASA 4H7PA 3VHXA 1U0GA 5DCUA 2Z5FA 5EWMA 4TMKA 3TRKA 5JT1A 2XVZA 3EBOA 4AURA 3KJIA 1Y8RA 3Q9UA 3T5DA 1DFGA 4XYEA 4AI6A 3EDYA 3D2AA 4HCJA 4E31A 2ZRFA 1SXJC 1NBMD 1PDVA 4QT0A 4BFVA 1D3AA 1GTJ1 1JG6A 5HZKA 2RGYA 5ENVA 4FE4A 3EPPA 1RCUA 5CA0B 3LQFA 2RB4A 1RYHA 2CLCX 5E6UA 4ZVNA 5IVPA 4DV1B 4RQBA 4HPJB 5FH9A 3KWMA 3LPNA 3N3BC 3NPAA 3MCWA 4MVJD 4Y6OA 2OUIA 3QLJA 2EF1A 5EYPA 1T25A 2FGKA 2R6GA 1WUIS 2V0GA 3JYNA 4DKXA 1Z2DA 2Q46A 5ALJA 3R75A 5LQAA 2I6XA 2HJHA 4EG4A 4ISBA 2QX4A 3ORYA 4X20B 3RVDA 4JYZA 1XTBA 1TADA 2P9JA 1FUKA 3LX8A 1AZTA 1LK7A 1FU4A 2HK8A 3G17A 2CDCA 2VEOA 2CFOA 2AXEA 4J8PA 1ICEA 3WLKX 3TFWA 1ZD4A 1K5PA 1KOJA 2F43B 2HJSA 3FAZA 1W52X 4JASB 3VNRA 4B3XA 3AVPA 4DARA 2V5AA 2RGUA 2WAMA 3TD9A 1KEEB 1Z36A 5H9WA 1ORIA 4K46A 5FO0A 3M2PA 4L15A 3TTWA 2BLNA 3TQCA 1WSWA 4MWDA 2CBXA 3I9V6 2QT0A 1GQFA 4GRDA 1SUFA 5ELXA 4F2GA 5ESDA 5JZBA 5E4YA 1M2OA 3HSSA 2JCGA 2P9QA 3RH0A 2TMGA 5FTKA 1TFRA 4K6MA 3WGOA 2B4KA 3JVIA 4JWTA 1H69A 1VBKA 2D4HA 3N1UA 4M87A 4ZT5A 4ZT2A 3U7RA 3HKDB 1AGYA 3K96A 2WJ3A 2AOUA 2WNIA 3DV9A 3ZWBA 4BB9A 3K71B 4B6PA 4K03A 3F47A 3OZRA 5EE1A 1H22A 1PS9A 2RKWA 5B3LA 2OO5A 3C8ZA 4RTPA 2AFIE 1VE7A 1WSBA 5K5EA 2QZSA 4LXXA 4Z7NB 5J5AA 1C50A 5KYYA 2I0FA 2O8CB 1DC3A 5KB3A 1Q83A 1W96A 1NY6A 3KB1A 2EDCA 4FQ5A 5JCZA 1JEAA 2QTGA 3EGVA 4GQIA 4N7RA 3WNCA 4DLTA 4LMPA 1JG3A 1F0PA 2QZZA 1H2RS 4U7JA 2VHCA 1SOUA 2YY5A 1MOPA 3TTTA 3WRWA 4X0EA 3OQ6A 3W77A 3WK7A 4QYMA 5AKKA 3RG2A 3NBFA 2BCEA 3NDBB 2DECA 2HX1A 1CR4A 1DIBA 1W5AA 2ERXA 2VPZA 2XUAA 3AK4A 4MKZA 1VHLA 4XUGB 4C76A 2ZBDA 2Y67A 4ZO7A 4GYKA 5LPNA 1HDGO 4RQUA 2V7PA 1A50B 4LHEA 2WKWA 4MXDA 2VUTA 3JXEA 4MW7A 4OM8A 4C2BA 1KQOA 5I51A 5JISA 3NVMB 3NC0C 1T0HB 4WKBA 3V55A 3UT0A 2ZIAA 4CKBA 4POOA 1WZCA 3MPOA 2BJVA 1OX6A 2MYUA 3OX4A 4MW2A 3M4XA 3C97A 3WIEA 1I13A 5I9MA 3VISA 2ZFUA 3HE3A 5KYUB 4YMSA 1KOGA 1RPAA 3TNYA 1RWBA 4JFRA 3N75A 3JQ7A 1TEZA 3HR4A 3IQZA 1UBGA 4IIJB 4KYVA 1D2RA 5DSZA 5TLSA 1NBOA 4DC9A 3L0BA 3A9RA 3FWNA 1W5BA 1HE4A 3FZEA 1Q1GA 2XEXA 1UFOA 3E9ZA 3NRCA 4Z9BA 3RD5A 2J7KA 4PLVA 4PY2A 1KI8A 1YGYA 1JI3A 2NQ2C 2PZJA 5FOSA 1JRLA 3H6KA 4X62B 2BGUA 3GJZA 4AWAA 3VUEA 2QX7A 1YA8A 4RGYA 3SQWA 4DCUA 4G1VA 1LB1B 2HWUA 4WFIA 3E23A 1VJ0A 2IYNA 3CLRD 3D6TB 1N0HA 4QXPA 4YQZA 1CX9B 4GR9A 3N0XA 4DG9A 1MIHA 3GEBA 5E0OA 1GPMA 3F6RA 2PT7A 2WDZA 2Q2VA 1XRQA 1WMFA 3HY3A 4EFDA 3UV3A 3C7AA 2ZSIA 4EQZA 3TECE 5HQJA 2IHYA 4QPCA 3U1VA 2W0MA 2ZUUA 3GEPA 2F43A 1QIIA 4GR5A 1YBFA 4RWEA 3E3AA 1M9NA 2DVMA 3T4EA 3VZBA 4BX8A 2JAPA 3INRA 1NFQA 3LQKA 1TIKA 5KOYA 1ADFA 2XYHA 3IDOA 3OP4A 4DEYA 1FB5A 3OZ7A 4PX3A 2QG4A 4NFHA 4A1OA 3BAZA 1PWXA 4HP8A 1QPBA 3PGA1 4MGHA 4Y6QA 4ZODA 3K0KA 5HHTA 3ZG6A 3QGMA 1D1SA 1MC1A 2X5XA 2G8LA 1E0DA 1NBME 1GGKA 2XLBA 1JTEA 1DDGA 3TLXA 1S9HA 4O59O 5FR1A 4D43A 2MIIA 1ZGCA 3DC2A 3G5TA 5BOVA 2JNWA 3C8DA 3GCWA 4C6TA 1OFGA 3BF7A 1V7CA 2ZW9A 4YLEA 1CHNA 2YWXA 4OFWA 1AGXA 3QPDA 3W6PA 3GMIA 1U31A 2AFHE 2MT9A 3E3MA 3PNQA 1G17A 3WLAA 4AWBA 5JVDA 3HXTA 3PQFA 5AXAA 5I9SA 3QLUA 1GU0A 3EA5A 2WQ6A 2Z2ZA 5I9TA 3U1TA 5IFKA 2G9RA 3RJ5A 1DQYA 5JMOA 3PJDA 3WLHA 1E9CA 1SCKA 3OA2A 3CUTA 4FMCB 1CERA 2YS6A 4YX9A 2X3YA 4K5QA 1Q14A 1IHUA 4NC9A 4UNQA 3SX0A 2IOFK 5AHRA 3O1IC 5JSKA 4CR6A 5DX8A 3N07A 4OI1A 3SM9A 4PWYA 1DXQA 2WMNB 4IJQA 5DVZA 4B0OA 3F5SA 3PFNA 1DDIA 4MKRA 1OFHA 4PHTA 2TECE 4PLZA 3RS7A 1JG2A 3D8NA 3G6WA 1L4UA 3DEHA 1YVDA 2GJ4A 3FCUB 4QBGB 1G3UA 3CE6A 5IDXA 1V3QE 2HYDA 3Q1KA 2BR4A 1KQGA 3DTNA 4OJTA 3D64A 4RD2A 4CIDA 5HM6A 2NVUB 1B43A 3OE7D 3EXG1 5JPCA 5L95A 4QOFA 3U6KA 4P22A 2REBA 5I8WA 1ARZA 1Y4DE 4P81A 1H5UA 2E4VA 4FUQA 4M38A 3UCEA 1H2YA 2PFSA 2WM3A 2QN7A 2IODA 3EUEA 4R8KA 4S05A 1H5QA 1RTTA 3JQ7B 3MJTA 2GXAA 3ROEA 4K26A 4L9SA 4O8CA 4I19A 1JT9A 2ZZMA 3MNFA 1B2RA 1RWXA 2O2EA 3KAQA 3LC7O 4IVPA 3OJLA 1S01A 5AHWA 5HIIA 5HVNA 3LA6A 2KQUA 2QX6A 2X13A 2NQ8A 3AYZB 1BYIA 2WVHA 3M1YA 2EP7A 4H9GA 4P3OA 3C6MA 4WI1A 3REGA 2CHVA 3TIGA 5EHQA 3EG9A 4JBXA 2HF2A 2BFPA 4BKQA 7AT1A 2O8NA 1PGQA 2M1XA 3K8ZA 2F3UA 3AI2A 2FPPA 1AV7A 2NMVA 1I1OA 1W2GA 2J6BA 4UHFA 5HRUA 2HWYA 4W5RA 1ZSYA 1ZS9A 3T06B 2EJVA 2HDWA 1O54A 2J9ZB 3FNFA 3H13A 4ODIA 3I6MA 4E2ZA 4E51A 4C89A 3K9GA 1T9ZA 5GQSA 4JAVC 2PT6A 1N4DA 3QJYA 2Q3BA 5EC8A 5CEFA 1CJSA 1UMBB 3OKAA 4DIDA 3NC1C 1J8QA 3QFRA 2DFDA 4HLCA 2VDPB 4WA8A 3IVRA 4I3HA 2GN4A 3O4HA 5JSYA 4U2FA 4INOA 1YZHA 4DAOA 3CNLA 4J16A 3NC4A 1BD3A 2H7YA 4HAXA 4IDFA 4BV8A 1PVVA 3VQTA 1J90A 1OA1A 2A1UB 3B53X 4OU5A 4LI0A 2NZVG 4CIAA 4HNTA 3GP8A 2G82A 1HV8A 2ZIXB 2XA9A 2WJZB 4QDXA 5EJAA 5B7PA 4GKJB 3PR1A 4W9NA 3M5WA 4TYYA 1MC8A 3RFVA 1T0IA 4RYDA 3IIMA 3LLSA 5GOTA 4HC4A 1R7RA 3WKBA 3GMDA 3IT3A 2RK4A 1K1EA 2XOKD 4JJFA 3UXEA 4HB2A 1K0FA 2IP4A 1T1SA 2G0NA 5F2NA 4BAGA 1EFCA 2HCRA 2OUKA 1EDBA 4F4JA 1UBKS 3IA7A 5D3MA 1FSFA 4EHBA 3WLMA 5A3RA 1MABA 4MPPA 3WKEA 2BFCB 2X3FA 5BV7A 1KVUA 2AFRA 3C7CB 3L5KA 2QZ4A 1J22A 3JZIA 4KRXA 4N18A 2WJWA 3HPQA 3K30A 3R3UA 1XRJA 4FGLA 4YMVA 1M0WA 2QRQA 4OGWA 2IYAA 2O4CA 4RMGA 4URZR 4XZ3A 4FCWA 1NJ6A 3ZNQA 3T5CA 2B82A 4M83A 1V5EA 3PQ7A 1A96A 1G21B 1FXWF 4LVNA 1YIAA 5BR4A 2RCYA 1NVGA 2V9ZA 4MGYR 4JS0A 3HM2A 5BYBA 4RSGA 4ZI7B 1TQDA 1AGPA 3IRUA 4A2PA 3QE4A 2SCUB 4B17A 5B6JA 2HD4A 5CNKA 3BKXA 1ZLXA 2X9GA 3STXA 2GWHA 4IDNA 3WTCA 2C5EA 5G4KB 4C2TA 3IB6A 3F73A 1BSVA 3EDRA 1ZI9A 2EOAA 4QBKA 3ZTTA 3TZQA 3ZV4A 2A57A 5K09A 1WCIA 3EZ9A 1GOTA 2IZ6A 3KB8A 2VSXA 4AYWA 1MJNA 4RAQA 5DGIA 3GNLA 3LUJA 3H11B 1AKEA 1A5TA 1JR2A 1JI0A 2RG7A 4BLPA 2BF4A 4G9BA 2Y0EA 2F48A 1ICIA 1NOKA 2QM7A 3DL4A 1KNQA 4HMOA 2H3EA 1ZESA 4UAVA 3VHRA 4ZGBA 1E5TA 1NOJA 1C7QA 2ZJ6A 2CDRA 1UINA 3OPYI 3P0JA 1YSCA 1DQZA 1MX5A 1HFWA 1SVNA 3ABZA 4L5JA 3TNDA 1Y5NA 2XZDA 1RBZA 4KQ2A 1FFXB 3ANTA 1EB8A 1FMTA 4X6XA 4Z2YA 2VPYA 5G1NA 4RIFA 2Q2WA 3K0HA 3M5CA 3N2IA 4K9DA 1II8A 3K53A 2XMRA 3HKDA 3JQQA 3FPBA 2XW6A 1NNEA 4GO1A 1XPJA 3ZJTA 2J0VA 3LPAA 4Q9DA 2VF8A 2IYOA 3G9QA 2X1VA 3VXKA 4O29A 4ZCQA 5TB5A 3TLGA 4DA8A 2OD9A 4IZHA 4NP6A 4E94A 4EECA 5BURA 2ZS7A 1T8WA 3QYPA 4DNXA 5AESA 1KS2A 2GEDA 4H7KA 5GONA 5SZIA 2P78A 1QLHA 4FXPA 3KD3A 2FPOA 5FBHA 5K3FA 4EHLA 2J3LA 5JWHA 2E7ZA 3GCXA 1XNJA 2GBLA 3D31A 2ACEA 1N6PA 4X1YB 4TMFA 1SXJA 4WBNA 1L4KA 5FPSA 2HHAA 1XXHA 2Z1DA 4ZCIA 1FJ2A 4IQ0A 4DGSA 1FQOA 2QPAA 4BJ6A 3Q41A 5M5BA 2X4DA 3WL6A 3NHZA 1PR2A 3DLTA 1Z29A 4XA8A 5EGSA 5IW8A 3CNEA 4YBRA 1A9OA 2PVSA 3FROA 1J7KA 4N12A 5KBYA 3SZOA 4D8TA 2A7XA 3Q7RA 1OAOA 2PX0A 1NFFA 2LWIA 3CF0A 4KXQA 4MVJI 4F2DA 2TYSB 2G6TA 3CR3C 1I7SB 1OWNA 1DP4A 4AF8A 1VFPA 4KW7A 3T5BA 1JXMA 3UK7A 2E82A 5G4KA 2Z4RA 4MV9A 3DAHA 5DWDA 4MS3A 2I6SA 3HJFA 2C3PA 5SYNA 1O6BA 3MGGA 3DKIA 4UMFA 2ONYA 4BU0A 5CLHA 1I30A 5JJIA 3GPDG 4RQTA 1X13A 1ZGJA 4G0NA 5FOTA 1SOWA 2WWIA 3FDFA 2FMFA 4IV0A 1XU7A 3SI7A 3DEYX 2NUTB 4AN4A 4ZJPA 3MF4A 4LJ8A 1GAQA 1HG0A 4I55B 4EHIA 2C5HA 1CQZA 1W0KA 2IPMA 3HY6A 5F1YA 1G98A 1JXAA 1L5RA 4NECA 4EABA 4CEJA 3FIJA 2AOTB 4I7EA 4HYEA 4EZEA 4S12A 4J0DA 1IHYA 4F85A 1KARA 1Z4QA 3LT4A 3MWFA 1L7NA 2EFCB 3OT5A 4R5HA 1EFPB 4MKXA 4RV5A 1T4GA 2F3SA 3PQ5A 4TS1A 2YZKA 4YAGA 4Z5XA 3PQ8A 4WY5A 1Z7GA 2ZWMA 2ACKA 3C7DB 3E05A 3KVVA 4M9ZA 5B3KA 3I73A 2AFIA 3C3WA 3PU6A 4X84A 1R4NA 1Q6ZA 3LRPA 2YFYA 1GHTA 1B0AA 2GFHA 2VDWA 3QE0A 5JD3A 4D6XA 1AS3A 4ETWA 1NBAA 2OBNA 3DMHA 2WJHA 1OKKA 5ALDA 5FTMA 5BVGB 3DOJA 3SBXA 5LU9A 3KUKA 3HXMA 1A8QA 3UG6A 3W6OA 1AHHA 1MZVA 1CZRA 4HG2A 1WRBA 4ILEA 4B7CA 4BNDA 1A7UA 5KOHA 3GGSA 2JFWA 3EW7A 3DE7X 4Q37A 1CU1A 2DQKA 4KR6A 3FDZB 1XQ1A 1KOLA 2JS7A 4IIYA 4LX8A 4I1VA 4MW0A 2H08A 2BTOA 3ZOKA 3ZQ4A 1VLVA 1XLTC 2Q4EA 5DTIA 4G5GA 2JA2A 3N2KA 1P0MA 1AO3A 4NNOA 1OC2A 2VP0A 4BO9A 5CA1B 1JA9A 1MVOA 1BEZA 1JTVA 2AN4A 2CB9A 2ZDQA 1IVYA 2YCLA 4IDDA 4ZEMA 3OZCA 3O4FA 5CFNA 1T9GS 4EMUA 1S2OA 3ZWOA 3G8AA 5I4BA 2J0QA 3A58B 4KNVA 4DG5A 1H9AA 1UBHS 2A4MA 3CF4A 3HDTA 3ZVRA 1ZN9A 1E2GA 3HI4A 2R8XA 5EJIA 4AL4A 3IAM6 1OH5A 3W2GA 2ZI7A 2REQA 2IDKA 1J20A 1FMLA 2Z2IA 2JH8A 2QAGA 1I4LD 3CS3A 3ETHA 3AL2A 4ZOLB 3JY6A 1Y6RA 4IH4A 3VU8A 3GLUA 4TZ6A 5DSXA 4BO4A 4ENPA 3D2LA 3KJEA 5JAQA 1UZNA 1JQAA 4XLZA 4B83A 1JHOA 3T7RA 4FQ8A 5A6SA 4QUJA 4BFWA 4RTSA 2P2GA 2G25A 1OJLA 2ID7A 1E20A 2NO7A 3IGFA 4ZYVA 1QX4A 2H65A 3T4XA 4D3XA 1U11A 1NONA 4RKQA 3MJEA 4RA9B 3H1PA 1XRRA 1OXTA 2XMCA 4DILA 2NAPA 2AZXA 3QVUA 1VMIA 3QLVC 2ZXFA 4TMTA 1KEEA 3LHDA 1I3NA 1XHLA 4BQRA 2BEUA 4RAOA 3HVJA 4ZANA 5I4CA 3NHKA 4DDMA 1F60A 4IYRA 4WDQA 3R7LA 1GG5A 2C0PA 4J6EA 5JAOA 2GM4A 2OQVA 4AKGA 2JZOA 4NPCA 4CQLB 3EPRA 1P60A 1QP8A 3BE5A 3QA9A 1A4IA 4Q4JA 1UEJA 2IUUA 3ICQB 5E2IA 4K0RA 4UUPA 1LDNA 4N47A 1T36B 4B6SA 1MENA 1Q2XA 3P19A 3SJBA 1OV4A 4JXXA 3FLAA 3O3MB 3E9QA 3RRMA 4MUAA 1ENPA 2ZVQX 5FBRB 3TL3A 3SKYA 5JY1A 1SHZA 1LBIA 4UU8A 4HL6A 3LP8A 3QWHA 4D9HA 2VSNA 3NTVA 1WMBA 3KOZA 4G1MB 3RUFA 1NBEA 4F72A 5KSWB 1C7IA 3C3EA 1FU7A 1W94A 2QV0A 1ATIA 3ZVLA 4F84A 1YOVB 2GO1A 2Y0CA 3OUUA 5E1BA 4TYPA 4N76A 3ZX4A 3LYAA 1YZVA 5LZ8A 2UYOA 1HA3A 4CFSA 3B38A 2EJUA 3COWA 4D45A 3SEAA 3AIIA 1NTRA 5H59A 3ITDA 4DBVO 2DLNA 3MLAA 4ZYUA 3EMVA 1ZRNA 3OEWA 3EZGA 1RKQA 1EX1A 1FYVA 1EVQA 3DWGA 3DJYA 4AU1A 4EGSA 2JFHA 4UQOA 5MGBA 3SEQA 2FFQA 3RHTA 4CLRA 3A05A 4D44A 2OZLA 1H2FA 4TZTA 4NQZA 2EC5A 3F0TA 2JIZA 4EEZA 4CEIB 3QVGA 1LSJA 3S3TA 4PO1A 2BSAA 3HB9A 4FHFA 1QHXA 1GPYA 5EI5A 4BGIA 3BGIA 3CINA 4OEHA 4CTJA 3I52A 3PE6A 3KR9A 1FJHA 4HN2A 3SYLA 2A0KA 2YR0A 3BXPA 1DIOB 2I8LA 4MQ6A 1QGZA 5EPEA 1E2HA 1ZU5A 5LZ5A 2NZWA 4V0QA 4BNJA 4BMCA 2FEWB 3N8NA 5LLTA 4BXOA 1WUKS 5JBQA 2I91A 2NU7B 4U9IS 1YI0A 1WPGA 3LX4A 4G1BA 5CXSA 3SXUA 5DM60 2KYRA 2J9FB 1EP9A 4UHKA 1KP2A 2FPSA 2NSDA 1THMA 3RABA 3LUDA 2A59A 2ES4A 1NX9A 3EBPA 1Z06A 1BMFA 4FGZA 2Y6UA 3QEBZ 4WFQA 2YICA 3DW3X 1YS1X 5KKCA 1P33A 4M76B 3JAMA 4P4NA 1NDHA 4AZWA 2H59A 2ZULA 2IA5A 2VUHB 3BXFA 1NURA 2PL1A 4EUFA 3LY7A 1G7CA 1Y6QA 3G02A 2ZSJA 1MX9A 1ZDMA 4A0FA 2G5TA 4QRHA 1HE2A 3NTXA 3TPCA 4X63A 1CZKA 3IIJA 1LWNA 1E5QA 2ECQA 5K05A 2PS3A 1N6NA 4ZRDA 3RSOA 4HLUA 3Q2IA 3ZE1B 1MV5A 4BYMA 1DARA 1HZZA 1RIIA 5CHYA 3UWOA 1HE8B 3DNFA 2ZYHA 3N2YA 4FI3C 4HQFA 3O0TA 3GRKA 5ALOA 3TGWA 4C0LA 4LQDA 3V2IA 4A0QA 1AD2A 4GVXA 1G9SA 5AQEA 4Q3NA 3AHIA 3L7YA 2XZPA 1T24A 3OTWA 4YJGB 2BMEA 5LYJF 2QNRA 1H66A 3QP9A 4KIFA 1GG9A 4EA9A 1W30A 2ZIZA 4OB6A 5FPHA 3TL6A 4BO6A 1JIQA 4O1HA 1P1KA 4AP6A 2F9MA 2WABA 3JZFA 1UODA 3JD3A 4YV7A 1JU3A 1D0VA 5TF4A 1ZNZA 2A1TS 4EENA 4TTVA 4KWEA 3EGOA 3H97A 4OATA 1A7KA 1E77A 4II3A 5CBPA 2OMEA 1KR5A 2OCPA 2PD6A 2D13A 2W8BB 5IT5A 3ZBPA 3QVVA 1FNMA 4AMVA 1RFLA 1DG1G 3WY9A 4HWSA 4MUGA 4DNFA 5JAPA 4JP2A 3CB4A 4R51A 4B34A 1SBHA 1YQUA 3GIWA 3PQ3A 4EGQA 2R84A 2FW0A 4N3CA 2FF7A 2R85A 3NZEA 4PAOA 5DIZA 5JWOA 4ND7A 3B1WA 4QXMA 1HNZB 4M9SA 3ORSA 2Q49A 1H85A 2BCGY 4R81A 4OJQA 3RYIB 2EYUA 1DBSA 1RC0A 2GVDC 2ZE6A 4L02A 2HL6A 1DEHA 1VIYA 4WLEA 3G0DA 1CKEA 5KVCA 5AO9A 3ZX5A 5J4VA 4B74A 1ZEMA 4EIWA 4A92A 2IZ0A 3KYDB 4QUKA 4R0NA 1EJ2A 4GYWA 3IUJA 4NY1A 4BS9A 1XEXA 2ZJ1A 3SJ7A 3ZU4A 2OHJA 4UMEA 3TXAA 3LF1A 5H3LA 4BNYA 2AN3A 4CNQA 3Q7QA 1SQ0A 3ONNA 3PHLA 3C5WP 5KYNA 4RVDA 1TO2E 2PFKA 4COOA 1NKSA 1MU0A 4IKEA 2E4YA 5AXCA 1ISSA 2OHHA 5CG2A 2E1RA 4NQRA 3S2IA 4L2IA 2RHCA 4OUDB 3K72B 1KZYC 4RMHA 5D5HA 5IAEA 5T4HA 4EP1A 5AHKA 4RKWA 3K0SA 4BVFA 1RQRA 4N7MA 2EZTA 4JU9A 5TJHA 4BX2A 1R1DA 1O0CA 3DOFA 3ZIAA 2VUUA 4U02A 4JL5A 4U6QA 1N2CA 5K6AC 3JCZA 4WXEA 3QEJA 4TYNA 2QQGA 3MM4A 3OZWA 3OFKA 4PCLA 1V9CA 2QRLA 1YOBA 2JFQA 3ANSA 4FWBA 4M9CA 3RYTC 1PW7A 1XF1A 4D9GA 3HFRA 1VLQA 4LN1A 3BXEA 1WMDA 4LSWA 4QPZA 3W9YA 1VC2A 1W93A 4ZYWA 2HLNA 2X0KA 3DLCA 5K2OA 2FSHA 3LV8A 5A3QA 4QULA 4UOQA 1SXPA 3PIRA 3DS8A 4WCFA 1FTNA 3WISA 2BFFB 2J46A 4OD0A 3A2LA 3L49A 1C2TA 3AHCA 1KJIA 1Y3FE 3CUEF 1U8UA 3OA0A 1BXZA 2W2LA 4CM9A 2Q45A 3IP8A 2X5OA 1LU9A 1KRWA 2ZJYA 4B3BA 4OP1A 4IG9A 2FWJA 3F8TA 3BGVA 4MRPA 4CG1A 4E14A 4DLLA 3MTGA 4QOGA 4GDFA 2RI6A 2C8VA 3B12A 4CGZA 4Y9RA 3KXIA 3CCFA 4NTZA 3T34A 1U8FO 3WBKA 5BN4A 5LXTB 3DLHA 2P30A 3LCJA 4PZEA 2VXYA 1B8PA 4I4IA 2P2CA 1MIOA 1VGQA 5ECYA 3WK8A 1GL9B 4ER6A 1WHTB 1DHTA 2R5WA 1E1RA 1FTGA 3A9SA 4PS0A 4Q93A 1X92A 3NEPX 5LMCA 3HBNA 4EMTA 5B58C 2I22A 1JFTA 3F6BX 3B6ZA 3UMJA 1YA6A 1T0UA 4EFMA 1BA2A 4E2WA 3ZDDA 3ET5A 4GU5A 3IVAA 4TV9F 3LBNA 5EUMA 4X8LA 2RBKA 4TMXA 3FNBA 1Y1SA 1D8TA 3N74A 2GN1A 4PG4A 3TS1A 4KCGA 2KPOA 1XTJA 3PIIA 1CQJB 3KUXA 3G7UA 4P80A 4LSMA 4P2BA 4I4TA 5ALWA 3JATA 1E7YA 2BT4A 4B79A 1U0HC 5SYAA 2VT3A 4OSOA 1K9SA 9MHTA 1VDMA 1JWBB 2RFLA 1N2ZA 4EA6A 1U7HA 1NVTA 1PR1A 1SG0A 5AYVA 3H0KA 5F3RA 1OWOA 1XJWA 4ACBA 1ECJA 3PB3A 5ELLA 5F2OA 4DV3B 1R4AA 4J07A 2JGJA 3EQZA 1FLDA 5H9VA 4M22A 3LNTA 1KERA 4DSNA 3V32A 4DG8A 3AWDA 1DC4A 1XV5A 5CP8A 1TEHA 1MHPA 4RHCA 4GKBA 3TQFA 1OMOA 3MGBA 4OPMA 4O1MA 2C2BA 3NQ41 4H59A 5P8WA 2ORIA 2YDXA 4KRFA 2B7BA 1ES9A 1UPXA 2IXDA 3FWKA 1WOYA 1Y48E 4PQYA 1TQ4A 3IHKA 3OX3A 3FLBA 3IV7A 1F17A 4ZQIA 1LJLA 1MG0A 2WTEA 3DOOA 4CIBA 3AVXA 2DUUA 2LBPA 2Z2JA 1UC9A 5AVOA 3BCSA 2V6IA 2W58A 3KHKA 3L4EA 2OM2A 3GVCA 4EL5A 3V97A 3NEJA 3KKZA 1E6UA 2VJKA 1A95A 3O83A 4D9IA 5CURA 4AWXA 1AS2A 5JNLA 3TMYA 3H8JA 3LX6A 1MORA 1B8OA 2X58A 3BIJA 1T6ZA 1V45E 4U63A 2FPWA 4LF9B 1B14A 1TW2A 4KPEC 4D9EA 4X66B 4A1FA 4D81A 4C1BA 5IRCD 5DYYA 2R8PA 3JAWA 1RQGA 1QX3A 1BVRA 3HYRA 3HCWA 4NARA 3LWDA 4A82A 2YWRA 1PEDA 4P4SA 3AEZA 5JAHA 1N5LA 1TD9A 1WDKA 1XZDA 2VHTA 2J3EA 3R9KA 3GF4A 5LQCA 2E6UX 1HFEL 2AD1A 1Z4OA 4HAUA 1FBTA 4L7QA 3QUSA 1PT8A 2ZS8A 3PRJA 3OCVA 2VHWA 3R3ZA 4IXMA 1PR4A 2XSZA 1XVUA 3TQTA 4BKRA 5AJVB 1RXEA 2X7HA 4NG4A 1PZGA 2E49A 2H9IA 3ZS8A 4B6JA 2FQXA 5BNIA 2AG5A 4DNQA 2WVGA 1RYDA 1T6YA 2PNJA 2GPWA 5B2ZA 2RHDA 2Y71A 1ZK2A 1KJ9A 1Z0FA 3CW9A 2VF2A 3IKJA 1HMPA 3JQAB 3SDZA 4QYSA 2FSFA 3QPAA 4IGEA 4F3CA 5CG1A 1HZJA 1VE5A 1G7RA 3EPHA 1J1UA 3OZUA 4GIBA 4OFBA 3VR6H 4PRLA 1SZCA 5EWLB 1JW9B 3GPBA 3EXHB 4BLOA 4NOKA 4R69A 2G09A 2DETA 2GTIA 2QJFA 3T1VA 3FETA 5CB8A 2GPTA 1B7GO 5ED4A 4C7BA 3B3AA 1J8MF 1ZIOA 1T0BA 2YXNA 1E3LA 5DN6A 1DJOA 4C29A 4JY7A 2XH8A 2FY8A 4KIWA 1X7ZB 1E1MA 4MJ7A 4RF5A 1XALA 1I3KA 1QNLA 4WZZA 1HNNA 3IAS6 3IP5A 2A0UA 4E7PA 3Q72A 2P4EA 3LWZA 1CC1S 1B23P 1C81A 1EA7A 2GFIA 3RUCA 1KAGA 1Z5GA 2OFOA 1IE3A 1QE5A 1AQUA 5DI3A 5KTNA 3R23A 3HVIA 1V6CA 2LR0A 3HB0A 1U6JA 1LBQA 2MDTA 2PT5A 4IO1A 2G70A 4BFZA 3KB2A 5ITVA 3KV1A 4FINA 4HS4A 3ASUA 1OPXA 1RE1A 4G2NA 1NMXA 1RPNA 4UTNA 5DT9A 3D3EA 4BMOB 4V1CB 1XROA 1N2OA 5BV1A 2GMWA 4LQ4A 2V0CA 3AP1A 5HBGA 4MWBA 4CM3A 5HCIA 3JWHA 2JASA 1NLMA 4HUQB 4MIEA 1BFDA 4LRTB 3AM4A 1W87A 1B2LA 2H1LA 1ESCA 4KI7A 1S4QA 4PYKA 2MSKA 4JQCA 2EQ5A 2C5GA 3FGZA 3FGNA 1EBUA 1PNRA 3HU5A 2ECFA 2B1JA 2CCGA 2PH3A 5DM4A 3WLTA 4J1SA 1F2VA 3ZHCA 3W9UA 4R54A 4JOQA 4GOMD 1C9EA 3BMOA 2AYYA 3L43A 3NTRA 4W1QA 4D2IA 5EHZA 1SCUA 3GJ3A 721PA 4EARA 3SAJA 2ASEA 2PSEA 1Z73A 3LZCA 1ZH8A 2OCDA 1YKFA 2TRSB 4C5AA 9ABPA 2DMRA 5A5VA 1Y1RA 3GO4A 1YFZA 2EWVA 5BSUA 4JJEA 4NH0A 2GYVA 1P77A 3LT0A 4NNJA 421PA 1ZGAA 2I2FA 5JYCA 1E3MA 2TMKA 4LYAA 2AYXA 4J6FA 4LHSA 1P0PA 3QX8A 4KBGA 3SQDA 5C80A 1L7AA 1Q16A 3H2KA 4Q3OA 4EM6A 2V7BA 1UZAA 3RODA 3OM1A 2QU8A 2B34A 3I9JA 1DGQA 1DE0A 1JLRA 3C7TA 1VKJA 1RI3A 2NAFA 4JXZA 4G4SO 4HDKB 3W5CA 1MR3F 1MAUA 3EHEA 1TU4A 1I5RA 2RHGB 3VI3B 1DTWB 2OSBA 2PD4A 4L8YA 3UHOA 1P80A 3NJRA 2J31A 4PX5A 4ZQEA 3JD1A 5IM5A 4DIMA 5IKEA 1BS2A 3I4LA 3L77A 4MUYA 1YZGA 4OH7A 4R2KA 3T7EA 1XMVA 3LXUX 4W63A 5IKPA 3VZSA 3CLTC 4UVDA 4JYBA 4A73A 1T4CA 2XTAA 5ALIA 1YQEA 4P31A 2YVUA 4I2NA 4U00A 4HWRA 3WBFA 1IHDA 2JH9A 4LZPA 2W22A 4RXTA 4BC0A 4P32A 4BNIA 2AEEA 1N7IA 2GK3A 1GTVA 1ZR2A 3DQPA 1M5UA 1Z2CA 3WGVA 3NIGB 3IDSA 2B92A 5F64A 4CT4B 3AJAA 1OYYA 2P2ZA 5GP1A 3VSEA 4RH3A 1ESDA 1GNSA 5FOQA 2BEUB 3S0JA 1KYWA 1Z4IA 2I54A 1AGRA 4Y2YA 5BMVA 2WSLA 1SD1A 3A2KA 1WQ3A 3HTXA 2VTBB 4DR5B 5BXQC 3R7WB 2H5EA 5CDGA 4LGVA 3P9ZA 1EVJA 1O1YA 5F73A 3ICEA 1XN4A 4PE5B 1N5RA 3AHEA 2PR2A 2RHLA 3FHOA 4HSGA 4EF6A 3NXKA 4ZJYA 4H0FA 5IZCA 4KFCA 2AN9A 4B3TB 1CUDA 1BKDR 3X44A 4JI4B 5I6DA 5JQGF 4MMYB 3AYXB 2ZLBA 4WRRA 4ND3A 3W3AH 5D00A 4B71A 2QTVA 3GJTA 1TYBE 1X1QA 2HV9A 2NP7A 2QAGB 2HIHA 3KV3O 3LA8A 4OP2A 5FULA 5IF9A 3QBJA 4JIGA 1ONNA 1BCRB 1SZDA 3TQSA 1Y4UA 3P26A 4FOPA 1D07A 4TLAA 2O0JA 2WB4A 1YULA 1Y5IA 3QUCA 3WLRA 3V4LA 3D1JA 1CB0A 1BMFD 2CY0A 3DAYA 4ZVRA 4LJAA 1OXMA 5BR8B 1ENZA 4AZ3B 1B1CA 5DN9A 1XEAA 3BTUA 3PWSA 3ZGYA 1T0JB 4I3GA 3H11A 3LHSA 4FMCF 1NP6A 4RJKA 1FP2A 4AQDA 4OKNA 1PL7A 2YIJA 2YNMA 2BGNA 4IM7A 1L5KA 3GLIB 3DV2A 4CF7A 2WHYA 2XPCA 2C7RA 1AY0A 2VAWA 3GZNB 1JDPA 5AHXA 4HKTA 3DT8A 5CFRA 4JI6B 1MV8A 4QU8A 3W34A 1EDZA 5G1OA 4ZARA 3U9SA 3SJZA 5A4JA 3EW9A 3VKFA 1GY8A 1OT3A 4YRPA 2GHQA 2NVBA 1NXSA 1QNFA 3LC2O 4J75A 2C7VA 4QYTA 1RP7A 1YRHA 1WBDA 1TTQB 4FFBA 1Z8HA 4DHWA 2FHSA 1WE2A 1K86A 4JHLA 1WZUA 4TWZA 1CY8A 5HIAA 4IOMA 1XA0A 2OCAA 2OO3A 4MV1A 1M2WA 4LTMA 4R1NA 5I01A 5J2UA 1NU8A 3UY4A 3V8QA 4MB2A 4MVJM 5K3DA 1C8LA 2I3ZA 5JYBA 1E79A 1JQKA 2GM3A 1QK3A 2H92A 4QTUB 5EE9A 4OOFA 3D81A 2BR3A 3TLKA 3NOOA 1XDSA 1ZD2P 4RD4A 5E9JA 1A9YA 1Z6YA 1II0A 4JLVA 4NCXA 2AMYA 3NCTA 4V2IA 1YBMA 4G0UA 3U09A 2J3JA 3OPXA 4FHZA 5C34B 3RVQA 5EIFA 4CF5A 4TRNA 1EWTA 1PGOA 4H3HB 2EEPA 3B5JA 2ZBEA 3CZQA 1D1TA 1ETUA 1OVGA 3GRFA 3I9KA 3WHLA 4L8GA 1GQQA 3E22B 3PVZA 1TT5A 1NHWA 1JJAA 2AX3A 4KXLA 4WKCA 1FFHA 3FVTA 3KOOA 1MDFA 1H6BA 4NL4H 5IYZA 2EX4A 3IAAA 4KUEA 1ZD8A 2CLLB 4GM0A 4HJRA 2EBWA 4MR8B 3R7NA 4EYQA 3QU4A 3PFGA 2WAOA 3V1TC 3A37A 3O7MA 4OB8A 2Q8QA 1M8PA 2CNWD 4ZOCA 1Z5PA 5LLDA 2EFJA 2J07A 4PSAA 4ERXA 4XWKA 3T1TA 2MMCA 3CZ4A 2DR3A 3A26A 3KQQA 1RYEA 1WXIA 4OFZA 2HK7A 4CCWA 5EE0A 4GSLA 2H1HA 2YRXA 4OREX 3M81A 1FDTA 1V7QA 3RVMA 5MN6A 2OCXA 2X0RA 1F8GA 3E9YA 3FPFA 4ZU6X 2B5VA 1JEQB 2WHQA 1RLMA 1RJ9B 1U80A 2J4FA 5AW4A 2I2WA 3Q10A 3VPCA 5EWJB 5ITZA 3U4QA 1JAHA 3OFSA 2GF9A 2PXHA 4QDUA 5LA6A 1Z62A 4S1TA 3JZMA 1B6TA 3M4JA 2YJZA 1RXCA 2X0JA 5E6SA 3RVPA 4DL9A 2PE5A 2ZTHA 4LY0A 2Y27A 3SMQA 4EF5A 3U7QA 1KXJA 1XMPA 4YT2A 3NTLA 3T12A 5A04A 3CT4A 5FUWA 4AP5A 5DN6D 5JV5A 4LK3A 1E7SA 3A2MA 2XEDA 1DT3A 2D06A 2FEKA 1MJGM 4P7FA 3STVA 3AG5A 1RXVA 4AJOA 3IB3A 2H57A 3P2YA 1G0NA 1VI5A 1NN3A 3AY6A 4Z1MA 4B3DA 5KEIA 4GNRA 1W2WB 3AHDA 4EHKA 1LF5A 3GJQA 4WK6A 2GK6A 2P77A 2DJIA 1Q3TA 4FOLA 4UOZA 2Q3LA 5LZ9A 1FS5A 4BHTA 3GUZA 4DHEA 4EA8A 2J33A 1X0XA 2QROA 3L9XA 2VR1A 4IDBA 4IMRA 4TL9A 5IFLA 1FXSA 1JPVA 1GPJA 1SU8A 4MA5A 4D4GA 5IABA 4CIVA 4O4LB 2HZ7A 3IAM1 2IHUA 2WW8A 3I05A 4M0DA 4MI1A 1XMJA 2FP4A 4B32A 5HF9A 4HX9A 4DOMA 2C9YA 1PIWA 4ENQA 4IDHA 5KVAA 1DT5A 4XTCS 5EL0A 2XQKA 1G8MA 3VKWA 5FWNA 3NS7A 3QBTA 1JGTA 1D09A 2Y66A 1WU7A 1QIDA 4C3ZA 3BWYA 2DFTA 1PUIA 4F3RA 4ENUA 1XNQB 3HCOA 3G13A 4IXNA 4MNTA 4OH1A 2XDWA 1DAFA 2O5VA 1FX0A 2IV7A 4BMNA 1AHIA 1UF9A 2LCIA 2BH2A 2PG3A 5AI6A 4B6GA 4YRJA 1VJDA 4BVKA 2A58A 1Z26A 3CF6R 3DOEA 4MW1A 1CSEE 1SCNE 4C7OA 2OGWA 1L7RA 3DUWA 2AKAB 4YDQA 4YY3B 8MHTA 1IY9A 3ZGLA 1EA5A 1SC9A 2ASVA 4F04A 1EJ6A 3DCJA 1JMKC 1XK7A 4MRMB 2JBAA 4PHHA 5LM3A 4ARAA 3QZUA 5FA5A 4KTVE 3Q8MA 3YASA 1V7ZA 3I0ZA 1OLOA 4AUMA 3QVLA 4C03A 5JAUA 2PS9A 4QXRA 3KEOA 2WF7A 3FNEA 3ZI7A 2NACA 2EW2A 4D9CA 2WMOB 1GLNA 1PJTA 5EP2A 3EXEB 3KL2A 4AULA 4AMZA 1WW8A 1LC0A 4F3YA 2Z2XA 4G1UC 4MQ5A 2I4OA 2QN8A 3HH8A 1BCSA 3AUFA 1XLTA 2YS7A 4RD1A 1R0BA 2NU9B 1T13A 2B4YA 2YL2A 5ILGA 1QZ3A 1KQPA 2Q3DA 3DR5A 1IY8A 4BKOA 1UXIA 5KYGA 5LBIA 1CZOA 1RZ3A 3QNUA 4Y9SA 1ZD3A 1USWA 4FSHA 2X1MA 1E7RA 3CH5A 1E98A 4HGRA 5SY9A 2VAXA 4CLDA 4MAFA 3MINA 2R7NA 3EZXA 2OV6A 1F38A 2VQ3A 2JHPA 3FCSB 4MKGA 4QOEA 4R1PA 2O7VA 2F1KA 3CEHA 4O2BB 3RARA 3RR2A 3T9DA 1ISMA 2B5OA 5TJ9A 2WF6A 3IEVA 2E18A 3UFBA 4QM6A 1XDGA 1CE8B 1I6MA 1A88A 1XTQA 2XVXA 4IS2A 2PLFA 3OD5A 5JVDB 4PC1A 3BD9A 1HL3A 3ZDFA 1WDWB 1JPJA 3ROQA 1ONSA 2GZAA 4ANFA 4Y1RB 5ERYA 8LDHA 3V3TA 2VJBA 5DLQC 3RU3A 4LFBB 5T64A 4L8WB 1OZFA 4UTPA 4W9RA 2HA3A 1MQ8B 1UPTA 1ZMRA 5HUJA 1WO8A 4HLDA 5KHLB 4BE7B 2C5BA 2QZJA 3QKRA 2WWYA 3KALA 4FDTA 1V71A 4RPIA 4URXR 2C4WA 4D46A 1COWD 2O6HA 1QIGA 4X7MA 3EGXA 3PL5A 1Z18A 2FFJA 3WGHA 2G7MC 5MGNA 4TM7A 3AVWA 1NJ8A 2GXSA 1DQSA 2Q29A 9ATCA 2XDYA 2VDNB 1IZYA 2UUBB 4LBYA 1IEVA 4K1LA 2AQKA 1PJLA 3X1DA 4E1AA 3E5NA 1P9OA 3D5EA 5D7BA 4A10A 1EP1B 4E11A 2GLXA 2N1BA 1L7PA 4MWCA 3O1LA 5HWSA 1R6VA 4OHVA 1HEUA 3V2HA 4L6AA 3C4QA 3I4CA 3LUCA 5KKNB 2WG1A 4MRMA 4WUVA 2X4IA 3IPYA 1PFVA 1Y5RA 3R24A 4NPHA 1KAEA 1E9FA 3TRJA 2G80A 3V34A 1B6SA 2Q4DA 4ETIA 1P7WA 1QF6A 4P4GA 4OX9B 3SXPA 3RRNA 1E60A 2EATA 3KO8A 3OWHA 1QOPB 4X1IB 3W7VA 1IN1A 1M6YA 1CFJA 1BMDA 3AR2A 3RC2A 1VYVA 3WMWA 1HDEA 3FRJA 3DVSX 4RXUA 2FOIA 1LZLA 2FDXA 1DG9A 2XDAA 4IYJA 4Z1OA 2C0QA 2GAOA 4N01A 3K2QA 2R2AA 2WTBA 2XUHA 2ZYWX 3BQNB 4OQNA 1PJQA 4G1EB 1PL0A 4L3OA 1LDEA 3ZZNA 1CUVA 1YUBA 1JBEA 5T4EA 1JQ5A 4UPVA 3ZWAA 2VT6A 4US2R 1FA9A 3IIEA 1OH6A 2ANCA 1FQKA 1QH8A 2P0EA 4AKEA 2O2XA 4K9MA 5KI6A 2VJMB 2ZRQA 2WJGA 2XMDA 5CCDA 2CUKA 3CX8A 3QMMA 4UHJA 1D2CA 3A3KA 1UDCA 3B3FA 1CIPA 2CZQA 2OWEA 4JROA 1B8VA 5JW6A 3KQUA 4AY6A 4BNHA 3X2SA 1KZ7B 4HLNA 3ZZ1A 4NBWA 4B73A 4OHBA 3MS7A 1CY1A 2G08A 3QI7A 2WA2A 4JXKA 4GZ5A 2JAXA 4K1XA 5JXJA 2XXAB 1J49A 3O91A 4M8LA 4GI3A 3EVBA 3SYMA 2XQGA 3QK7A 4G5XA 4P0TA 3EGDA 1NPDA 1TAQA 1TJNA 2XLCA 1OD6A 5DFAA 1UPUA 4DYDA 5DK6A 1NAIA 4Y2QA 3MIIA 3I2KA 1IC6A 2AFIB 4I5DA 3GJRA 5F3DA 4TQUS 4IWXA 3QKTA 3KDSE 4Q48A 2RAUA 4Q3EA 4GX2A 2Y6VA 1JBQA 4E5YA 4OJYA 4WJKB 3HJGA 4BNLA 1D6NA 1UDAA 3NBAA 4NZOA 3UGTA 1Y1TA 3WXBA 3WYGA 4TWAA 1JHAA 1NRIA 1DAMA 1TD1A 3FR7A 2QORA 4P4LA 5AW0A 1ZFNA 5LQMA 1WB9A 2C20A 3D0KA 1AUVA 1HMYA 1YMQA 1DBVO 2PZEA 2YFHA 1E4VA 3OZFA 2GLUA 5GADl 1QCDA 5BN3A 4GL2A 4TMWA 2MYTA 1Q7RA 1E59A 2BWJA 3F7OA 3ZHOA 1KE1A 2B30A 1VIAA 1E7QA 2L18A 1UR5A 4XLLA 4V1CI 3T1NA 5JR3A 5JQGB 3OO1A 1HKHA 2I2CA 3JQ6A 5TIIA 4BEVA 2VNIA 3OIWA 2I8CA 3FB1A 1IHOA 2HPVA 3VDMA 4H7EA 1E2PA 4AIRA 3N7TA 3L4KA 3PUYA 4KHZA 3H75A 2WZQA 4BX3A 1LRKA 4YMWA 3EOAI 3HYSA 3E7DA 3GQBA 4Q6WA 1TIBA 4MVCA 3HJHA 4XSVA 4BLUA 3V1UA 3IIIA 1Z13A 4YJ3B 3T0FA 5LC1A 1HL7A 2OHXA 2BGJA 3M83A 1V1JA 5CT9A 4AJIA 1CUIA 2VDOB 1QFYA 3H2GA 3E9NA 4BTLA 1TJ3A 4IQ4A 1USKA 4WMLA 5FI3A 4CLOA 1DB3A 4YVFA 4NATA 4RVCA 2IHNA 4JX9A 3T7JA 5IXJA 2H7CA 4ZT3A 1P4AA 1Z74A 1UEXC 3RJZA 3WVNA 2B2CA 3DCIA 3I9LA 5GZ3A 1MTZA 2VHJA 5IX8A 3VA7A 2UYHA 4G5YA 1SD5A 3IX7A 1N2JA 5EHXA 4R7GA 1ABFA 1Z75A 2ZSDA 2O07A 5E1OA 1GZSA 1RJFA 3GLTA 5EJ8A 1RS0A 3U3MA 5EE3A 3H5LA 2GEBA 1WULS 4KE6A 1S1MA 3CX4A 3GCZA 5AJUA 1M0TA 1XZFA 4KVAA 4Q47A 1RJDA 3UJ9A 2P5YA 4BQEA 2HW8A 1YVEI 4G09A 1AUXA 3KPYA 2ZYGA 4QYWA 1FFSA 3H5OA 4U2KA 5IARA 4MUXA 3IQIX 4Q1DA 2PJUA 2FG5A 3BCUA 1JG1A 1K8RA 4CEHB 4KQHA 2A5DA 3MUFA 2AFHB 3DDZX 2NYAA 2CL0X 4LJKA 1NW9B 4EYGA 4ND1A 2YWBA 4C0JA 3FOCA 1VE9A 4IVQA 3BXOA 3VC1A 4YV0A 2FZEA 2YWHA 4W5OA 1I3CA 2R1VA 3S6JA 1CCWA 5D7NA 5B36A 3O4GA 4BP8A 3ROGA 1Q95A 4TL8A 2IBTA 1RPTA 1KY4A 1Q12A 2AI1A 4Y2SA 4N0DA 1OX4B 2BFFA 4MUHA 4UE2A 3GLGE 2FPUA 3EAGA 4UVHA 4OHXA 1C5KA 4MCAA 2PZBA 2QP3A 3CEAA 1TKCA 4OHKA 1QRDA 2Y1WA 2FP4B 3MCAA 2RAFA 4MI9A 3TTSA 5KYWB 5M7EA 4AICA 5B4VA 2R6CA 2YFQA 2FP3A 2YZ2A 3JQDA 3OC6A 5CVCA 1XDUA 2XDQA 1VL8A 2PRYA 5TQJA 4A8HA 3FTPA 5KTTA 4O33A 2ZWPA 3NAQA 3H9QA 4YAOA 5EWMB 3JRXA 3L7DA 3F74A 3SP1A 1CUFA 3DHVA 3FWPA 4HDMB 4CU2A 3FB4A 1DV2A 4IGIA 4RK5A 3WRXC 5C4MA 3T3HA 1CHDA 3M82A 4RVSA 3Q5EA 3UJ7A 3BB1A 5LQNA 3MOSA 3UKDA 2H4WA 3KKNA 3NYIA 1ZZEA 2QPLA 1TMOA 3P20A 3KG2A 4J9VA 4RLQA 3WWDA 4BQIA 1NLFA 4F86A 3AR5A 3I83A 2RHHA 1CUYA 3G8CA 4B6RA 5KWJA 4BQNA 3RS4A 4IMIB 4IILA 4ZAFA 5KZMB 2AIRA 4XDZA 1PR0A 3OWOA 2VPTA 4IDQA 2AGVA 3DKVA 3ASYA 4MRAA 4I6JA 2VO1A 4KIUA 1SZPA 2OHIA 3T35A 1BCRA 1J8DA 2EJWA 3ELWA 3KE8A 4Y1FA 1BQEA 1GNPA 3HV2A 1QORA 4JEHA 5FPQA 1KAOA 1QS0A 4DCVA 5A3JA 2W0SA 4G8DA 1AIPA 1IQRA 2PWYA 3P97A 1P7PA 2CDAA 4R7TA 5F51A 5K8LA 3UXHA 5KJEA 1QM5A 4ZQHA 1OBHA 1OTXA 1EK2A 3E9MA 3U37A 3NHYA 3A6FA 4HYTA 1XL0A 3L01A 5IXYA 3ONEA 4DV0B 4LF5B 3FYDA 4TXJA 5EJEA 4AJLA 4TTQA 1I36A 5DI9A 3I3SR 3ISVA 1AHNA 3NP7A 3GPIA 4B2LA 1CW2B 3L6EA 4CDRA 1Q0TA 2BFMA 3ET4A 3BMNB 1J39A 5BP7A 5BRAA 3AFNA 3IH5A 3REFA 1U7UA 4ER5A 1Q7BA 1KFBB 3NM6B 1DV1A 2JJ2A 1MZPA 1VKNA 3A10A 1B0ZA 2EZ8A 2QOEA 4PLHA 2KS6A 1U3FA 2EW8A 4KO3S 4BDSA 3IR7A 1RP1A 5BVGA 6YASA 1YJXA 3Q85A 4JVLA 4LY6A 4GMDA 5FPTA 5K8VA 3AESA 5BWOA 2JFYA 2OPBA 3SXJA 4PGGA 3BK2A 2VYVA 3P94A 1G4HA 3I32A 3Q6MA 2FNAA 1KMMA 2C3MA 2ZP1A 2GAJA 4RK7A 1ZD1A 3DCYA 2ZYRA 1FFDA 1B6GA 1FLAA 1BWRA 2QMZA 3JW8A 1XWIA 2BI7A 3CVJA 2XF8A 5AKXA 2GEKA 2I9KA 2XKJE 4MUBA 3ZYCA 2O06A 3K6RA 5A7HA 1CUBA 4KBYA 1E4EB 2G83A 3GT0A 4DRXB 1JEEA 2H52A 1PTJC 3E1GA 3GDHA 1YE3A 1DC6A 4ZV7A 4EW2A 3UHPA 3AXTA 1K68A 1IN6A 4IJVA 5BUQA 1CS0A 4GPZA 4Q9NA 4OXYA 2RGRA 1RWQA 1JWAB 2H85A 3RHSA 4QWWA 3RFCA 5A0VA 1CRQA 3I0NA 1SBCA 1ADBA 1MRZA 4FDAA 1IXRC 3OJ0A 1B15A 3MSCA 4OGLA 3TTYA 5DULA 4EGJA 1G5QA 1C0LA 3B7GA 3F6EX 1CLUA 1Y7LA 1E1DA 2DUJA 1YZUA 3UQYS 4KPFC 4CDNA 1FPQA 3MWLA 2SHKA 5C5IA 3CJTA 5L4NA 3QRWA 2R6JA 1VSUA 4XX0A 1KAHA 2CE2X 4JX8A 3DV0B 4BCBA 1ZAYA 1FNBA 4HAZA 2NUBA 1ECCA 4JLPA 4NCJA 4MDHA 4EFLA 4ZYLA 1JPNA 4O4HB 3G0IA 1LLCA 3P0HA 3PCXA 5AVVA 4TN1A 4GXNA 4OAQA 4B3IA 4KGZA 4DYVA 2UZ4A 2WKRA 2IITA 5EVCA 1E94E 3G2IA 4GG1A 1A2KC 4MGZR 1WB5A 3CBQA 4H6VA 3R9XA 4PNZA 5HEKA 1GZ3A 3C1TA 5K0NA 2ZIGA 1XZ8A 2B1GA 3C98A 2VTVA 1YAJA 1GGJA 1HT3A 2J5BA 4RADA 1J2EA 2CXXA 5JSZB 3LD9A 3DXXA 3TW8B 5K3SA 2VRCD 1UC4B 1WY7A 3AJDA 4XGQA 3DVAB 5CFZA 2IEIA 3G88A 3VHLB 2GCOA 2JL1A 3MJFA 3NDRA 3LRXA 4MVWA 3RSSA 2ZM5A 2PBRA 3N0TA 3MG9A 1PJ4A 1SHLA 3SIRA 5FWAA 4D1YA 4KXFB 2VIIA 4FGKA 3DEIA