2OV1A

Crystal structure of apo form of znua with flexible loop deletion
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
260
structure length
260
Chain Sequence
DAMDITVSIPPQQYFLEKIGGDLVRVSVLVPGNNDPHTYEPKPQQLAALSEAEAYVLIGLGFEQPWLEKLKAANANMKLIDSAQGITPLEMPGRLMVADPHIWLSPTLVKRQATTIAKELAELDPDNRDQYEANLAAFLAELERLNQELGQILQPLPQRKFIVFHPSWAYFARDYNLVQIPIEVEGQEPSAQELKQLIDTAKENNLTMVFGETQFSTKSSEAIAAEIGAGVELLDPLAADWSSNLKAVAQKIANANSAQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Possible regulatory role for the histidine-rich loop in the zinc transport protein, ZnuA.
pubmed doi rcsb
source organism Synechocystis sp. (strain pcc 6803 / kazusa)
molecule tags Transport protein
molecule keywords Periplasmic binding protein component of an ABC type zinc up
total genus 90
structure length 260
sequence length 260
ec nomenclature
pdb deposition date 2007-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01297 ZnuA Zinc-uptake complex component A periplasmic
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 2ov1A01
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 2ov1A02
4UDNA 1PQ4A 4WNAA 5KOJA 3AEKA 3PSAA 2R7AA 2XDQB 2XH8A 4HN9A 4WESA 5B58T 2AFIB 1QH1B 3UJPA 1K2VN 3K1AA 3ZKAA 3ZTTA 5KOHB 2WHYA 3PDIA 2PS3A 3NU1A 4FKMA 2AFHB 2X4LA 4ND8B 4BBPA 5BVHB 5JOQA 3PSHA 1G21A 5KHLB 1QH8B 4G09A 3ZK9A 1L5HB 4MLZA 3AEUA 1M1YA 3AERB 4HMPA 4M7OA 1M34A 4OXRA 1QGUA 2XV1A 5AFSA 3R5TA 3MFQA 5I4KA 4INPA 2M6LA 3EIWA 3AEUB 4UDOA 1K75A 1XVLA 4TKUA 4WN9A 2OV3A 4G07A 1FP4B 2YNMC 4MDYA 2AFHA 2O1EA 4XPIA 1MIOB 3K1AB 5KOHA 2AFIA 1MIOA 4WESB 3HJTA 3EIXA 4TKVA 1PSZA 2XQVA 4H59A 4WZAA 2OV1A 1K0FA 3MD9A 4WNAB 3LI2A 5BVGA 3LHSA 4WN9B 1KAHA 4GICA 4DBLE 4UTPA 4WZAB 3AEQB 4K3VA 4B8YA 4OXQA 3MWFA 1QGUB 5M3BA 2XY4A 3BE6A 3BE5A 3G9QA 4PAGA 4HMQA 4XPIB 1N4AA 3U7QB 4UTOA 5GGXA 1L5HA 3AETB 1G21B 2ETVA 4TKUB 2WI8A 1EFDN 3MWGA 3R5SA 4FI3F 3PDIB 4FILA 5HDQA 5JPDA 1M1NB 2XDQA 1ESZA 3AEQA 1H1LA 2PS9A 2Q8QA 2PS0A 1KAEA 3HH8A 4OVKA 2M6KA 4HMOA 4LS3A 2R79A 4TKVB 3CX3A 4MO9A 1N4DA 5CX1A 3TLKA 5HX7A 5CX1B 2OGWA 2QI9F 4FNAA 1N2CB 4H0FA 3AEKB 3TEFA 4WZBA 1FP4A 1K7SN 1TOAA 2PHZA 3ZK8A 5JJ5A 3ZK7A 1H1LB 3MINB 5GGYA 2XUZA 2MINB 4NNPA 3GI1A 3AESB 1M1NA 5JG7A 1N2ZA 2PRSA 4MX8A 5CR9A 1G20B 1M34B 3HXPA 3AESA 5FLYA 1M1YB 3AERA 2MINA 4IRMA 3MINA 3AETA 4PM4A 2OSVA 2Q8PA 1QH8A 4N01A 3TNYA 4CL2A 4WZBB 4NNOA 1KARA 4ND8A 5BVHA 1N2CA 4LJSA 3U7QA 5M2QA 1G20A 1QH1A 2RG7A 4INOA 2YNMD 5KOJB 5M34A 5BVGB 5M29A
chains in the Genus database with same CATH superfamily
2QYTA 2WLTA 1T5LA 5I7RA 3OPYB 4IXDA 3WNVA 4WCFA 1JA9A 1YB2A 3FUVA 1CDDA 2ZJ2A 3M6XA 4RHFA 3MGGA 3CF2A 4IJMA 2QVGA 5ELXA 1Z74A 5AQ1A 2V03A 5KSYA 3RUAA 1QMGA 3JYPA 1W94A 3ZV3A 4J0DA 3VOAA 4H6VA 4IIBA 4X45A 5JS2A 4HVLA 3FTFA 2GGSA 3CISA 4IEFB 3N0XA 3N7AA 1FPMA 4G0MA 5I48A 3FSRA 4IXTA 4I3GA 1N77A 1DRJA 3AEUA 3WXMA 5CFPA 1Q0LA 5CT6A 3OETA 3KLNA 1Z39A 2ZM5A 1JKFA 821PA 2EBHX 4MGZR 2L17A 5LBTA 1U3VA 3BA1A 1CUZA 4EIWA 4A26A 9GPBA 1Z4NA 1K06A 1ETUA 2Q3EA 3BEDA 4W4TA 1F6DA 5JQGB 2BJWA 5IJZA 3PGJA 3FR7A 3N76A 5EWJB 3TZHA 3MJTA 1NW4A 1C29B 3HPRA 3T0IA 4F1KA 2HTFA 7GPBA 2FRDC 2ZUFA 5B2FA 7REQA 3H2JA 5EPEA 3TSCA 1J0BA 1OGYA 3DUWA 4EF4A 4DPLA 4ESOA 4TROA 5FX2A 4MKHA 3D2CA 3H9CA 5CA1F 4YRAA 4CIYA 5KQLA 3JAMA 3KJXA 2QN1A 4A15A 2VAMA 3UG7A 3WGQA 4F8EA 5KJEA 3VPAA 2GNPA 4OK3A 4AUKA 1C9YA 1FQJA 5JAUA 4G0QA 2P3QA 3NYQA 2EW8A 4EQZA 5JMTA 1EWRA 1A8PA 2PGXA 3IHKA 1SZJG 2VTEA 4XJXA 1FW8A 4LDNA 2G7ZA 1JTFA 4A8TA 3KKEA 5I7OA 3RHZA 4OHOA 2P0YA 3H1PA 3OFVA 3NAMA 3TN7A 3QOYA 4UM8B 3RLIA 4FFNA 1NN1A 5E4TA 2C9BA 4IIXA 2JFGA 3ZDQA 3TRFA 3D6NB 1SH7A 4OBEA 1E98A 5HZMA 2J6CA 2MR5A 3QWFA 4NY1A 4RHYA 2DLNA 2P9HA 5A5VA 1U2GC 1NQTA 3K6SB 3AOGA 4MW2A 5CW1A 3UKJA 1HO3A 1LI7A 1MJNA 3IPYA 2E4XA 3RVMA 2WMDA 1W8DA 5JTUA 4PZYA 1TKRA 4OTZA 2Z5VA 2FPUA 3K8OE 5HUQA 3COYA 2E9SA 4P4SB 2EF0A 2GA9A 3OD1A 4J16C 4ECAA 2H3HA 4KBGA 3PKIA 3UJNA 4H0CA 4QNRA 2ZJ4A 4PC3A 3MINB 4UEJA 1VHTA 5EKUA 1HDZA 4NSNA 1PV2A 4EBFA 5K3FB 2O5CA 2PYDA 2EU8A 1X9GA 2QJRA 5EWLA 3AUKA 2BR3A 4MAAA 2JH8A 3K7EA 3E4CA 1X86B 2PCJA 3VVMA 3JYOA 1Y3DE 2P9ZA 2F1IA 5F51A 3S27A 2YKGA 3VHQA 4ZU1X 4CM5A 4F4IA 2HLDA 2D13A 3H42B 2JH9A 4IX1A 4QUAA 4L78A 5EL0A 5FFNA 2ICAA 3KKNA 3N74A 4LOHA 4Q39A 1JLRA 2ENUA 4DA9A 4DJTA 1KSGA 2P3OA 1C7JA 1PEKE 1QXSA 1VLJA 1ZL0A 2C9DA 3ELWA 2HI0A 4PNPA 5BVGB 5L4SA 1PBTA 3JYHA 1C1DA 4OHBA 5AESA 3ICCA 2BBTA 2CL7X 1M54A 2QX4A 3AT1A 4MV7A 1YR2A 3VTAA 3REQB 2VSXA 2PWBA 4RACA 1AZWA 4GP6A 4BNHA 1PJ8A 1ZGCA 3L84A 4S1OA 5EJ5A 2QN6A 3C6BA 3VR6D 2J9RA 3OTOB 5BWLA 2ZRNA 1NPTO 2D4AA 2E6KA 5EIBC 4L5BA 1FTGA 2B5WA 2RMKA 4J4TA 5U4XA 5HZKA 1E62A 2WINI 5JDIA 5F1PA 2WUEA 3DEHA 3JPYA 2QRHA 3PQ3A 5EWLB 1PVOA 3NDJA 4MR7A 1UBNA 1Y0BA 2GBCA 1P7CA 3R5TA 1ULSA 4M8KA 2I76A 1QQTA 4KITB 2LR0A 1DLJA 2YS7A 4FFOA 5T7BA 4PNZA 4FW8A 4F2DA 2J4FA 3LQQA 1ZIXA 3I4FA 4Y1GA 2UZ0A 2Z9CA 2D1FA 3SC6A 3R41A 4OMDA 5CNMA 1I2DA 4RCVA 2CJPA 3H3FA 3IQWA 2P41A 2RBEA 4I5DA 4P3NA 2MTBA 3MCUA 4G0UA 3FD8A 5JD3A 1QVZA 4FCCA 4O4HB 5DMXA 4IICA 1W29A 1JQLB 2B4AA 2JKZA 3C16C 4N3CA 2HJHA 4WUTA 2VWQA 3PEEA 2IWRA 3I9V6 4XIIA 1A9PA 2PX4A 1I1QB 5LQAA 3EPPA 3QEJA 4UE2A 4L15A 4O6VA 4MR7B 4JLAA 4GX5A 4FLMA 3GP8A 1YGYA 3IEMA 4KAJA 1TF2A 3F2IA 3P45A 1PFKA 3CRRA 5H4HA 5J2UF 1B74A 1NOKA 3EZFA 2NU9A 2EKBA 3ITEA 3OM0A 3H6HA 1H0SA 4IM7A 4EJ0A 2V3VA 1MZPA 5MDHA 3LBYA 4LSZA 4YCSA 2H5LA 2ZUBA 2G25A 3JQ9C 2Y4OA 5JDIC 4CR6A 1T0JB 2VA9A 4E0BA 2RIRA 5GZ1A 1N36B 3PXEA 4DIEA 2QPTA 1DBRA 4KQ6A 4NCAA 2CL5A 4HQOA 1DRUA 5GAJA 4BAUA 4B3TB 1XA0A 1J2UA 1QFSA 2ECOA 1N4DA 3QXGA 4PLZA 4CIXA 1YGPA 3TIIA 4CKBB 1A96A 4DWWA 5CEFA 1QU3A 2PVSA 2I2XB 1F0YA 4TKMA 5J5VA 3ZJ4A 5CA0B 1DAKA 4B2LA 4K0RA 1OXUA 5HKOA 1LPBB 3W2HA 3TXYA 2BFCB 4I1OA 1G6OA 2WTBA 3JQAA 4DUZB 5B4VA 2COEA 4QQKA 4OGWA 2VQFB 1JJAA 1E89A 3C6XA 1ZY2A 1QHHB 2QQGA 2QTVB 5DM2A 2F00A 4TSFA 5I4IA 1NHGA 2IU0A 2BC9A 5AH0A 3ZY4A 3K9BA 5FUBA 5EJ2A 1JXMA 3TLEA 2HL6A 2JB9A 4YQFA 4AJLA 1E3WA 4MS3A 2PWPA 3IQDB 2CMDA 3NIGB 3UXEA 2ZBRA 2FZGA 1EG7A 3KYJB 2P6NA 5EFOA 5TPZA 1L7RA 5IM4F 4DCPA 2XMCA 3W9UA 3UWDA 5AVOA 1Q77A 5HOEA 4L3VA 4YJ2A 1J5XA 1OU0A 4C78A 5LA6F 5CDFE 2HMTA 2H18A 2W6QA 1Z08A 3U4DA 4BMXA 5EERA 3MT0A 1TYAE 2ZVQX 3CUEF 4H9GA 1H65A 2PU5A 4LYHA 1KJQA 2D2VA 2G63A 5KOJA 2W7TA 1RJEA 1XF9A 1RVV1 1O95D 2IYUA 1AM4D 2PH7A 2D3WA 1AQUA 1KI6B 1P2FA 4QLOA 2HEIA 3UVEA 5C8YB 3PP8A 1SUBA 1XL1A 5ALHA 1JPNA 1L7BA 3CRW1 2IEYA 4X1IB 2ZBFA 3A04A 3LKZA 4R1MA 3CLRD 5BR7A 3IIMA 1SOUA 3WNZA 3U4MA 2QG9A 2GSWA 1Z0ZA 2WJPA 3N2GA 3Q3JB 3RR2A 3SC4A 2ZTUA 4HNRA 2W98A 4WDQA 3KT0A 2GX6A 5L3RA 4JUCA 1MQAA 1XA3A 1PLJA 1CDEA 4X92A 1QG4A 3EW9A 2HD4A 2ODPA 2IYNA 3ILSA 1SHTX 3OEWA 3Q5EA 3NV9A 1ODTC 3Q3EA 5EP1A 2H4HA 3K9HA 2P77A 4C7OA 4ZIRA 3NTLA 4UOZA 13PKA 2GCIA 2GEKA 2OV3A 3EW7A 2HWXA 3UGJA 1E0DA 1VMEA 3P0JA 1RI2A 4RU1A 1YQGA 2VDNB 4CQNA 3C4QA 2G82A 4JNCA 1K89A 1KI6A 5K0LA 2TMKA 3ZDRA 1UWCA 2FFQA 1DJMA 4NOJA 1GZHB 1XEAA 3FPJA 3E2IA 2BFAA 3L1KA 5AKIA 5LA6A 3QVOA 1Y5MA 3GBPA 2F67A 3BGVA 2YH2A 2J7PA 5H5JA 3VO1A 3TEMA 6REQB 2GOYA 1SKAA 2ZT5A 1SCDA 1SBQA 1C9KA 3R2JA 2QZPA 5IM4A 4OXQA 3T4EA 2WUGA 3ODPA 2LKDA 1MQ8B 2I66A 2RBKA 4KLZA 5DGXA 4D8XA 3HA5A 3A1CA 3D31A 4C4PA 3HHPA 4XH9B 1HE1C 1F6WA 3PGVA 3HB1A 4IFEA 4IDHA 4R3UC 1CXZA 1GOTA 1VRWA 4DLXA 2FMUA 1HDCA 5C31A 2YR0A 1ND6A 3F6BX 1JS1X 5EKSA 4RDXA 2NU7A 5ICGA 5JD6A 2GCEA 4Y2YA 4HEA6 5GVRA 4YP0A 2OV4A 1HQCA 3IPRA 4KPUA 1KZYC 1UC5B 1MO3A 3RRFA 2VCYA 4UU1A 4I9NA 4RHEA 5B3AA 2QU7A 1Q91A 1OKKD 1Q0SA 3OA0A 2X2PA 2NO4A 3DYBA 3GEPA 4MAMA 4MQUA 2GTHA 4YS6A 2IW1A 2PRYA 3O47A 3OD5A 3ROPA 1ZUNB 3R0ZA 4L4UA 4II3A 3RNLA 3E7FA 2EXXA 4FFBA 2IE8A 1MAAA 4A5OA 4N03A 4EB8A 4RMNA 1L7MA 1Q83A 3OJLA 2NMVA 1F9EA 3N28A 4E15A 5DM4A 4BGUA 2JDID 1PJSA 4HPJB 3HCOA 1GITA 3DL7A 3JQ7A 5J23A 1AS2A 4RYLA 4I81A 3Q11A 2DR2A 4AROA 3MJFA 1A9QA 3L0DA 2W6OA 2O06A 2W93A 3IUBA 3O3OB 3AVQA 1QUFA 1R5BA 1QHIA 2A5LA 4BHTA 4Y6RA 1IG0A 4ZO9A 5FP0A 1EWTA 1K5GA 2YXNA 4E1VA 4M1KA 4TSFD 1Z6AA 4QWMA 3RIHA 3OZDA 5CBPB 2O54A 3HV2A 3VR4H 5KTTA 2XZDA 3K8YA 2XWJI 1YONA 1G6HA 2C8LA 4NCIA 4D74A 3FDXA 1FDSA 3GROA 3HYRA 3O8LA 3PPVA 1ODJA 1Q74A 3KYBA 3R4CA 4PSVA 3IP8A 3VOTA 4CW7A 4D8UA 4Q19A 4G5FA 3U39A 2J33A 4YAJA 1EGHA 2XH8A 4D57A 2R5FA 4EAAA 3L7OA 3O03A 3ZKAA 4RSMA 1TEZA 3HKCB 5J2TF 3W8DA 2FWAA 5EXEA 1XV5A 1X7YB 3G6WA 2ZSBA 3PDCA 1TT5B 2HXYA 2FFJA 3KCQA 1BX0A 3LY7A 1UFRA 3U49A 2G77B 1BQ4A 3QOWA 3NBUA 1UBEA 1UZUA 4CLXA 1M34A 1CZNA 3JQ6A 3EZ6A 3M5PA 1YMUA 1SC3A 4RWZA 3WC4A 3KEMA 2HTEA 5I4KA 5LYYA 1DRWA 2E1RA 1EAYA 1SHUX 4M0FA 4Y2JA 5DE3A 1BA3A 1EVZA 1W47A 2CKDA 1GLNA 1UT6A 3IP6A 3QFFA 2EZTA 4S1WA 5AYVA 3UAWA 4CT4B 4X54A 4EFNA 4M1QA 4CLHA 2WIDA 4OPMA 1F2TB 2WWHA 3NBYC 2WSIA 1J22A 4C04A 3MQ4A 4DIDA 4EHKA 1G7TA 4L4ZA 2V7GA 1CIVA 3KR1A 2D06A 3C48A 4II2A 3PFNA 5JYEA 2C5HA 5JNWA 4ZYUA 1W4BA 3V7UA 2IXAA 4W63A 1UJ5A 2Y1KA 1K6EA 2F1HA 3FYDA 4MKRA 3SC2B 1BXRA 2C57A 4A0HA 5BSGA 3GDHA 3TW8B 2IZ0A 4F3CA 3AF5A 4JEUA 5JXIA 1H93A 4D41A 3TZ6A 2DUMA 1LEHA 2Q99A 5TC4A 2QRUA 2X2FA 5IBQA 4FW9A 2IV2X 2NO6A 5GP1A 2PUDA 2CHVA 4QSHA 1MT0A 1TZKA 3LY5A 2OCYC 1GEGA 3GJSA 4V02A 2JANA 2IUTA 1EM6A 4Q24A 1MO6A 4N7RA 2A9JA 2IZ7A 5LSAA 3VO8A 1Y8RA 2C2KA 2QNIA 3P9QA 3QI7A 2EKLA 1R5OA 2XE6A 1CR1A 3FCXA 4N3BA 4X1KB 3WYDA 2CD9A 1VL1A 3EUAA 4MHOA 4XZ3A 3EAQA 3FBGA 4AKHA 4MIEA 3TQOA 3PTLA 2A3RA 1EUCA 1UZNA 1B43A 3EA4A 4YRCA 2G17A 3L6CA 3RU2A 2ZJ1A 2R79A 3IEKA 3NOVA 5JVDB 4F04A 2NPOA 5JZMA 4HDRB 3GJXC 1MN6A 3RSZA 5A4AA 5BSTA 4HNHA 4WN3A 1RYDA 5T6BA 4ZVQA 4EGSA 4OBXA 4H2DA 4WCFB 4LJ9A 4WZBA 1FU4A 2J0UA 2Y6UA 3HBNA 4G4GA 5ESDA 3W5SA 4AJIA 3U61B 1GL9B 1JQBA 3AW9A 1XEXB 1LV7A 4FKBA 3ZHCA 3LCUA 4BTLA 3NBAA 1RAAA 2IS1A 1CT9A 4NV0A 3BK2A 4Q05A 2P4UA 5CG1A 4GYKA 2V98A 5FWXB 2G5PA 1ZPDA 1NOJA 2ZWIA 4OY3A 1VMKA 3USZA 1KOGA 3JR7A 2ODNA 2DHDA 3DP7A 2O52A 1IYZA 4ZVLA 2AQ8A 1CQPA 3UMCA 1IE3A 2LV8A 2ON6A 5B30A 2R68A 3ASZA 2OB1A 1FYDA 1UBGA 2GLXA 3H5AA 1FXUA 4RTJA 2O8CB 1V1MB 4AKEA 4P93A 4R9UC 3SR4A 1PKEA 1KO5A 4HNUA 1T9AA 4D1YA 3MJVA 4WLEA 3S2UA 3L7MA 5DM70 3U4AA 3WL8A 2RGBA 4C0BA 4NMHA 3AYZB 4PRYA 3ZTWA 4MPDA 4RX1A 4BFZA 1CX9B 3I8SA 4C07A 3O26A 1G8JA 3OFND 4H77A 1VE5A 4WEQA 3DHYA 5TMBA 3GLIA 2C9CA 2QDXA 1LS1A 1G8MA 1SHJA 4DLNA 1L4LA 2EJTA 5D2CA 2PBRA 3H18A 1E9VA 1CS4C 2AZTA 2ISCA 3QEOA 4N82A 1CJCA 4QOFA 5DHPA 3LYUA 1Y7TA 4PE5B 2HU8A 3MGKA 2HT1A 3PIIA 1DUIA 3FOBA 4ML3A 4HTAA 3D4BA 3RRYA 3IIKA 2BI7A 5AJHA 2HF8A 2PMWB 2HT6A 2ZIXB 2AD1A 4GQAA 1D6MA 4BFTA 3WWDA 3EZGA 2TECE 3DR5A 2JLYA 2D0IA 5F2OA 2TMGA 1FUEA 2QE7A 2W2NA 1AKQA 2ZRJA 4EJFA 1FRQA 1PJ4A 3R7NA 2EJWA 1UM8A 1SXJC 1VIMA 3QYFA 2PWYA 2HWUA 5K3BA 2C7QA 2AEEA 5CA1A 4XM0A 3KKQA 3FDZA 2PAAA 5BNIA 2ALJA 1THZA 3SC2A 4F92B 2Z09A 4KQHA 1T2AA 2WMYA 3BB3A 3FFAA 3HUEA 1NDUA 4I08A 4KPGA 6ABPA 4OB7A 4MULA 1TZMA 4HEJA 5DEIA 3KT6A 1J1ZA 1SJ9A 2JDIA 3GOHA 4L8YA 1L4BA 3CH7A 1PR6A 1FMCA 2ECPA 1QVWA 2QUBA 3NNDA 5CMLA 5IT5A 1ZSVA 2UUAB 1C9JA 1EINA 3IALA 4MV0A 1DBWA 1H0HA 2J9GA 2ZIXA 2VAXA 4ZDKA 3VPSA 4EK9A 3BTOA 3G0IA 3QTBA 1ZUHA 4TLLB 2QMZA 2ZSIA 2R7KA 5B1HA 3IQEA 4COKA 1OLXA 1VIYA 1P2BA 3IVAA 3DL4A 1H05A 5E4YA 1JJIA 1VIDA 3AY6A 3QUTA 4IWYA 2A5JA 1A7AA 2R86A 3FH0A 4KVZA 4LJAA 4HZUA 3X44A 3ZDEA 4BRZA 4NENA 3A3KA 4J7CA 1TTHA 1F4VA 3R9XB 2ZR0A 8AT1A 5HGXA 3LK6A 2I9PA 1QORA 4XUEA 2D5IA 5LYJA 1IZ0A 4GOLD 2EWVA 1P1BA 3FGPA 4CODB 1HEYA 2YICA 4QRIA 1U3DA 1UT8A 2EJBA 4G1MB 1PFVA 3DCIA 4D98A 4D0NA 1PNOA 4L9AA 1G2IA 2FCRA 5BSFA 3VUEA 4EO7A 1JIVA 5D86A 3MRXA 2RH9B 3ZH9B 1YR9A 3LDFA 1MGOA 1W8IA 4MRPA 1LDNA 2BCEA 4U2DA 4URYR 3K94A 3GXOA 3A06A 1N2ZA 2G3YA 1EVKA 4YEDA 1ZK1A 1ENZA 1G66A 4OK6A 3AESA 1P8AA 4C22A 1T6NA 3HLYA 4UVEA 4Q7JB 2OSVA 3NANA 4PIVA 3C3JA 5JZOA 5DIZA 5JEEA 1YJAA 1QHEA 1W88A 4PLTA 1NJ5A 1ZCBA 2VF5X 3LBHA 3UCEA 4DJDC 1KEPA 1RKQA 2Q2WA 4HAUA 3UK6A 5JH7B 3OU7A 1XZNA 2XCRB 3GZNA 4WHMA 3F5FA 2VDUE 2YW9A 1Z29A 4PWZA 1RQXA 3BC1A 2ZRPA 3TDNA 2BZ0A 3CPSA 2QTLA 1A5BB 1FLDA 1Q44A 1QIHA 3MXOA 1LNSA 3W4IA 1Q0ZA 3TSAA 1F3OA 2B82A 3VPBA 1HT0A 2QY9A 1GPKA 4WL0A 1D2RA 2ZP1A 4HN9A 3DDOA 4IUDS 4P5DA 5TMDA 3GMDA 5HS6A 4HG2A 3KXPA 1NF3A 1EEHA 1X0XA 1XNRB 2ZB4A 3OUUA 2C5AA 1KETA 1HG0A 1RBQA 1P6UA 4F2GA 1R8QA 5KTMA 3CF6R 4RMHA 1E8MA 2AG1A 2K5UA 3ER9A 3PQ4A 4ARCA 3P4XA 1LV8A 2VHXA 2C2ZA 4XQCA 4GMXA 3VR5D 4IEIA 4B3RB 1F17A 1BD4A 3GPDG 4OFWA 3TRIA 1M8JA 2M9MA 1EHIA 2B69A 4DJAA 3KPYA 4BQNA 4HVTA 5I7HA 1ML4A 2AC4A 1D0IA 1JIIA 1P1FA 2AUTA 2E21A 2W2LA 4KYTA 4OJKA 4UNPA 4UVDA 2W2LD 3AB3A 1A4IA 1BXKA 3NH6A 4D9NA 4DCGA 3VTZA 2VTBA 3NCTA 1FYEA 1AS3A 2PGLA 4EA7A 4EB6B 2JAXA 1KNQA 3L06A 2QUJA 1BAPA 2XKBA 3N1UA 1LW6E 4J0KA 1JECA 1KYIA 1QP8A 1U0OC 1XD2B 2F9LA 3E3LA 3S44A 3UMFA 1GPH1 3V7FA 3LYAA 1YS4A 3ME5A 4WE3A 1BYIA 2YIMA 4Z0HO 1NJ8A 2W8ZA 2CLLB 3KLOA 3HLKA 3AJDA 4CLOB 3JASA 1RSZA 2H7YA 3GFRA 4OQ4A 3VJMA 2I1QA 4L5YA 4EA6A 2M2IA 2R6DA 2C2BA 1ZD8A 3FCSB 2QVXX 3NM6B 3VHLB 4GGPA 3NEYA 3INGA 4DLRA 2WJHA 2VPQA 5E8RA 3VVCA 1K3UB 2DEUA 1Y7LA 4PO8A 1XTBA 3PZBA 1FIUA 3Q85A 1C8LA 4FR5A 2DKFA 3BHJA 1TRHA 4FD2A 2IE0A 3GPBA 1T9HA 2CBXA 4W5JA 5EUBA 2FQQA 3OEHD 3IODA 3NATA 1YO6A 3LOQA 1ECLA 2PKXA 1W4ZA 2VNHA 4P4NA 4Y2RA 8ATCA 3U13A 4YMVA 4YMWA 4LF7B 3ZR4B 3ZXUB 3DEIA 4Q3OA 2ZVJA 4XLTA 4Y7DA 3DC7A 4RMJA 4C29A 4F86A 1VI5A 3IBYA 2EDAA 2Y1FA 4HCJA 5D01A 3LBAA 4DCMA 4EGQA 2G83A 2Q5HA 1V26A 1Z7GA 2QZJA 4FJ2A 4N3AA 5G02A 3K0KA 4BQPA 3RYHB 4F91B 4D5GA 5JQGA 1T0IA 4LYEA 1EWVA 2BMFA 2ONCA 3HU5A 5CH8A 1P0PA 1F14A 1NQVA 3NZEA 4RQTA 3G17A 2V0CA 5L45A 1TA0A 5IULC 2JJ1D 3OIYA 3RU3A 4AT1A 2N75A 1QIMA 5BW4A 3IVMA 1UJBA 2XXAA 1TA9A 4UHFA 4XARA 5BRJA 2Y3IA 5CLIA 4JAVC 4UBOA 1QX3A 2R25B 2WSMA 3F6YA 1E1LA 3R7BA 4QXOA 4E5VA 1K92A 1TD1A 3V4LA 4M87A 1OW3B 5BSMA 1NM5A 4CQMD 1X1CA 2XW6A 1WZ2A 2Q0SA 1EXWA 1NBME 2QL9A 4GMDA 1USVA 3SE7A 3VRHA 4BWFB 1ILEA 1SKYE 1LBEA 2JGIA 1SK8A 3O93A 2W6PA 4UU8A 1JDBC 2R7AA 3EY9A 3R0QA 5FL7A 3HCEA 2BKLA 2FPMA 1TI7A 2A8YA 3LXXA 5CVUA 4DWJA 5JOQA 3ZLTA 1EESA 3DKKA 1FFWA 3OVMA 4KYVA 1IPFA 1WSWA 4FBLA 4AU1A 4HDOB 1TM2A 4IIHA 2VH2A 1QTNA 2GEUA 2RHBA 3EZNA 3SZGA 3AUUA 3U80A 1Z2OX 4HK4A 4QUGA 4TLAA 5G0WA 2HB6A 5BWMA 1TGVA 3HWX1 4BB0A 3LKVA 4E22A 2Q5QA 3EIWA 4PG6A 4HVAA 1JZSA 1NF2A 3EVEA 4JU9A 1V1RB 3V3KA 4PC2A 3DDCA 2VZ8A 4HGZA 4KWTA 2AXQA 4G07A 5EQTA 2ZDGA 1QCZA 3H7AA 1PL8A 4CF6A 1K4MA 4I46A 1XHEA 5LBIA 3L2OB 2B94A 3DBOB 2IGBA 3T7SA 4EI7A 2FEKA 1CCWA 1R0RE 2EV9A 1KPHA 2B83A 1CJUC 4XXHA 4HNAA 5HM6A 1XWIA 3NHFA 4FYWA 3TW0A 1QONA 5EMKA 5BWBA 2EX4A 2C54A 4IJ5A 2QW0X 1H1DA 2G06A 5H70A 2H4XA 4NECA 4O3FA 2XLBA 3LX5A 3T8YA 2RAPA 3ZD8A 1W46A 3ZG6A 3MWFA 1FRVA 4P9NA 1S2GA 1PS8A 4CMHA 2YNMA 4XX0A 4I55B 2B98A 3N2GB 1DO2A 1Y81A 1B2LA 2H8GA 3I0MA 5BYAA 3STXA 5J1SB 1M5UA 4ZIRB 4BWVA 3VSBA 4FS8A 3D6JA 2BI4A 1NBIA 1YJ5A 4GFDA 2BGIA 3DAGA 2VK1A 4LSMA 2JBHA 2C4HA 3DT9A 3DVLA 2IXDA 5DFAA 4OHXA 1LK5A 4CRWB 3I28A 4AKIA 4NH0A 4FX5A 1Z0JA 2ORWA 1E6MA 3IOEA 2XE8A 1QKKA 2ANCA 5FDFA 4DV4B 2H9AA 4LMAA 5DCLA 4ENQA 3JD2A 3A1TA 2I6FA 2GPYA 2PUTA 1AGYA 4N5MA 2D7JA 1CJVC 1JEDA 2B7LA 3DV2A 2O5RA 1RYMA 3CKLA 2CZQA 1UMKA 5CLQA 5C51B 5CA0A 2YHIB 4IWNA 4KAFA 5FV4A 3J80A 1WIWA 4JT4A 3FLMA 5MGNA 3TEFA 1BS2A 3BXOA 3WGUA 1NRJB 1SURA 2Q7XA 4AK9A 4DARA 2V6GA 3KHTA 4I9HA 4RK1A 1K68A 1VGQA 4PNHA 4HRVA 3NFYA 3OECA 1WUYA 4NTZA 1I01A 4QHYA 5KMGB 2H63A 3OESA 1ZJ4A 3AR8A 5CR9A 2GZAA 4X3PA 2NZWA 4ZVSA 3BS4A 1SG6A 2EEPA 4G0YA 5AJYA 3KWMA 1SFRA 3IPLA 1G16A 3F1LA 3B38A 4R0NA 3JTEA 2JGNA 4JVMA 3ZHOA 3H1FA 2RGXA 5IJ9A 3VU9A 2HCTA 1R8JA 3L43A 3N59A 4FZJA 4G0WA 1HRDA 4PNEA 3A4TA 3NC0C 3R0IA 2ZREA 5JSFA 1RI5A 4GXNA 4BX0A 1ODCA 2XYVA 3JATA 1TAUA 4QPDA 5B64A 3M3DA 3R44A 4A6EA 3T7JA 3EHEA 1YRYE 3ZPXA 3HZZA 5ESXA 1WETA 4OHYA 4RFSB 2YVKA 1ODFA 3OF2A 3SEFA 2ORVA 3AHCA 4BVAA 4LQ4A 1L1FA 1XTTA 5GOZA 2EF1A 3A26A 3F6CA 3UFXB 3M2PA 1IZ8A 3DLTA 3WO0A 1PDWA 1WKBA 2H4WA 2O2CA 9LDBA 5HQ3B 2B1JA 4JA0A 4L4XA 4KR0A 1FYWA 3ZEIA 1U1EA 3NYRA 4AX4A 4P54A 2X9VA 1BRTA 3V46A 4C0SA 5CTJA 2PVCA 1CIJA 5ETJA 2RHWA 3IXLA 4YGXB 2PTHA 4DCNA 2O8DA 4CKEB 1YJ8A 3PV0A 4W5RA 2NUPA 1IFXA 2GH1A 4I8DA 4RS4A 5HBGA 1YS6A 2WF8A 4HLCA 8OHMA 4BLWA 1Q1GA 4KQJA 4KMRA 1YASA 4ZAXA 5KNDD 1DC3A 2Y76A 4YAKA 4Y30A 1YUNA 3K5IA 3GO4A 2YBDA 4IIUA 5IK2D 2ZRIA 1IB0A 1QWSA 3DEFA 4BNDA 5CDSA 2XZOA 2Q29A 2F43A 4B3SB 2WYUA 3AY3A 2Q2OA 4R8SA 1Y4UA 1W59A 4GT1A 4RFSA 4ZAGA 2DFTA 4KR3A 1EB8A 5K20A 4XIGS 2Q3FA 2EIXA 4UM5A 4O2AA 3D8NA 1AKMA 1VLQA 1B26A 1UOPA 3JZAA 3KPWA 1D0VA 5KYWB 4ENPA 1FZTA 1U6JA 2IQ5A 2LXNA 1W9MA 1WCIB 4L8WB 1PT8A 4G63A 3BZBA 4C7BA 4IHAA 1N4AA 5BO5A 5DNUA 5KNBA 3G79A 3LT0A 3QI2A 3RLFA 1TFRA 1SB9A 2FKNA 2N47A 3R0XA 4R7TA 1GQFA 2EGUA 3UFBA 2ZM6B 2J4DA 4HXGA 3L07A 1LI5A 2BFEB 3CMCO 5MN5A 1Z63A 2OAEA 4FI3F 4CL3A 4G2NA 5ALQA 4EY8A 3EGXB 3G68A 1RZUA 4CQJA 2C5LA 3V8BA 4D46A 1RZVA 4TSRA 3WDKA 1N3BA 1JLLA 4YRRA 1F0NA 1QVAA 3NTRA 3SIPA 1MO4A 5EEGA 1G3UA 2V6FA 3FHTA 3LFUA 1F8XA 1Y9DA 3S5JA 4LRTB 3PA8A 4Q47A 4I14A 4P0TA 4EY4A 3RSOA 1OZHA 4EPWA 3T9DA 1XTVA 3FOAA 4KK3A 1FVXA 1VSQA 3CC8A 4TTIA 1X7ZB 2VYVA 3TMAA 2ZBQA 4JBHA 3DXFA 9LDTA 2GCGA 3DE7X 3MGCA 1C1XB 1WD7A 4LPKA 1E1DA 1Z5VA 5I45A 5IAAA 4R0VA 2AOUA 4RAOA 2Q50A 2OO5C 4CCYB 3ON5A 3WQHA 4F4UA 4H4CA 2HREA 4R1OA 5DB4A 3MBIA 4IVNA 3DBRB 2QLNA 2AQKA 4PANA 2QM8A 1ZM2A 4M21A 3ET4A 2WSSD 1M6VB 2ZRKA 3I52A 4C7VA 1P9RA 2RKBA 4REOA 1UP4A 1PTKA 2NXWA 3HZHA 2ZCJA 4L8FA 1T25A 1KJJA 3PFCA 4ZJPA 1S3GA 3IOCA 1D4FA 2P9JA 3CEJA 4MJXA 4Y2SA 5I8ZA 3WRYA 5FR2A 3ZS8A 5JT1A 2YZMA 3SVTA 2A0XA 1A9XA 3C45A 3JVIA 1XBTA 3PF8A 3ZWBA 2P2DA 4WESA 2R00C 2ZULA 4BO2A 3D3QA 1DJNA 3OTWA 4I5FA 4BRUA 1HX7A 3NU1A 1ULTA 2IXEA 2P5TB 4TTRA 3JVEA 2P65A 3PVSA 5DLQC 3IL2A 3QFCA 1RHMA 3DBLA 4L2IB 3V6MA 2WHEA 4AS3A 4G1UC 1Q1NA 4DY6A 3WMGA 4CTNA 2XUKA 2P91A 4W9MC 1K5HA 4IHQA 2FN3A 2OV8A 4QYWA 3LZCA 5A9SB 3FGOA 1OT5A 2FLWA 2D1QA 2KX7A 3TQHA 3S6JA 2FSPA 1E69A 3F78A 1I30A 3TZQA 2HSGA 3I45A 1GR1A 4MV4A 1BE0A 3FHCB 3WI7A 3C3EA 1Z12A 4QASA 4JLPA 4IAOA 2PTGA 1MOQA 1CC1S 3N2YA 1U5AA 4NAVA 1A9SA 2B8EA 3AL2A 4GR5A 2HUNA 3C5VA 3ORHA 4CDMA 1JLSA 2CLEB 4JL6A 2IYXA 1X19A 5ECYA 5T64A 1MX1A 1SOAA 1ZD9A 4Y2VA 3RHTA 3VDXA 2WU1A 1RHJA 3L7IA 3SLRA 5G2OA 1O8CA 1HQYE 1P9WA 3E9RA 4KLRA 1WDLA 3G3EA 4ZQIA 1YDGA 1DEKA 1QCDA 5DZSA 3N6RA 1NBEA 1QYDA 2Q6LA 1UJ6A 2V6BA 3OUTA 4U2FA 1BS9A 1AQYA 4A2WA 2YYZA 1M74A 2W90A 3IUEA 3QUCA 4TS9A 4JQYA 5BW6B 2H0QA 4J75A 5BN4B 3ZJYA 5BY2A 4PAGA 2ZRQA 5ADVA 5EHXA 4OX9B 3F1KA 4PIMA 3E8SA 5GY7A 3ZUPA 4EYOA 2AZDA 3LT1A 4G1CA 3WDMA 2G6BA 3D5QA 4QLAA 2P27A 1NLUA 4ZWNA 3LE8A 1DG1G 2PL5A 3R20A 3KQYA 5ENDA 3PHCA 1EFPA 5F21A 5JPDA 2VP2A 4RD0A 5AW0A 1WKVA 3FKQA 2EHDA 2LKCA 2EG5A 3M83A 4BYGA 4ZPXA 1CE8A 1SXJB 2ZE8A 1HEUA 1CP2A 3L1UA 4LHWA 4S12A 2Q8QA 3ZWXA 5TXGA 5H8WA 2NXNA 4IP0A 1AA9A 3QF4B 2L19A 2Z57A 1OH8A 2WHXA 2Z43A 3LWBA 2CYAA 1UC8A 1VHDA 1JDPA 1EK6A 4K2AA 2AIRA 4LJKA 3UK1A 4IGKA 3A6LA 3HUUA 5FHQA 4DRYA 2WEKA 1GDHA 4L4YA 5JU6A 4O3MA 2QEQA 3NIBA 4H1VA 1NLFA 2VP9A 3CW2A 2Q1SA 1U0RA 2NT4A 4QD3A 4KVFA 3GNTA 3TKLA 2E5LB 2EP5A 2HV9A 4ZI7B 4Q3DA 3T4UA 2WZDA 1NW9B 4WXMA 3C14C 1D7OA 5F73A 5KDLA 3DCJA 1AKVA 2FPIA 5AM4A 2ZZMA 1K6JA 3PUHA 1LRLA 2EAUA 2XNHA 4XVUA 1YI1A 3W7VA 3DTYA 2PXAA 3L0YA 5DCUA 3NTQA 1QDEA 3DXXA 3MWJA 4RL4A 1JKJB 1XLUA 1GVHA 5HR5A 1YRLA 3AL0C 3M7IA 3ZDAA 3DVQX 3C24A 5FBHA 3I01M 2C2YA 2FX3A 4CV0A 3C5CA 1KVUA 3A3OA 1F8YA 2I3GA 3WADA 4G0PA 4DMUB 1X14A 5T6MA 3PK0A 4BQQA 5ADUS 3FYUC 3ZE9A 1LK0A 3EUFA 1PUIA 4TQAA 5ENZA 4E11A 2IHBA 4DLUA 4A6XA 1DT5A 5E4FA 2G0AA 3W1VA 1T8YA 1EYZA 4Z4QA 3OSZA 5KWSA 2WM8A 2YFYA 4Q4JA 3RS9A 4BRSA 5SYAA 1TNDA 2J7KA 2O8FA 4AYWA 3G2IA 3FMVA 4TRNA 3RIYA 1HQDA 1NQOA 2HGSA 3FETA 3LLMA 3QMVA 4KH1A 4MWDA 4AF7A 4Z5XA 1EDDA 5AW1A 3D1VA 4M53A 3QP9A 5HPYB 2FPIB 2H65A 3OE7A 2HMAA 1MA3A 1USWA 2MSEB 3HY3A 2V55B 5IANA 1JF8A 4G0NA 1RADA 1UDWA 4S0XA 3M4ZA 3ZCXA 5L4LA 2BFPA 4HLUA 3S1SA 3KU4A 1YB5A 3GL9A 5KNCD 1BCRB 2FSSA 4OQFA 1K7FB 4B46A 1E18A 4BP8A 4E08A 2IS4A 4CU5A 2CNWA 1IONA 1XQYA 4G67A 4GUAA 1GCUA 3HBAA 4UASA 2FZLA 2JCBA 3VVLA 3HWRA 5CIWA 1V5IA 3QUQA 5JS6A 5ECGC 2QD3A 2CDBA 2PQ6A 2EL9A 3ETNA 5M04A 1NMZA 2BMEA 1H9CA 5J40A 3IJEB 4N0EA 2JJMA 4BZPA 2OHXA 2Y8EA 1PZEA 4C6TB 4UM9D 1ODKA 2QP3A 3BMCB 4R51A 1JDBB 1NE2A 4B6QA 4BUZA 1F6BA 1WSDA 4HDNA 3R8FA 1NVVR 3P0HA 2OCIA 2OGTA 1IWBB 2QPOA 3OZ7A 4W8GA 4I3HA 1IXYA 2P0AA 3BULA 4KIJA 4ETNA 5BN3B 3C0KA 3DEAA 4I5GA 2YFQA 1DJQA 3DE5X 1JI3A 1IWPB 3PQ5A 1NDHA 2O8EA 2QT9A 2JJ2A 1NYTA 4FOTA 2PZBA 2DBYA 4K81B 3FZGA 2RHGB 3Q7SA 3HRIA 1GHTA 4Z1OA 2I6TA 3ZU4A 1N2JA 2ZTLA 1KEKA 5I7WA 4B17A 1ACJA 1GU1A 2WWYA 2CMHA 4B7XA 1KAEA 3N2NA 3CJRA 4YJDA 3SJ7A 1PD0A 4U7GA 3VR6H 3HVRA 2XVXA 3OICA 1ISGA 2YWJA 3MCZA 1X3LA 4AZWA 1NBOA 2BJVA 5CX1A 1M2OB 4U9IS 4RHXA 3ILVA 1WEKA 2C78A 2AWNA 4O4IB 1TFUA 1WL8A 4PO9A 1EIZA 2I67A 3HDQA 4NJMA 4DNQA 4J0FA 4MIOA 3L5OA 2F3TA 4B9AA 2V96A 1P4GA 5A4MS 3L01A 1EVJA 3NWOA 4UE6A 1K8RA 1QV9A 3AESB 3BXXA 3JQFC 4XFKA 5HQJA 3HZRA 2W0MA 4YT2A 3CG4A 2C4NA 5ISMA 1E58A 3RTGA 2A86A 1JAXA 5LQSA 1TTPB 3R9KA 3RTAA 2NVWA 3E53A 1BW9A 3MA0A 1TUIA 4H4DA 3MHTA 5IU6A 5KHAA 3C3CA 2D0DA 4ND8A 4OAPA 3AHGA 4NK4A 3W6NA 4QEDA 3M1LA 4IOLA 3EVBA 4YP5A 2X0JA 5DGIA 3I6ZA 1AGXA 2D8AA 2EYUA 1UBSB 2FWNA 1B3RA 3OQHA 4K6OA 3GUYA 3QEAZ 3O90A 4PO1A 1TKBA 2ZTVA 4WNCA 1JLKA 3X2EA 1X80B 4AM8A 1VG9B 1C0PA 2RJNA 3ILYA 5HTKA 4BMOB 1NUHA 1YE8A 2WUWE 1WD5A 3CEAA 4QGBA 4O4IA 4RFVA 3S0JA 1CJKC 3SU8A 3T15A 4HKTA 1EGVB 4B33A 3PDIA 1QYIA 2X3UA 3HJNA 1N0WA 4HZGA 5FH9A 2ZOSA 5JH7F 4O5AA 4IDFA 1MVOA 2P68A 1ORVA 1M33A 2C3MA 3B51X 3NHWA 4G3XA 5EIFA 4J3NA 3ROEA 3X1ZA 4CQLA 1FA9A 2KM1A 1NBMD 2QMEA 2FFRA 3BL8A 4WY8A 2GAOA 3UWSA 3OQJA 2IYLD 1E3LA 3V8EA 3W3AH 4R83A 5E7MA 4ZVOA 1V25A 3H5NA 4QBIA 2JAOA 4EW6A 5KYGA 1AKEA 3F7OA 5AW8A 4MKFA 1EWKA 1K75A 2FEXA 3QBEA 3C97A 4GSKA 3BMNB 1KR5A 4UHDA 4HGOA 3FYUB 3ZI4A 3K3PA 4FC7A 1YC2A 4LA4A 4M88A 4M9XA 1OPXA 1ZH2A 3RWOA 3EY4A 4DLPA 4EHNA 5TPWA 2RARA 4NYMR 5JY6A 1FBTA 3P2YA 3NHZA 3WSWA 5BSRA 3FKJA 3V4FA 4MQFA 2EGHA 2FN9A 3RODA 3ACCA 3DKIA 4QDKA 1QJ4A 1RLMA 3S4YA 4ZVVA 5K6AA 2H48A 1TXGA 3PFBA 4YRNA 2Q6VA 1UMCB 4NE2A 4TV8B 2KBFA 3B3GA 5F5XA 3FOEC 1JHDA 4D9CA 3IQHX 1NU6A 1T13A 3HDHA 4N9WA 5DOZA 2XY4A 2Q6TA 3T0GA 3BUSA 4IO0A 1QQ7A 3HEMA 4M86A 1PT6A 1W2WB 1W5FA 2H59A 4JENA 3LIPA 4MWCA 1XG5A 2HQBA 1W9HA 3NHAA 4GKAA 4Q16A 1FQKA 1HKHA 2WD7A 3RU7A 1MPXA 5CLHA 5JS1A 2QVCA 3QBDA 3STVA 6AT1A 1RC0A 1V0JA 1X7DA 2G0NA 1SUDA 4QPPA 3NS7A 2AJ8A 5IVHA 4W5NA 1YE5A 3L8MA 4FD3A 5IW8A 4AS2A 1PF7E 1B6SA 1HBJA 2RC6A 4E6EA 1H1LA 3ZQ4A 1L4YA 2BP7B 2XCQA 2ZGVA 3E7XA 4NDNE 5IUKC 3UT5B 1XQ9A 4B5LA 1WB6A 4NICA 2A5YB 4RZ2A 4BO1A 3T34A 1J42A 4XR9A 2JAHA 1N5RA 4MI3A 2D74A 2DBZA 1P61B 4W8OA 5A3JA 4Y1RB 1CQWA 4C7XA 3NOQA 2WSYB 3RI3A 2JFZA 3GMSA 2HYDA 1D3AA 1UK9A 3FZNA 3GCGA 4HC4A 2GZ3A 5DWDA 4AB1A 4E70A 2G5GX 2IZOA 4FSDA 2IZ6A 3AI2A 3HYCA 4GO1A 1T8WA 3L3BA 4KGXA 2O7SA 4R1PA 4G4SO 5K01A 3WLAA 2J9YB 2C31A 1IY2A 1FSZA 1HYQA 3E15A 2EC5A 3MT9A 4G65A 4O5OA 5ICFA 2POQX 5DYIA 3AERA 4OBWA 5A04A 1I80A 1E3WB 3A58B 3F71A 1EX6A 2IYZA 2R1TB 1OXTA 1G8YA 1R88A 2ATIA 2PXHA 4UDXX 4G37A 3WBFA 5GTDA 5EJEA 2V4UA 5JZBA 3AF0A 2W2OA 5IT0A 1GPBA 3HJHA 5KTSA 2VRCA 1GGMA 1FSPA 5FL7D 2B2CA 1IB6A 3FNIA 1Z7YA 4F4DA 3TGLA 3PEYA 4B5KA 1U0HC 2VDMB 1KL7A 1X1TA 2YIVX 2XUDA 1GNTA 1QE3A 3N2KB 4D56A 1EBBA 3KQHA 1DQNA 3AKCA 3P8ZA 3Q6MA 2MT9A 4OM8A 3ILXA 3WNBA 5AW6A 4UUAA 4FNOA 2EZ8A 2HHLA 2X1MA 5IJAA 1XHFA 4O2BF 1EX1A 4B48A 4BWYA 2A1IA 5FO0A 1F51E 1YDWA 5LP6F 3MIZA 1WCYA 3U7GA 2Y0PA 3KV3O 3UJAA 1TJPB 3LUAA 1X7XB 3QWBA 1GLGA 1UXIA 1CUUA 4KPEC 5HKKD 3NTXA 3RNOA 2FGKA 4EATA 1R64A 1O9GA 2BFEA 4J4HA 2R8OA 1D09A 3GT3A 4F6CA 1NYQA 2ZBUA 2LVBA 4HLNA 5J3JA 5LA6B 4URFA 4JBXA 4WAUA 3STUA 1TEXA 4MB0A 3E2MA 1G17A 4LXUA 2V5UA 4NZZA 3K1ZA 2CLIB 2OZKA 2WU8A 2WJAA 3PJEA 2XNDA 3O4RA 2P2LA 1QANA 1YHYA 2WYHA 4HHEA 4PZUA 4GDFA 1MABA 1YRWA 2IT1A 4BECA 1XI2A 3BB4A 3CRQA 3NWEA 4GI5A 1OBCA 1BJTA 4P7FA 3LC7O 1VJCA 1W85B 4HQRA 2DFVA 2IY8A 3CUYA 3ZWNA 3HCPA 5K3DA 5IT4A 2R2AA 1N6RA 5DK4A 1CUIA 4DSAA 2QPLA 4OREX 2A3NA 4KWIA 3T7CA 5EXSA 1U6IA 5BORA 1IJEA 1E6EA 1V5EA 3IAHA 4RDHA 3U3ZA 3WGIA 3CVWA 3WL4A 5IVDA 1QGDA 1T6BY 1DS6A 4PTLA 1HTTA 2LTAA 3AY7A 3DW3X 3ROKA 2NUPB 5EHQA 4Z4HA 1L5MA 4ZEOA 3OCCA 2XOXA 1NQAO 2G9ZA 2FSUA 2B30A 4Q7EA 3JVVA 3IP3A 1KJNA 2JFNA 1JEOA 4D9EA 4WECA 1U7HA 5KHOC 4NXNB 4FHZA 2GEVA 2WF5A 1Q0PA 2IKSA 3F67A 1A4UA 2JLQA 4X1IA 4U2KA 1I5EA 2LBPA 2YIJA 3D7RA 3CX3A 5HCIA 4GWKA 3VO2A 3DH0A 4YRMA 3DZDA 4W1PA 5H80A 5FOTA 1P1IA 1SU7A 1L4HA 4YUXA 2XQGA 2NVUA 5JSZA 1L7VC 2XF8A 2YY7A 1GZVA 1QO9A 3O1LA 2QB5A 4PHHA 3VBEA 3HA7A 1IXRC 3V8NA 3H9JA 1V1RA 2I2DA 1PX0A 1N0UA 2INGX 3BHMA 2QRLA 3DHVA 4FPXA 4MO2A 1PZNA 3TLCA 3QQ5A 4IIJF 4AN0A 3RVBA 4Z4IA 1T5OA 1CEQA 1Q1EA 2A1TS 3TRJA 5ALWA 3OCWA 2Q3LA 2ZR9A 1XZDA 3IH5A 4YR7A 1KMQA 5DASA 3QFRA 2XMQA 2ZJOA 1MB2A 3EGEA 2ZG6A 4ZOAA 3H87A 2AE1A 4L51A 2X0RA 1FUYB 4M60A 4IRUB 3MJEA 3JARB 3KWJA 4HGPA 4OLAA 3IIEA 1G20A 3WAGA 4OMUA 1TF7A 3MMSA 1LDYA 3OZIA 4HDQB 3ILHA 1ZK3A 3H19A 5A2QA 1COWA 1XN4A 4JT8A 4TTAA 3OHMA 5H16A 4Z51A 3ZU2A 3LYHA 1H8EA 1V6CA 2A9QA 3W2TA 2ENWA 3T3GA 1NVFA 3LUHA 1XDWA 2YZ2A 2BKEA 2ZIWB 3PSAA 4HWSA 3G9ZA 5JSZB 1O5TA 1TA4A 2H92A 2C83A 2C9MA 4G4IA 4K86A 4RUKA 3RTEA 2OCPA 1UJCA 1P81A 1IY9A 1S96A 3S2YA 1DFGA 3GCWA 1JL3A 3G0CA 4JI7B 4ZK2A 5DI3A 1UXHA 1OH7A 3BGWA 3S3TA 1ZJYA 1VJTA 2WG1A 4Q9HA 4UPEA 3GLIE 2WYWA 5JXHA 1D2AA 4XIFA 4ZODA 4UC0A 2A0YA 2GR9A 1ZW6A 3EGDB 4E5KA 1HYGA 3LWZA 1JSXA 1T2UA 1AB5A 2QNBA 2UAGA 1A1VA 1NJ2A 1V16A 2PGNA 2WYVA 3M3HA 4AG3A 3HN7A 3IMFA 3WLPA 4BZWA 1E1QA 3CU5A 3EJ6A 1W1IA 4Z9XA 1VLMA 5C8ZA 2Q5OA 1RE1A 1VSUA 3E9NA 1W0CA 4KCGA 4CG3A 1P7YA 1LXCA 1GM5A 4GM4A 1PWXA 3CX4A 4QFBA 1CZHA 4HN4B 2ZJZA 4WESB 1A9YA 1RVDA 5JR3A 5G1NA 1SQ5A 2GERA 2WD9A 3I2HA 4ZKEA 3UKDA 1ORWA 2JEZA 4MUIA 4AL4A 4F7WA 5K8JB 3IV7A 1XYVA 2V7XA 1KMCA 1MFPA 2R6R1 2IQIA 2C4MA 5H81A 5AXDA 3AEQB 3TR0A 1Q1ZA 4ZTUB 3W2GA 1TUBB 3WDSA 1HDRA 4ZV7A 4RDIA 3K8QA 1QBGA 3ESBA 4K9QA 4YAOA 5FF9A 3RT7A 5SYMA 1HE4A 4EHHA 621PA 3ISJA 2Q0XA 3ONDA 4US0R 1JLHA 3A6FA 3HCDA 1X6VA 2PSFA 2XUAA 3PU6A 4H16A 1ZH8A 4Q3NA 5HUHA 1KMHA 4QATA 1IDOA 4Q1DA 5C4GB 2NP6A 4DUGA 3AR6A 1SVKA 3LG2A 3ZWWA 4BJ3A 3U3JA 1P0QA 1QGYA 3WICA 4JP3A 4TQUS 3JVDA 4UFNA 3UUFA 3V4SA 4DLYA 1MZVA 1NVMB 3E9CA 4DV0B 2IHKA 3TLYA 3AHFA 1WQ3A 4RD1A 1GILA 4J07A 2B20A 4KXLA 1SXQA 2YV1A 1G5TA 4OM7A 1XLVA 5NULA 3N58A 3JAWB 2AHOA 3ICQB 2IK8A 3U5ZB 1Y3BE 4M49A 3VZQA 2AGVA 3FDJA 2GS9A 3U3DA 2EKDA 3HKBA 2O3UA 4MVJI 5EP4A 3THOA 2O4UX 3AR2A 1JR6A 1STOA 1P9NA 3N75A 3FWYA 1NE7A 1JGTA 4GL4A 3RS7A 1C1YA 3A2MA 2F55A 1YACA 5DP2A 2H5EA 3H2GA 1FP4A 1K7SN 2AHRA 5IUJC 3U16A 1KRXA 2HNKA 1CUFA 1UIMA 3OT5A 4WK6A 5C34B 2EW1A 3VNBA 1YZNA 1JX6A 3D0KA 4KIWA 4OI2A 4LFBB 4Q4DA 2DPXA 3E9EA 5CDHA 1VYHA 1TKCA 3LL4A 2VHQA 1DZ3A 2HQSA 3R5FA 4P3XA 4M36A 4GSLA 3D8UA 2E55A 4DG9A 1P5ZB 4NBWA 1RCTE 3DLBA 4J0EA 1QSGA 5FCDA 1CUHA 2H2FA 5IC6A 3OZEA 1U1GA 2C20A 3OQIB 4RF3A 1QHNA 1KOLA 2M1XA 1YVEI 2VPZA 3K6RA 3DOFA 5E3HA 1GGFA 5C0OE 4P34A 2JGEA 1FFXB 1O2DA 3GLIB 2GESA 3MVEA 3VUFA 1A50B 1A9TA 1AUPA 1N2GA 2C99A 2F9MA 1YBAA 2ZI9A 3GG9A 3W9BA 2R4UA 2RBGA 5A5GA 2XDAA 4E4YA 2PKEA 3GDWA 4WBNA 5SYNA 4XYEA 1Y4AE 2BFDA 3MZ0A 4L3WA 1VQ1A 2JCYA 3AVOA 3C8HA 4JJ8A 4LV8B 4U7TB 4X97A 1QZ3A 4DUYB 5G1PA 2JFVA 4NBSA 4D82A 4RIFA 5CBPA 2CXXA 2QIOA 4H27A 5DSTA 2H57A 1K08A 3C7CB 2WM9B 4CF5A 1E2BA 2OP0A 5ABPA 1USIA 3ROZA 3SFTA 4GQIA 1R6UA 3FUXA 2FQXA 3P71T 3RRMA 4BJ6A 4Y9RA 1GRNA 3OM9A 3WSVA 3WA6A 1RRGA 1LLDA 2QP9X 1IBRA 3CYFA 4JC0A 3EFBA 3U0VA 1R5NA 4DRXA 3ZDBA 4LZPA 2ZIZA 2F1OA 5FV7A 1QMPA 4OU4A 3U6BA 3UAYA 4U7FA 1FX0B 1MOZA 1O03A 1ZNWA 1AA6A 4LI0A 2XOKA 2WTUA 2WIFA 4RXTA 2LCFA 1P6XA 2TMDA 3B7PA 1TT5A 4Q03A 4M1ZA 2NTYC 4LOIA 2B7CA 3RB8A 5BNZA 4PF1A 5IP5A 1WU8A 3R3VA 1J49A 1QE5A 3K1AB 5G41A 1RD4A 4F2PA 5B2EA 4MH0R 5AUOB 1V9CA 1ECJA 4QYIA 4ANFA 3MUEA 4XWOA 1RTTA 4WBNB 1FF9A 2XT9A 5JBQA 1RYHA 2KHZA 1E9RA 2GILA 3AK4A 5DGTA 5FQOA 3GYGA 3TNJA 4A2PA 2IUYA 1OIVA 3UOWA 2LZ0A 3L0BA 2Y1LA 3L8ZA 1QFZA 2J3DA 5DN6D 3AF1A 3TZBA 4Z4EA 3COSA 3NPAA 4MUGA 2JFQA 2DT8A 2P30A 3K2BA 3RS2A 1CR4A 3R8XA 3KVYA 2NTJA 2P79A 5GGXA 4PQEA 5KAMA 3UBTA 3DG9A 4MW0A 3TIFA 1EK5A 1GZ6A 4HGRA 4LOAA 3ULKA 2B34A 1QCYA 1LU9A 1U0GA 1UC9A 2D2EA 3AP2A 1O95A 4RGQA 3Q72A 4QBFA 2PZKA 3O5AA 1X1BA 3H0KA 5E2IA 5ALNA 3TW8A 1SXHA 3V32A 1P44A 3C43A 3TF5A 1Y63A 3OZXA 4Y67A 4F4HA 2IXTA 2J1LA 3OPYA 4HB2A 3VX3A 4WDRA 1SO8A 3KHKA 2BKUA 1IN5A 1NY6A 5KB3A 1J9GA 5TIIA 1XD2A 4AZ3B 2BCGY 2G36A 2GYYA 1Q50A 2VHVA 2YX1A 4MI6A 3GNLA 4B4WA 3BZWA 1FDRA 4KMOA 3TQQA 2KS6A 1SUFA 1BFUA 2WNIA 4HZIA 2KSQA 1M0SA 1PT7A 1ODIA 3GJ5A 4YRLA 4ZQFA 1GG9A 1SUSA 2G88A 2H1RA 1SCIA 1D1SA 3G89A 3CWQA 2FPSA 4TSKA 3W4JA 4ZHQF 2WHQA 4IVPA 2ZIEA 2NN3C 5DMHA 4ZC1A 4UZSA 3V7WA 3GLUA 3WLLA 4AWBA 1QAQA 2NW6A 3H0EA 3KYDB 2YZ7A 3TQTA 2O19A 1NXTA 2C8JA 2Q8PA 2YVUA 3M6WA 3GLFE 1LLFA 5BQPA 1RKBA 5GMOA 2QTMA 1IHOA 5AJVB 1SWWA 3K20A 2LGJA 3PPWA 2ZSJA 5EJAA 4JOCA 3DZIA 4K03A 3BSFA 4OLJA 4GPD1 3GGJA 4WOBA 1H8HD 1KGDA 1T0UA 3BWYA 3L0PA 1X8KA 4KFTA 1LB1B 2HUPA 4MWSA 2I9KA 3KNZA 1JWAB 1PVVA 2ZKLA 1VA5A 1XTJA 1MW9X 1PYOA 4LNUA 4O4JB 4PPNA 4FFSA 4R4JA 3QVUA 2WJGA 2R1VA 4K9LA 4PCUA 4FR0A 3A9UA 4ZQGA 4J7AA 1A27A 2NUTA 3JWEA 5KQPA 2NYAA 4WOJA 3VHRA 4JHXA 5HGJA 3FCOA 4DCUA 3N86A 5CB4F 1ZNXA 2QUHA 5DWVA 1XKXA 3B1FA 3IXMA 2WJVA 3SVZA 1EK0A 1SCNE 2QM0A 4FDMA 1TM1E 3DBVO 1R6TA 3FJ1A 3KEFA 4U6SA 3ZNQA 1U8TA 3F74A 4PC6A 4YLGA 3ZZ0A 3OA2A 3PCRB 1FLAA 4PXAA 2QTFA 3ZZNA 4FMCB 1PR5A 4PXYA 1QCCA 4XSHA 3FMIA 4JQSA 3TBKA 3NHPA 1VMAA 1G38A 4JODA 1NNI1 2Y9MB 3HKDB 4L0MA 3EULA 1UPBA 2GZ2A 1Q7TA 1NULA 3MELA 5AXBA 2ZQZA 4JITA 2I29A 1BVHA 1WEHA 3O2SB 2I7DA 4DLAA 3EZ2A 3LQYA 3QY0A 5D5HA 1T5IA 1J4AA 2EARA 1TQ2A 1KRHA 4LZAA 5EHGA 3S7TA 5CD9A 1I7QB 4EHAA 2VJYA 2KPOA 1M7HA 3W5BA 3LUBA 1M34E 3ADCA 3I6MA 2P75A 4WINA 4B3CA 5LNK1 5G3YA 3USES 2DFNA 3DL2A 3L18A 4PV7A 5H02A 1F0PA 1S8OA 3S1LA 3V6LA 4AIIA 4YY3B 1YZQA 3SXJA 1JHAA 3LECA 4MW5A 2G76A 1AG9A 2VF7A 4GLLA 2QVBA 3K05A 3DHNA 3LUCA 3FPBA 4PZZA 1VKNA 1OH6A 3G2PA 3EIEA 4KBFA 4EYQA 2H2WA 3CVUA 4BX9A 1Q1QA 5DU2A 4Q18A 4MWOA 1L5FA 2A4MA 4E6PA 4B3JA 1KIFA 3IQIX 1QPGA 4AZVA 1I14A 4OLBA 3KQSA 1DTWB 1MO2A 4PQFA 3EPLA 1ZN7A 1LF0A 1XCOA 3P4YA 1LQTA 2G5CA 4CM9A 1JVSA 4EITA 4FJ1A 3G02A 5FOWA 4F0JA 1XVTA 3UJBA 4XTCS 2B5OA 1QV6A 1UWKA 2GN2A 2IPOA 2I2CA 2WWXA 3MJHA 4AMGA 5BUSA 4MQMA 4KUEA 4P5PA 3L92A 4QGFA 1N9ZA 4GLJA 5LKAA 1KYXA 2FNAA 3ANTA 5FOQA 5EJ6A 1SQ6A 1RJ9B 3CLUC 5CRIA 1IM8A 5JW6A 3CUKA 1WXDA 3RVLA 3LSTA 1NMEA 4MB6A 4L1KA 5JAOA 3NRCA 1TOAA 1ZMXA 4QDZA 4AJ9A 1ACMA 1M2VA 2H2IA 3LY9A 3ZK7A 1GT6A 1WW8A 3ESCA 5HTOA 1VLZA 2I71A 3MD0A 3QEKA 2XXAB 2HA2A 4QHTA 4KGZA 1NRXA 3BKXA 4RVCA 2XRMA 1XD9A 1Y9JA 2YWRA 3USCS 3BL6A 1YB7A 1DTWA 2H2GA 2OENG 2UYOA 3AG6A 3O31A 4QRHA 3UAVA 4BV8A 1N6OA 2VUHB 4QBGB 1M1YB 2YMPA 1IXSB 3KKPA 3M5DA 1ZOPA 2MINA 3BWDD 5K3SA 5C5CA 4V1CI 4UEKA 1E2JA 1TM5E 2FGJA 3C3DA 3DDUA 3GZ4A 4HLDA 1Q2XA 3PC2A 3ELBA 3BJRA 3S99A 2ZPAA 4A1OA 4TM8A 4LFCB 3L8CA 5M2QA 1Z4KA 2GO1A 5JTTA 2RHDA 4HDNB 2R8PA 1ZD3A 4IR7A 4BX2A 4DDKA 3JASB 3U3KA 5HQTA 5K05A 4UVGA 1G4HA 2BP7A 4HRAA 4WI1A 3UT5A 2OCBA 1CR2A 5M34A 3VNVA 3GIDA 2G71A 1CR6A 3O8BA 3SQWA 1AF7A 3PRKE 4A2QA 1YR3A 1Y1QA 3TLAA 2DBRA 1FMLA 1Q14A 2FW7A 3L4BC 5B4UA 1DARA 3CE9A 3Q98A 3LGXA 1HH4A 2X0KA 3HHEA 4ZYWA 1XP8A 1G8AA 1L7NA 3MILA 1UJNA 2OGZA 1M67A 4IGFA 3AB8A 4C1NA 1DELA 4YAUA 1YL7A 3G0BA 5KSOA 4C7OB 1WMEA 4MKIA 2J8ZA 1WS6A 1GPLA 4YP6A 3WJ1A 4RTPA 5IJXA 3ZGLA 5FTNA 3QXHA 3CX8A 4IF4A 5GINE 3C8ZA 3OC0A 3LY8A 4OFBA 2ODEA 1J0EA 3QA9A 4DLZA 4OP1A 4LYJA 2FN8A 1PJBA 3G8CA 4G5YA 2ZR8A 3FCYA 5CEEA 1FSGA 2IELA 3TLZA 4GOOD 1N75A 3B6EA 1T6ZA 2VI5A 4M1WA 5KOHA 5KCZA 3T9FA 5ER9A 1PCXA 4RXUA 1KI1A 1FYVA 4JC8A 1K9VF 4TV8A 3DWIA 5CB8A 2FMKA 2Y67A 4INAA 3K6SA 3IIIA 2DUWA 1ZMTA 1DOZA 4G8CA 1VL2A 3UHJA 1XCJA 4CM8A 1U7WA 4OA5A 1ATIA 3MAGA 4BCDA 4RKRA 4AF6A 3O1HB 3QQPA 1X7XA 2C95A 1WVGA 4QULA 5ALEA 1BXGA 1QFXA 1RXIA 4E5DA 3L77A 3L8YA 5HCNA 4B79A 1SWVA 5AVKA 4HH1A 1P0MA 3OZRA 2G9NA 3FYCA 3UCXA 3GLRA 3P1JA 2RGGA 3AF4A 3PWZA 3D8BA 5BRNA 3TLXA 3ZWDA 4JYPA 1G5RA 2Z08A 2D5LA 1KJIA 3T3IA 3NGLA 1YZFA 3C3BA 1YZUA 2ZE7A 2IA5A 1EUYA 1XZQA 3Q88A 2CJWB 3WIEA 4WBXC 5BPFA 1GDDA 4JROA 4P5EA 2P4EA 1IHUA 1PKXA 3COPA 4FFBB 2GAFA 2R8YA 1DDIA 3G1UA 3VTFA 4W7SA 1ISIA 3L0SA 2Q9UA 2C07A 5IF9A 3B8HA 1HLPA 1HGXA 1XXHE 2IV3A 5C1PA 4YJHB 1C2YA 4YIKA 4E33A 1WDKA 1OT3A 4O0LA 5KWVA 5IX8A 2XJ4A 3OEED 1PIWA 4IXNA 4BC0A 4MV8A 2H17A 3HEAA 4NBNA 5LQKA 3HM9A 2JH3A 3BH6A 3FPEA 3MNFA 4J29A 3T52A 4L7VA 4B2PA 3EZLA 2CSXA 2MINB 2JCSA 3IQFA 5DYWA 4QA9A 5T4FA 4F5DA 4AULA 2IYWA 1X1RA 2A92A 3FUCA 1T9GR 3TDKA 1RIIA 1DC5A 4XR4A 5FI1B 5BV7A 5LIRA 4B87A 3BDAA 3T3OA 2C0PA 3ZHZA 4RESA 3TJZA 2D7DA 3I62A 4C2UA 1U2PA 1YS2X 4CNBA 3RO7A 1F4LA 2EZ4A 2YRXA 4QU5A 3KSBC 1W7AA 1ZO8A 4NRDA 2J9FB 5D3QA 2A0UA 2R44A 2HU2A 3CNLA 4GVXA 2Q3JA 4J94A 4PR3A 4KQXA 4WPGA 4DIFA 3PX3A 3Q9UA 2DHEA 2BUCA 2QW8A 4KQCA 4X9XA 5G0TA 4AUEA 3ELUA 3LHDA 3I2GA 1PHPA 2QE7D 4DB4A 1T34A 1I4EB 4KE9A 4LXTA 1D2GA 1T2DA 4RZQA 4ISBA 3EGWA 3INRA 3G59A 4B09A 1ZJZA 2II6A 1BHO1 2MHCA 4HXFB 3ZWCA 3I8XA 2W70A 4PN3A 1RXYA 5B4TA 2ZETA 1ATZA 1YZTA 2ZWAA 3JZDA 2GRAA 2ZDQA 3EIHA 4DB2A 4OQYA 5LD2B 2A57A 2P9GA 2VPTA 2O1WA 1KH1A 1JE1A 4KPUB 1YIOA 5I7VA 2HA4A 4HNQA 2IVFA 4XASA 2RGUA 5LB2A 1R16A 3SS7X 2GRUA 3U3MA 4DPKA 1OU4A 3R1IA 3R6DA 4TKZA 3PC8C 2JLZA 4NARA 4NC9A 1UK6A 4Z9AA 3HR7A 3E8MA 4BEWA 1NQ5A 1WHSB 2X8JA 4LC0A 3BGOS 3EF1A 4BO3A 1P80A 5ALJA 1SD2A 1ONOA 3V34A 2F43B 2HMWA 3TW4A 3M33A 1RMYA 1UBJS 4XOUA 3A9TA 1GQOA 2HO4A 3JYLA 1OWLA 4RZUA 4BC1A 1NP3A 4BU0A 2N0SA 2NSHA 4I8IA 4R2HA 4XQ9A 1KY5A 2JLWA 2PO5A 5C18A 3ANSA 4JP5A 4CR8A 2OM6A 4YX9A 3GFTA 4F1WA 1F7VA 2QQEA 1YUBA 5AVXA 4MVJP 2DPGA 3OIVA 1L5SA 1T15A 1VDZA 2X58A 1F9AA 1IHYA 5C4MA 1LNQA 5B7QA 3EGXA 2O0JA 2NXCA 2ZJ8A 1B41A 3IE2A 4FZ3A 2FCAA 4V0MA 3IP1A 5FWDA 2XCIA 5A0FA 3V2GA 3W5CA 3FOZA 1QKIA 2F6RA 2GN8A 1IPEA 1SVMA 2XPCA 2CK3A 2PX8A 2YZGA 1ND5A 4OQZA 5JECA 2BKVA 3N2ZB 4ZMSA 3LLSA 3R3XA 3DE4X 4QEZA 5GVSA 1JFVA 9ATCA 1GRQA 1U7UA 2XYQA 3F8TA 3D4LA 4PYJA 1CYEA 5LCXA 4Z54A 1WG8A 3G85A 5ICMA 3DBIA 1ZK4A 3DE1X 2RK6A 2WOOA 2J3EA 2XA1A 2DFDA 4W6ZA 5FNVB 4BB9A 3S1AB 2ZPUA 3D3KA 4I2NA 2CZCA 3JRNA 3L0CA 2IIVA 3LGAA 3THRA 3AONB 4E51A 4F9GA 2HJRA 2EQAA 1Q7GA 1ANKA 2WWWA 1E1CB 2YY6A 3WGKA 4ZANA 1VIAA 1OX5A 1M6WA 1JVNA 3B1KA 1U0EA 1FFCA 1E4EA 4JDUA 5HIMA 4B83A 4TVSA 3VKGA 4S04A 4CCYA 2X0NA 5JE8A 4CG0A 4I4TF 3MT8A 1SCAA 4P3OA 3ZHXA 4B3BA 4QDXA 3KHSA 2GUWA 1JG7A 1WOYA 2BFOA 3I9NA 2DPLA 3L7LA 4X95A 4CLRB 3E9MA 2FLVA 3HUFA 5HUJA 4EA9A 3ZVRA 3BBLA 1N5IA 1O97C 3AYXB 1EPUA 2FX2A 2J07A 3O82A 2B8JA 1IZ9A 4N12A 1QRSA 3IB3A 2C3OA 4X8OA 2GN0A 1EUZA 2GCOB 4RZ3A 2ARKA 3WL7A 1YA8A 1ESEA 2VYNA 3NHSA 2WF7A 4ZOLF 1WCXA 5LFAA 1QH1A 3OOYA 3L6DA 4YREA 4LJ5A 5TS2A 1DC6A 2O0KA 2ZAMA 1E6UA 4LSWA 2C4UA 1FXSA 3DA8A 4BNKA 1JALA 2ZI5A 4FQ7A 3JVUA 4Q1CA 3KAQA 1M10A 4AD8A 1RXVA 5E2BA 1X9IA 1OZGA 4RLQA 4ACBA 3AIOA 3PFKA 2C7BA 3KQKA 2V7QD 1R4NA 3O0DA 2GD0A 1SCQA 4ZOQI 1EDEA 3AH8A 1HC7A 5CYPA 4PLHA 4ZRNA 4DAOA 3VQTA 1QH8B 5FR1A 2Z9DA 1IJKA 1L5QA 3Q7PA 1L8LA 2ZAYA 1L5HB 2V1XA 1C14A 3PXBA 2C04A 2BV3A 4XD7A 2C7GA 1JFFB 1E8DA 1WZNA 2FP4B 2OD7A 2YN0A 1E5DA 3CNHA 3AP3A 1J99A 3ZE1B 4UULA 3ZXIA 1Q1AA 2ZRCA 5H68A 4EB0A 3UXYA 4DEVA 1ZEMA 3EF0A 2R85A 2W11A 1BVUA 3SZLA 5EJ4A 2EG9A 4N7BA 3H9UA 5B1DA 3IHTA 3LKBA 3S55A 5A4JA 3FPLA 5A6SB 4WK0B 2GB4A 1V39A 3QUBA 4TPKA 2X5KO 1MD9A 4PHFA 3PEVA 1PSZA 4BAGA 2H7XA 2C96A 2JJ1A 3BJIC 4B0PA 2IUSA 2OV1A 2BGJA 3CZRA 2BIFA 2ZSFA 1KAHA 3J7AC 4KWCA 1PJ3A 1NF8A 2A5FA 1N3YA 4J3JA 5AK6A 2AZXA 3IERA 3AF3A 1DV2A 3A7EA 1OROA 1KGSA 5JSQA 2GN1A 1Q11A 2R0QC 2O8CA 3LHFA 4CCAA 2X9NA 1TZBA 4WBSA 5EJ9A 1XDBA 4BQEA 4EG1A 2WJJA 4P32A 5KSZA 3MW8A 3K4HA 4ZJZA 3NJ4A 3EPHA 1E63A 5CPBA 2A5GA 4RD2A 5DNEA 3BMXA 3UV7A 1G9TA 2UXBB 2LUOA 2AJBA 3B6MA 3KYDA 4QYXA 4B31A 3PUKA 3ZTYA 5HF5A 3ITDA 2ODBA 1GGKA 5IBRA 1T2VA 1SQFA 2EWWA 2XIQA 3RAFC 4IYJA 2RG1A 4IOKA 3R7WB 3D5EA 1MNQA 3QKSA 4WZBE 1Q7EA 1URPA 2M6RA 2I7CA 3C41J 5FEUA 5FPYA 2AD5A 5JSUA 3UWKA 1IUOA 3LUFA 1P2VA 4Y9SA 1P73A 4DLBA 1UL1X 1MB9A 3BA6A 4DV1B 3CTPA 4EUFA 3I76A 2RGEA 3F6PA 3N6XA 2FUG6 3NX4A 2KLBA 1CY0A 1G8FA 1VXRA 1ZVVA 3IJPA 5IAEA 5L51A 3ELDA 4M7WA 4YO8A 1CSEE 4ITRC 2FETA 5D5PA 4S1VA 4KACA 3VR2D 2FMXA 2W6ZA 1UZAA 4TXHA 1JAHA 3CHYA 2VHEA 1C41A 4MVJA 1F2UB 3MN1A 3PX7A 2O07A 2OKCA 1C9DB 2Z3VA 1GKUB 4UXIA 3CRNA 3QX8A 4JI3B 1I0ZA 5GADl 2CEAA 2VHJA 4PZCA 2E48A 3PUWA 1XE3A 2PFSA 3Q8WA 1JKJA 2BONA 3GRZA 1U1CA 1ZGGA 4FUQA 2CN1A 4WTOA 3TD9A 1IDN1 3JWIA 4WZBB 1XWWA 1H1TA 4XWGA 4YVFA 4E5NA 1IBKB 3U7QA 1A8QA 4WY2A 2GN4A 3MT7A 3EGOA 4MDHA 5ESWA 1I0LA 3K15A 5GJCA 2F59A 1XJ5A 3FFBA 4B44A 4YHHB 2JIZD 1RYZA 3AEZA 2IBTA 1MJFA 1YAJA 2DFLA 2HIMA 3I53A 2OXFA 5JLAA 2O5EA 2VAPA 4KPYA 4M3NA 4V39A 2I6SA 3V7YA 4KRFA 4LF9B 1U9IA 2CZGA 1O5IA 3IDQA 4NMWA 4RK5A 2FRDA 4MUYA 1A9RA 4I4CA 4YA6A 2CXHA 5DKFA 4JUDX 4X85A 5B58T 3I64A 4Y6QA 3U3RA 3EGVA 5C7LO 3L4JA 1GU0A 4WQMA 3OLQA 5AVZA 1QIGA 3D9QX 3W8RA 5DNDA 2GPBA 5BUQA 3TL3A 3VZRA 1QV7A 5FTWA 1NRIA 1FX0A 2AXPA 3COWA 2IUEA 4ESHA 5DLYA 2JD2A 2V7TA 4OIFA 3ZDZB 1QLWA 4CKCB 3E70C 5TGDA 4CV3A 3OC6A 5FWYA 3TQIA 3SICE 2ST1A 1FP4B 3GFPA 4NMMA 1OAOA 3IAS6 1WAMA 3O92A 4MV3A 2NO5A 4NOMA 3ZCRA 1G3QA 1S8FA 1WLYA 4L27A 3P2OA 4KE7A 5FRDA 2BLNA 4A2CA 4B34A 1FVOA 3E2PA 4J0QA 5CTAA 3W34A 4DT1A 3WGLA 4A16A 1A72A 4OGLA 4F45A 1CQIA 3QE3A 2BRUC 2A9OA 4IHJF 1Z25A 2VPXA 1FJHA 1HE2A 3C3WA 3JD1A 4ZQCB 3LHSA 4C4RA 2AZMA 4XGRA 5KINB 4FB4A 4KQGA 1PSDA 1RM3A 5AJTA 5E7JA 1HZZA 1I3NA 2OXEA 3SAJA 2GYUA 5B3LA 4B6JA 1KAMA 2WJZB 1EDZA 3OQPA 3VNQA 3BE6A 3FHOA 3MWLA 4HXYA 4EGCB 3M9XA 1ZJWA 3CUUA 1OVMA 3L4KA 3KBBA 1DQSA 3CXRA 5BXYA 1WUHS 5E9WA 4PLWA 4XVHA 3UH1A 1I8TA 4LTNA 4DLKA 4U9UA 4F93B 5K51A 4JR2A 4P82A 2VJAA 2BEVA 5FULA 2IYOA 4AJ1A 1ZOSA 1KDPA 5LLTA 1XAJA 1VOTA 3REQA 1EP3B 3NNSA 4Q21A 3K9GA 1EDOA 5J4LA 3NETA 5HJ5A 3LOPA 2WUDA 3TTXA 2VTDA 3AHEA 2XCTB 3KDAA 3NIFB 3A31A 4B3MB 3AZQA 3NXSA 4NNJA 4E13A 3S2GA 2AT1A 3IDSA 2OZVA 4FN5A 1C3OA 4FDUA 1V1MA 1X1SA 2VLIA 2YJ6A 4IQFA 4IV8A 1XF1A 4D9JA 5IRCD 4NG5A 3RS0A 3PD0A 2QAGA 3U5TA 1LJUA 3ZX4A 2OCXA 4LY0A 4M7PA 2REQA 3O4GA 2Y1XA 3N0RA 2RHJA 4BDSA 1IMOA 3E6AA 5FBQB 5CU7A 5GGYA 2VTKA 3EMKA 1MENA 3LCRA 4OD0A 1NF9A 2CVZA 2Z95A 2HGZA 4ECEA 3SHQA 3UA3A 1REQB 4P98A 4QQFA 5JFOA 1AOXA 2QN7A 3I92A 4ZAZA 1M3SA 2PKYX 4LYFA 3VR2A 4JQOA 1LPSA 2B4KA 1YS9A 5COQA 1B00A 4NNOA 4UM7A 4OHPA 1JHRA 2XTMA 3PYMA 1MH1A 1WV0A 2HLHA 3M4JA 4WFKA 4Y0VA 3TBFA 3UC9A 4Y18A 2G28A 1FJ2A 1FYFA 4PLCA 1A97A 4EWLA 2EKZA 1AU9A 1QHGA 3DVAB 3GFFA 4OUDB 4YP1A 3RRBA 3V1MA 3GEMA 4I0WB 5EZYF 2QTRA 5I5GA 4B71A 4AMBA 3EK2A 1YA6A 3GDFA 4JI5B 5DBGA 2B3DA 4K9MA 4MI9A 1HYBA 3LDHA 3H4IA 1II8A 3P4UA 4FNGA 1OI2A 1HMYA 3AERB 3FNGA 1BXGB 1R27A 2Y2VA 1DP4A 3THXB 1GZ7A 3IOYA 3QMPA 2WWVD 4DDVA 1POXA 2VJKA 4HUTA 1YTLA 1X7WB 4KXMA 2FY8A 2ZI3A 3N9IA 2W58A 1F20A 1PTJC 2QRQA 3C5EA 1LSOA 1ZRSA 2WU3A 3B82A 3M81A 3V4OA 1US8A 4B6SA 2FDCA 3AWDA 4BIIA 3BD6A 5LUBA 4RTOA 4XPIA 1WE2A 1G6KA 3WL5A 3AFOA 3CZ5A 3TG2A 3RIMA 2X14A 3SWWA 2I7VA 1WPXA 2OORA 2QJOA 5DK6A 3SOPA 1IN7A 3VDQA 5F9HA 5KREA 2EKPA 3KZKA 1ZJ5A 4HFRA 3PF9A 2D7CA 3GJZA 4HQ6A 5CDFA 4CM3A 3AVXA 1VMDA 4JK3A 2PUCA 4IOMA 1VKJA 4P58A 3PGA1 5F4BA 1OX6A 2A9RA 1AUOA 1VSBA 3I6BA 4A03A 5JCZA 5I4CA 4PQGA 1WXIA 2VTBB 4BNUA 1VSTA 3IAFA 4EEKA 3UV3A 5A02A 2WJYA 4NU8X 5DHAA 3DM9B 1FXWF 2Q4EA 3G5MA 2B8WA 1C1HA 4ZT2A 1VG1A 4O02B 4JOBA 4LV5B 4OXKA 1TD9A 1CQXA 2H4YA 4ZCMA 3TPCA 1ZMOA 4ERXA 4MW7A 4IJUA 1OTXA 3PHJA 1QTIA 2C8KA 2PQ0A 4YPFA 2WPDD 1KDVA 4CMGA 4BNYA 1PJAA 2OK7A 2J3HA 3ESAA 5IM5A 3B1VA 1VJ0A 5FTLA 4FMBB 3HB5X 3DQQA 3H9EO 4DDUA 3F4LA 1QYVA 4LS3A 1H5QA 2RGNC 4Q7MB 3M6UA 4RM2A 1M2WA 4KJZA 5L3SB 3HABA 4JXZA 1FS5A 2FU5C 3NYIA 4KLCA 2GK4A 3FHLA 4K46A 5LN1A 1XK7A 7ADHA 1K7EB 1V48A 3Q5DA 4KNVA 5JNRA 1IQPA 1F12A 1GWNA 4JLJA 5TF4A 3MTGA 4LZOA 4Y9DA 1SC1A 4U5XA 1MW8X 3WL3A 4I1PA 1TM3E 3WS7A 3WAKA 3PC7A 1GV1A 3ROTA 4C5BA 4K3UA 1ZXXA 2JAWA 3QVXA 1ZXBA 3JALA 3G2QA 1XVIA 3W5AA 1T6YA 4QNMA 4BMDA 3TNYA 2QQ0A 3OIWA 4JT9A 2OESA 4DXHA 1WCWA 2NYRA 2Y6VA 3UPDA 4GBGA 3U44A 2OHIA 3CH5A 1GGHA 3ETHA 3P9NA 4EKYA 4V1CB 4TL6A 3RRNA 4GYYA 4GXRA 2IS6A 1FUIA 3UN1A 5LQJA 1XYYA 6Q21A 1IM5A 1UAYA 2XE4A 2LIPA 3EXFA 4F3YA 1U8AA 3OTHA 1NBMA 4CTJA 1PNRA 1CHDA 1ISFA 4N49A 4LPSA 4YJHA 4IMIB 3X1JA 1VP3A 3RC3A 2AI2A 3CGWA 4FKMA 1RLJA 4TTPA 4Y2HA 4IIGA 1BQ3A 2XT6A 4BKPA 2UZ3A 2XUOA 1UBUS 3U31A 1UEJA 3WO1A 3AZPA 1G98A 1WZCA 1IVYA 2X4IA 1X15A 2QBYA 4HX5A 5LC1A 3VMMA 4ZAWA 3MTIA 2WTEA 2FUEA 4TV9A 4NG4A 1Y8QB 4P38A 5FTKA 4EO9A 3R24A 4WNIA 2VVTA 2VEOA 3IYLW 2UXDB 3LT4A 1A8HA 4R05A 1LFAA 1R9MA 4CNQA 2ZIFA 1DZIA 4ZXFA 4NL4H 1KI2A 2YHSA 1QU2A 1S2MA 1ZM3A 3HMQA 4RVGA 4CGZA 4CUJA 4B2YA 3GH1A 3LFHA 2O20A 1E5TA 1W5BA 3I39X 4C89A 5LOVF 2QJWA 2OO7A 3SX0A 1VHJA 4CMEA 1QOPB 4B7UA 1M2JA 2H9IA 4FR2A 4RTMA 2WUFA 2WAXA 2AK3A 3ZE6A 2ZUWA 2ZJ6A 3FBTA 3KYIB 5FO1A 2C5SA 4QE3A 5HSGA 4EPXA 4B32A 4KQMA 2H06A 2AJCA 1NVBA 5LWQA 5JO9A 4ES6A 1FP1D 2I2BA 3VU9B 1SKYB 1PJZA 1JT9A 3I58A 3K70B 2QT1A 3GUVA 5FJJA 1G21B 2IEIA 3CEPB 4GKVA 4TM7A 3GRPA 3JRWA 5AVVA 1AUVA 2YC4C 4X3CA 1KEEA 4YMGA 3TRDA 1G2OA 3LXMA 4CF3A 2JLCA 4FMPA 3UFXA 1FU7A 3B20A 5D7BA 3JD3A 4Q4AA 1FU8A 1BWQA 3BGSA 3GLQA 4EGJA 1YU6A 2UUCB 1FYXA 1KFKB 4D4IA 2FR1A 4X1YB 1NMYA 1GQ2A 1X7YA 5ULLA 1NVVQ 4L50A 3C1TA 3WMWA 1WVIA 4WBNF 4J76A 3LSYA 5K7SA 1F38A 5CCXA 3WIOA