2OV1A

Crystal structure of apo form of znua with flexible loop deletion
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
260
structure length
260
Chain Sequence
b'DAMDITVSIPPQQYFLEKIGGDLVRVSVLVPGNNDPHTYEPKPQQLAALSEAEAYVLIGLGFEQPWLEKLKAANANMKLIDSAQGITPLEMPGRLMVADPHIWLSPTLVKRQATTIAKELAELDPDNRDQYEANLAAFLAELERLNQELGQILQPLPQRKFIVFHPSWAYFARDYNLVQIPIEVEGQEPSAQELKQLIDTAKENNLTMVFGETQFSTKSSEAIAAEIGAGVELLDPLAADWSSNLKAVAQKIANANSAQP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Possible regulatory role for the histidine-rich loop in the zinc transport protein, ZnuA.
pubmed doi rcsb
molecule keywords Periplasmic binding protein component of an ABC type zinc up
source organism Synechocystis sp. (strain pcc 6803 / kazusa)
molecule tags Transport protein
total genus 90
structure length 260
sequence length 260
ec nomenclature
pdb deposition date 2007-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01297 ZnuA Zinc-uptake complex component A periplasmic
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 2ov1A01
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 2ov1A02
1H1LB 3HJTA 4TKUB 4UDOA 5CX1B 5CR9A 4WZAB 2R7AA 5M34A 4DBLE 4WN9A 5M2QA 3EIXA 1M34A 3ZKAA 4WESB 1QH8A 2R79A 3AEKB 1EFDN 4MX8A 3PSHA 4TKVB 3ZK9A 2OSVA 4B8YA 2MINB 1MIOA 3AEQB 2Q8PA 4HMQA 4LS3A 4WZBA 3EIWA 4FI3F 2PHZA 5B58T 1QH8B 1QH1A 2OV1A 4PAGA 4NNOA 3PSAA 3BE5A 5KOHA 1K75A 4CL2A 2QI9F 3U7QA 1MIOB 1N2CA 4WZBB 3AETA 1M1YA 2PS9A 3NU1A 1N2ZA 4OXQA 3R5SA 4IRMA 4FKMA 2M6KA 3UJPA 4INOA 5BVHB 5KOHB 5KOJB 4WNAB 1KARA 4LJSA 1KAEA 1M1YB 1TOAA 3AETB 2YNMC 4G07A 4HN9A 1K2VN 4WN9B 1M34B 2RG7A 5JOQA 4FNAA 2O1EA 4GICA 1M1NA 4HMPA 3LI2A 1KAHA 4MO9A 1N4DA 4G09A 3AESA 4UTOA 1FP4A 5KHLB 5HDQA 1QGUA 3AEUA 3HXPA 3ZK7A 3HH8A 1G21A 2Q8QA 2OV3A 5HX7A 1K7SN 3BE6A 4ND8A 1QH1B 3PDIA 1G20A 1ESZA 1M1NB 4XPIA 4NNPA 3ZK8A 2PS3A 3AESB 1L5HA 3CX3A 5BVGA 1FP4B 2XUZA 4PM4A 4N01A 4K3VA 3U7QB 1N2CB 4TKUA 5CX1A 5AFSA 1QGUB 1PSZA 3AEUB 4H0FA 2YNMD 1G21B 2XV1A 4ND8B 4OXRA 2M6LA 5M29A 2XY4A 4INPA 4WESA 2XH8A 5GGYA 3MINA 4XPIB 3MFQA 5JPDA 3MWFA 2AFIA 3MWGA 1XVLA 5BVGB 2WI8A 4MLZA 5M3BA 3AEQA 3ZTTA 2X4LA 3G9QA 3TLKA 2OGWA 2WHYA 3R5TA 4MDYA 3K1AA 1PQ4A 3GI1A 3TNYA 1N4AA 5JG7A 5GGXA 3MINB 4BBPA 4M7OA 4HMOA 2AFIB 2XQVA 3TEFA 2XDQA 2AFHA 5JJ5A 4FILA 4UDNA 2ETVA 3AERA 3K1AB 1H1LA 4OVKA 4WZAA 4UTPA 4H59A 3LHSA 3PDIB 2PRSA 1G20B 2XDQB 3AEKA 5BVHA 4WNAA 2AFHB 5KOJA 3MD9A 1L5HB 2PS0A 5FLYA 4TKVA 1K0FA 3AERB 5I4KA 2MINA
chains in the Genus database with same CATH superfamily
2YKGA 4OLBA 4HGOA 1DGQA 4JIMA 2AE2A 2HNAA 4RPGA 4X44A 1EWYA 4MKZA 1E3EA 3EIXA 2CBGA 2OHOA 5IT4A 3LSYA 4G37A 1KDYA 3CEPB 3GNTA 5LA6B 4D0GA 5BN3B 3CSSA 5B1YA 2GRJA 5A9SA 5I45A 2DCUA 5HCIA 5J43A 3F73A 2YXLA 5DHUA 3TQQA 1NNEA 2WJJA 2ESRA 2DULA 2X6RA 3F6BX 1CZNA 2NWQA 1QVRA 2AF3C 1AGYA 2W4QA 3K05A 3PVSA 4P9NA 2P30A 3VSEA 3OCXA 3VPHA 2XCTB 1RYDA 3HR4A 4O4HA 3HU1A 3QEBZ 2PTHA 3H9BA 5L8VA 4KWHA 2AJBA 2PA3A 4TM8A 4FYKA 1E0DA 2VVTA 3JATB 4HXGA 3T3MB 1G21E 3ABSB 3HKEA 3S2SA 4YGXB 2WSBA 4G97A 2I1LA 1PYOA 1CY1A 3EGDA 3HVIA 4HS4A 1C1DB 3HBLA 1DJNA 3I04A 2IZOA 3CM0A 2BR3A 4IICA 3VZDA 3SDZA 2BFEB 1CDZA 1DIHA 2I3DA 1KK1A 2RGEA 2WLSA 1KAEA 3TJZA 3DZCA 3NZEA 4JQSA 2JJQA 1GKLA 3M49A 3ZD8A 4P3YA 5FBQB 4BNIA 3WWEA 1XSEA 2H2IA 2OCGA 4PFQA 5LMUB 3BJMA 4NDNE 1X7WA 2R6GA 5E4TA 6GPBA 4ZARA 4L57A 4O8ZA 1EA5A 3KVNA 4D8VA 4U5QA 5BMOA 4OBWA 1ID8A 1JI0A 3EMBA 1VI5A 1YWGO 2W48A 2W93A 4OHVA 4XGRA 1GR1A 4BMXA 4IQ0A 4DW8A 4E14A 5LSAA 3BH0A 2QXUA 4MPPA 3ST7A 3W2IA 1P9NA 1KYQA 2ZWVA 3DE3X 2JGFA 3GEEA 3SFVA 1CUFA 1KI8A 2R84A 4RFLA 2V5AA 1IY0A 3LNTA 1JR4A 4CMAA 4EY5A 1Q92A 1Z7WA 2BL4A 5BVGA 1Y5NA 3I2YX 5CDHA 4K9KA 4QXQA 3JQPA 4F3NA 2YHSA 3WTCA 4D9KA 2BGUA 3QEMB 4QUIA 3ASVA 3AIIA 3QBVA 2JGEA 4WI1A 3TG8A 1U9CA 2F3TA 2PX8A 3C70A 3NTVA 4GQIA 3UC9A 2OPBA 3FOAA 5LXTA 2JKZA 3RFUA 3SC4A 3DCYA 4ZEMA 5EZSA 4X3CA 3L7MA 3H16A 2YWXA 2ZIVB 4O4LB 2JCBA 1X14A 2W0MA 2X0FA 4DEXA 5AQEA 3V3KA 2OG1A 4GKBA 3WBJA 2JBAA 5E7JA 3TRJA 3QIAA 4ETWA 4ZCRA 4X7BA 3QE9Y 4URZR 1ODTC 4DQKA 4OJNA 2BGNA 1XZ8A 4NJMB 4LY9A 1P2TA 3DF9A 3F49S 1ZR4A 3ABRB 7GPBA 4FDMA 4WRRA 2Q1SA 3S4YA 5KCZA 4IEFB 2P90A 2C4NA 1T3SA 2YCBA 3I62A 4OQDA 4AYTA 3S2IA 3W6NA 2J6IA 2Z98A 3BRWA 1PZHA 3AF5A 1THTA 1GTJ1 5K2OA 2CJFA 5KO2A 2CMDA 3BQNB 4JNKA 4TUYA 4M0LA 4PFJA 1IEXA 3ZWPA 2ZCJA 4X1KA 5JFGA 5M2QA 1P5FA 4QBHA 2V7WA 2MSEB 4GLJA 2G9VA 1B15A 2AVDA 2ZRLA 3ZC3A 4BMCA 1RQNA 2QBYA 1OX4A 2PCLA 3OA0A 5EJGA 4NENB 4L5JA 3BH6A 2R1ZA 4FPXA 5DNVA 5E0OA 1ZZEA 4BNGA 1GL7A 3G9XA 4QRDA 4EYKA 5F5LA 1ZGCA 3QYFA 2COUA 4X45A 3WHPA 4EJSB 4RCYA 4B09A 2FG7C 3I1FA 5IEBA 1C9DB 3B12A 3HDYA 5DNYB 3FDZA 1JKXA 1RKVA 5L6LB 3H9GA 2R0QC 2FLWA 3WVNA 5GPBA 1V3VA 3DM9B 5F3DA 5D01A 1RQGA 1VIMA 1YFLA 4FOLA 1SNYA 1ZD2P 3DA8A 4UPVA 1A9PA 1LVGA 2EP8A 2OV4A 3A9SA 3FZYA 4N5DA 5FTJA 2C4WA 4OK3A 2QMEA 3WP1B 3ORFA 1I0IA 2V45A 1Z68A 1MTOA 1RM3A 1FFXA 4X97A 4RYDA 1FJHA 1GRVA 3CTMA 5JZOA 1T5SA 3JQFC 4L95C 5HF6A 5LN1A 1J2EA 5A3QA 3SCZA 3GGSA 1GCOA 5IASA 1JIUA 2Y4OA 1BJRE 1AGPA 1NQUA 4CV2A 1UBJS 3PGKA 3GH1A 3GZNA 5JC1A 1JSZA 1KZGB 2I6FA 4KBFA 1EFRA 4L6AA 3RM3A 1USIA 1P0MA 3O8BA 3R5XA 5KWSA 1EESA 3KZNA 4GE3A 3W2HA 4J1TC 3WAJA 5JEDA 1YH3A 2ON6A 1RLIA 2QM7A 1FMJA 1U31A 2YJ5A 1GQYA 2QN8A 4LHWA 2I03A 4PQFA 3AF6A 2AN1A 5CYFA 5TT0A 5KB3A 3D8RA 1U1EA 1WNFA 4KR7A 1Z17A 2HXGA 5DCYA 1TK2A 4WW0A 4WADA 3PYMA 4FD3A 1VPEA 1FMCA 1UBCA 2C88A 2PX3A 1T8RA 2HQ1A 4KC0A 4LVCA 4EG4A 3THYB 5DYIA 2VTVA 5KWVA 1OYOA 5JQGF 2I5PO 2XXJA 3T3IA 3KXIA 4RTJA 1E2EA 1T2AA 3BK2A 3FWPA 3RTGA 3ZY4A 1E7MA 2PJUA 1LRJA 3HV0A 2ZRFA 4QO7A 1JW9B 2BV3A 2B7BA 1Y7HA 1O77A 3L0OA 4R1PA 2QRZA 3T3GA 4E5SA 4OMUA 4BYGA 2H6EA 2OVFA 2Z2KA 1DC4A 2ZRJA 1WUJS 1FFYA 1AB5A 1D7OA 2WYUA 2WHYA 3LF2A 3IAFA 3QXHA 4CU2A 4DQDA 4WK2B 3SAJA 5JT1A 2XWPA 4WJZA 3H7AA 3ZVRA 1PS0A 1WD7A 3I9OA 4HUTA 1W5EA 2YRFA 1J8FA 3ENZA 3MF4A 4L3WA 5FQNA 1EAYA 1ZD9A 3E15A 3H2HA 4O1IA 5LZ4A 3DEFA 5BOVA 1KRHA 1F5SA 5H68A 1JHRA 1EKXA 2ODAA 3IB6A 5BN4B 3C3BA 1M1ZA 3KJXA 1E5XA 3VTKA 4C5CA 1XPUA 2ID9A 1XN4A 4N8EA 1Z8NA 3PF8A 1O97D 1QYWA 4GOMD 3IX7A 1T2VA 3U49A 3SX0A 3L77A 4D4IA 5LYJF 1GFWA 1WAMA 1XA0A 4HUQA 3DXYA 4FQ7A 3T4EA 5GIPE 5K3AA 2D4AA 5KOJA 1CUVA 1EVEA 2MT9A 4UM7A 3ZDAA 1I3OA 3OU6A 2CNLA 1CUBA 3L6DA 4O4IF 4WFJA 5JYEA 2FZ4A 1K06A 1YRBA 1XLWA 2F64A 4TWAA 4Y0NA 3QPUA 2VIIA 4E15A 2ZEJA 4DBLE 3AHEA 3DZJA 1K3TA 3GLFA 3QVOA 2R1VA 1KI9A 5DM4A 3COJA 1GTRA 5I7AA 4RIHA 1CY2A 3O7MA 2D8MA 3RVMA 1J0XO 4JP8A 3HU2A 1RLOA 3F4LA 1UOQA 2Y2UA 2QPLA 3KR2A 4BFWA 1UF9A 1I2DA 4ENSA 1PRYA 1XTSA 3CYFA 4DSOA 1IULA 2FZLA 1KJJA 1X19A 2X3UA 3A10A 4MGKR 2OV1A 3EXIA 1CUXA 2XMRA 4NS1A 4QRHA 2INGX 1WQ4A 4TTVA 5K03A 1D2AA 4XUCA 3RVQA 4UVDA 3G79A 3THWB 1SM4A 3IEKA 1NKSA 4GRIA 2Q5OA 4E2WA 2ZTUA 4P82A 1CR1A 4NH4A 1Z4LA 3QUAA 5CM8B 3F4BA 2OCPA 3LY8A 2H52A 4KO2S 4KRGA 4D9NA 5CK4A 4DQLA 5HRAA 2JFPA 1U5CA 3U62A 3G7NA 3JWEA 2CK3A 2NSJA 4QA9A 2CD9A 3QFFA 4W7IA 1P1JA 2EZTA 1R7RA 3EZNA 2NN3C 3MQ4A 4JI5B 4H4DA 1E9RA 3HP1A 4KTVE 3E9NA 4MHOA 1X1TA 3TO5A 5K3CA 4F45A 2JFGA 2WJGA 2ENUA 3IMFA 5KVCA 3RUEA 4IV5A 2C2GA 2G06A 4D74A 1U0EA 3UW3A 3UA4A 3HMKA 4Q3NA 2QT9A 3MLBA 1SZJG 1M2OA 3UVEA 3TLEA 3E5MA 3R7BA 2I7XA 3HB4X 1QGUA 2XMZA 3GW8A 4QICA 2G71A 2PZFA 3QKIA 1C8LA 3MYRA 1HMPA 4OB7A 3RRFA 4UCFA 3PENA 4Y1FA 2QMQA 1G19A 4XASA 4O59O 4NNPA 4UTRA 1N6PA 5JVDF 1I2MA 5LJLA 2FCRA 2QYTA 3FPHA 1NFRA 2SKCA 2PG3A 4TPKA 4D0NA 5DT9A 1FUKA 3T61A 4EHNA 4CFYA 1YI0A 4YRRA 5F2KA 2FP4B 4ZT7A 1CE8B 2ZBGA 3HZHA 4HADA 3LVQE 4RC9A 4B3MB 1EM6A 4R05A 5H16A 5TC4A 5BR1A 1AF4A 4CQMD 3WKBA 2WD8A 2J3JA 1ZXXA 2CXSA 2L2QA 4L74A 3MB8A 3U5TA 3QHAA 1VL6A 2WJWA 3V97A 1R3DA 4K9PA 2H4JA 5EOVA 3KT8A 4NMLA 1MD9A 5DHQA 1W52X 2GT1A 1PR2A 1KYWA 4R1OA 4V1CA 3K1TA 3D3WA 3ZKWB 1R4MB 2I34A 5HKOA 3ANSA 1QPBA 5AVQA 1XV5A 1R10A 3H2GA 3CURA 4G5GA 1XK7A 2MSNA 2XCSB 2YS7A 1KEEA 5C53B 1TJ4A 2C9OA 5EFZA 2BGTA 5BT9A 5ALZA 1T1IA 3NUQA 3TIIA 5DN6D 4U9UA 2H4XA 3IGFA 5AJUA 1Y6QA 4OGGA 4XVRA 5HQTA 1J0BA 3OPVA 4W7HA 1KQFA 1CQZA 2GAJA 3W8EA 4KO4S 4AB1A 4KMOA 4KQ1A 3AHJA 2ISSD 3OQHA 3QM1A 4N5NA 1CK4A 2XUOA 4F5EA 3LC7O 4GLLA 1O6CA 4F9FA 3RSLA 1A71A 2FYTA 4FMDF 4N39A 1Y8QA 4JDUA 3RAFC 3CZQA 4TV8F 2IITA 4ZN6A 4PHFA 4HRAA 5K4AA 4B81A 4ENTA 3EXAA 2A9RA 1DI0A 3V34A 4FYPA 3CTPA 4P38A 5EJ9A 3Q3JB 3STTA 4X54A 1JJAA 4AK9A 1RHKA 2OMEA 4LK3A 2OFFA 3OD5A 3FYDA 1HQKA 1O57A 4I3FA 4ISBA 2CXRA 2GEUA 2HBRA 4NONA 3R9KA 4ZCMA 5KTKA 2M1XA 5LLDA 5K0SA 2WA1A 4RWZA 2BFBA 1DLIA 1JQKA 4HNTA 4YCNA 1YJXA 3OMWA 4EY3A 4DC1A 4EB8A 1I5EA 1ZOOA 4JBYA 3ZGVA 4JQOA 4J0HA 3FF4A 2CC2A 2FDXA 4CIAA 2Z9CA 1TZCA 3B82A 1T4MA 3O3NB 3R24A 2QN1A 3LKZA 4YONB 3UMRA 2C59A 4PR3A 4QGHA 3OURA 2PH3A 3G82C 1RCTE 1YACA 1Y5LA 3FFTA 4J29A 3FUTA 1ZI9A 3BIXA 5BUCA 3LUGA 4IMRA 5KSYA 4CXMA 3T1YB 4F85A 4ED9A 1YCDA 2QAIA 4M9SA 4NE2A 5FDFA 1DIAA 1G8FA 4QDKA 5K8LA 1XWIA 4HWKA 3QFSA 2OK8A 4XDZA 2Z83A 1NAIA 1JUDA 1YR7A 3GQBA 3M81A 4N65A 3CS3A 1AUVA 5JVDB 3ZHSA 1JALA 1E1QD 1OZ0A 1U2TA 2QA5A 4ZMRA 4R2WA 2BELA 5FAXA 3ISJA 1G98A 4HBGA 1QCZA 1OFGA 3HV2A 4JBIA 4TTPA 1BKDR 4B76A 1P1KA 5IK2A 1ESZA 1PLJA 4RNCA 2XUHA 2ZIUB 5L3ZA 1EFTA 1QKJA 4YWJA 3GP5A 2H31A 4HDMA 4G9EA 3OWOA 1OTYA 1E6UA 4C6HA 4H2DA 2H7XA 1KJQA 3RJ5A 4BGUA 1HE5A 2JAWA 1CD5A 1EUCB 2RH9B 3OZDA 3BWVA 4IJ5A 4BX9A 4RAOA 3HBFA 3NFYA 1GKIA 2VUUA 2OBLA 1U0OC 1H65A 1RYHA 1Y5IA 3R5KA 4IDEA 2OM2A 4OXRA 5ELLA 3MINA 2SKEA 3ESCA 1ZOLA 5JPDA 3N0VA 1RHMA 5G40A 3VO1A 2ZSAA 3TQRA 3LT0A 5ENDA 4S12A 4G0VA 3PPIA 3SEZA 3MWDA 5G4KB 4YDQA 2F00A 3DH0A 1M83A 5LUAA 1I3MA 1CDOA 3HYNA 2GPJA 1Z07A 1YR9A 2YJNA 2Z8ZA 4S1OA 2VRBA 2CDAA 2PH5A 2YMPA 5B53A 4GL4A 3TL3A 4RJTA 4EPYA 4ZZIA 2FP3A 1S3FA 2Q5IA 1QANA 2E55A 4FOPA 4MYSA 3ZNOA 1QP7A 3L1VA 3B6KA 2HO5A 1LLQA 1GP2A 1XTVA 1Z5OA 2C8VA 2I4IA 4QU8A 1NATA 3AHIA 3TSOA 1R8YA 3ELBA 4D97A 1IG3A 4EO4A 3M6UA 5MDHA 3V8BA 4KQGA 4WJLA 2P27A 4D3DA 3KSUA 3LDFA 5F7OA 4TV8B 1S8FA 5DXFA 2YFKA 4GGMX 3AL0C 1YZHA 4Q7EA 2PZBA 1LSUA 3DEIA 3OZWA 4OPMA 3WBBA 2WJ3A 2P5TB 3DHWC 3D5TA 4UNIA 2OOKA 1IQPA 1QYDA 4J8PA 2MU1A 3JQGB 2OO3A 3TCXB 1NXVA 4FWIB 3OZUA 3SNHA 4UCQA 4CQLA 4M9CA 5KYGA 4Q3CA 2QIPA 1S7GA 4U8GA 1W9MA 1XRSB 4KW7A 4RVFA 1JXMA 2OP1A 1FNCA 5K3FB 1DAHA 1GPKA 1O95C 1PSWA 2WWWA 1TI7A 1X77A 5K3BA 3VO8A 3H4IA 1IRXA 2QL9A 2W6ID 1HLGA 1PR1A 1ZKMA 4IIYA 4O4JB 3G5LA 4KXNA 4I1PA 2XNCA 5JALA 3USES 1X1CA 2GI4A 4AQ7A 3BUSA 1QGAA 1A5BB 2J6CA 2YWBA 4M7WA 1YDWA 4PC3A 3IELA 2XDYA 4JOCA 4A5OA 1CY6A 2J30A 3GLSA 2NXEA 3X1ZA 3VZQA 1TEVA 2OXEA 1V9LA 3Q12A 4CUJA 5JARA 1B76A 1TZBA 1WY5A 2YXNA 2ORYA 3RUHA 3I64A 2HOQA 6REQB 1UPCA 2H4YA 1KK3A 3IUNA 4EGAA 2O0HA 4WIAA 4KBYA 5GJVC 1N77A 1M2WA 4DUGA 2I99A 2ISQA 3FLEA 3OKPA 5ESDA 2FX2A 3BL6A 3DO5A 4RA9A 1LPSA 4RVSA 5IZCC 4YIKA 4H7FA 4RTQA 5JOQA 1T3TA 4ZQCB 1YZLA 1K7XB 5EMHA 4IJVA 4MVWA 3SQXA 1IZZA 4I36A 5JXGA 3D7LA 3G88A 1UCFA 4UE3S 3B60A 3L7BA 1JJBA 3PFHA 1WU8A 4PBTA 3UC5A 5KVSA 1K86A 3BMNB 3GVIA 3PD1A 2IYYA 5CVDA 4RK4A 1COZA 2WRZA 3AY0A 4Z8YA 1PR4A 2GO7A 3AVTA 3NOOA 2G67A 5A02A 5JV5A 9MHTA 4GOKA 2IL1A 4PO8A 4ENUA 1KOGA 2IBMA 2QD5A 3E70C 3IA2A 1SOVA 2B78A 3KYCB 1T4BA 3P94A 4FYHA 4LMRA 4IG9A 1RAGA 4S1PA 2QN3A 3UHAA 4CMEA 4LVNA 2RDMA 4YAOA 3FKSD 4XCQA 4BQNA 3TQSA 1QIMA 2OK7A 2X2PA 3NJ8A 3KQLA 5C3MA 1M2KA 5DGXA 1H5UA 1YRHA 1ISHA 3H7IA 3TTYA 2ZZMA 4MI3A 3VTAA 1STOA 4KQIA 1BG6A 2AFIA 2NTEA 1DEKA 1P72A 1GQSA 1MVLA 1UDRA 2KW5A 3ZH2A 5DM0A 2VP5A 5I7EA 5BYBA 3ABIA 3SS8A 4RTKA 1UOPA 4JAVC 1Z6PA 2HGSA 3GQVA 1G16A 1YTUA 5CPFA 4QQ8A 3IBFA 1HEIA 1Z0KA 3T3PB 2G9QA 2YVQA 3UK6A 3OP4A 3SZLA 2YJGA 3FFBA 4V0RA 1FIUA 3L6CA 5CB4F 1T0IA 2Z9DA 3NFRA 3SNKA 2ZTHA 3LH5A 4B7ZA 5LQUA 2PGOA 3RAJA 4KIFA 5EPOA 2BSXA 2B7LA 3CISA 1FJ2A 1JLLB 3DFUA 1WP9A 2KLBA 3F9IA 3ETCA 1INLA 2F1IA 4NK5A 1B2RA 1LLDA 3TIVA 2YZ2A 4BYMA 5E0KB 1LPMA 2HCJB 1GADO 1L8OA 1L5HB 2XMQA 2JD0A 3HN7A 4KQEA 4RM3A 4CODB 2B21A 3EBPA 4UDOA 2ZJ2A 4XLLA 2CSUA 2QY6A 2AEFA 2CDNA 2QM8A 4RDCA 5A1JA 4JX9A 4UEKA 4MGIR 1C1XB 1JYEA 2GN9A 5CT6A 4RJ2A 5CXXA 3B1VA 3SM3A 4Q82A 2H7VA 5DBIA 2P0AA 4YRMA 4RE5A 3HLTA 1SVOA 5I4CA 4YQZA 4Y3UA 1WCXA 3AUYA 3HY6A 4ZKDA 4HGZA 4EG1A 2B5OA 1C4WA 4JU8A 1AC5A 2AWNA 1V2GA 3ZVLA 4B4KA 1XZQA 2HA4A 2QR5A 4YAUA 3GRCA 2XGSA 4R1SA 2BMWA 1XPRA 1C3VA 1HDZA 1KC3A 4ALJA 2K7FA 5KTNA 5BWNA 3JYLA 3D0OA 4C89A 3RF6A 3IRVA 4E70A 3HNRA 1RI5A 3HA2A 1L4UA 3R0JA 5AESA 3RVDA 3F7NA 4LX0A 5HMLA 3T1TA 1V5WA 2H85A 3KE9A 1OAOC 3LBAA 2FW9A 2OBNA 1HA3A 1A9RA 4UMDA 2C9CA 3DHYA 4NXMB 3NPAA 1U11A 4I5FA 3OD1A 4WXHA 4FEGA 1FC0A 2VHYA 4QD3A 4ZV9A 2RARA 2F4NA 2AQHA 4JVNA 4LRQA 2YOGA 3D59A 4DC0A 2O4CA 4DA0A 2CMHA 2PJDA 1Y5RA 3BE8A 3WQQA 1CZHA 5AKIA 4YJFA 3T7JA 3R09A 3FLMA 1ORRA 4COKA 5JD5A 3S7ZA 2C9YA 3VKHA 2FSHA 1PT9A 3PUJA 4B5LA 1RQXA 4G36A 4U2BA 3V5NA 3DZIA 3GGJA 4WBNA 1L5KA 2A86A 3W9BA 2LVBA 1ESMA 5F1YA 5G0VA 3SICE 4B32A 4NYMQ 1PYGA 5C8DA 2FJUA 2KQUA 1WU7A 5AVJA 3IEXA 4P31A 1H2WA 4GHWA 1U3WA 4GSKA 4IRUB 1L5QA 2ACWA 1DQYA 2R87A 4CMJA 3EN0A 3LQ2A 5CEJA 1DJLA 1FB5A 2C2YA 2PU5A 2C4TA 4MRMA 3KR0A 2O52A 3WLSA 3ZY3A 4F21A 5ESWA 4RY8A 2C92A 1VLLA 2BFCB 4RW0A 4EYQA 2ZYDA 1HDGO 1GSHA 5EPUA 1BA2A 4NL4H 4DJ5X 4EWLA 3KAPA 3FZEA 1JDTA 4CVNA 4DCTA 3CONA 3E81A 5HXAA 2XGOA 3K0SA 1WS6A 3F4KA 1TQDA 3MLEA 1JHVA 3KJEA 2B82A 2BISA 3OUTA 4RVCA 1XMIA 5CB4B 3HYSA 1ZGZA 4MS1B 1MOSA 3H1FA 2BWJA 3WYGA 1NNLA 4UE6A 3HR8A 2NUTB 1VB3A 4XR4A 3IILA 1LNQA 4YTEA 2DH5A 2Z6AA 1ZM3A 3RC8A 3R1IA 3T7CA 4KIWA 2X2EA 4PAOA 3N58A 2ROQA 5IH7A 3NHZA 5LD2B 3L05A 2JHFA 3KOWA 4U7JA 4XVHA 4PLCA 4FR0A 5CAEA 1NJGA 1A2QA 1GCGA 3VC7A 1U04A 2DUUA 1XF1A 1E2GA 3WJ7A 4JWTA 5K6AA 1L5WA 5K0NA 2BHTA 4HVTA 2FQYA 4Z7OB 1QKIA 4JLBA 2RGRA 2ZJ3A 4MYRA 1SIUA 2FX5A 5AJXA 2GAFA 2G9NA 3TDNA 4DQ0A 2ZRHA 3VNSA 2AG6A 3REGA 4M1KA 3DBRB 3OZSA 1KO4A 2GZMA 2JIPA 1L1FA 1E2FA 4FN4A 2JVKA 1ZPDA 3Q0EA 4K05A 3RKRA 4KLNA 1T9CA 2ZUCA 2V0GA 1OVMA 3R41A 4I1YA 4ER6A 1ID1A 2FFJA 4JLDA 4QO8A 4DDKA 2FMHA 4LF4B 1P5ZB 1PGQA 2P40A 3FTPA 3BKXA 3JWHA 1R3UA 1CRLA 2R8BA 4Y1EA 1QHIA 3IYLW 3I61A 1E66A 1TF7A 4HEQA 3A28A 3RC3A 4F6RB 1QJCA 1HFKA 1YQDA 4HX5A 1GGNA 2UYCA 5U1PA 3TXXA 1OYYA 4B31A 5I7FA 2QDXA 4KFSA 4Q4JB 3VU8A 4RENA 3L79A 2PZLA 1AF7A 1Z3CA 4OJKA 4L07A 2FUG1 4YAJA 1XMQB 5ADHA 1L1QA 4L22A 4RY0A 4ID9A 1AZTA 4E0BA 2FPGB 4OGKA 4EGFA 3T5MA 2EL9A 4HGQA 1C1HA 1W4BA 2DBYA 4D0SA 3VH2A 4CN8A 1SRRA 5IDYA 3C5CA 4BB0A 3EPHA 1SQSA 5HQ3B 2JZNA 3FPCA 1YMQA 3L0DA 1RHQA 3N5KA 3CPHA 3MT0A 3HCCA 2XLBA 2Z2XA 4RSMA 1KQNA 3GAZA 2AQIA 2VUHB 1ZKDA 1C2TA 4MMYB 1EFVB 5BURA 4M60A 4TTAA 3TSCA 4D9HA 2CHUA 2JGAA 1VPVA 3H97A 4KSBA 5EMJA 1K4MA 5AHXA 5PGMA 4Y2RA 3SU8A 1GPH1 2TYSB 2VK1A 3ETGA 4LWOA 1FVFA 2XZTA 4N40A 2HC9A 4ZTZB 3H05A 4NCKA 1TAGA 1QS0B 2QV0A 2PQ0A 2KHZA 3BMQA 2C9ZA 2Y0DA 3OCYA 1ECPA 3O8OB 5GGYA 4QULA 3RTCA 3TL6A 4BWYA 3JQQA 4S0XA 1DBSA 2FFQA 3ZY2A 3LPCA 3JQ8A 4YALA 3W90A 1V5IA 4B82A 2PFSA 4ZVUA 1O9HA 4LQLA 1G8MA 5EE9A 3U7RA 1EFHA 1JWBB 1QLWA 1ZG3A 2Q8NA 3G0DA 1ZONA 3HP7A 3HSKA 3I52A 4L4RA 4RDIA 3RV3A 1PX2A 2X0JA 3AFMA 2H1IA 4PSDA 2CHFA 3GP8A 1MAUA 2ZJAA 3ED5A 3M0EA 4L8FA 1T2NA 4CR7A 4AJ2A 2OESA 2JFWA 3VA7A 3G8CA 1R6VA 1SG0A 3L43A 2ETVA 2HT1A 4MCHA 4CDRA 4Q7QA 5JPCA 4IMPA 4QAJA 4J1TA 4KCGA 4LEIA 2HN9A 1TA0A 2XECA 2NO5A 4LOAA 3RRNA 4EPWA 2EYUA 5GOTA 1WXIA 1T9DA 3G3EA 3MAJA 4XXHA 3VR5H 2JRLA 2PM8A 4GKVA 4AT1A 1QE5A 4YBRA 4DV1B 2J7PA 2F1JA 3AVUA 1PVOA 1KK0A 3U4IA 1Z16A 2J9XB 5FO0A 3I76A 5M34A 4KPFC 3SZ3A 4TMTA 5E8JA 1J56A 1L4GA 1KDVA 4YCMA 3JQAA 3I8SA 2FGKA 5KHOC 2C2ZA 4R2JA 1LBHA 1SHTX 3OMLA 4DIDA 2JGKA 5EN4A 2ERCA 2FPWA 2QN7A 3JZFA 2YUTA 1OY1A 4YJHB 4C4SA 1QFMA 3PXDA 2B37A 2HADA 4REQB 1K9SA 4UHHA 1TCUA 2A4KA 1HBJA 1ZIXA 5T8KA 1BGWA 4N18A 2BGGA 3D7MA 3TCKA 2J32A 3ESBA 1QO0D 2K5UA 1JQJC 2JFQA 4EA6A 2Q2WA 2YWHA 1ATIA 1QVAA 3PE3A 1ACMA 5ITSA 2H4HA 2VATA 4A6XA 3DMDA 3DL4A 2HF9A 3RWMB 3R40A 4IIGA 4FOSA 4PZ9A 1P18A 4XM0A 3GUCA 4AJKA 1WEKA 3EODA 3OE4A 3FI0A 2ZYUX 1IAQA 2WD7A 2XI4A 2XCIA 1ZNZA 2OEPA 5C7LO 2D5LA 1HQYE 2IPOA 1ZVQA 3KB2A 2KJQA 1QFYA 4G01B 4JC0A 4E1VA 1U2DA 3LUKA 2HFKA 3GAMA 2KE5A 4XW2A 1YQGA 5AI5A 1DO2A 1RQ2A 3H2BA 3HCWA 1N3YA 1UJ4A 4TQUS 5CITA 3O9MA 4E31A 1JNXX 5EE5B 3WA7A 1VJ5A 3CKLA 4MS4B 3OFKA 3PI6A 1KR2A 4K6OA 1ZH4A 3ZWOA 2JJ2D 3U4QA 2QXTA 3SE0A 4KQ2A 3QGMA 4IDPA 2VKQA 4FVTA 3CPSA 4JJ8A 4B3IA 1QRRA 1PP4A 2E5WA 1JHPA 3ITNA 3PQ3A 2F7SA 5KHLB 4Y2HA 1YL7A 3LWNA 3A27A 1ECGA 2QSYA 4RWEA 4HNVA 2W42A 2VTEA 4IDGA 4OH7A 5JAUA 5CA1A 3IV6A 3KXPA 2PMFA 3GAFA 5FXMA 2WJ4A 4BNTA 5KYWB 4KSCA 3R76A 3TLMA 3ZGNA 2IUTA 1SOAA 2NO9A 1FP2A 2CHVA 2JF0A 2L69A 1NLFA 4PM4A 1SCIA 4QUGA 4YBZA 4BE7B 4EFLA 1HEYA 3Q7IA 4TMFA 4LF8B 3IQZA 4LV5B 4S1WA 3AVVA 2J0QA 3LA8A 4MIOA 1NM5A 1QPZA 3P9CA 4PY2A 2QP3A 2X7HA 4EG7A 1AS3A 1C9EA 3WGIA 4GS5A 2IOFK 1IHXA 2WIDA 3V1YA 1WR8A 1Y5MA 4WESA 2Z8XA 5FJJA 2B4QA 4CMIA 3VFDA 2FEPA 2NTVA 4QXRA 4BO3A 3MWFA 1Q77A 1U8XX 4MWSA 4EVRA 5KYTA 1ESEA 2D7DA 4EECA 2PUJA 3LGAA 3KVYA 2Q5JA 5REQB 4AJNA 4CT5A 2GHQA 2F43A 3T95A 1GYQA 4EAAA 5KUTA 2Y0PA 2V7XA 1FSGA 3P2JA 5G0SA 1PGPA 2EGHA 3DR5A 1DBPA 2W8ZA 3W06A 4EI9A 3IOEA 3HB1A 2DBZA 3OOSA 5JCJA 3L8HA 3MRVA 5IXSA 1OBVA 4FNMA 2ATEA 4YHHB 2QTFA 4NOLA 5DEOA 2HF8A 4L5CA 1R5JA 3X2SA 5KSWB 4BZQA 4WZBE 1W7AA 2E37A 3O2NA 4D0RA 1MTZA 3DZGA 2MCFA 2ZJYA 4F5YA 1ZGHA 2L0XA 4BVKA 4F8EA 3EF0A 2W2LA 3NG1A 2OCYC 1QIHA 1UM9B 1VKJA 4FFMA 4MWZA 4PV7A 1FLNA 3DONA 1OPRA 4GR5A 3ZG6A 1HT1E 5K01A 1YFJA 1E1YA 3QUTA 3OPYA 5J59A 3F78A 1WV0A 3H5NA 3PC6A 1RWMA 4F56A 3F97A 2Z5LA 3PXBA 1Z62A 1W96A 1D0SA 4XD2A 2F8SA 2AA3A 2AMJA 3OSZA 1GV1A 3VAZA 2UVDA 3NX4A 1QBKC 1P1RA 3BXFA 1R0RE 3KDAA 4G2TA 5GMOA 5M04A 4J0FA 4F1JA 4K6KA 2GNPA 1I6LA 3DOFA 5J4HA 4YHBA 1UAYA 5EXXA 3SF0A 2OYSA 4KPUB 1KKUA 2PMWB 1XWWA 2V7VA 4FSXA 4OKNA 5GV8A 5IP5A 1J2RA 3W05A 2X19A 1SGWA 4L4ZA 4AZTA 3OCJA 2TMYA 2QJRA 4YP6A 3WNVA 2VJMA 4JR2A 1RZRA 4ZRMA 4ZT3A 1H94A 2PV0A 5IC6A 3F2VA 1VCHA 4YUVA 2FEOA 1W0JD 2PKWA 2ZRIA 5JCOA 1G8SA 2QM0A 1XVUA 3R3XA 4M49A 3PQ2A 1B23P 3FSGA 3OLVA 1PVVA 4F3RA 4G67A 5KU7A 1K1EA 3EH2A 3MTIA 4B43A 5JS8A 5JNSA 3RRXA 2VP4A 2I54A 4FDUA 5HGXA 4H4EA 1GT91 2QD3A 2BOVA 2EJBA 1Q21A 3TKAA 4PYIA 2YWCA 1VTKA 3RARA 4U7WA 4BVEA 5JADA 3K0HA 1ZCAA 3EDRA 4UXJA 2HMVA 1ZVMA 3BGIA 4R2LA 3TS1A 2YWGA 3ZY5A 1QO7A 3FOZA 1XD8A 3BMOB 3GFFA 4BZPA 3TLZA 1S2GA 1YS2X 5KNDD 5CBPA 4R1QA 1RCFA 1T0HB 1CJSA 3GLIE 2YH2A 4KWTA 2IBSA 3DE5X 4M0UA 3F8SA 1N0WA 2DX7A 1VKRA 2EWWA 3DM5A 4GGOA 1ISJA 1YOBA 4WAUA 5F5NA 4EPTA 3ZZTA 1SQ6A 1T3GA 3QELA 5C5EA 2RGWA 3I6IA 3PPWA 1YS7A 2EAUA 2N3ZA 1HDYA 4J7AA 4TS3A 3A6LA 1KZYC 1NHGA 2A1UA 5CVEA 2QEQA 1IXSB 3LJKA 3BXEA 3PA8A 4HFJA 1AHHA 2KI5A 1D4ZA 1TJYA 5AOBA 4BQQA 1CY7A 1I33A 1E5QA 4YYEA 1CJMA 1OYWA 5HW0A 2CZQA 2I62A 2QYHA 4HQLA 4U1RA 5D3QA 5FCDA 3VPBA 4ZKEA 3EASA 3ZV7A 5LMZA 9LDBA 1A7AA 2IZ6A 4FTWA 1J5PA 1NW8A 5NULA 5CFLA 2EARA 1T4CA 3FYUC 4GX2A 2WUDA 3DMFA 4PIVA 2MSCB 1ENZA 3BG5A 3B3GA 1MC4A 3BJZA 4CT0A 2GSWA 2OQIA 4W6QA 4EY8A 3DFKA 2FR8C 2WF6A 3U39A 5E1BA 3K1AB 5BWBA 1JMVA 4UFNA 3I2IA 3QPBA 4BEVA 1DC6A 4MJ7A 1DT3A 3V6MA 3JQ7A 1NVMB 2NUPA 4H7PA 2JAXA 1XYYA 4M88A 4W5WA 4QGAA 1JBEA 2D06A 4WY5A 3SF8A 3ZEAA 2J85A 3NWJA 3GY0A 1U4OA 1CZUA 1XNJA 3O9VA 4Y8VA 4DEVA 1NTOA 3HJTA 2DR3A 4A0GA 2WHEA 3HFRA 2DP4E 4RVGA 1U2EA 2PUBA 3K73O 1KBOA 4H31A 3ZKAA 3H0KA 1RIIA 4ZO8A 2GKGA 2QVXX 3DD5A 2XMSA 1Y3BE 2HUPA 3IE0A 1GAJA 4TQAA 5TVKA 1RSZA 3SXJA 3EXG2 4B6JA 1GQOA 1V25A 3MFYA 4MP6A 3TECE 1NONA 2W58A 1Z2EA 4ENPA 4GP7A 2AMLA 2X1MA 4BBZA 1QU3A 5L3QA 4PXSA 1Z0UA 3IV9A 3CEJA 4GDFA 3PHHA 4I66A 1S9HA 4LVUA 4BP9A 5TPZA 1FSFA 4Z2AA 2J3KA 2XVMA 1DPFA 3WK6A 1OBHA 2XQJA 3CBGA 2G1UA 3UKJA 2AJDA 2XVZA 3KTAA 4MI9A 1U7UA 2P9FA 3UJ6A 3P0EA 1MUUA 2GPYA 1NAHA 4R2HA 1CZRA 3TEJA 3PDWA 2A0YA 4F5DA 4FDTA 2C4VA 4WA7A 1GLVA 2JIMA 2WG0A 3KV3O 1QFZA 4TVKA 3KSBC 4AD8A 4MEAA 3BZWA 1QVWA 3RC2A 1GZVA 4LBVA 1AKYA 2PV7A 2XT6A 1UBMS 2HWXA 4I4TB 3ITDA 3OTGA 4FK8A 3U7EB 3UA3A 3EJWA 3IPAA 1OF1A 1SOUA 3EXEB 3WLTA 2HBYA 3PXUA 4V3BA 4A0SA 3TM4A 2B35A 5IT5A 4CEIB 1MLDA 3CH4B 3AUSA 5IC5A 4YO8A 1CJBA 1QYXA 1XF9A 2JDID 2RGYA 3FPSA 4FUTA 4NU5A 4OGLA 1TKRA 3KQHA 2X76A 4NU0A 5JTUA 3K0FB 3PYLA 3R3WA 1Z5ZA 3GFGA 4LF5B 4TKMA 1MJNA 4GMHA 4DYHA 5TQ2A 1C30B 1VMDA 2HIHA 1JIVA 3HJBA 1OLOA 1OU4A 2NPFA 3SIWA 5BSKA 3PGXA 4GE0A 3VISA 5KJ6A 4R5HA 3TX2A 3AF2A 4TSRA 1RWWA 1P33A 1KMCA 1SWVA 1UK9A 1IOWA 2REBA 3KJFA 4LNAA 2AUMA 2JI9A 4X62B 5CW2A 3GBPA 3TJRA 3AVQA 1M73E 2G08A 5AVTA 2WFLB 3PFBA 2ZJ6A 5HILA 4Q9DA 3MSCA 2CXNA 2HKIA 2BKEA 4DILA 2CL0X 4G26A 1U0NA 4QU9A 3RWBA 4UPEA 4XPIB 1OZAA 2JFVA 5EMLA 5B36A 1NW7A 2MSKA 3GVCA 2ZATA 1IJEA 2XR1A 4MSUA 2BHNA 2QZZA 3VBEA 2C99A 3VR3A 3SC2B 1T2UA 4PZYA 3S5JA 2J8ZA 4YPVA 2ZJ1A 3CSUA 4U2CA 2GXSA 2WTMA 4RQTA 2DPLA 5IJ0B 1QRSA 4AKGA 2VP6A 4NV0A 2CLOB 4P81A 1UC4B 4HEA1 4HO1X 1UBOS 4B3JA 3L8CA 3TI9A 5A04A 4QTTB 1RWBA 2ZBDA 5EJAA 3KG2A 1XMSA 1A4IA 1JFFA 3EZLA 2P2DA 3QRWA 3ND9A 4FILA 4LZZA 1ZFNA 4RE6A 5TS2A 4EPVA 2XB2A 3BFKA 2Q62A 2O8FB 1YJQA 1UBHS 2WOJA 1BWPA 3R74A 5EZ6B 1EE9A 1LNZA 1VCMA 3WSWA 2RH8A 4KI0A 2PRZA 4KI7A 5TMBA 4JI7B 2VDMB 2WB4A 4ZODA 3CC8A 5BN3A 5LA6A 3VHQA 5E4YA 2YRWA 4BKUA 2V3WA 5BY2A 4KDRA 2VRWA 4V0SA 5PNTA 2PD4A 5KQRA 1F9EA 4C6SA 1RACA 5FHRA 4Q03A 1X9IA 4KE6A 3PTAA 1URPA 5MN5A 3LZ6A 3M5PA 4DJEC 1NYQA 1PJRA 4V0ME 4Y7CA 3TDKA 1G9TA 1XT6A 4AC9A 4RPJA 2PUFA 2IYEA 4M1QA 4E2YA 2HYDA 3ICQB 1G5IA 2NSLA 4N0QA 1QK3A 3PQ7A 2YHUA 2OVBA 5B3AA 3EXFB 3LCMA 4N5MA 4HMQA 4PNEA 2X23A 3LD9A 3UWSA 3A4TA 3JATA 4RMNA 1N57A 1G38A 4YRPA 5KQGA 3FXAA 2OBBA 1BWQA 1P4HA 2QTNA 4KFUA 2X4IA 5EJ6A 4M8SA 1SUIA 2BTOA 1Q1EA 1C1DA 4XVQA 1VMEA 3M1YA 3OM0A 3WK4A 2QI9F 3FTDA 3B8HA 2BFEA 5E7MA 3ENKA 4DMRA 5HKLA 2ZJFA 2QQEA 3H9EO 5A62A 4W9MC 2PRJA 3OEYA 5B1DA 5ALKA 1QIJA 1FS4A 2F90A 1BE1A 1X0XA 3NASA 2CE7A 1VI6A 4WKOA 3DVRX 2UZAA 4W9RA 2P9CA 1ZXBA 1L1EA 1NURA 1PR0A 1V5GA 1W8IA 3FAKA 2TSYB 3I73A 4TROA 4A2WA 1AT1A 2P4QA 5FJIA 2WV7A 2YVUA 4ID3A 1RYYA 1MW9X 3HEAA 3O1LA 4ZAZA 5FPYA 1M6YA 2QENA 5LD2C 1R8SA 1X7HA 1QJ4A 1J0EA 1BQEA 2Q9BA 3EQ6A 1NU6A 3H17A 2JIZA 1EVZA 1YZVA 4Q4LA 1T8PA 1GZSA 5FI3A 1LBEA 2ZUUA 3OM9A 5AW3A 2P68A 4FFLA 5ICSA 1KAHA 4WCFB 3H11B 5FFMA 4U00A 3V1TC 1TQ6A 1K8RA 3C8MA 5ECYA 2I1VB 3WRYC 3HDGA 1DLJA 1Z0ZA 3Q8KA 3LUFA 5CG2A 8ADHA 2NYVA 1ISSA 2QJFA 2IOHA 3QEMA 3U7JA 3WMXA 2CV1A 1I9GA 2W2KA 4XKJA 2VNKA 4XWKA 4K2HA 5I8ZA 4XFKA 1W2GA 4PCAA 2WMYA 3T41A 4AZSA 4EARA 1Q0SA 5A4AA 4B40A 5AH0A 2HH9A 4WHMA 3UAVA 3HQ4O 4QPPA 1CZKA 2PRKA 3CUEF 4P7FA 1QAQA 1K3FA 5ICGA 3BTUA 4NYMR 5T6MA 4GXQA 4UM9B 4ARAA 1Y3HA 4HQ0A 1PQUA 3GJYA 3NOXA 4IGIA 1ZEJA 1K8QA 3IXQA 4O4LA 4XZ3A 2QZJA 1C0PA 2BJWA 3REOA 1M74A 4OI0A 1XVVA 2ZS8A 3EBOA 5K0FA 3KTOA 2LNDA 3O91A 4UQLA 4KGDA 1ZIYA 5BRNA 1E2BA 3KLPX 4DB4A 4D9GA 2GKOA 2X8JB 2V7UA 1LDNA 3ONFA 5DH9A 5A9SB 4J4BA 4BNNA 2HV8A 3MMSA 3GMIA 1SCAA 1Z7EA 4G5OA 4NJMA 2AZXA 4KLAA 4C3UA 4NH0A 3EZ9A 3UN1A 5CB6A 2VUTA 1IDOA 1XJCA 2ZR0A 3D6AA 1MDFA 1RWQA 1J21A 3GELA 4NS4A 3C6XA 2A1TR 4C4ZA 4DMMA 2Z5FA 3NAQA 4QFMA 4KXYA 1JGTA 1PUJA 4YLYA 1KO5A 1VPDA 4XB2A 3LECA 1UOOA 1AUXA 1T9HA 3W3AD 3UV6A 5LQCA 4OG2A 4PYMA 5ENZA 3HBNA 2NT3A 3EMKA 3CRNA 4YDRA 1GU0A 3A3KA 1NRXA 1E7WA 1XUOA 3Q7TA 3JCZA 4NENA 5GZ3A 1VG0B 1M9NA 2EZ4A 2WMDA 2ZETA 3FGOA 4JGBA 4L75A 1CR2A 1DEAA 1ST2A 4R0MA 3AP2A 4JSRA 3U26A 4EJSA 1ORDA 3EC7A 4RLHA 4U2KA 5BSMA 1OR8A 4C76A 1U3TA 1N2XA 4GM0A 1SXJC 4Q18A 2B69A 4UCXA 5T4HA 3W79A 1H2FA 3ZI0A 5K8UA 2JVJA 4KQKA 1ECFA 3M3PA 5K0TA 3WLOA 2JA1A 2VYVA 3Q8MA 1OLSB 1ORIA 3ROFA 1NNUA 3TZCA 3F6RA 3M6WA 1CJVC 1TC1A 2WUEA 2VQDA 1Y9AA 4JXXA 3C3AA 2EKZA 5B6PA 2WJ6A 3OOWA 4QBFA 2FOLA 5CNJA 5H83A 4FLEA 4FWTA 2GAOA 3VO9A 3GRZA 1XDWA 1CWUA 1ZWKA 2EERA 4EL0A 3DQPA 4C2TA 2YJZA 2DE0X 2B5WA 4DA4A 2ECOA 1UFOA 3WGOA 5IRCD 3C5EA 4RJKA 1DQPA 2W6JD 3SLKA 3WLFA 1WDKA 2Q5LA 3SKXA 1JSCA 1WSWA 4BY9E 3NVKI 3B1WA 3BD9A 1DE0A 5IFKA 1DC8A 2AK2A 1R0KA 4PZAA 2XD9A 1QHSA 3DBVO 4WV3A 2YHAA 5IAAA 3A1FA 4JROA 2WUVA 1EDBA 3M6AA 1FSPA 4WOBA 3D6VA 2QUHA 3IOBA 5EVJA 3LNCA 4ZCSA 3RHSA 2B8WA 2P5SA 3DLPX 3O1JC 4K5QA 3M83A 4W82A 1JHDA 1HGXA 3B9BA 5FBVB 3B36A 3MCUA 3QVWA 4V0NA 3SEAA 1VJRA 3RKSA 3THYA 1PR3A 3AJAA 1LS6A 3B7WA 1PS8A 2V7TA 2VLBA 4AUEA 1DFGA 1GQRA 1OB2A 1QWOA 1N1MA 1QQTA 2VT2A 4FYIA 5CU7A 3ZU6A 1JB1A 4YT8A 1P17A 3TRFA 1YUMA 1C3XA 2R85A 3HCRA 2P4HX 3VPCA 2XRYA 4IIJF 4TS4A 3L46A 4MW7A 4G8BA 4LTNA 3RRMA 3QYAA 1IY2A 5HZMA 1FTSA 1ZUIA 3LUBA 1CEQA 1WD5A 3HGMA 3N87A 3OY2A 4OHKA 1FNBA 4TXJA 4V03A 1KYYA 3FVWA 1ADFA 3IOMA 2QJWA 3EWSA 1YAHA 2I55A 3A04A 4YV0A 1YB5A 3N2ZB 4R40A 1QYVA 2XUAA 5JRZA 1AA6A 5BN4A 3WHIA 1HK7A 4M7PA 1KF0A 1YVEI 2QQFA 3EPRA 2XUKA 5L6MB 3MC1A 3ONDA 2TRSB 4WOPA 2F1RA 3H5RA 1GGJA 4QARA 1DFHA 2VYCA 1ZH6A 3NLLA 4GBJA 4HRXA 1DWOA 1VL2A 3G0GA 2J31A 1NW9B 3WE7A 4LDRA 4KR3A 1R6XA 4OHFA 4QTUB 5FUVA 4GD3Q 3OT4A 1ZICA 5CFOA 5SY6A 4BO4A 1LSSA 4PZZA 1BU5A 4OEHA 2HWKA 2DPYA 2GBFA 1U7OA 1QE0A 4RZ3A 5AP9A 1GAWA 2FY8A 2VDPB 2PAFA 2Z1NA 2ZSUA 3AEZA 2KB0A 4NBKA 4ZOCA 3BGOS 1JR3A 5FH9A 4M38A 4BNLA 2I0FA 3N0WA 1DCTA 5P8WA 1E6KA 4YQEA 5JS2A 5GTDA 3DGEC 2IYVA 3GJXC 1JFRA 3H1BA 1DX9A 5AO9A 4E30A 1QHNA 2ZR8A 4WZAB 5JBIA 5LQMA 4NVRA 2C5EA 4TTQA 4WN9A 4FYJA 4GX0A 1OGJA 2ODWA 2R6FA 3OF2A 1VXRA 3LHFA 1TVEA 1A97A 1T2FA 4RY2A 4B83A 1TKBA 4D8WA 1JFTA 5HS4A 1K63A 4CLDA 1MX3A 1T5LA 2Y1KA 4ALNA 1SPBS 5FEMA 5KTSA 3THWA 1XQVA 4ZTUB 1JHQA 4MHSA 2J67A 3M82A 4J1SA 4JI3B 5H8WA 2W2NA 1SXIA 3RUFA 5E6UA 1TM2A 4OV6B 4BVBA 1CHDA 4GOOD 2AXPA 3PNSA 2OFPA 3ULKA 5K4HA 4P54A 5IUKC 3OJXA 2W2MA 4H6XA 1ORHA 1L7PA 4URUR 4WOKA 4ZVVA 3VDNB 4Z4QA 4HKTA 2GCOB 2I4MA 2H2DA 4OA5A 3KCNA 4LPKA 1KP9A 2NVWA 1SHKA 2NZ2A 3K16A 2EF1A 3F5FA 5LZ9A 4J49A 2H3EA 1RPNA 1KETA 5CVJA 4D26A 4INOA 3KLBA 1AN0A 2DUNA 2H1RA 1ZIPA 4D42A 1Y4ZA 2O14A 3N8DA 1U7TA 1RVDA 2AG1A 3BICA 3CUUA 3NHJA 3A3YA 3QJYA 3RBXA 4ZPXA 1QFSA 4D41A 5F76A 2DUWA 1A96A 4AF7A 1L4FA 2BW0A 1TQ8A 1XBTA 1Y7LA 2ZKLA 4KK4A 3PF9A 4OH1A 3ZJ5A 2PZJA 4K03A 1ZAKA 4X1OA 2KX7A 2EL7A 2Q28A 3A1CA 3DLTA 4MVCA 3ZWWA 4DBZA 3W34A 4DMGA 3MIIA 2EGUA 2FXIA 3M34A 2CNOA 3VHRA 1XZNA 5HRCA 3F90A 1JDNA 4XI9A 2GUGA 4CUKA 4BWGA 1C29B 5KYUA 4IIJB 1P44A 3OM1A 2AI2A 1DEHA 3K1JA 5ITVA 1H1TA 2A57A 1XEWX 4HEJA 2CXXA 3EYAA 3AW9A 2C7BA 2AD5A 2FEKA 4XA8A 5NLLA 2FP4A 1CE8A 2V5UA 4AKHA 5BYAA 4W63A 2WNHA 3TQFA 4LF7B 3K31A 1VQ1A 1UZNA 3A9UA 4JK3A 3L7NA 4K8OA 4Z49A 2C5GA 1J1UA 4GZMA 2PLNA 1ZR2A 3F47A 1BKSB 3NT2A 2A67A 4KXQA 1PAUA 3F5SA 5IKXA 2NU6B 2BRUC 4FJ2A 2ZLBA 1G41A 2YIJA 2CUTA 1R4MA 3ZKWA 5JSQA 3P9XA 3SXUA 4ZZ3A 3U4GA 3KNZA 3VR6H 4BFXA 4CKCB 4OQNA 2OD7A 2D0IA 4I5IA 4EI8A 4R84A 3A8TA 2QB5A 4NKRA 4J0CA 5DMXA 4RQAA 3O73A 6ABPA 1N5MA 1WLYA 4U8HA 2GZ1A 5DTQA 4BFCA 3ZXUB 4MRRA 1U98A 4ZGBA 1EG2A 1TUBB 4MVJP 1SB9A 3F71A 5CP8A 4G5FA 3B53X 1CYDA 3AYXB 4DC9A 1PJSA 4YMSA 2A0WA 5ERXA 2ID8A 4ARIA 1U0SY 2LR0A 5EUCA 1V7ZA 4PLGA 1FP1D 4W5HA 1ES9A 2CCGA 2HEGA 4BBAA 1PBNA 4P4NA 3HI4A 4XD7A 1E9EA 4Z99A 4R7GA 5LL6P 3U1VA 5JISA 3MJVA 2V8BA 1MJGM 4L6IA 4IDHA 4U3JB 4L0QA 1Z7GA 5LZ8A 1L6IA 1LI7A 5AKJA 3LLMA 3IEPA 2V4UA 3FDFA 5DM70 3B1YA 4KACA 1P31A 4QUJA 2FPIA 1WLSA 1TB4A 3R6LA 3TLYA 4B6GA 4BFSA 1QIEA 2XUFA 4GRDA 4LCEA 2I9KA 2FZCA 2VYNA 4P5DA 3R5JA 1EDOA 2C9DA 4IUYA 4QOGA 5CPBA 3WGZA 1MV8A 4JYAB 3QG1A 5MFPA 4LZAA 1KZ4A 2H5LA 4MPRA 3IHTA 2DR2A 3BWEA 1P1CA 1TM1E 2P2GA 4RL6A 2VEOA 1FYDA 3PL1A 4DZTA 4C7VA 1SQFA 4D3SA 4M0PA 2ZE7A 3AZPA 2BEKA 1IBCA 4FT4A 1KVTA 3TVYA 4FIDA 5TE9A 2C84A 2NAFA 4KQCA 4GKJB 4Y18A 1CUHA 1I4LD 5DBFA 4OHXA 3N8NA 2UKDA 4GX1A 4R0VA 2ZT7A 1OIWA 1B3RA 1I6KA 2P91A 5ILQA 1IXKA 4CCAA 2PPLA 2FWIA 2IY8A 2VP9A 2EFYA 2GHIA 4LUCA 2VAWA 4TRNA 3OZTA 3DAHA 3GCWA 4AMGA 2JZOA 1T5BA 1Y1KE 4NBRA 4BUZA 1Z5VA 3N07A 3P9IA 1USGA 3GMSA 4YP1A 3UK7A 4ECAA 1EMDA 3CVXA 1OKKD 3GUVA 4NPCA 1Z6XA 4EOGA 2ZBPA 2MMGA 4X90A 1DZIA 3OP1A 3N5CA 1PJZA 3QPDA 4AMYA 3A6GA 3JVDA 2P5UA 1N6LA 1E62A 2Z6UA 2D5BA 4L2IB 3HXPA 1EUCA 1UKBA 4O2RA 1ZJ6A 4UCWA 5B3JC 2OD2A 4E07A 2PYZA 1KFKB 1XOIA 2R2GA 4TXHA 3WGMA 3KT3A 4G0ZA 1YB4A 4QGFA 3H0CA 1CUCA 4K40A 4M7RA 5ANRB 3DDNA 3FGPA 4CIDA 4E11A 1XTTA 3R44A 4NFLA 3UMMA 4AVYA 3V2UA 4FKBA 5CX4A 4XWAA 5IBQA 2EFJA 2F6RA 2IPLA 1Y8ZA 5G4KA 3EVEA 1DXOA 1O97C 5BOSA 1MBZA 1ZQ9A 3OT1B 1CZOA 5DGTA 3LCVB 2FUKA 4CM8B 4CF4A 1OV6A 2RKOA 4DRYA 5GM2A 2M2IA 3K4HA 1XCBA 2E89A 4Z4IA 2UVQA 2VA8A 3HE3A 4LJYA 1I7NA 1XRLA 2JH8A 4B3DA 1V16B 3H8VA 1QF6A 4P4LA 5E9AA 4IIUA 4LCBA 2PVSA 1NR7A 2IX3A 4C2AA 3BEDA 2VWGA 4TRRA 4DJFC 1GUFA 2V03A 4M87A 4BJ5A 3AONB 5BP7A 4TV8A 1GRQA 1AN9A 1R88A 1TGYA 2YN2A 3D4BA 2D0PB 3E1GA 4KN9S 3C43A 5A2GA 2WM9B 3DOIA 1ZOSA 3OQ1A 3QKTA 4V0KA 3SGLA 3SQWA 4B1FA 1MABB 1OXTA 2ZE8A 4PPFA 3WKDA 3JAWB 2AOXA 4KRXA 4TYQA 2H7YA 3JQGA 4H59A 2EBHX 3ACBA 2QAJA 3D2AA 3HU3A 3IQDB 4WKBA 3WV5A 2CFRA 4PRLA 4DBVO 4XIYA 6AT1A 3VNVA 3AGQA 1JZQA 2EEZA 4G8JA 5CT4A 1Z8FA 4MRNA 4EH1A 4LBWA 3T1QA 2FDCA 1QAOA 4DREA 3BK1A 5K3FA 1KFCB 1KY2A 1YCGA 4HX2A 1ZD1A 3OOJA 1ONBA 3D6JA 4ZVLA 3ONWA 4O4JA 4ZT2A 2HRRA 4L0MA 3OT5A 3OE7A 1EFUA 3P4UA 4QPNA 3W4KA 4DR2B 2BZ1A 1RLMA 2PUDA 3ZLJA 3VMFA 1DRUA 2FSPA 3KEFA 3A4LA 3TSZA 5IU6A 3K96A 1K9VF 3KAQA 4I08A 1IZ0A 4ESVA 2QTWB 4CM1A 4EA7A 1DBIA 2C5FA 4FW9A 4TLDA 1NP7A 1QH1A 5HA5A 1CUGA 3EZ2A 2C7RA 2W90A 3O38A 1Z88A 3V8QA 3GT7A 4OXYA 3O4IA 1NBHA 2W9XA 3IBGA 6REQA 5KOYA 4TQGA 3EUWA 5A9TA 3BGDA 3C3DA 4P92A 1BDHA 4ZEVA 4FHZA 2BCGY 1REQB 3DXZA 4P4TA 4XLZA 3T54A 1O0BA 4N1AA 3RS2A 2CJWB 4MVJI 5G1OA 4NZZA 3URMA 5IXJA 2WUFA 4G4IA 3SK0A 4N48A 2GHRA 2VDUE 1CV2A 4FGLA 5EVCA 3TIFA 1G6OA 1C3LA 4E5YA 3BMNA 3L04A 2F3UA 2DAPA 4KZPA 2IEBA 1HL3A 1TYEB 3KWMA 2QIOA 3HO8A 1PJ2A 3ZV4A 2JCSA 5L3VA 4AY5A 1AKMA 1KYZA 1POXA 3DAGA 4PPYA 5FF9A 5A0TA 2JLXA 1BMQA 2WJPA 1TYZA 3DDOA 3G89A 5F2NA 3TQIA 4MLCA 3QEAZ 3B89A 1W87A 4HXYA 3ZU2A 4CLOB 5F3RA 2GK6A 4JP1A 3P5SA 4JI2B 2VJKA 1QTNA 1BJKA 2HD4A 2K7ZA 1IWPB 4FGZA 1K7FB 1X7YB 5BSUA 3ROEA 4CV3A 1T43A 3UBTA 3NI2A 4Y9RA 2XSZD 1SUPA 2MIIA 2X4DA 3OFJA 4JNCA 4LDJA 2R8OA 1PK7A 2BZ0A 4IOLA 1W4CA 1MQ9A 2XW6A 3F7TA 5DISB 3Q3IA 5LBTA 4HRVA 4R71A 3JVIA 4PAMA 2UAGA 3OFSA 3WLKX 1ZN7A 4OUDB 2JBHA 4IXDA 4KVZA 4PLZA 2VNIA 1YJAA 5I3ZA 1GUBA 3P0IA 3SX4A 4WZ6A 1P80A 2II6A 4MUAA 5CT5A 1HLFA 3EG9B 3WKEA 2SBTA 3WFJA 4CEHB 1UK6A 3DTVB 1L7DA 3TNFA 3T35A 1GA6A 4KOAA 3RVJA 4MYTA 2BTEA 4A7PA 4LHEA 1WSDA 3G0OA 3C3JA 3B2EA 1NP6A 2IDJA 5AHRA 4UASA 4CI0B 1JHXA 3IJEB 2IOQA 3BGSA 3EQZA 4OIFA 2YDXA 3IDQA 4MVYA 2X0NA 4FDVA 1TJ3A 3SP1A 4DRXA 5MN4A 4OFXA 4M0EA 1HDXA 3J80A 2MYUA 3HTXA 1VSBA 1E3IA 2ZR7A 1H3NA 1HZJA 2ZSDA 5EP3A 4Y2VA 5DX1A 5HJ2A 5CG1A 1C1XA 1E3JA 1OHHD 3BMXA 3B1JA 1GL9B 3L02A 3QE3A 5ERYA 2OB1A 4N7BA 3PJEA 1Z56C 3DKPA 3IMGA 4OQQA 4RIEA 3R6WA 2LD4A 5CM2Z 3GWGA 4TKUB 3TG2A 1KEWA 4OQLA 4TMVA 2IZZA 2WPDD 1U7PA 4I1RA 4X24A 2W2VA 2ZJ4A 4YUZA 1N7GA 1FEZA 1KZ1A 2JAHA 4H17A 5DYTA 1JB9A 4O33A 2QT0A 5AOAA 2CCKA 3BXGA 2JG3A 3DDZX 1JL3A 1P0IA 3E5NA 1O5TA 4EEZA 4Z6KA 1F0PA 1L4NA 4P86A 2O1WA 3ZHUA 2VJDA 4NY1A 4TSFA 3K9NA 5C80A 1ULTA 2WAMA 4LKOA 1YI8A 3Q2IA 1YDGA 1CUIA 2I1QA 2Q4BA 3EEQA 3H5AA 3K5PA 3WWDA 4DJDC 4EVQA 1XFDA 3IDZA 2Q3LA 3C8DA 3CVYA 2NX2A 2WHQA 3QA9A 2Z56A 3OH8A 5EE1A 1OFHA 3RADC 3MOGA 2Y1EA 2PXAA 3QFHA 4QTYA 5IJ9B 3NNSA 2QP4A 4GXRA 2I87A 3T5DA 4FGWA 4QQRA 4RTSA 1PWEA 1JE1A 4IRMA 2J3DA 4EENA 3MEQA 3GLQA 3N7TA 5EZYF 5KYVA 1QTRA 3IKVA 2O8DB 1OLXA 1VBMA 1I6MA 2I9PA 2BH2A 2PKQO 2VBIA 3L1HA 4MQ6A 2O3UA 1VKOA 4RV5A 5KI6A 3AX6A 2UUBB 4AX8A 2CDBA 3QUCA 2BMDA 3LQFA 5JWOA 3RB8A 4KXXA 4YRIA 2C3YA 2OV6A 3WIVA 4IH4A 4P2BA 2B25A 2OM6A 4US1R 3QVJA 3CXRA 4EKDA 3NDBB 2RHTA 1KIMA 3TCNA 1GYPA 4BMOB 3W5AA 3UJCA 3OJEA 2BFCA 4XPZA 1A9ZA 5CFZA 2QAGC 3HJCA 4QAQA 2EYQA 4UFPA 5FNVA 5KEIA 3L7OA 1C3OB 2IKSA 1DX6A 4OHWA 2QI9C 3EWNA 1G8GA 5K5EA 3P2IA 1JPUA 1DSSG 1UPTA 4ML3A 3H65A 4OYYA 3HM2A 1C1YA 1XYGA 2R25B 5G0UA 3W2EA 2BUAA 2RJNA 3Q88A 5DNDA 5CB4A 2ZS9A 2ZBQA 4ND7A 3C3YA 2Z8YA 1RTTA 3GRFA 3L0YA 5K51A 3KQNA 2CFOA 2NUTA 1I9CA 2PLAA 4D6PA 4CWAA 1R18A 5DI3B 3FMIA 2GXUA 2QRNA 3PITA 2F8MA 4RD2A 4I19A 5ECDA 1PQ4A 3BM5A 2NZ8A 3PT5A 3STWA 4F46A 4O08A 3PVZA 4LMPA 2VPQA 4GWLA 1WY7A 2HDHA 1BU8A 2H4ZA 5BSFA 5KYXB 2SNIE 4W8OA 3ZVNA 1BDBA 3ORQA 1XXLA 1DRJA 4FYMA 4P3OA 3OJLA 3VC2A 3HDHA 2CBXA 2H9AA 4QFDA 4QELA 6YASA 1PEAA 4I7EA 4JOSA 3OETA 5DIZA 3V1MA 1Q0HA 5I5GA 2PY6A 4OP2A 3ND5A 1KPIA 2FPMA 2PANA 2Q6TA 3CKMA 3JRNA 1J0AA 3TW4A 3S55A 4IFTA 2QRPA 1UXJA 1U0TA 2NPIA 2XBLA 3ZWBA 5IJXA 4CMHA 1KTIA 2CL5A 2IEDA 3DBRA 3S7TA 1HKHA 2WHXA 3VU9B 1GTZA 4LG1A 4EG8A 5J1SB 3C7AA 1ZSNA 1PWZA 1LBTA 1GGKA 2R7AA 5TQJA 3SI7A 4BKMA 3THXA 1GTG1 1QUFA 3ZYZA 4Y2TA 4F06A 2G1PA 4HX9A 4GM1A 1RKXA 5DTMA 5BQXA 2DHQA 5MHTA 3BJEA 3PV0A 2ZRKA 2VHCA 3AFHA 4JBGA 4YRJA 4YMUA 4O2AF 1OROA 2C4MA 2P2ZA 1ZX1A 2YMMA 4MH0R 4HNRA 5E4FA 3UFBA 2Y27A 1NOKA 3NBUA 4CF6A 4F8YA 4DBLC 1L8XA 3B1XA 4LDQA 1WCV1 2Y99A 4PCVA 4F6RA 3AC0A 3L06A 2PMDA 4HK4A 5ALVA 5HP4A 2IV2X 2ZBUA 3AU9A 2WSSA 3EFBA 4JB0A 4Q4JA 2B98A 3L8GA 3VH4A 4FZ5A 3FR7A 4UUNA 4BPBA 2QQGA 2OZVA 2XUPA 5EZYB 3SBDA 3NRJA 1N2BA 1M7GA 2H57A 1SU6A 2IYPA 4ZQFA 2NXCA 3STHA 4Y1RB 1P0PA 3PXEA 1XG5A 3R0IA 2C04A 4UHDA 4RO0A 1F14A 3TUIC 4ER0A 1HDOA 4HAZA 2HQOA 2XYVA 1HY3A 1HE8B 4YAEA 2GH1A 3ZHCA 13PKA 6PFKA 3RNLA 5JY1A 1BROA 3PRJA 2HCFA 4QUBA 5HQ3A 1XMOB 3PJDA 4RCVA 1K0UA 2WU8A 1BTOA 3MWEB 1B41A 4MW9A 4TTRA 1TCAA 3EARA 1Q20A 3PNQA 5AKGA 4UU7A 5BSWA 1HRDA 2CZCA 1EFVA 5KDDA 1PGNA 1SC4A 1U2RA 1ZNXA 2CWWA 1KL7A 3LPDA 1ICEA 2V4ZA 2V6MA 2DFKB 3M6FA 4XIGS 4YN3A 3WLLA 4D02A 2JLUA 3D02A 4RH0A 1EJBA 3HVRA 4ZALA 1C9JA 3P2EA 1QS0A 1G291 2FR1A 3SJBA 2WSIA 3O8OA 4N6GA 5AJHA 4B4UA 5JEEA 3FZNA 2PKQP 4ZYTA 3CVWA 3PQDA 3QV1A 3RUAA 2P5YA 1I2ZA 1UIMA 1W9HA 2NG1A 1ZDMA 1R9MA 3RUIA 1I7DA 2V55B 4PX9A 4GKKB 4NBTA 2HK8A 2AXNA 4PVCA 2ZPAA 721PA 1PV4A 2D1SA 2XUGA 2CV0A 1EDDA 2YW9A 2FSUA 4YXWD 1UJCA 2C57A 2FWBA 4A4DA 4YAGA 2Z0MA 5H70A 2PIAA 1ILEA 1UR5A 1Y3FE 1X94A 3D6HA 3F9CA 1GG8A 2F3QA 3IH5A 4O3FA 2Q5QA 2ZK7A 2OWDA 3TNLA 3ZQ6A 1AV7A 1HYQA 5MN6A 4PG4A 1OXVA 4O02B 5LQNA 3AM3A 4QQKA 1SMKA 3CLRD 3R0QA 3ICOA 1UMKA 4IKPA 1I3LA 2FRVA 2D2EA 5DCWA 3BL8A 5J2TA 1L5RA 1KI7A 1XKQA 1QQ7A 3G9TA 3KQMA 1PL7A 1WMEA 2G9ZA 3WDLA 4MK4A 5L4NA 3PDUA 4RTMA 1EDEA 2OCDA 1IWBB 4OHPA 4LFBB 4C2BA 1AU9A 3KPVA 5TSDA 5I3CA 3ND6A 2BJHA 4DMUB 1WPGA 2J9YB 3D6UA 3JYPA 4QJ4A 3IR6A 2VCYA 3O83A 4BJ6A 5CCEA 4W5OA 5HFNA 4A36A 4Z1MA 3RASA 3ZZUA 4EK9A 4G56A 4NATA 3VVMA 3ZGLA 3C8UA 1W4ZA 4A0QA 5ALXA 2B4RO 5AKZA 2WP0A 1E6CA 1X8KA 4LJRA 4OAQA 2JIRA 1K0FA 5EP2A 5I4KA 2Q27A 1QTQA 3IVMA 5DDIP 2BGIA 3DMNA 4REQA 4XQGA 5ICEA 1QRDA 3H83A 3ZIAD 4F4FA 2GDJA 3FPAA 2H1VA 4CKBB 1TYCA 3NCTA 3A11A 4CM9D 3BEOA 3O0DA 1U6IA 1FDVA 1NG1A 4CR6A 3L6EA 4ZICA 3JARB 4TYMA 3X1DA 2BUBA 1IN7A 1IZYA 2IYRA 4NCHA 4ZAXA 1B0ZA 1KO8A 3OQIB 2EATA 3RDPA 3R6GA 4QOEA 4DM3A 4MQBA 1LWOA 4BNXA 1G3MA 3LFUA 3OJ0A 3UT6A 1EJ2A 2H06A 4JJ7A 2WFZA 4GQBA 1MGOA 2C78A 2ODBA 4UHEA 1WXGA 1JDZA 4YQFA 3L6UA 5JJIA 1H9CA 3N0XA 5EWLB 3A36A 2JHCA 3G23A 4LC9A 5DTIA 5FLEX 2JH9A 5DE3A 4CTOA 2PWPA 3FPLA 3KZMA 4BDTA 4MS4A 2P8JA 2G8LA 4JJ6A 2IE8A 4OXQA 4YV1A 2QUIA 3LK7A 5IN4A 2M32A 3PRYA 2IZ1A 1JKJB 1B8OA 1EWTA 2XTAA 3B48A 3GD5A 1JHOA 1OAKA 2A14A 3THSA 4LAFA 3V1KA 3W7VA 1YQ9A 4LFAB 1NPTO 1RXEA 3IO5A 2GPWA 1T6YA 5AI6A 1A7UA 2ZYHA 3EFHA 4X7PA 1AQNA 3TTTA 4CLXA 5AKLA 4ZIRB 1S6YA 3I9FA 4AKEA 2PSEA 3NS7A 3QTTA 2HBQA 2IFTA 4HD8A 4MP3A 4W99A 4FFOA 1IVNA 1K8XB 5CDTA 1IJBA 4GLOA 3V7WA 1OWNA 3WIEA 3PCRB 4CKYA 1LW6E 2XHEA 1O9GA 5LQRA 1L7AA 1KBQA 1JIQA 1XKXA 4WKNA 3D3KA 5BXYA 5DBGA 1PWHA 1E20A 4FZ3A 4NULA 3SJZA 1MKYA 3KO8A 3KUDA 3UWPA 3F3MA 4OQFA 4YR7A 4LXXA 2JA2A 3SOZA 2WF7A 2HPZA 1N32B 2ATIA 3LY5A 3VYWA 2O8CB 3KEGA 1R5NA 1QNLA 1Q3HA 4Q9KA 5REQA 4YJ3B 1CP3A 2NZVG 3E2MA 1Q7BA 3LP8A 4JEMA 4JLUA 4LOLA 1XNGA 4ND1A 4BLRA 1Q91A 5H59A 4BNYA 2GN8A 4UM8B 2YL2A 2QYSA 3BPSA 4QXAA 4TMXA 2REOA 2HWYA 2IS2A 3F0TA 4Q9HA 4KGZA 1P9WA 5KJEA 2H9YA 3NDIA 4D8UA 3CT4A 3N2YA 1Z83A 4C1NA 2NUAB 2WWHA 2NO4A 3TLBA 2O54A 2I6QA 3O75A 1NI4A 1NIJA 2XBMA 3JD2A 3K9CA 3O4JA 2Q3EA 2C5BA 5JSFA 2ZI9A 3IAAA 4LHYA 4J91A 3N74A 2XQVA 1JQLB 3HWX1 4HPXB 4C4TA 4F3KA 5CFRA 1JR6A 5AHKA 3RC7A 1UM9A 1ZUWA 2DUJA 2FZWA 1S8OA 3X0DA 4NQRA 5JJKA 2DECA 4UTVA 3PJRA 1WOYA 2EX1A 4E88A 5EGSA 1Y1SA 3C5WP 5SYNA 4AKSA 1M75A 5E9QA 2O23A 4YT4A 3WGTA 3E0QA 4RM2A 4C0SA 3T06B 1G8YA 1ZISA 3AOEC 3ASYA 3OX3A 3VV3A 1VKZA 4YC7A 5G0TA 4EG3A 2QUJA 4FR5A 4MKFA 1L7RA 1EVQA 4J07A 4BIMA 1KP3A 8MHTA 3HN2A 3MTBA 3M1IA 4YCBA 4NMWA 4PYKA 2L82A 4KPUA 4GG1A 2YJ6A 3EULA 4KFRA 4YEDA 4QHTA 1GTVA 4NQZA 2FW0A 2Q2OA 2R6HA 4K9SA 4TWJA 1UPXA 2BRUA 3GA5A 5CM9C 5H0IA 2XQIA 3UAXA 4W4TA 1T8SA 4IAOA 4CL3A 2P9ZA 1PBTA 3OBIA 3Q87B 3PHLA 4DLYA 5BPFA 3TBHA 2Y67A 3ICVA 2WFMA 3IPLA 1CUJA 1Z2CA 3CX7A 4JJKA 4QVIA 1O94C 1VE3A 3VNUA 4PX2A 3V4FA 2BGMA 5LFAA 3RFFA 4N8DA 4B85A 4BX8A 3O0TA 1N1GA 1W59A 1YL6A 5CNMA 2C5SA 2ZYVX 2QF7A 1G8HA 1KJWA 3PEEA 3GG2A 5LZ5A 1GG2A 4JCOA 4R2IA 4OM7A 4JYBA 3VX4A 1YA8A 2A78A 3DEAA 1RRCA 3DE4X 3R9WA 3MZ0A 4HY3A 1Q57A 5KQLA 4F86A 1E8NA 3AUTA 3ZCUA 4KP7A 5BW5A 2FNAA 2VBGA 2O2GA 1BOOA 1RLUA 1P2VA 4TQ9A 2VS1A 2JIBA 4BQIA 3C4JA 3LXXA 4LI3X 4Q3AA 3DLCA 3NTXA 1TFUA 3BMOA 3WNBA 1FRFS 1RWPA 2QD1A 4IS2A 3MOIA 5ALEA 3UHFA 2D62A 4W1SA 1F2UB 4D9IA 4NFYA 1KMQA 2XCQA 3L6OO 3CCCA 3MLAA 4MYUA 4OYHA 1RJ9B 1NLUA 4XIIA 4YI5A 2G07A 2RG1A 4UU8A 3N75A 2IV3A 3VOAA 2Q4RA 3OIWA 2AWOA 4K88A 5GZ6A 1PIWA 2DLCX 1OZFA 2NU9B 2D2FA 1H93A 2GYWA 2HMAA 3OFVA 4PLTA 3A31A 3MMZA 3SWWA 1RPTA 2JGLA 2R6DA 1XTRA 4O5AA 2ZB3A 3MUOA 1CP2A 1Y9ZA 2DTDA 5KNDH 5MGBA 3A06A 3GDWA 1TJPB 1MX1A 1Z75A 2P2CA 3AF0A 3DC2A 4INAA 1JXOA 1N2CB 2V59A 4I99A 3ZW8A 1GKUB 5AXDA 2Y1CA 3RIXA 3AFIA 2Y0BA 3Q7QA 1LDBA 1M7BA 2OV2A 4E5KA 4YP9A 4JEIA 2VF5X 3HKBB 4PCLA 2BONA 5A5VA 3NOVA 2O0KA 3VPXA 5DHRA 4NCAA 3MT7A 2X7JA 2A0UA 5C8YB 5K0BA 4R9VA 1W581 4BTVA 1V7PC 3LQQA 3OUUA 1L1RA 2C2WA 3P52A 1I1QB 4HAYA 3K1AA 3QX3A 2P35A 1S7CA 4M9ZA 3UUGA 3L84A 4AMZA 1M5RA 4M9QA 1X2BA 3AL2A 4IP0A 4M8IA 1K2WA 4QX6A 2R00C 2YV4A 1G5TA 2I4NA 1R5OA 1ANKA 4YJGB 3BXHA 3JAKB 1EQAA 3I8OA 2LCQA 3R23A 5LJIA 2NIPA 4NEHB 3NHRA 1AY0A 5LB4A 4A1OA 3ZBTA 1B2LA 2IELA 5YASA 3VYRB 4IIBA 1GAQA 1RZUA 4BQEA 1XKLA 2PWAA 3MS7A 4ROSA 3WV4A 2FH5B 2JLAA 2CVOA 3IIJA 5IT0A 4GLBA 3TRIA 3TF5A 2PL3A 1NMEA 4X85A 5EMKA 2CB0A 4AJPA 1UFVA 5KVAA 3R0ZA 2IBTA 1ISGA 4AZ0A 4BMSA 4DCVA 3IQEA 3GT3A 1KEKA 3DWEX 3LKBA 3DCJA 4M1YA 3CB4A 4YPFA 3L0SA 5CR9A 3CNBA 3TX6A 5KTRA 2XTZA 4KYIB 3DVLA 1E9SA 2GEJA 1VG9B 1TM4E 2J3LA 3NGLA 4IJMA 4N3BA 4ZXPA 3G2KA 4EY7A 2HQSA 2Y6UA 5CVUA 3KXDA 1I1NA 3K3PA 1D8TA 1TA4A 1NVVR 3D3EA 3PDJA 4M0DA 5IMBA 4F4HA 4ZYUA 2IYTA 2O2ZA 3AO0B 4R3UC 5DGIA 2FZGA 1IOVA 2WYHA 3E8MA 3WADA 2HQBA 3PS9A 2WK1A 3ORSA 1J49A 1XHFA 2CF5A 3CRRA 5SYAA 1KPGA 1NG9A 2X5OA 3W5CA 4YDHB 1DAFA 4I4TA 4BAZA 3O3MB 2OPHA 2BEUA 2IA5A 1WABA 3EXEA 5A9RA 3OZFA 3TVDA 2A6PA 3D6FA 4DG8A 4CEIA 2C0PA 4G0UA 5FPHA 1HORA 2QK4A 2EC5A 4ZYLA 1HTWA 3NB0A 5JSZB 4ROTA 3WNDA 1TIBA 1TO6A 1YQWA 2JJ8A 3E2IA 1V3TA 3KQPA 4FIZA 4PGGA 1GN9A 4MR9B 3F1LA 3ZUPA 4BMVA 1XCMA 4FDAA 1LZLA 5TV2A 1C30A 3WYCA 2R6R1 3AK4A 2EBFX 5KAMA 4XVCA 1C80A 2FGJA 3DBIA 1PLKA 1WX1A 1U3FA 2VFAA 1G5RA 4NJEA 1N4DA 5BV1A 2G1AA 2QVGA 3NWBA 3NUGA 2DPGA 2WFLA 1Q6ZA 1XQ6A 1E5LA 1GQ2A 1DQSA 1R0XA 5HX7A 3DUWA 2BVNA 3EBLA 1WW2A 3ESYA 4IXTA 1YBVA 5JFTA 5JBNA 2DY0A 4X84A 1DC3A 2A1TS 4XPIA 4PX5A 1GD1O 4UHKA 1SUBA 2CE2X 3NV9A 1Z0FA 2MHCA 1Z38A 2ZRPA 4US0R 1RZ3A 1ONOA 3UQZA 1IPEA 3LX5A 1FQWA 1P75A 1P73A 5D3MB 4AXXA 5EJ5A 3SC2A 1I94B 5HFAA 4MHTA 4CFSA 1SWWA 3HVKA 1Q22A 4HAOA 5JR3A 4IDQA 4Z4GA 1W2WB 2OHVA 2A35A 5CH8A 1FUUA 2HCTA 4F3YA 3HUUA 3QY9A 4RPLA 5AUQA 2YXEA 4PZUA 2IZ0A 1PO7A 1ZM2A 1P4RA 4EPXA 2ZB7A 1UPUA 2HA2A 4MMXB 3TLAA 2O8FA 4BV3A 1E2KA 3VMMA 4B3RB 5F33A 1Y1TA 4OHUA 3TE7A 3GLFE 3AHCA 1SUFA 1V8FA 3WXBA 4C3VA 2R4QA 3I5AA 4GOND 1OW3B 5IXYA 1OWMA 1Z5UA 3KDSE 3G6WA 3CLSC 1XELA 4LTMA 4X95A 2I6SA 1Y98A 3NC4A 3BQ9A 3QE0A 3WL6A 2VHQA 4DS3A 3LPMA 4FHEA 4KR9A 3M4XA 2QVYX 3IUPA 1UP7A 1G5HA 1GEEA 1TDJA 3HGQA 4GPZA 1AX9A 2WIGA 1EX1A 1XAJA 3UH0A 3AR4A 4BMZA 1Z6YA 3BKWA 2WF8A 2R8EA 1ZA1A 4DLXA 3ZD9A 2JHAA 1AJEA 2ZBVA 3EXFA 3GJQA 3PGMA 4S35A 4YJ2A 1NN0A 2GFQA 2LCIA 4YCDA 4BUJA 4OP1A 1EM8A 5A3RA 1AMOA 1E1RD 1QRAA 3SDBA 1TQ2A 5CIYA 1FXSA 2JKYA 2JANA 2VRCA 4UEWA 4Q9AA 1CY0A 2B1GA 3R4CA 3NDPA 4UTNA 1GXSB 4AY4A 3FJOA 4CL8A 1C7RA 3CR7A 3IDAA 2D2IA 1N5OX 1L9XA 3AEQB 1XEWY 2P6NA 3UK1A 2DLNA 3M7IA 3RAGA 2WMOB 1H66A 3TKLA 1SK9A 1OI7A 4GOJA 3F46A 5FPPA 4FI3F 3IE1A 1AUOA 1HR0B 1W4LA 1J2JA 1IHPA 4G0NA 3VDXA 1DXYA 2H07A 3Q7EA 4IEIA 2QTVB 3BE4A 3WGYA 3WKAA 1QG0A 2IS1A 3RT7A 4P4GA 5LOVF 2X5KO 1G59A 4YLGA 3GUYA 3PXGA 1U9IA 1R0CA 2ZGVA 3PUVA 5FEUA 3TZHA 1AGXA 3BF7A 4UEQA 3K30A 3E23A 3WMRA 4CMCA 1Y4AE 4YLEA 1VFNA 3AQ4A 2C5AA 2LPMA 5CFNA 3CGGA 1NQXA 4DDMA 4B7XA 4QKQA 3UJPA 2VI5A 2P6RA 4G9BA 4E4YA 3L40A 5LUBA 3TAHA 1Y3DE 4F5WA 1J42A 4X92A 4WCFA 3H11A 2P2YA 4OHYA 4XIJA 1B0AA 3SHVA 1IDN1 2VTDA 1P1HA 3AETB 3OPMA 5JPIA 2JPDA 2AKAB 1BCSB 3Q6NA 4MDFA 3T52A 3EA0A 2DWUA 4NCXA 3O03A 1BS9A 5JAMA 1DUSA 4KSYA 2Q07A 3V4OA 3R7FA 4Y6PA 5FNZA 1NXXA 5HVNA 1YZYA 1OI2A 1X7ZB 4BOYA 4R1TA 4YCLA 4GVPA 4OK6A 1QK5A 3CUSA 4JJEA 5B1HA 5I9BA 4E6PA 3G1TA 3E9MA 4DVJA 4EUSA 1B3BA 2JB9A 4QWMA 4YMTA 4JIGA 2KBEA 3I4CA 4WACA 3M5CA 1L8LA 2SHKA 1OWLA 4X94A 3GA0A 2IQIA 1JDVA 1JR2A 4J4HA 4ZCQA 2XUZA 1RYNA 2X8JA 1K66A 5CX1A 1ISMA 1LQ2A 3DL0A 2R86A 1VZ3A 3F96A 1PZNA 3EOZA 3IHWA 5LQKA 3U4MA 4DDWA 4GPEA 4F93B 2F2TA 1Z5NA 1A7JA 2FMXA 1ZQ1A 2Q5EA 2AHRA 3CZ4A 4OU4A 4WVFA 1AKRA 1BA3A 5DRTA 1WUYA 4LSWA 3MBOA 1N7HA 1QTIA 4W5TA 5CLIA 2A5YB 5A4MS 2VWQA 3BIJA 5B5SA 3GFOA 3P45A