2OV2A

The crystal structure of the human rac3 in complex with the crib domain of human p21-activated kinase 4 (pak4)
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
178
structure length
178
Chain Sequence
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPHTPILLVGTKLDLRDDKDTIERLRDKKLAPITYPQGLAMAREIGSVKYLECSALTQRGLKTVFDEAIRAVLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of the human RAC3 in complex with the CRIB domain of human p21-activated kinase 4 (PAK4)
rcsb
source organism Homo sapiens
molecule tags Protein binding/transferase
molecule keywords Ras-related C3 botulinum toxin substrate 3
total genus 63
structure length 178
sequence length 178
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2007-02-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2ov2A00
1ESNA 1CTQA 1YHNA 2VBCA 1G8PA 1XEWY 3L82B 2QPOA 3KXKA 1OLOA 1DOAA 3N2EA 2RGNA 4Q1EA 4LJYA 3AH8A 5IDVA 5LBIA 3ZD7A 4B76A 2RGNC 1RE0A 2EW1A 2C78A 1QHXA 1VMAA 1E2PA 3QKTA 4MRSA 3T1VA 3DHWC 3WBKA 1IXRC 1XXHA 1M7HA 3L8YA 3PUZA 2F9MA 4H1VA 4JBXA 4Q4AA 4L5BA 3RSLA 3PUVA 4LYJA 2ODEA 2EWVA 4KODA 1D8TA 2Z5FA 1Z28A 3AGPA 1U99A 3BB3A 1KIMA 1JJ7A 2BBSA 5CJ2A 4B47A 2OCBA 5FUWA 1AQYA 5EXSA 1Q1BA 4W9MC 2ZRKA 3LFUA 2CK3D 5AJZA 1E9CA 2CCKA 3LBIA 1F2TA 4DSUA 2B6HA 3K0FB 2FPKA 4NPHA 4C0HA 5FOTA 1MO4A 1AS3A 3TW4A 4M2LA 4ZDWA 4FCVA 3O8CA 1TU4A 1IN5A 2IXGA 1Z08A 1T5LA 2VO1A 4KFSA 2QP3A 1E0SA 1UKEA 2QA5A 3SYKA 1J90A 4K81B 4QC2A 4Q7LA 2C5LA 4EPWA 4IFBA 2RGGA 5EP1A 3A4NA 3BB4A 3K9LA 4KYIB 3KJGA 3Q9LA 1S2MA 1KJYA 5JSZA 2P0EA 3CX8A 3M0EA 3NBYC 3TAUA 3UMSA 4ARZA 5J47A 3IGFA 4OQLA 4D6PA 3GPLA 3ZDQA 1B0UA 3QKRB 4JKYA 4YLGA 3AVYA 1N6HA 2WWWA 3OIYA 1KI4A 1AGPA 1HA3A 1NKSA 3GFOA 3W3AA 2P6NA 1N0VC 4PSAA 4Q1AA 1RZ3A 4DEXA 2NGRA 5KNDA 3U7HB 4IKEA 1YZQA 3SN6A 1S4QA 1G41A 1TQ6A 5LB4A 3B85A 4NKRA 2ZJYA 4DHEA 4JVLA 3C15C 1HYQA 2WIBA 2WM9B 4F4JA 1E2FA 4A0FA 4AY2A 4PAMA 2F6RA 4P4UA 1CIPA 3QXXA 3DKPA 4MKHA 3K9GA 5CLQA 4O3MA 2GAOA 5D3MA 3GEIA 2BDTA 1IY2A 2J45A 3AVWA 3TLXA 5E95A 2IEZA 3WXMA 2QT1A 4NONA 4HSEA 2OEPA 4D4MA 4BFUA 2Z83A 4YC7A 4OI4A 4I1UA 1UEJA 1ZCBA 4DT1B 3LQRA 3U3KA 5JWRA 1YZUA 3KKQA 4PC2A 5DISB 3LA6A 3PQCA 4V03A 4Q5IA 4CF7A 4BE7B 2VYFA 1CF4A 1HH4A 1U94A 4R71A 3GLFA 4TLAA 1VPLA 1NMXA 5IK2A 3SHFA 4JSTA 3VU9B 1XX6A 4PANA 3TSZA 5E3HA 4C7OA 2D7CA 1RJ9A 2HUPA 1KY3A 4GOKA 3GLIA 4TT3D 3WNCA 1RYHA 2DR3A 4URYR 4HAZA 1KNQA 1W1WA 2GJ8A 2V6IA 5DI3B 1G9XA 4JVMA 3GLFE 4KVGA 1OPXA 1W0KD 4RD0A 4D25A 1E9SA 2K5UA 3C41J 5HZKA 3GJ7A 3AVQA 2UVQA 2ZJ2A 4XIGS 3QUSA 3UPUA 2IC5A 2NO0A 1OKKA 5TY0A 3VAAA 2XTZA 4NL4H 3GLIE 3U44B 2ZVPX 4DIEA 2WPDD 1DPFA 4DCVA 1T9HA 3JVVA 5HCIA 3C4JA 2JASA 1IBRA 1EG7A 2IYSA 2QPTA 1HV8A 3AGQA 1KO5A 2JJ8A 4Q4HA 3PUYA 4QM7A 2VSFA 1DS6A 4CDGA 4B2PA 3AEZA 2DFKB 5JJKA 3I61A 1UDXA 1ZJ6A 2OO7A 3AQ4A 3N5CA 3QBTA 3QEJA 4FW9A 1OH5A 5FBLB 2IW3A 3RC8A 2ZYUX 2C99A 2PX0A 2J7PA 3B60A 4LPSA 2YOGA 1OF1A 1IN6A 1A7JA 2J0UB 4EJSB 1E9EA 1G291 1YU9A 3P1JA 3PXGA 4TZ6A 2LCFA 2AXNA 1AS2A 3EWAA 4MRNA 3EAQA 2ODWA 4WIAA 4B32A 2G9NA 4O25A 5JS8A 2J0QA 4BFWA 1EX7A 3FPAA 2BKEA 3I1FA 5GJCA 4LJ6A 1GKUB 2GCPA 4GT1A 3W6PA 4AK9A 1GZSA 5HR5A 4P4TA 1L8QA 4U7DA 3H86A 1U8ZA 1XZQA 2Z0MA 5AJVB 2W83A 4D0NA 5C4MA 2GVDC 1TU3A 3NC1C 4AI6A 3AF4A 1RPZA 5AR1A 2EFHB 3QPWA 1YRBA 2W6ID 4OK3A 1SGWA 2QBYA 1KAOA 2HCBA 4D26A 1E1RD 1XTIA 4HLDA 1E4YA 2ZS8A 1F60A 3NBZC 5FPYA 4CEIA 5FL3A 5FOWA 5JRJA 1ZVQA 3NDPA 3MD0A 2ZU0C 4IVPA 1ZC4A 3HPRA 1KMQA 5L8VA 4JLOA 2AKAB 2RGCA 2IHYA 4H1UA 3TGPA 4O2LA 1XCPA 2EYUA 4URUR 5HPYB 4TL6A 1BIFA 1GUAA 1I2DA 4RD4A 3LNCA 4BGDA 5J4HA 1CR0A 2H8KA 1QHHA 2O8CB 1FMLA 3FKQA 1CJUC 1G17A 3AVTA 2VP9A 1LNZA 4L9WA 2AWNA 3K09A 3WP1B 3AF1A 1NSTA 2AFIE 2F1RA 1VYTA 3EG5A 2W6JA 1F5NA 1OXSC 4MUAA 2X8AA 4NYIR 5CJPA 721PA 4KI0A 1FP7A 2VHJA 1YR7A 3PUWA 4BASA 5C1BA 1DAKA 1TQ4A 3ZVLA 1KO8A 1QHYA 4FD2A 2P3SA 2P6UA 4XH9B 5G3YA 4BFZA 1KTVA 1QHIA 1F48A 3R20A 2I1QA 3QE0A 2A5JA 3SFZA 1R8SA 4FINA 3BD9A 1XMVA 4NHOA 3LDAA 3GP8A 3U60B 4NCHA 3VKHA 4JT4A 5KSOA 1L4UA 4GOJA 1TTTA 5JCZA 4PZLA 4M1TA 1T91A 4XSHA 1E1QD 1XEFA 3A8TA 2FPLA 4US2R 3ZGXA 3ADDA 3LW8A 1NLYA 4QHSA 3THYA 2BWJA 2JEOA 2HYIC 1A4RA 4RZ2A 2GESA 3T15A 1E99A 2N42A 3ZH9B 2P5TB 4Z51A 4FCTA 2XNDD 2DY1A 4IVRA 4MITA 1VDZA 1XTJA 2Q9BA 1T4GA 4WZ6A 3GCGA 5FTMA 1XMIA 3C5CA 4A9AA 1XJQA 2D06A 3OEED 4MYUA 4BLOA 2WAYA 4TN1A 2QSZA 3N70A 3SJZA 1KO7A 2WTUA 2R9VA 3LQQA 5EZ5A 4BFSA 4CEJA 4LJ7A 4MYCA 3Q72A 2PEYA 5KUTA 1BKDR 2X2EA 2XEXA 2REBA 1ZNWA 3CRQA 5JRZA 2FFBA 4O2RA 4YDHB 1Z5ZA 3D3QA 1D6JA 3NHBA 4KLZA 1WMSA 1W4BA 4PHHA 3ZVNA 3THWA 5LD2B 2ZRCA 2H17A 4DLXA 3C14C 4GRAA 4P32A 1YZKA 2F55A 2ATXA 1EGAA 3VX3A 5DN6A 1CULC 3KTAA 1EFUA 2W6IA 3QJYA 3T1TA 1T0HB 4RD2A 5E7JA 2JLVA 1NVUQ 4DLWA 1BH2A 2VH5R 5C2JB 1HURA 4ITRC 2OAQ1 3NHAA 1EK0A 2B21A 2A7QA 4EPVA 4PHFA 3RS7A 1E96A 1Q3HA 3QKUA 2CCGA 3FKSA 4CEIB 1N6NA 1EFCA 4JBWA 3K0CC 2EFCB 1F2TB 1Z6GA 3HJNA 4TTPA 1NJGA 5CDFE 5DLQC 4OJQA 2J1LA 3IBGA 3WYFA 2WICA 5B64A 4ON9A 1XZPA 4DSOA 1SVOA 4YONB 3EPKA 2C8VA 4C0BA 3T12A 1C1YA 2ZITA 3I32A 4NMMA 5DIFA 3RS3A 3RVBA 1G6HA 421PA 2H18A 4PC6A 2JLUA 1GITA 2J9RA 3L2OB 3QI2A 4G0NA 2JDID 4U02A 1E2IA 1SXJD 2GKSA 3B2EA 3L43A 2R8RA 3OZXA 3AKEA 4R2IA 2A3RA 2IEYA 5G41A 4LJ8A 3L8ZA 1UADA 2JIZD 5IHPA 1HQYE 3ASZA 5L3SB 3QXHA 1VG1A 4NU0A 2IK8A 2ODBA 2G83A 3N2IA 4DLSA 4NYJQ 4HAYA 5J4LA 1E1QA 4B44A 2FNAA 5K8IA 3VX4A 2BVNA 1ZM2A 4TYNA 3PJRA 2BBTA 3GMTA 1R5NA 1WBDA 4U00A 5CM9C 3NIBA 4DLRA 4D82A 1EXMA 4LY6A 3T61A 3AKCA 3A1SA 4WAUA 2IYUA 4A92A 1ZIPA 4IDNA 3UMFA 4KU4A 3WMFA 1BMFA 1YZGA 2WJHA 2ZE6A 4IJMA 5FI0B 1S1CA 1KOFA 1W4AA 2ZETA 4ACBA 2OBNA 3EW9A 4LV5B 3AVXA 3MWKA 1YE8A 1P5ZB 3QF7A 2XZLA 1XD9A 4NCIA 3R9WA 1PV4A 1QVRA 4R7ZA 1OB5A 1G8HA 3O47A 3UIEA 1D2MA 1KDTA 3DO6A 3U3RA 1K6MA 4FXPA 3KQKA 3U61B 2H5EA 3U3MA 1TPZA 1U81A 2OCPA 2V8OA 3FB4A 2F9LA 3FWYA 2HV8A 1MABA 1XEWX 1DARA 1X8LA 3P4XA 1NRJB 3LBNA 1NLZA 2VHUA 3ICQB 4BFTA 3X2SA 1DELA 2PLFA 1AZTA 5EXXA 4UJ5A 5GJBA 5JECA 4HAUA 1NBMD 1Z6AA 1U8AA 3H0KA 3BOSA 2IA5A 4QJ5A 4GI7A 2GCOA 3LY5A 2LWIA 5DSZA 3RRZA 3ZVRA 1MR3F 3QPUA 5G53C 3UG6A 5BN4A 5JCPA 4C3ZA 3B8HA 2ONJA 5KPDA 4MQBA 1KSJA 5FUXA 4ASUD 4KITB 221PA 1XD8A 4US1R 1WB9A 1UBEA 4RD3A 2G88A 4OK6A 1P75A 3T1QA 3IILA 2MSEB 3QG5A 4LBZA 3QNUA 4B3DA 1A5TA 3AF2A 1OB2A 1LF5A 1A2KC 1KZ7B 4NCNA 1XTRA 2OFXA 2Z43A 3M1IA 3QQ5A 2OV2A 1Q3TA 3VKGA 4GBMA 4PSKA 1CEEA 5H8WA 1CJMA 1Z29A 2VHQA 4JLVA 2QMHA 4OHWA 1ANKA 3U7FB 4CEHB 1P9WA 3CW2A 1Z63A 4EAQA 4TMVA 3K0FA 3AM1A 2O8FB 2CL0X 4J0QA 1UBCA 4HI0E 1ZU4A 1XXHE 1N6PA 3ASYA 4G5RA 3GEEA 1PZNA 3GJ3A 3EC1A 5ANRB 1GNPA 3FTQA 5DNYB 5IRCD 3REGA 2IS6A 4URXR 1LVGA 4KFRA 1M8PA 2CCJA 1CP2A 2W2VA 3VR6A 1P2SA 3SHWA 4MH0R 1GM5A 4XWOA 2ECKA 3MCAA 4H9GA 5JLJA 2OLKA 3CM0A 5EE0A 1AK2A 3GFPA 2J3EA 4A8JA 5BQ5A 3I92A 3EZ6A 4NYMR 4CEJB 4Q02A 1G19A 3E5HA 2WWHA 2IYVA 4QKQA 2FPMA 1FFHA 2NMVA 2IS4A 5CYOA 2FWRA 3HR7A 4KYUA 4C9BA 2EYQA 2Q3HA 5FOXA 4ZKEA 6Q21A 5DGXA 5DN6D 2RAPA 2NO9A 4WZAE 2O0HA 3SFVA 2FU5C 1Q0UA 1EX6A 1P60A 2CE7A 5JWOA 4HLCA 5AWFC 4TYWA 1P9RA 1CJTC 2WBLC 1W48A 1XRJA 1Z0IA 4R98A 4BZXA 3W9YA 1N6IA 3W34A 3X1XA 4LPKA 3BS4A 3IIKA 3EIQA 4JLDA 2FH5B 4B6FA 4EJSC 1ZD9A 3DZDA 4PFSA 1II9A 2KBEA 4GP6A 1GILA 1NBMA 3IIMA 1TADA 1ZU5A 4KVAA 4AYTA 1DAMA 1K5GA 4FMCB 1KSGA 1GKYA 1IHUA 3I5XA 3EZFA 1HEIA 1K5DA 5HZHA 3BERA 2ZJZA 4MGKR 1CKEA 2R44A 2D62A 4FMBB 4NCJA 3UANA 5BXQC 4BRWA 3AP1A 4DWJA 3DDCA 3I3SR 2QENA 2GEUA 3Q7PA 3EPLA 4N0EA 2GETA 1E2EA 3EWSA 2F1HA 3TR5A 2ZRPA 1PUIA 1NMYA 1SXJB 5E4FA 2ZPTX 2XX3A 3SEAA 3TIFA 2FF7A 2IF2A 5KNCA 3RABA 1AIPA 2Q9AA 4U5XA 2MSDB 1E94E 2RHDA 4JLBA 4C2TA 1GG2A 4KBGA 2ZROA 4QL3A 4WA7A 2BC9A 1NVWQ 2CVFA 4FMCF 3SU8A 5DH9A 3EIHA 3W3ZB 4LV8B 2CJWB 4TQAA 4EDHA 2NTYC 1S0UA 4L15A 4NH0A 2QE7D 1GL7A 1UFQA 2EFEB 4N0DA 4TLDA 4A6XA 1KMHA 3AUYA 5FBRB 2O8CA 3NEYA 3K70D 2IWHA 3BWDD 3U3JA 3JZAA 2QPAA 4HDCA 1ZUHA 2CLCX 2ZS9A 1IY1A 1JPNA 2V7QD 1TAGA 4JL5A 1ZBDA 3X1WA 1E98A 1AKYA 3FHCB 4QBIA 3K0AA 2I4IA 4V0KA 1W44A 2ZM5A 2GTPA 1F6BA 2ZAOA 1GRNA 1WCV1 3PG5A 3MSXA 2IYRA 4A2QA 2IXFA 1SXJC 1IJFA 1G4UR 2ZRDA 3PFIA 3NH9A 1TUEA 5B58C 5L3SA 3EIEA 2A5GA 2C96A 1VHTA 2GNOA 3FYHA 1WF3A 3REFA 1CR4A 2XXAA 4DXAA 3SZRA 2ZE8A 3KJEA 1O87A 4TL7A 4EFNA 4QNMA 2QAGA 4L4UA 2ZRGA 5FUVA 4KSBA 1TUIA 4IDOA 4CVNA 1Z0FA 3AP3A 1QG2A 4D4JA 2CHGA 2GXUA 3NDBB 3B5JA 5BN3A 3MMPA 1FZQA 4JT2A 3HR8A 2QU8A 4X8LA 1JAHA 3CUEF 3B1ZA 5AJWA 4EFLA 2JLXA 2WJGA 4Q9JA 3ONWA 4BLQA 2R2AA 2R62A 1DEKA 2NO1A 4HLUC 4LJ9A 3R7WB 2RCNA 3KKPA 4RD1A 3T5GA 2GCOB 3K09C 4MDEA 1ZUNB 2GRJA 1SVWA 2GA8A 4JLJA 1G7CA 1T3LA 2J46A 3L0PA 4B73A 4ZCMA 5KNBA 4ZCLA 3GLGA 4Q4HB 4CT4B 1FOEB 2F3TA 1S1MA 1F2UB 3K0AB 3QOFA 3T35A 5DYIA 4DCSA 4DLTA 4C7OB 4ZI3A 1A82A 3NWJA 3U6BA 2FG5A 2P65A 1QVAA 1RIFA 1N6RA 5H1YA 2AHOA 3CO5A 5SZIA 2J41A 4HLUA 4OQNA 1MOZA 4PXAA 5J40A 4F4IA 2P6RA 5F9FA 3OIVA 1L2TA 1VG9B 2FFQA 3LWNA 4OI0A 1J2JA 3DKVA 1JECA 1W2HA 1JEEA 3A4MA 3AUXA 1H8EA 1WRBA 1Z07A 3I72A 3I73A 4EPTA 2BMDA 2IXEA 2FX3A 3C7KA 3IKJA 4MRVA 1N0WA 4UQOA 1E2HA 1OW3B 2JATA 1R5BA 1IXZA 2PH1A 4V0LA 1XD2A 3HYTA 2QQEA 2QMUA 3KQUA 1JXOA 2DBYA 3CF2A 1M7GA 2W0MA 3ND9A 4HEJA 3U3OA 4B2LA 4Q01A 4Q1DA 1A1VA 4NYMQ 1NN5A 4QM6A 2VIIA 2F7SA 1U0HC 5J5CA 4MYTA 4I1VA 3CR7A 4D0LB 2JJ2D 5K8LA 2EFDB 5EE9A 1OH7A 3CONA 3U44A 1JBKA 3FMPB 2OZEA 4Y0AA 4MUBA 1HTWA 2A5YB 5JEEA 3QKRA 3ZS9A 1XP8A 2IT1A 8OHMA 2GWHA 4XVRA 4HDQB 4M1OA 4UNPA 4Q48A 4AKHA 2VP2A 3PEUA 3AB3A 4DIDA 3B1XA 4Q1BA 1N6OA 5B57C 1W47A 3NG1A 2OXRA 3BB1A 1DE0A 4HZUB 2FZ4A 3LXXA 4IEIA 2E9SA 3LVQE 4M1SA 2ODNA 3GLHA 4RFSA 1QBKC 3VFDA 1U98A 1TF7A 5FTKA 2O52A 2ERXA 3HP1A 2PZFA 4QXAA 2WWFA 1XPUA 1Z6TA 1E2DA 3IQWA 1HQCA 3LRPA 3EPJA 4OHXA 5FPHA 4PO9A 4Q1CA 1S8FA 1BMFD 1J8MF 1G21E 2ZE7A 2ZUBA 4ERNA 5C18A 1MRNA 2GK7A 1OE0A 3EZ2A 4OK5A 4W5HA 3UWOA 4YMTA 3G0HA 2GVZC 2PX3A 1DG1G 4OHVA 1NVVR 1D9XA 4A82A 2R6GA 3O8RA 1FMJA 4Q4JB 4ZDKA 1P6XA 2FA9A 1P2VA 4MKFA 1X8KA 1Z6XA 3NKVA 1AKEA 2XSZA 3A1UA 1XPRA 5BWMA 4RZ3A 2X1VA 2ZVQX 4D2IA 3EX7C 3RC3A 4GOXA 1JR6A 1XCGB 1G7RA 4UKDA 1DAEA 1P61B 5JEDA 5SZKB 2RH5A 4Q7KA 4OL0A 5IK2D 1NVXQ 1OV4A 3B1VA 4LGMA 1Z83A 5CYPA 1ZAKA 4A8JB 2JLZA 4XD7A 1P3JA 2XTNA 3ZLJA 4GPTA 1MH1A 3P32A 3K53A 1CJVC 1LF0A 5FL7A 3RS0A 1LTQA 3K1JA 1NL3A 1OXVA 4M21A 4KCGA 2IUUA 1OKKD 2QEQA 1D2NA 3EARA 5P21A 2FE4A 4NTZA 4W7SA 3RS2A 2ZJOA 1T6NA 1JR3E 2QTHA 3UKDA 3VQTA 4MGIR 4JLMA 3QSYA 1E2LA 4PZZA 5M04A 4WXRA 4DCNA 1P2TA 3KJHA 3P4YA 4PQYA 3U4QB 1PLJA 2SHKA 2A2ZA 3OIUA 4PX9A 1E79A 1U90A 3S1AA 1G4AE 2WJYA 1SKYB 1XTKA 5FR1A 4Q00A 3OFND 3P27A 3VR2A 3ZYCA 2QN6A 4DLVA 1I2MA 2O8DA 2C77A 2ORWA 1CRPA 3B9QA 3DVLA 2D2EA 4M22A 2FDCA 4BEBA 1US8B 1KDOA 1XMSA 2X19A 3MRSA 1E9RA 4HUQA 1QRAA 4HUQB 4LHVA 4LRWA 1T8UA 2D7DA 4IEEA 2BM1A 3ZZUA 1IXSB 3QBVA 2ZSBA 4HUTA 1Y3AA 4HB4A 1COWD 3TRFA 1GFIA 3U7GA 2HEIA 3G5UA 1P4SA 2GJKA 4CGZA 1XDBA 3ECCA 1XD2B 1JQLB 3A6PC 2RKOA 4POAA 2J7PD 4E03A 1RVDA 1UBFA 3S1AB 1SVLA 4LBVA 4GSYA 2JCSA 4ILEA 2J0SA 2JLSA 1W4CA 4V0ME 5J4VA 1TQ2A 5CLLA 4URVR 1RJ9B 3GFTA 1QDEA 2F3RA 4NE2A 3CPJB 4A8JC 2WKPA 4XWAA 2YNMA 3PR1A 5AK0A 5CK5A 4P0TA 3EA5A 4NCKA 2QRNA 4QRHA 3KFXA 1E1RA 4TMTA 2DB3A 3BC1A 4TYYA 1LY1A 2RGXA 4P4SB 4Q4LA 2V1XA 4K46A 3K70B 3HWSA 2ORVA 2FFAA 3U6KA 2DYKA 5AUQA 3CR8A 2R6CA 1GKIA 4PO1A 1VYVA 3ZD6A 5BYKA 1R0ZA 4BLTA 1NLFA 4HB3A 4IVQA 4Q21A 5FPSA 1KJZA 4PZYA 3U7EB 5LPNA 2NQ2C 1W36B 3QIAA 5F2EA 1KSFX 1MO6A 4JMPA 4QGHA 1KI3A 3OIWA 1KI6B 3C5HA 1N6LA 1ZD8A 2IS2A 4I1OA 4CZ2A 1XFAA 2Z6VA 4ZIRA 3R8FA 3KXIA 5EUMA 3VR4A 3WNBA 2A5FA 4IRUB 4LV6A 821PA 4PC7A 4LI0A 1UAAA 2YOFA 2RGEA 4Q47A 4QHTA 4X8MA 1CRQA 5F98A 5SZHB 4AWXA 2CLDX 1SVIA 5JBQA 3KTAB 2VP0A 1U2RA 1EFTA 2ZRLA 2C98A 1Q21A 1G5RA 1R0YA 4B34A 4MGZR 4C0AC 1CR1A 3IHLA 4PC3A 2JJ2A 5JI3E 2ZUDA 3OFNA 2OUKA 1JXMA 1PUJA 1XMJA 1TF5A 5KOYA 2B7BA 2O8EA 2BMJA 4DCUA 2D2FA 4DLZA 2P67A 1RFLA 2PMKA 1BS1A 3MJRA 4B2IA 5L3QA 5JMTA 3D8BA 2J0VA 3AF3A 4LC1A 5DHFA 1BYUA 2G1KA 2O8FA 4AYXA 3LO5A 2KBFA 3OE7A 4B48A 4ZI2A 4JJZA 4BZQA 2C9CA 3P20A 3RS4A 2EQBA 5D3QA 3LLMA 1TMKA 1DAHA 4LUCA 3KFVA 1AN0A 3Q5EA 3K70C 2KI5A 4QNRA 1OYYA 4A2WA 2GEDA 1YZTA 4MYHA 2AK2A 4Z1MD 1Z2CA 4WZBE 2WSSA 4V0MA 1XPOA 1FW6A 2XTMA 2I1VB 1X3SA 2JGNA 2YOHA 4Q4AB 2YKGA 1HT2E 1U9IA 2OXCA 3F5FA 2KE5A 1UKVY 3KKMA 1VG0B 2H92A 1TNDA 3V4RA 3GLIB 2HXYA 2OFOA 5EQTA 1N5IA 4FCWA 3SBDA 2HCJB 2GF9A 2ZANA 4DJTA 1DO0A 1J8YF 4ESHA 3DMDA 2CEAA 2GHIA 2V9PA 5H70A 2V3CC 1KY2A 3KX2A 4AYWA 2PZEA 2VP5A 5HE8A 3X1DA 3MFYA 1OHHD 2RGDA 2WWGA 3VR1A 2ATVA 3DM9B 2OM2A 2XSZD 3V9PA 3SYLA 4ESVA 1NSFA 1XEXB 1IJEA 3L0IB 4LJAA 2ONKA 1GOTA 3MLEA 4Q19A 3W8NA 1DTSA 1H65A 1PLLA 1R0WA 3CZQA 3K9NA 1VG8A 4A4DA 3VR5A 4B3BA 2E87A 1Z47A 3DZ8A 3UATA 3FOZA 4RD6A 1B23P 4A15A 2F1JA 5C4GB 1NN0A 4OKSA 3TUJC 4TL8A 4FIDA 3TNFA 4IOKA 3UMRA 1XB2A 4BEJA 3I8SA 2HF8A 5EXPA 4XOIA 3BH6A 5TV2A 2A9KA 4DC9A 3HU3A 4RVCA 2OLJA 5KDOA 3R7WA 2WVJA 1KI1A 1N25A 3TKLA 1T3HA 1SULA 4RCZA 3W6NA 1DAIA 3A4LA 2ZRBA 3CWZA 1WP9A 4OQFA 2JJ1D 3BFVA 4IDPA 4ACAA 3WRXC 5KU1A 1KJWA 4OHZA 4M0LA 3D7MA 4DSTA 1E0AA 4WW0A 2NPFA 1HE1C 2QBYB 3TUIC 3QKSA 1OXUA 1XTSA 3QF4B 2VL7A 2EWWA 4PC1A 3AP2A 3MWYW 1H8HD 2VHCA 3GQBA 3ADBA 2GAAA 1VCNA 4E22A 4YMUA 4LYAA 2AKYA 5JZVA 4HZIA 2ZRMA 1GSIA 5KSYA 3TSWA 1GP2A 4XWKA 4AIIA 3IEUA 4RFVA 3QY0A 3U2QA 2ZXUA 4V0NA 4KV9A 1G20E 4TQUS 4Z1MA 4LCBA 1P73A 4P33A 5E7MA 1DG3A 1H8ED 2NO7A 1CU1A 5TB5A 2Q6TA 2Z4RA 4HYYA 5KPJA 4DB4A 4E09A 1ZNXA 2QAGB 621PA 1MO5A 3FHOA 1FTSA 1GVNB 3IO5A 3QENA 4UJ3A 5FPTA 2QUZA 1G16A 1UEIA 2AL7A 3PV0A 4QG7A 3UWKA 4C2UA 3R9XA 3B7GA 2ZRJA 3GJXC 1NG1A 3KZ1E 3SR0A 2KWIA 2GXQA 4KO8A 5DI9A 3RRYA 4C4PA 4NYIQ 4EPRA 3V4FA 1G5PA 2O0KA 1F3OA 2I3BA 2UZ3A 2XAUA 4V0OA 2ZS7A 4DVGA 4G5GA 3THXB 1S3GA 4BFXA 4Z8YA 4BFYA 2FSHA 3NBXX 4TMZA 1QHNA 5FOUA 2BM0A 1UKZA 4ZIRB 2BMEA 3W5JA 3MUFA 3ZZTA 3SOPA 4DCTA 3IQXA 4C0LA 1P7CA 2QTVB 3QEOA 4IXNA 4CRWB 1GDDA 4R9UC 4M9QA 3D31A 3TE6A 3QKSB 2AR7A 1KK3A 5B2ZA 1YQTA 1T0JB 1YKSA 1SXJA 2ZI3A 3LX8A 4Q03A 2ZRNA 3NBFA 1E2MA 1JJVA 1VIYA 3MGCA 1E9AA 1NBME 5EJEA 4B3XA 2J87A 4EJSA 1I4DD 2NZ8A 5GVSA 2CLSA 2NO6A 4RCYA 3H1TA 4RJLA 4DDWA 1KI6A 2OAP1 2KB0A 4YMSA 2AN9A 2BMFA 3TUZC 5FFMA 5HKKA 1QG4A 1VYUA 4EPXA 4BLSA 3WHKA 3B82A 4OQXA 3F3YA 2GBLC 1TX4B 1P2UA 1JI0A 4FI3C 1UPTA 4PPGA 1KKMA 1MKYA 2QNRA 5KYKA 5J4KA 2WMNB 4D4KA 3THYB 4MRRA 4IW3B 1E32A 3AVUA 3RLFA 1E2JA 3LX5A 1LV7A 2C2HA 1CS4C 2BBWA 1Z06A 2O8BB 1JEDA 3WMEA 2BCGY 4KSCA 2BIFA 4TTQA 1EESA 2ANBA 2R6FA 3DOFA 1AJEA 2YV5A 5EUQB 1N6KA 4IOMA 3ZQJA 2JLQA 1Z6YA 4GNKA 1UJ2A 3WY9A 521PA 1SHKA 4BECA 1Z22A 4JIMA 1Z3IX 2FGKA 2PJRA 4D0GA 1W0JD 1HE8B 5G40A 3A1WA 3OF5A 2DHRA 3WP0A 2EU8A 1M2OB 2BEJA 4CT5A 3K0SA 1YZLA 2OE2A 3KDSE 1A2BA 1IONA 1WXQA 2YINC 4LYHA 2PL3A 1IAQA 4C0KA 1CR2A 4FMDF 5HCNA 3NTUA 3E1SA 5JSZB 5L3VA 1S9HA 4BLRA 1XJ0A 2Q0HA 3CH4B 1ZM3A 2D74A 2WIAA 1KAGA 4PQFA 5BYJA 3QXCA 2VA8A 3FMFA 5BN5A 4KAXA 4US0R 1KDPA 4F92B 2HT1A 5GADl 1FNMA 2ZRHA 4B6EA 3C8UA 5KDDA 3PEVA 1KI9A 3NH6A 3GLHE 4HAWA 1X1SA 4QGGA 4CEHA 2PMDA 2OT3B 2JJ1A 1IN7A 3MWJA 1FUKA 1CLUA 3GLHB 1NI3A 4RFSB 1Q57A 5EP2A 2ZYVX 1IQPA 3BK7A 5JFGA 5FOSA 4HAVA 2ZTSA 1PJRA 2RMKA 4YMVA 1ZRHA 1IN4A 3JZMA 2QI9C 4JS0A 3AKYA 1FQKA 3J81k 1Y63A 3CRVA 3TK1A 2XB4A 5AUPB 3SQWA 4DKXA 3PENA 3RSOA 1OJLA 4XTCS 2A30A 1JAIA 5JWHA 5HKKD 121PA 3RANA 4XVUA 2CE2X 1AGRA 4AC9A 1I4LD 1P9NA 2WWXA 3M6AA 2QGNA 3OHMA 1LFDB 3A58B 3UK6A 3GJ0A 2GXAA 3WRYC 1M1YE 3KL4A 2V4ZA 3CZPA 5TMPA 1Q22A 4EUNA 4V02A 3MG9A 3ZIAA 2DFTA 1GAJA 2V7QA 2ZSAA 5EE5B 4FN5A 4NYJR 4M9SA 5KSPA 3M4YA 2KJQA 2WV9A 1E9FA 1KNXA 1ETUA 4UNSA 2ZYTX 2BOVA 4TZ0A 3SS8A 2YHSA 2WKQA 5TXGA 2O8BA 3IHWA 1EFHA 2IHBA 1OIWA 1FPMA 4HATA 5CDFA 2ZJ8A 5TARA 5HE9A 1NN3A 2ZYWX 2J5XA 1Q12A 1X8JA 2CK3A 2GF0A 1TL7C 3FDIA 4BZPA 3BH0A 3KB1A 4R2HA 5SZJA 3GJ6A 1MABB 4A0RA 2YWGA 4DDUA 5IT5A 2W58A 1FX0A 2VEDA 3FFBA 3RWOA 2IYYA 3NC0C 2ASEA 4JJKA 5K8TA 2NOAA 4OI2A 2ZSDA 3CRMA 1GWNA 3TQCA 1OT3A 3D6TB 3GJ5A 4A0GA 4OQMA 5A5GA 5JHHB 2RB4A 4HZUA 1KZGB 2GCNA 1SKQA 3K8YA 4I99A 5FTNA 2J7KA 3ZZ0A 3HDTA 4PPQA 3CKLA 1GTVA 1AQUA 2OHFA 3RRMA 1IY0A 3BE4A 3IBYA 3T06B 2F43B 2FOLA 2OBMA 5KHOC 4MA4A 5GJVC 4IDHA 1W5SA 2GJAA 3VU9A 2FV8A 3LD9A 5A0FA 5BW8A 4M4SA 1QHGA 2C9YA 2BV3A 3CLVA 3E2IA 3AVVA 1JR3A 5CIWA 4HAXA 4AKIA 1II8A 1XU4A 4PR0A 4MGYR 4DBLC 4BWYA 1Q1QA 1T8TA 3ETLA 4XVQA 4G5OA 3LLUA 1CJKC 5CITA 1X1RA 2Z4SA 4UNQA 1WE2A 4YXWD 4AURA 4C0JA 3B6EA 2N46A 4OYHA 2B92A 2WJVA 1XF9A 2R6AA 1G1MA 3CPEA 1U8YA 2ZSEA 5H68A 2MSCB 4ZDJA 4TL9A 2CBZA 3X1YA 3A1VA 4QOSA 4CYMA 3VNUA 1FUUA 4IOJA 2QG6A 3KQLA 3K9HA 1ZNYA 4BUJA 1M34E 4JLNA 4Q9LA 4Q18A 1R8QA 1PVOA 2QM7A 4K8OA 2O5VA 2AXPA 4LDJA 3THXA 4PPNA 1Q1EA 5FTLA 5TVKA 4DB2A 1NY5A 4WVFA 2YJTD 1NKTA 5LB2A 1SVKA 1KGDA 5E7IA 2CDNA 2QM8A 4GMDA 2XXAB 3H2YA 2JLYA 1TEVA 3A37A 1OHHA 4HB0A 3X1ZA 3FHTA 1AM4D 1VCMA 1G7SA 4RZUA 3SJBA 4QBHA 2B7CA 4P3YA 3CH5A 2IL1A 5JI2E 3GEHA 1Q44A 4B3CA 1XJCA 4CW7A 3EA0A 3HU1A 4LOAA 1QHSA 4GDFA 2FZLA 4LJ5A 5FPKA 4G5QA 4M1KA 4WXPA 5FTJA 4TT3A 3L0SA 4URWR 1G3UA 4QBFA 3NXSA 1ZMXA 3O8BA 4I1SA 1E9BA 3QPVA 1W0JA 2JA1A 2ZJBA 2GEVA 5FUYA 3SJCA 1Z0DA 3IO3A 2F1IA 4M1WA 3W6OA 2RHMA 2WSMA 4GZLA 3KQNA 4DLYA 1NMZA 2ZIAA 3QXJA 4UNNA 4Q9KA 1W2GA 1LB1B 2ZI7A 1XTQA 4TSFD 2G3YA 1E69A 3VTKA 1G64A 3Q85A 3QVVA 3R9IA 4B43A 1KO1A 2VP6A 1QZXA 3CNLA 3L0OA 3CRRA 1ZD1A 3PCRB 4AKEA 1VIAA 2X77A 3KQHA 4Q1FA 1NJFA 1OYWA 3CB4A 3QF4A 2FGJA 4Y0VA 1VTKA 5FR2A 3BGWA 3PEWA 1TQDA 5F9HA 3R8CA 1E6CA 1NF3A 1E2KA 2GJ9A 1RKBA 1H8HA 4YXWA 2DWQA 4CIDA 4Z54A 1M7BA 4QJ3A 3THWB 3QXSA 3LV8A 4IFEA 4LBYA 1D5CA 1II0A 2AD1A 1ZW6A 3RAPR 1OSNA 4LHYA 1ZNZA 1NNEA 4ABYA 3F0TA 2A5DA 3WMGA 4QGFA 4DUGA 5JJIA 3ND8A 2EVWX 3GLFB 4JL6A 2HDNB 1EWRA 4HB2A 3PEYA 4W5WA 2ZSFA 5CK4A 4JLAA 1G8YA 1XEXA 3LW7A 1DADA 2AFHE 4F91B 1FTNA 1OFUX 1RYFA 4LHXA 4DDVA 1G3RA 3U4QA 2VHTA 5FL7D 3KUDA 3AF0A 4DDTA 3CF0A 3EPHA 1N2CE 1YZNA 4JYCA 4A1FA 5CIQA 4D80A 4Z8XA 4A6PA 2VLIA 3IPYA 1W46A 1CXZA 2XNSA 2Y8EA 3BORA 3ZIAD 4O0MA 1S96A 2XZOA 4GL2A 2GZHA 5CM8B 4XD7D 1FQJA 2B8TA 2GZDA 2REOA 5CB6A 4JVSB 1C4OA 4JLPA 1Z8FA 4EIWA 1HY3A 4B74A 1NG9A 3DM5A 2MMGA 1KKLA 1D9ZA 3FKSD 4X8HA 1R7RA 3RYTC 1R2QA 4PQRA 1Z2AA 1OFIA 4OI1A 1EFRA 3ADCA 1QF9A 4BQSA 4X8OA 2BCJQ 3EZ9A 3ZS8A 1NN1A 4RKEA 5D3MB 3TBKA 3OAAA 2H7VA 3QVUA 3RWMB 3B1WA 2OESA 4PAQA 4ZO4A 2D3WA 2UZIR 1JPJA 2ZU6A 3BH7A 4FWIB 1UM8A 5JHGB 1FL9A 1DAGA 5KO2A 2FMXA 1E79D 3MWLA 2W6JD 2GZAA 2JDIA 2WJJA 2IYXA 2C9OA 2IBMA 3LXRA 3OEHA 1JB1A 2WAXA 4AD8A 2IF0A 2VQSA 2HF9A 4C0SA 2QMEA 1WDTA 4NZYA 3OEEA 2QQ0A 2ZAMA 1XWIA 2HXSA 1G8GA 2IS1A 1ONBA 3F8TA 3Q7QA 2DFLA 4KJZA 2IWRA 3MJHA 4LK2A 2FFHA 4EPYA 2BBOA 5EP3A 2NIPA 4C0QC 4OHYA 2ZI5A 2QP9X 3T34A 3U5ZB 3RRNA 3ZQ6A 2XGJA 1E2QA 1COWA 1GIAA 1G18A 1J99A 2R6DA 3THOA 1R6BX 3A1TA 3O8DA 2GJSA 4M9ZA 1R5OA 2V55B 4KXFB 3W8RA 1G3QA 1ZYUA 1UF9A 4YDSA 3I8XA 2AX4A 3SNHA 4QHYA 4MKGA 3TMKA 2XNDA 4P31A 4F38A 1JQJC 2O0JA 1AZSC 1YRAA 2ZREA 3AVPA 4P4SA 3IPXA 4TLBA 4Q9IA 2QP4A 3PUXA 4DSNA 1Q20A 1VCOA 1G7TA 2B8WA 1BO6A 1KHTA 5K8UA 2G77B 3KKOA 2IYQA 3B13B 2CHVA 4UNRA 2ZR9A 4N3NA 1T3SA 4LSGA 3DMNA 2XJ9A 2PLRA 4D81A 1HUQA 4G1UC 2QL6A 1LW7A 2QROA 2REXB 4Q9HA 1M6NA 2WOJA 2YC4C 3I62A 2O8DB 1NP6A 1ELOA 2R65A 2JLWA 4KFTA 3TR0A 3OESA 2P5SA 2CL6X 4HDOB 3UXMA 5A4JA 1E4VA 1GRRA 2QAJA 1XBTA 3NEJA 3TAHA 1FX0B 1KMHB 3VHLB 4A2PA 4DT1A 3WYGA 2AWOA 4PSVA 4TSFA 4GMXA 2QAGC 1SXJE 4DRZA 2QORA 1US8A 2NG1A 2XOKA 1SVSA 2ZI6A 4LWZA 1CBUA 2JAQA 3BBPA 3BXZA 2OFWA 3OAAD 2G0NA 2ZRFA 4MKIA 1MRSA 2QY9A 4F93B 2RGBA 1G6OA 1GNQA 2FSIA 4LC0A 4I81A 2DFNA 4JVNA 3K0CA 5TDHA 4ASUA 3IDQA 1P62B 3W90A 4ARZB 2IUSA 2PT7A 4PHGA 2CNWA 1AA9A 4WOPA 1N3BA 3WNDA 1VHLA 2HT6A 1JALA 3BFXA 1KSHA 4AG5A 4B71A 2W2TA 3FGNA 3UG7A 3VHXA 3BRWD 3LAWA 1VCIA 4B75A 4E07A 1KDRA 1MO3A 2G1JA 1E9DA 4JBYA 1KK1A 4QBGB 1KK2A 2FSFA 3IIJA 4ZPXA 3TVDA 2P2LA 3I4LA 4PO8A 4Q4JA 2CVHA 4PHTA 4B3FX 2PT5A 3E70C 3PVSA 1UKYA 5AJXA 1F2UA 1KI2A 5AUNB 3CWQA 3QG1A 2HLDD 1KYIA 5EZ6B 2WHXA 3DOEA 4DLUA 2GBLA 4L16A 1J7KA 3KJIA 5DYGA 1WBBA 4XJXA 2E1RA 2HJVA 4GP7A 3CF6R 2ZI9A 2QRZA 2VRWA 1W49A 4URZR 4UXIA 2W00A 5GVRA 2YYZA 1KO4A 2XITA 2VTKA 2G6BA 5B30A 2XB2A 2JLRA 2HYDA 2YC2C 5FBQB 4XTRA 2GDJA 5HTKA 1DVRA 1GRQA 2VF7A 3KXLA 2IYLD 1EFRD 1ODFA 3DEFA 2QT0A 4JLKA 1ZINA 3FE2A 5AJYA 1RRCA 1SZPA 2QZ4A 3BAFA 1BOFA 1C9KA 4OJKA 1EWQA 3HYRA 1ZM7A 2A78A 1VKJA 1UBGA 4M1YA 1E3MA 4Q7MB 4XSGA 2DWOA 2CHQA 4EQ6B 1RRGA 1XCMA 3KUCA 1XXHB 3PITA 3SC3A 2OBLA 1GL9B 2EFGA 5DE3A 2QGZA 2FEMA 2H16A 2IUTA 3FMIA 2LKDA 4M1MA 4TLCA 3C16C 3T5DA 2BJWA 2AD5A 2IYTA 2WPDA 3ZJYA 3CNNA 1ZP6A 1JR3D 4TMKA 4Q66C 2WJIA 2WKRA 3CNOA 1W7AA 1J70A 4KFUA 2XZPA 2X2FA 3CX6A 2OILA 2VSOA 3CRW1 1PLKA 3DL0A 4TWZA 4HLQB 4WBSA 3NVAA 3FFAA 4AKGA 2OCAA 5KDLA 1DO2A 5EXTA 2ORIA 4G5SA 1G8FA 4M9XA 4EKDA 2YZ2A 4FMDB 2N1BA 4A0HA 3SBEA 1SKYE 1JNYA 2YVUA 2V1UA 1TEXA 3MAAC 5DHAA 4KBFA 2BEKA 3BIFA 3RHFA 2CNWD 4RZXA 2Q3FA 3T1OA 3AV0B 4L9SA 1RW4A 1V43A 4JL8A 3OE7D 4D4LA 2G0TA 1LS6A 3OEHD 2ZRAA 4N1AA 1SVMA 4KHZA 1MV5A 2NZJA 2VF8A 2WMOB 3IEVA 5FOVA 2QSYA 1N0UA 1YR9A 2NPIA 4TQ9A 3G82C 3VKWA 4B35A 3VNVA 3TSOA 3TH5A 2V6JA 2FN4A 1FNNA 1ZIOA 2OSBA 2ZR7A 1YR8A 3GLGE 1E0KA 2WSSD 3VR3A 3RS5A 2FJUA 4MRPA 2HLDA 4IHQA 3FMOB 3AKDA 1VECA 2QE7A 2PCJA 3GLGB 1W5TA 4W5JA 3SJAA 1QHHB 4C30A 4B3GA 2MMCA 3PIRA 1LS1A 4TMXA 1V5WA 4LHZA 3P26A 1E2GA 4YQFA 1AS0A 4GZMA 1S9DA 2V54A 5GJWC 4RKFA 5LDDC 2ZJAA 4I4LA 1O3YA 1SHZA 1G3IA 1BYIA 3JVUA 3CPHA 5JJLA 4S35A 1OH6A 5EE3A 3WYAA 1OIXA 2CL7X 2QTFA 4LZZA 4II7A 1UDWA 5FI1B 1N5JA 3B1YA 2Q9CA 4OBEA 2XOKD 2PJZA 4JKIA 2GILA 4S2EA 5DO9A 3WHLA 2PBRA 5AUOB 3WBJA 1R4AA 5JS7A 4Q7JB 3KKNA 2YWEA 2H57A 4JYBA 4FWTA 5L3RA 1NIPA 1IM2A 3I5YA 4LBWA 2Q3MA 1WA5A 4QGAA 4NDZA 5FH9A 4TYQA 2C95A 3H84A 4TLEA 1XNJA 2ZQ5A 1NIJA 1R10A 3FVQA 4QFMA 4JSYA 2PZGA 3ADKA 4EQ6A 2VSXA 5UKDA 4LHWA 2DWPA 1KI7A 2L0XA 2GK6A 2ZI4A 2VP4A 3TW8B 2XJ4A 5L3QB 1OXTA 2DPXA 3EC2A 3TQFA 1N5KA 3RNLA 2BHRA 3SYNA 1TF2A 4PPFA 4BPBA 1G5TA 2H1LA 1U0JA 4EFMA 1YVDA 5F3WB 3GJ8A 1U9IC 2YWFA 2ZE5A 3ICEA 3TJZA 4TTRA 2Q21A 3BFKA 5IF9A 4KLNA 1M74A 1X6VA 1ZM4A 1NVVQ 2ZUCA 5KTYA 3ZVMA 3Q5DA 2KSQA 1ESMA 3SE0A 3GD7A 1IOZA 5FBWB 2WWYA 2ANCA 4ZDIA 2ERYA 3K0EA 1OFHA 2O8EB 1E0JA 4DUGD 4ZCIA 1KK0A 1OIVA 1RRPA 3V00A 1GL6A 3KB2A 1E2NA 4UXJA 4NP6A 2J0UA 2ZRIA 2WZQA 1ZUIA 3HPQA 2BKUA 4TMWA 1DAFA 3SQXA 5J4YA 3CX7A 4RY2A 4F4CA 1I4TD 1R0XA 4LJ4A 3SI7A 1II8B 1U0LA 1W0KA 1ZC3A 4LX0A 1IN8A 5ELXA 2C03A 2RGAA 1K8RA 4ZV4A 1G3MA 2YWHA 3B78A 3EASA 3Q8XB 5CB8A 2J59A 2ZR0A 2VPPA 2IYWA 3GJ4A 4IOLA 3BJIC 5LD2C 2QMOA 3AVOA 3VMFA 1RRFA 4GFDA 2W2XA 4AG6A 1Z0AA 3SDZA 2IYZA 1S3SA 2PCLA 4G01B 4PAOA 5KSZA 1FP6A 4E5UA 4G3XA 2UKDA 4B33A 4IDQA 4BRUA 2FSGA 3H4MA 4RSGA 1OFTA 5FBVB 1D2EA 1L4YA 1NY6A 4DEYA 4ZKDA 1KI8A 2C04A 2GXSA 3B9PA 5DI3A 3LVRE 1OXXK 2LKCA 2ZJ5A 2CJWA 1MT0A 1ZCAA 4M53A 1W4RA 1X86B 4PTLA 3LH5A 2OG2A 3A36A 3TVTA 2BJVA 3LBHA 1WQ1R 2PEZA 1N5LA 3DPUA 1Q1ZA 5C46F 5EP4A 4UXHA 4QJ4A 4DZZA 1Z0JA 3EZ7A 3Q3JB 3RDPA 4BFVA 1W36C 1RC8A 4M8NE 4MDFA 2W0SA 1W36D 5EE1A 2IX3A 1SQ5A 5G3ZA 1YR6A 1P72A 2CXXA 1ZM9A 2F43A 3HU2A 2ZEJA 1HT1E 4LYFA 4NBSA 1GNRA 2HJGA 4F7WA 3W5IA 4IXMA 2CMKA 3CIOA 3EXAA 2D4HA 1YJ5A 2WWIA 4TYPA 3IUYA 4YMWA 1DBSA 4L8GA 4A36A 3CBQA 2JIZA 2DCUA 2TMKA 4BLPA 2WOOA 1T5IA 4JZKA 2FEOA 2AK3A 1Z0KA 1OH8A 1L7VC 2OCYC
chains in the Genus database with same CATH superfamily
3AO0B 1ESNA 4ZHQF 3OD1A 1GGKA 2VBCA 4FXOA 4BB0A 2NX2A 3ZN2A 3AL3A 3G5LA 4UEQA 2K7ZA 1NVBA 2CXNA 4EY6A 5L4SA 4UAUA 4YAWA 1B0ZA 2XWPA 3LUCA 4NS1A 4WLNA 5JPIA 3PUHA 3AH8A 4R2JA 5IC6A 2XDYA 5LBIA 3AM3A 3ZD7A 1FFBA 4B76A 1QZTA 2RGNC 4C78A 4ND7A 3O92A 1G6Q1 2EW1A 5THXA 1SIBE 4CLEA 5EIAA 4V24A 3L8YA 1U8UA 3PX2A 1ZKMA 4KQGA 4N54A 2F9MA 3CLSD 3R7LA 2C8JA 5HTOA 4R31A 5F3DA 1RXEA 4L5BA 1W25A 2EWVA 3L8MA 1D8TA 1P1FA 4FX5A 1Z28A 3HCCA 3AGPA 1RAFA 4UC0A 1U99A 2OB1A 3UHFA 2PNFA 3NGLA 2EAUA 3UGKA 1CHDA 4K9NA 3RTEA 4UAGA 1AQYA 4CLRB 5K03A 3CN9A 1Q1BA 3UNXA 4YN3A 3U7QA 5JZOA 2Y0PA 4W9MC 1FJXA 1A77A 2CK3D 3N07A 1RQNA 2O50A 1E58A 3HADA 4CI0B 1RR6A 2O2IA 3LBIA 4FDLA 3AY0A 4ZYZA 3BJMA 1BRMA 1PGNA 1J2RA 2GM5A 4U3JA 4NPHA 2CXPA 3H5AA 3NR2A 3TW4A 4E21A 4KFCA 2CBGA 4IIYA 4Q0MA 2M1ZA 4J2OA 1TU4A 4L9AA 3MGBA 5BO5A 1KIAA 2INGX 2E82A 3V5NA 4NARA 4DLLA 1QGDA 1JAXA 1H0HA 1RKUA 2QP3A 1UKEA 3SYKA 5IVDA 2AN1A 1J90A 2HN9A 4HVCA 1W29A 2CFSA 4GR4A 1VBNA 5KNCH 3KYCB 5IF3A 2Q8QA 3D3WA 3K9LA 1R6AA 2CUKA 4L78A 3KJGA 1VL6A 3Q9LA 3ROPA 1TYDE 1P9OA 3AFOA 3G3EA 4RVNA 3RUHA 5JSZA 1TOAA 1ENYA 2VYVD 3DE2X 3M0EA 5DW0A 3TAUA 4Z6KA 1HKUA 2PUTA 2VAVA 1SCUB 1CX9B 1DEXA 1M6WA 3IGFA 4FLEA 3ZDQA 4D6PA 3CRNA 3QKRB 3K9FC 4MPPA 1G0OA 1EWVA 4X1OA 3OIYA 3PZRA 5FWAA 3L7BA 1NKSA 3FG9A 3D3NA 3WIEA 3BSWA 1RZ3A 4FZJA 3U4DA 5CVUA 4EHBA 3HI4A 4F5DA 5CLIA 1A8IA 4KX5A 1ESCA 3I28A 4N7JA 2JFWA 2VWQA 2XCUA 2JD1A 2LDXA 2WHPB 3EN0A 4KAAA 4X5OA 5LB4A 4RDXA 5JD5A 3B85A 3RKSA 2ZJYA 1QYXA 4DV0B 3MCZA 1TCVA 1VJCA 3A4YA 4QELA 2ZJ1A 1HYQA 3KE8A 1MN6A 4F4JA 1TKRA 3EYWA 4A0FA 4Y2TA 4AY2A 3CR3C 1AQJA 3O82A 5H81A 4GQAA 2BZ0A 4UQPA 4RXUA 4XOUA 5EIOA 3DLBA 4MKHA 1AKNA 5CLQA 1RZVA 2XMCA 3GEIA 2BDTA 2OXFA 3AEQA 2XGSA 4E30A 3P2IA 1BROA 1LBHA 4D57A 4HY3A 5BR1A 1F38A 2QT1A 3G85A 3OT4A 4HSEA 2I62A 3N87A 4FFNA 4DQDA 4TUYF 4LA4A 1NDQA 1W73A 1WNFA 3OUUA 3BQ9A 3D8SA 2ZBFA 3GNSA 2H1HA 1KAQA 2VZ8A 4L5CA 3R3HA 3NHKA 3LCCA 5C37A 3UMCA 2XRYA 4PC2A 3EC7A 1ZK0A 4CF7A 3C3KA 4ARSA 1WMAA 3E53A 4BE7B 2DMRA 4M0UA 4RHTA 4EMUA 1IBLB 3Q3IA 4PYNA 2FW0A 2MDTA 1PNTA 1VPLA 4MO2A 4M0EA 5IK2A 2EG9A 4FKMA 3U62A 1N3IA 2XI4A 4WH0A 3TSZA 1A1SA 2AC4A 1Y9EA 3TRDA 4P6VF 3FGZA 5BV0A 1KY3A 3GLIA 1RYZA 4EITA 4OKIA 4HAZA 1W1WA 3UV6A 2ZZNA 1G9XA 4JB3A 1ZAYA 5B4TA 2BUBA 4KVGA 4D25A 4RD0A 1E9SA 3C41J 4N01A 5HCUA 4LNUA 3R7NA 4LECA 4G1FA 4WY5A 2UVQA 2X9QA 3UPUA 2OZLA 2FQ1A 1NT4A 3QX3A 5TY0A 3U44B 1PN3A 4GM4A 4NL4H 3HB7A 5IC5A 4JYZA 1HYEA 1R66A 4XFDA 1QP7A 2UYCA 2OY0A 1L4NA 1ORIA 2FR8A 3C74A 3C4JA 3D3KA 3JVVA 3NUZA 4RF4A 2HBQA 3WRXA 2AVDA 1IBRA 2HIAA 1WDKA 3L93A 2QPTA 4TVOA 3T7RA 5CVDA 3VSBA 5EGSA 3AGQA 4DZRA 1LJLA 4O02B 2VQFB 3AEZA 2DFKB 4WLOA 4BN4A 1T9KA 2HF2A 3I61A 3UJBA 1WM1A 2HNBA 4WESA 4BVJA 4NFYA 3UVEA 2CNKA 3I9V1 5HWSA 2AZDA 1SQSA 2RC5A 5FBLB 2PX5A 6PFKA 4CKZA 2IW3A 1VRVA 2C58A 3KSZO 3MFQA 1Y37A 2PXAA 1IN6A 1CPYA 3EE6A 2J0UB 4ENWA 1JDTA 1DKOA 1YU9A 4N7MA 4RA9A 5ALHA 3WGHA 4XWWA 1DIGA 4GGMX 1W6UA 3EWAA 4A1OA 4FZRA 2I2WA 3V4OA 4C5CA 5AFSA 3GT3A 3DZGA 7REQA 4WIAA 4HS9A 5ERXA 4O25A 5HGXA 2IIVA 1B16A 2YR0A 3OFKA 5D01A 1AKWA 5GJCA 3LBFA 3HR4A 4KXUA 4MWEA 4H7JA 3FIJA 3P4UA 2JEZA 5E2AA 1MRZA 3OM1A 4U7DA 1XZQA 1JHMA 2P1RA 3S55A 1EH5A 2HC9A 3VPXA 2A9FA 1GAQA 1MOQA 1NVKA 1PR4A 3KVOA 1IOWA 2H48A 1WS6A 3P9SA 3QVTA 4MUGA 4YWJA 1I10A 3DR5A 4B0PA 1E3QA 5DBHX 4ANFA 1A95A 2XGOA 5K1ZA 4MUXA 3G9ZA 2EFHB 4GPD1 1F1BA 2I3DA 3QPWA 2W6ID 4B4OA 1EWYA 1KAOA 2WTNA 3OT1A 4D26A 1E4YA 4GZ6A 1W9HA 2M2IA 3NBZC 4LY9A 1X80B 3WK5A 4DHWA 5FL3A 1BTOA 1LNQA 4DYDA 1ZRMA 2W11A 5FOWA 4BX3A 5CFQA 5JRJA 3AJ9A 4KOEC 4YMIA 1SOMA 2ZU0C 1SKAA 1V71A 3HPRA 4PLTA 1MF7A 4MPTA 4F5YA 4LZNA 3SP1A 4JLOA 3VNSA 7YASA 5L8VA 4P81A 1HNZB 4W82A 2RGCA 3DZFA 1N36B 3U4MA 3N6RA 3ZCVA 2CLIB 4QDXA 3TGPA 1UDRA 3LFHA 2WYIA 1SIOA 1P1IA 1I2DA 4FFPA 3LNCA 4BGDA 5J4HA 4OX9B 2ETVA 3FKQA 3FPCA 1CJUC 1JJFA 4CLOA 1JEOA 1N2CB 4X41A 2VQDA 3T1YB 1PL7A 2NYVA 3AVTA 3OFJA 4J90A 1C4KA 2D5IA 2H65A 4I2VA 3K09A 4L9WA 4AZ3A 1H05A 3R0ZA 3GGJA 4HDKA 4W9NC 2WUVA 3AF1A 3SC4A 4MKXA 2AFIE 3K15A 2X8AA 3SS9X 721PA 2HIMA 3PTLA 1AKRA 3F6EX 4N3AA 2RHTA 4FIZA 3ZVLA 4I8IA 5I01A 1PR3A 5G3YA 2IVZA 4BFZA 4EYQA 4RIHA 1ECPA 4AUEA 3A3PA 1ZJZA 3SICE 3SFZA 1R8SA 4UVHA 3IBCA 3RFTA 4J16A 3BD9A 4RMJA 3COWA 3FRHA 3RG8A 3U60B 1EBFA 1JSRA 4MP6A 4NCHA 5J59A 3VKHA 3FPKA 3OEWA 4YNBA 1WABA 5E1MA 5JCZA 1TTTA 1OX4A 2D54A 3TZQA 4E4RA 2XCIA 3IP9A 3A1FA 4HMQA 3TN7A 4ITUA 1T91A 1E1QD 2B37A 1PEDA 3SLKA 1I7PA 4DA0A 1U2ZA 3ZGXA 1RS0A 2IYPA 1E1NA 3BILA 3IE2A 1BGVA 4IZOA 1NONA 1IMJA 2Z2YA 4QHSA 2JEOA 4UTNA 1MQAA 2HYIC 1A4RA 3OTWA 4RZ2A 1E99A 1XTVA 3W8DA 4D45A 3HTXA 2P5TB 5E2BA 1LH0A 3L01A 4FCTA 1DNPA 4DSZA 5F3RA 1VDZA 5LMUB 4KN6A 3TGLA 1XTJA 2Q9BA 1GA1A 3DP9A 2WJWA 3C3EA 3C5CA 5B37A 1H3EA 2JGLA 1W85A 4BNDA 3S2EA 2UZ1B 5T6BA 2YMQA 1U0BB 3D6NB 2WAYA 5B3JA 3N70A 4FDAA 1KO7A 4LX8A 5IN5A 3AUUA 2FPXA 5K4GA 3MTIA 5EZ5A 1CS0A 2EXXA 3MWEA 4G0XA 3Q72A 3KKKA 4PWYA 5B58T 5JRZA 3FZQA 4UZEA 2JFQA 1T9CA 1LV8A 1J20A 2ZIVB 3X3HA 1WMSA 4K26A 3DKIA 5LD2B 3Q7SA 2CVOA 3BZUA 5HKOA 1PTJC 4P32A 4ZVTA 5BR8B 2I7TA 4GYWA 1EGAA 1RJGA 3QUBA 3HCOA 3R7FA 5DN6A 3VA7A 1QQBA 4LXYA 1EJ0A 1B8OA 2E3JA 3QJYA 2GN6A 5DM4A 3T1TA 1TW2A 4TTSA 1NQXA 1RDFA 5I5GA 5FO0A 4NBRA 4J49A 5GONB 2ACEA 2J9FA 5C2JB 5HX7A 3VPDA 2ZUWA 3HCRA 3P71T 5AHKA 2IH5A 3EEBA 3U3ZA 2OAQ1 2AFHB 1BE6A 4EPVA 3BHNA 2C20A 2O3JA 4PHFA 3DFZA 5COAA 3W5BA 4IH1A 1SNYA 4WOBA 4PN3A 5LVAA 1W96A 3CVOA 4BY9E 1X80A 4CEIB 4ZVNA 4CR6A 3H3JA 2HCFA 2Q3BA 4YCLA 2F64A 4BO1A 5AW6A 5DLQC 3WYFA 4WK2B 3T4XA 2H1RA 4F7DA 1JQ5A 3H75A 1K63A 1NQOA 5B64A 1KRWA 4ON9A 4YHHB 1JIVA 1JSZA 2BGMA 1QVWA 1T3GA 5IZCC 1ICEA 1KQNA 4L2IB 5T4FA 3GWGA 3EA4A 3B38A 4LAFA 4GICA 4RK7A 2H18A 3CUWA 3VZDA 1IDOA 4B5KA 4OYRA 4UTPA 4IUCS 2O07A 4A2CA 4NZZA 5TMEA 3GAMA 4MHTA 5F7XA 2UVDA 2X8JA 4FB4A 3QX9A 4R2XA 5K6RA 3DLPX 3VNBA 1BVHA 3B2EA 3L43A 2ZB4A 3EG9A 4P5PA 1JHPA 3AFNA 1LJ8A 5J43A 3R6TA 3WBFA 1XL0A 3TCXB 1ZR2A 2O4UX 2JIZD 2NVWA 2XUPA 3OA0A 3QXHA 2XADA 1Z74A 1MAWA 2P9ZA 1NMEA 4LQDA 5LYYA 2P2NA 3R77A 1SCQA 2WQZA 4AMGA 4YPOA 1QJ4A 2FUEA 5J4LA 1MOSA 2P77A 1VHJA 3IB3A 1NFRA 1RBYA 3UJ9A 3A25A 1QYCA 1ZM2A 3GMTA 4QPJC 3USCS 5TJHA 4DLRA 4PG7A 4B7AA 5M2QA 5A4IS 3EK2A 2WYOA 3L1VA 4LY6A 2HPZA 2AUMA 3COSA 3AKCA 3O8OA 4HOYA 4JP8A 2H4ZA 1HO3A 3U48A 5GZ3A 3GZNA 3X1MA 4EI7A 3AW9A 4EY7A 4Q37A 5CCDA 3TTWA 2NQTA 3OC0A 4A92A 2B2NA 4IDNA 4RIFA 1G5QA 3DB2A 4GHWA 1QJCA 1YZGA 2WJHA 4I2NA 4QZVA 4UZFA 3A1DA 4EAAA 1CY2A 1BE0A 1PL0A 2Q5QA 3E1GA 4KGZA 5EVCA 3RARA 4JOCA 5LP6C 4LTMA 1B15A 5L9AA 2OBNA 2QVXX 3MUOA 3LVBA 4U39A 1BWPA 1CQPA 4ZOBA 4B3RB 3QF7A 4WBNB 3FOEC 4NCIA 3K7EA 5K2MA 1SXPA 1U7PA 3OOSA 4R7ZA 1OB5A 4ETNA 3G8BA 3N86A 3EVZA 2H54A 3O47A 4IZIA 3UIEA 5C8YF 1Z5GA 1Z9BA 4RTRA 1HNWB 3MUNA 1QQ5A 5A9TA 4KR3A 2RGYA 3HM9A 2PRZA 1K6MA 4FXPA 2H5EA 2JFGA 2WK1A 3EY9A 4BGUA 5CFLA 3L7LA 2ZWMA 3F1KA 2F9LA 3MMNA 2GD6A 2D8AA 1XCLA 1RLIA 1X8LA 3P4XA 2JW5A 3HL4A 3UHPA 5ITSA 1NVMB 3ICQB 4ZEOA 5GV7A 2PLFA 4UUNA 3SJUA 3MTEA 1AZTA 5EXXA 4UJ5A 4HWOA 4F8JA 5MN6A 4HAUA 1Z6AA 2XOEA 5CNKA 4HGNA 3L4BA 2BGRA 4O5AA 2IA5A 1Z3CA 4GI7A 1RZRA 3LY5A 2LWIA 2ZUSA 3QPUA 4KDFA 4LW8A 4Y6SA 5IN4A 3O4JA 1KZ6A 3O4VA 3B8HA 1DAPA 3L8EA 2ZB2A 3ZV6A 3IRUA 3I6MA 1XD8A 4BGIA 4US1R 3DFMA 2YXLA 2O3RA 3HU5A 2V4UA 5A7HA 3RV4A 4D97A 3E3AA 3RSGA 2H0QA 1O95D 4OK6A 1P75A 4X85A 2VHEA 1PX0A 2Q2OA 4LBZA 3KLMX 3M2PA 1VI5A 2W4QA 5LP6B 1A5TA 4UCXA 2WAOA 3AF2A 4QPCA 1M2KA 4QRDA 4RX1A 1YBVA 4I9HA 1OB2A 2X41A 3W1EA 4G9GA 4ZOQI 2IX9A 3JALA 1KP2A 3VKGA 4PSKA 1CJMA 2QMHA 4OHWA 2QLTA 1ZW1A 2M32A 4EAQA 4PLYA 4OHPA 3EXG1 1O89A 2PKQO 5B12A 1XXHE 4D8UA 4L6AA 3ASYA 4UE3S 4G5RA 2GB4A 3GEEA 1JEYA 4OQ4A 4CMEC 1GT6A 2A88A 1GPLA 1PE0A 2VT6A 2VI5A 3EC1A 4I5DA 4NBUA 3SX0A 1EKXA 1NE7A 3FMGA 3PDCA 3WTBA 2E89A 2RAUA 2IS6A 5DX1A 3ER6A 5HF9A 2Q29A 1JIUA 3GX1A 4KHPB 1CP2A 4NZ9A 3SQLA 4O6VA 1FVOA 3P9RA 4I4IA 3OURA 3ZDXB 1GM5A 3DEHA 4XWOA 4YCMA 3IMFA 4PXSA 3TDMA 2FR1A 2CSUA 3F78A 4IIJA 4QUJA 1PFQA 2AJ8A 2JZCA 2L18A 2SKDA 3U7QB 1FRVA 1MD9A 4AP9A 5A3RA 1GQSA 5DBOA 4IIFA 4Z3KA 1G20B 2QPLA 5DHQA 2IYVA 2FPMA 3A32A 2OQVA 1U2PA 1I7DA 3RG2A 1VLLA 2D8MA 3TL3A 5CYOA 3FBWA 4MPDA 4C0WA 1FFXA 4JR0A 2PD6A 4YCBA 1I6LA 4R8LA 4C9BA 1MFZA 2EYQA 4ZKEA 2EATA 1N78A 2WPNA 5DGXA 1CUBA 1I7LA 4HNQA 5DN6D 2NO9A 1JDZA 1YTLA 3E0QA 4UEKA 3SFVA 4IS3A 1U31A 1RMTA 2QX7A 3ADCA 3IALA 3ZLVA 3OZSA 1K2WA 4ISBA 2H2GA 1O2DA 3TL2A 1LBSA 4ALMA 4YRIA 5K0EA 2OORC 3I6BA 5G1OA 1BVUA 4CE6A 5CD9A 1DBPA 3B5IA 2W70A 4E12A 1LU9A 4JBNA 4FFOA 3X1XA 3QYAA 5CNIA 4B6FA 3BPSA 3IODA 1PJSA 1GV0A 5CT6A 3ZWQA 1G2PA 3NHYA 2FYTA 4AYTA 5FNVF 3C6XA 4MUHA 1NMSA 2UZAA 4GM1A 1F6DA 4OH1A 1UL1X 3E84A 3A2MA 3UFXA 5C5IA 1IHUA 4CKBA 4P86A 1QCCA 4K9OA 2AHRA 3GLRA 1HEIA 3TQIA 4PSUA 5HZHA 4M60A 3GLVA 3BERA 2ZJZA 1CKEA 2MINA 3LHFA 1O4WA 1A50B 2YQ4A 1DAOA 3HXOA 2IUFA 3AP1A 3R8CA 4DWJA 2QENA 5I7UA 3MCUA 1ICIA 3EPLA 4N0EA 4ER5A 4MLZA 3I37X 1W0CA 1WSDA 3R4CA 5KKCA 3AXTA 1PUIA 2MU1A 1D6NA 3HKDA 1SXJB 2QD5A 5E4FA 3PLAE 4ZD6A 3AETB 2ZPTX 1E1KA 2OQIA 5C3MA 4EH1A 2FF7A 2IF2A 5H3CA 1KZ4A 4TXLA 1C9JA 1L7XA 2BFEB 3RB8A 4MUEA 1E94E 1WV0A 3IXQA 4PY2A 4EZEA 5CIYA 1GG2A 3DT6A 1BC5A 4WA7A 4F9GA 4JYMA 1NVWQ 4FMCF 3X44A 3HN7A 1Y3HA 1QFZA 1VJ0A 4EDHA 2V9ZA 1ULBA 5IYZF 5JXJA 1OT5A 1SZDA 3G17A 1S0UA 4GI5A 1N1GA 3DVSX 4N0DA 3LUBA 4RU1A 1KMHA 2B5VA 1XK6A 5LQRA 1UFRA 1L7QA 3M6IA 2IWHA 3G9XA 3U3JA 5EIXA 1QFSA 2W6MA 1A8HA 3OY2A 2HU7A 2N9UA 4PVCA 2R66A 3SXUB 2JHCA 4CMEA 1IY1A 2V7QD 3C24A 4WK0B 1QV7A 3CBGA 5HNKA 1TAGA 2OHXA 3R3XA 1ZBDA 3A9VA 3EF0A 4JL5A 1AU9A 4KIGA 5G1PA 3FHCB 3O3NB 4RM3A 1VL8A 3E22A 2J31A 2W2PA 4ND5A 1SFRA 4RNCA 3NVDA 1W44A 2Z04A 2ZM5A 1AKTA 3PU6A 4LXTA 4WZBB 2J09A 4ATNA 2N0SA 4CN8A 1C8VB 2OVFA 4H1WA 1GRNA 1OX5A 1WCV1 2JFUA 3NV7A 2I87A 4G0VA 4NATA 4B4DA 4N8SA 3ZIUA 3MSXA 2IYRA 3GFSA 4X90A 3OCJA 2HTEA 3C43A 3V8NA 3DLHA 5L3SA 3EIEA 4EWLA 1VMIA 2R1TB 2AMYA 5CCXA 2CDRA 4JBIA 4QDJA 3RVPA 4EG4A 2ORYA 2BEWA 3D6HA 2WSBA 2WFZA 3KJEA 4TL7A 4P4GA 5JYEA 5CG2A 5HJ5A 3V2HA 1V16A 4KSBA 4EEZA 4KN8A 3IIIA 4CVNA 3NU1A 3AI2A 2JEYA 3BGOS 2CHGA 3IEPA 3B5JA 1PEAA 4P22A 4REOA 1CJBA 1PR0A 2DBZA 2R7MA 4XD2A 1KE2A 4M9UA 4X8LA 3RK1A 1TZKA 1ZL2A 2GO1A 2XD9A 3E22B 4WDRA 3TRIA 1OQAA 3RU9A 2HL6A 1ZSYA 4LJ9A 5IKXA 4BX9A 3NNDA 3AZOA 1X9IA 2EV9A 1IDN1 2RCNA 2RJOA 5CFOA 2E4ZA 1A9ZA 2J3QA 2HHAA 3FWNA 4H3KB 4D9NA 2P4SA 2WT9A 3WWCA 1RPAA 4G0YA 4LMRA 4FFDA 4XPZA 1QE3A 1Y5NA 4JLJA 2NTJA 2Y6UA 1G7CA 4DNOA 2VRCD 2I29A 5DXAA 4ZZ2A 5KNBA 1LQ2A 3GLGA 3ZWOA 4QO7A 4Q4HB 3ZXYA 2FPIA 2F3TA 1S1MA 2YFYA 3PJDA 3HJFA 1F2UB 4U7GA 1FRFS 3JR3A 3T35A 4UDXX 4E6PA 1A82A 3NWJA 3U6BA 4J7AA 1FSFA 1QVAA 2BP7B 2G07A 4LXXA 1V9CA 1K8QA 2FPUA 2ENWA 2IH4A 1T6XA 2IOHA 5H1YA 3Q8WA 4YAOA 4HPWA 4V0RA 5SZIA 2DJIA 2J41A 1TK9A 3OZTA 1R9GA 2R5NA 4HCJA 1U3VA 3V1TC 1UODA 2I67A 9LDBA 2Q7XA 4JNCA 5L40A 4GNRA 3QMWA 1VSTA 2H11A 3OIVA 1IMOA 1L2TA 3LPLA 4NENA 2J3DA 1J21A 1JEEA 2J4DA 2XIQA 1ZEJA 4WNCA 1Z07A 4HTFA 3I72A 5IJ0B 4F2HA 3WOHA 2BMDA 2A3NA 1FYXA 1D4OA 3PPXA 1VMKA 2FX3A 4NULA 5FLEX 2ZJFA 4E2XA 4OX9Y 3W04A 2BYTA 4C5BA 2QX9A 3CF4G 4OSOA 1R5BA 3QJ5A 1X1QA 4X7RA 5TE9A 1IXZA 4BMPB 4U7FA 2D1RA 1KFEB 4AJHA 1NC1A 3KQUA 1AE1A 2XDQA 2PAAA 1M9NA 3ND9A 3UA4A 4BJ6A 3U3OA 4MARA 3CCBA 5HRAA 2DVMA 1A1VA 1A76A 1M75A 4XASA 2GYUA 3ZOKA 2VIIA 3SHVA 1U0HC 1USWA 3CJQA 2VKTA 5M34A 2Q5LA 3H8JA 3H6KA 3OBBA 5EL0A 4YR9A 4D0LB 3DAFA 4WY8A 1YB5A 1JLHA 2WD7B 2IOFK 1OH7A 3CONA 5DGTA 4BBAA 3U44A 3WG9A 1WXXA 2IP1A 1JDJA 1KF0A 2ZWAA 3FMPB 2QL9A 1HTWA 1M76A 1WSAA 1OWPA 1VBFA 3QKRA 1DUIA 3HHEA 1ISSA 3FFXA 3R3SA 5TPZD 3ZS9A 1YSCA 5CDYA 4XVRA 1ZCZA 2AZMA 2QD4A 2XYPA 2JFBA 2CXUA 3IV6A 4M1ZA 1E7SA 3B1XA 2XBLA 3LO8A 1N6OA 1K3FA 2XWBF 2A1UA 4MAMA 5B57C 5I47A 3ONEA 4RK1A 4HZUB 1G0NA 2FZ4A 3M6FA 3LXXA 4XQGA 3SG0A 5CA1F 3INRA 5HIMA 1AHIA 1IZ8A 4A5OA 3R8XA 3VFDA 5HRUA 3GLHA 2X3UA 4S0ZA 2W37A 1UWCA 5C81A 1SD5A 5DCLA 3TTTA 2SCUA 2MOKA 2PZFA 2V6BA 2XLBA 5FAXA 3MTJA 4ZYXA 4XDHA 4O1HA 5CT9A 4DNXA 1HDXA 1E2DA 1X2EA 2AG1A 3AHEA 3IQWA 4K5QA 4V38A 3G0DA 1ZD2P 3LRPA 3E58A 1AF4A 1PHPA 5L4LA 1D4ZA 4OHXA 1Y34E 4X1IB 2FUG1 5D3ZA 4I55B 1UK8A 2P91A 5C18A 1EWTA 4AS3A 2DUJA 5IEJA 2GK7A 4OK5A 4W5HA 3G0HA 1QC5A 4ZU1X 5KYYA 3UT0A 5K8JB 2GVZC 3IC5A 4R8RA 1D9XA 1MJGA 1SKBA 1MAVA 1K6XA 1PTJA 1V8PA 4W5NA 1ZGZA 4DRXB 1AV7A 1P2VA 4MKFA 3NKVA 1KPHA 1AKEA 4RZ3A 2X1VA 2FLVA 3UF0A 4YT2A 1SUDA 4JYAB 4I4TA 1JR6A 1G7RA 1O1YA 1P61B 1TYCA 3FNEA 3H5VA 4UKDA 1PVDA 5JEDA 4OL0A 2RDMA 5IK2D 4EENA 2BFFB 2QTBA 3HP4A 4X20B 4A8JB 3TPZA 5J58A 1TTQB 2AKEA 1TVKA 3BWVA 3I53A 2PQ2A 1KR5A 3I2JA 3CZ9A 5I9TA 1CJVC 3OQNA 4IQ8A 3OU6A 3K2QA 2NUPB 3K1JA 3RS0A 3UB2A 1TA0A 4FK8A 2AMJA 3ZLBA 3GLQA 1ATIA 3C4VA 3KHKA 2HSWA 3FWPA 4KCGA 4C4SA 1D2NA 2BFBA 3ICVA 3IQZA 5C7IO 1JSLA 3HLYA 1GGMA 4NTZA 4W7SA 1L3IA 1JR3E 1PWZA 1XNHA 3PKJA 3PUKA 4JLMA 4RTPA 1Q83A 4KP7A 3UC9A 1VSVA 4NXMB 1PJAA 4DCNA 5KU7A 4B3TB 4BNYA 2WVAA 1XOIA 2JKVA 3U4QB 1PLJA 2SHKA 2WFMA 2WQ7A 5KTTA 4PX9A 2BFOA 1G4AE 1S2GA 4G1MB 1LPSA 2WJYA 1SKYB 3OQVA 1QHFA 2PTHA 2VJMB 1H2FA 4PRYA 4D3ZA 1MT3A 3ZYCA 3KSUA 1HQDA 1AQIA 4QARA 3V80A 3VR2A 4R1TA 1J2TA 2VTDA 4DLVA 1K9VF 1Q1NA 3VBEA 4PYLA 5EMLA 1K1EA 1UXJA 3DUFA 3STXA 2PG3A 4QOFA 4URHA 2IIPA 3T0FA 3D43A 3R0VA 2AG5A 4V3CA 3ELWA 4DZTA 5LM3A 4N5IX 5AKHA 2X19A 1RFGE 1XMSA 3MRSA 3ZNNA 1R64A 2GKOA 1QRAA 5BWBA 3S1SA 1QGUB 3IAS6 2BRUA 4C7MA 4L4YA 2BM1A 3LA8A 4ZOLF 3WL5A 4OB8A 3ZZUA 4EW3A 3CMCO 3GAZA 4G8CA 1XT6A 1HYBA 3TRFA 5PGMA 2VUUA 1XDBA 4ECEA 1VHDA 3M1YA 3QLVA 2OO5A 4TV8F 4YY3B 2RHLA 1T5SA 3X2EA 3HYLA 1H1DA 2KLHA 1UZUA 3QMPA 4MW7A 4FI3F 3IJ5A 1ZMRA 3QVOA 1J09A 3R24A 3TM4A 2DTXA 2JCSA 1L4FA 4LCJA 2J0SA 2JLSA 5EYPA 4V0ME 1T9ZA 4FPXA 4LQLA 1NX6A 1Y9JA 4BFLA 4BCBA 1QDEA 2F3RA 2Y05A 1TECE 3LPDA 3CPJB 1Z5UA 2C3UA 1B3BA 3DUFB 4A8JC 2YNMA 4MI1A 2G5GX 3AEQB 3DLCA 4HPXB 3ZKAA 3BXGA 3Q2KA 4J0JA 2X6QA 3EA5A 4P0TA 4HJRA 4GR9A 4YAKA 2AOUA 2GNPA 2ZIZA 3BC1A 3EMBA 4EGFA 2RGXA 4CL8A 1OU4A 2XRFA 1OWOA 2PRJA 1FUIA 4UARA 2V1XA 4K46A 3EOAI 3HWSA 5E8JA 1EMDA 3KU1A 2C3OA 4FGZA 1F0NA 3U6KA 3R9XB 1BW9A 3KSDO 1TA4A 3R44A 1GKIA 3U49A 3I9NA 3UY4A 2FAXA 2PSFA 3UBTA 3R40A 2QLNA 4B79A 1KA9H 4FS8A 1P5RA 2GAJA 4IVQA 4DMFA 4Q21A 2EJBA 4ETMA 4O0LA 1WCIB 2A6PA 4M9RA 3V8EA 1NATA 3BVPA 3QIAA 5JZ9A 1AX9A 2ZYGA 3L8GA 5F2EA 1KSFX 3FCAA 4K2AA 4QGHA 3M9WA 3ZXIA 4KRXA 3VAZA 4EBFA 4HGPA 3NETA 2IS2A 3O73A 4UMDA 2V74B 1M6YA 2Z6VA 3OHSX 1L5GB 4LE1A 1JDUA 3AF6A 1FMFA 4ZIRA 4FT4A 2QTGA 3TECE 3KXIA 3GDHA 4TV9A 1BHSA 2C5SA 2V0NA 3VR4A 821PA 4LV6A 1QQAA 1COZA 3MJCA 2DBRA 4PC7A 1A71A 2YOFA 2AZTA 1V3UA 4R40A 3TNLA 4WBNF 5KI6A 2DWUA 4HK4A 1JL3A 1YUMA 1SVIA 3AHDA 1U9JA 3H1BA 4ONEA 4TSKA 3KTAB 3VHRA 2VP0A 3GFQA 3R5JA 5EIWA 1O6FA 1J42A 1QKIA 1QMGA 4IO0A 3W5SA 1EDEA 4DRXA 2C98A 3JZIA 2R4UA 3HZHA 1EIZA 1KQPA 3NX4A 4BP3A 2PD3A 3IHLA 4PC3A 2BHNA 4BV9A 1I2ZA 3OFNA 4OM7A 3I04M 2ECQA 4ZI7A 1E20A 5KOYA 2Q1XA 2C4MA 2HA0A 1ZJWA 4RQBA 5C8YB 5GONA 1U4NA 5JAPA 1BS1A 4C1BA 4UFPA 1BD4A 2ZTMA 2M1XA 1P2DA 2J0VA 1PEKE 2COEA 3CEPB 3GU3A 3HCFA 4LC1A 2G1KA 1KC3A 4Q7EA 4TMFA 4GE3A 3EF3A 5D3KA 1BMQA 2DHQA 3CGWA 2ATIA 3B36A 4G1CA 5CHEA 3RFUA 3SC6A 2C9CA 3PFNA 3GIDA 3P20A 1IVYA 2JFZA 5K0ZA 1GKKA 4CMGA 1DAHA 1OLSA 3KFVA 4JJEA 4NU8X 1MX5A 2W90A 3D0KA 5DK6A 5C5CA 1OYYA 2UYHA 4W1RA 4MYHA 2ZUTA 2V3WA 1KS9A 2AK2A 3AB7A 1XN1A 3PEEA 3L46A 3OO1A 4AO7A 1NVAA 5CTJA 4E6EA 1FSGA 1I6WA 5D85A 2I1VB 2JGNA 3MJVA 2YOHA 5ALYA 5KYXB 5IAKA 3JVDA 1LDYA 1PFYA 4HVTA 1TZCA 1QYIA 4XYBA 1H2AS 2HXYA 2OFOA 3E9MA 4P7JA 4E33A 1ETHA 1THMA 2LIPA 4ESHA 1X1EA 3UO8B 2V3CC 1UFOA 4E5YA 3ETHA 4CCAA 1N34B 4MI9A 4XGQA 3NHPA 2YFQA 1ML3A 3TLZA 4QUKA 3FVWA 1M8FA 3NI2A 2RGDA 3L8HA 3SF8A 1VLHA 2POCA 4CM6A 1TIPA 2ETXA 3TIVA 5A4AA 4IQGA 3WJ2A 4ESVA 4KLAA 4PHCA 5IM4F 3MLEA 4MYSA 3JAWB 2O4CA 2QRMA 1YBMA 2VBFA 3SQMA 4A4DA 1AY0A 1T5TA 1C7QA 3FKJA 3UHOA 4OU5A 1KS2A 1Q3KA 2NVUB 2E87A 3AJRA 5CH8A 1B23P 4MB6A 4M7PA 4WFKA 4A15A 1Z2NX 1PL8A 1FSSA 4PQGA 4F3TA 2FK8A 1NN0A 4WFIA 2NZVG 4UM9D 3GJZA 2PY6A 1R5JA 4TL8A 3K3PA 5ALNA 1UFVA 4G4SP 4HQOA 3TNFA 3VO9A 4C20A 3UMRA 2H52A 1XZBA 4BEJA 1IG0A 1OVGA 1RYNA 2GS9A 4NDNE 1V8FA 4XOIA 2HRBA 3PDHA 3GJRA 3BH6A 2OYCA 4KAJA 2A9KA 5BRNA 1ZJ4A 2E6KA 4AXXA 3A9TA 1YVPA 8ADHA 1U9ZA 2UYYA 1N25A 4M98A 2AN4A 2PGOA 1G8JA 2HLHA 2PRIA 1QKKA 1QO9A 1SULA 2B1QA 3B3GA 3JAWA 2QM0A 3GK3A 1CQIB 4RM2A 3WHIA 4DDMA 1QX4A 1ESDA 5J2TB 1R4NB 3MNFA 5J1TB 3H1PA 4DT1A 4IDPA 4KK3A 1M1XB 2P79A 4LE0A 1Z68A 1KJWA 2P3LA 3I76A 3M5WA 4LZLA 3D7MA 5E1DA 3HXTA 3CLUC 2G0AA 2I8AA 3UJ3X 4DSTA 1GQRA 3CLRC 2QN8A 2FMUA 4DS3A 1B6RA 1C1XA 3QF4B 2VAWA 4RMNA 2HIGA 3HA7A 3KOOA 4PC1A 4NE7A 2FPRA 3GVPA 2VHCA 3ZU2A 2Y76A 3H0CA 3O2SB 2YXBA 2DLCX 2XCSB 1QF6A 3K5WA 1BVYF 1Y89A 3UICA 4WKGA 3WTCA 3E7DA 5JZVA 4D6XA 2C9MA 2ZRMA 4HZIA 3AFGA 1ONSA 3TSWA 4DBVO 1A7AA 3IEUA 1SOUA 4P0QB 3H7AA 2FJ0A 3JX9A 1PYOA 1USUA 4KV9A 4TQUS 4YBRA 4KWTA 3C4QA 1P73A 4D79A 1DG3A 1U1CA 2PIAA 1CU1A 5TB5A 4HYYA 1ZOOA 1O5TA 1SO8A 1V16B 1C3LA 1ZNXA 3E5NA 3JQBC 4CCYA 5IYZA 4LRUA 1ZWLA 3AYXB 2HJ9A 3FHOA 3GG9A 3DVAA 5B2FA 3UTDA 3R9XA 2Q3LA 1JHXA 4DARA 4XJTA 4D3FA 5AT1A 4OQZA 1XMQB 1N5MA 1T13A 3HLTA 2X58A 2XODA 2XKKA 4PIVA 2VWPA 2JI8A 1KR2A 4W6QA 3HE3A 4DVGA 1KEEB 5BURA 1WW2A 1FVFA 4QYIB 4V0OA 4DIBA 2AFIB 3PHBE 2A1TR 2JLBA 4GBED 4J7CA 4XYGA 5K0LA 3WYCA 1C9MA 2J9ZB 3E3MA 4PZ9A 4CR8A 1D5WA 1MJFA 2H2WA 3PGMA 4TZTA 1XRSB 3RSSA 3ZWYA 4Q3AA 3RO7A 4EW6A 2BMEA 2FZWA 4KXLA 3MUFA 4KVFA 5AW4A 3KWMA 2NZ2A 3QOWA 4YMHA 4P0PB 4ZOLB 4FZ3A 1C5KA 2C7BA 2LW7A 4FOSA 1GDDA 2BSXA 4CRWB 2HQOA 4M9QA 1TZ2A 4N41A 4UOQA 5ITVA 2AR7A 5DMHA 2ABWA 2HK8A 3EXEB 3C1UA 5KYNA 1NXXA 2OGWA 1HE3A 1SXJA 2X5XA 3LX8A 1VOTA 1WCYA 2DPYA 2ZRNA 4G63A 4Z3DA 1VZ3A 1QHEA 2GHRA 5AOVA 4YJ3A 4B3XA 3OX1A 4IJVA 3PD0A 2NZ8A 3O7WA 2NO6A 3H1TA 4RJLA 2IQIA 5EJ2A 2A9QA 1WULS 3H2IA 4QDOA 4WNAB 2AN9A 2VNHA 2I2BA 5CVEA 5FFMA 1PBTA 1QG4A 1YDFA 3LCUA 4DPKA 4EPXA 1M3SA