2OVAA

X-ray structure of human complement protein c8gamma y83w mutant
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
171
structure length
164
Chain Sequence
ASPISTIQPKANFDAQQFAGTWLLVAVGSAARRAEATTLHVAPQGTAMAVSTFRKLDGICWQVRQLWGDTGVLGRFLLQARGARGAVHVVVAETDYQSFAVLYLERAGQLSVKLYARSLPVSDSVLSGFEQRVQEAHLTEDQIFYFPKYGFCEAADQFHVLDEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural features of the ligand binding site on human complement protein C8gamma: A member of the lipocalin family
pubmed doi rcsb
molecule keywords Complement component 8, gamma polypeptide
molecule tags Transport protein,ligand binding protein
source organism Homo sapiens
total genus 36
structure length 164
sequence length 171
ec nomenclature
pdb deposition date 2007-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00061 Lipocalin Lipocalin / cytosolic fatty-acid binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 2ovaA00
2JU7A 3OJYC 4A60A 1GT4A 2A3FX 2ASNX 3FR4A 3AKMA 1T8VA 3NX2A 1A57A 2OZQA 4CK4A 4AZRA 5EEEA 1BJ7A 1PMPA 2ANSA 1DFVA 1JYDA 2Q2PA 3S26A 5KHPA 3C77X 2RA6A 1JZUA 1YWBA 3B2JA 4ORSA 4GNWA 4ORXA 4DQ4A 1NP1A 3Q6LA 1YIVA 1X8UA 2QO6A 1KQWA 5IO5A 2CM4A 3VG3A 1BRPA 2P8GA 3FA7A 1B0OA 3B2KA 4MVKA 2Q39A 3BDRA 4YGGA 1QFTA 1D2UA 1GGLA 1U17A 4AZPA 3TGBA 1G74A 4XMCA 1OBUA 4ORYA 4YDAA 4YFQA 2NNEA 4LZUA 1YWAA 1ML7A 3UEWA 3FA8A 4IB8A 5H9AA 3PP6A 3NQ3A 1OEJA 2AKQA 4ZHGA 3IFBA 2ACOA 2G78A 3WJGA 3P6EA 1VYFA 4HPDA 1OEEA 1O1UA 4OMWA 4ZHFA 3BU9A 1LFOA 2R73A 1IFBA 2GTFX 2WUTA 3B2IA 4RUUA 3SAOA 5EEDA 3UEUA 5LJBA 4GETA 1EPBA 4HFOA 1SXUA 4N7CA 3APVA 1EALA 1DZPA 3RZYA 4Y0PA 5H8TA 4ZHDA 2RD7C 3WVMA 1QWDA 2A0AA 1I04A 5HCEC 3BSZE 5LJDA 1GT3A 3RSWA 3VG4A 1TVQA 4XMHA 1KZXA 4O9SA 4EDEA 5H9KA 5LJGA 5K06A 2NNQA 3P6HA 4KIIA 1E5PA 3FLLA 3WJEA 5AQ6A 3MBTA 4NLIA 3NX1A 4UU2A 3PECA 1EIOA 1QY1A 1KOIA 3BRNA 3WXQA 3B2HA 3FR5A 2ALLX 3WJFA 1GT5A 1MUPA 1X8QA 1TOWA 3FEKA 1NP4A 5F7GA 2RCTA 2FS7A 3HWFA 1X8NA 4RUNA 2MM3A 3ELZA 3I0AA 4NNTA 1CJ5A 5D4AA 4BVMA 1BEBA 1ACDA 4LZVA 5F58A 5HTDA 2JU8A 1ZNEA 3TZSA 2LKKA 2HNXA 2QM9A 1XCAA 1HBQA 1YWDA 3K3LA 1U18A 1GXAA 1IIUA 1P6PA 2CBSA 3ZUOA 4PSQA 5BVTA 5CE4A 1I4UA 5D48A 5EDBA 4QGWA 1SXWA 1LPJA 3FA6A 2W2AA 1ALBA 5F6BA 2WWPA 4Y0SA 3CWKA 3D97A 5HCDC 4HPAA 2F73A 3P6DA 3BX8A 4TKJA 2LBVA 1QY2A 5B27A 5HZ5A 4QZUA 5HTEA 2QOSC 3NR3A 4D6AA 1X8OA 5D8JA 3WJCA 4YCHA 4ARHA 1OEKA 3HK1A 5EZ2A 4TLJA 5D45A 2EU7X 2K62A 3C76X 2Q2MA 3APUA 1YWCA 4TNNA 3P6GA 2CZTA 4GE1A 4IB9A 4NLJA 1LKEA 1SY1A 2JU3A 4LKPA 1GT1A 1FDQA 4NYRA 5H9NA 2KTDA 3ZUIA 1ERXA 2BLGA 4AZOA 1DZJA 1YP6A 4GNYA 1BWYA 2POAA 2N93A 4AW8A 1OPBA 5H9LA 2R74A 2AH7X 4ZHCA 5LKEA 4TJZA 2Q4NA 1PEEA 1JJXA 3FW5A 1QFVA 4AZNA 5HCCC 1RBPA 1X71A 5F1EA 1RLBE 3STNA 1GKAA 1IW2A 3KFGA 1DZKA 1LNMA 5LJKA 2CM9A 3PH5A 1BM5A 3PPTA 1HBPA 1OBPA 3KZAA 1FEMA 2FLJA 4WFUA 4ZHHA 3WJBA 2WR6A 4IMOA 2G79A 2HZQA 1LIEA 2OVDA 4HPCA 2AT3X 2RCQA 2WEXA 3D96A 5HZ6A 1OPAA 3GAQA 2DM5A 4ORUA 1CBIA 4ALBA 3IA8A 2AL0X 3EYCA 4A8ZA 4UU3A 1ZNDA 4MVLA 4ZGUA 1ERBA 2L9CA 1CRBA 2LFOA 1E06A 3CBSA 2WEWA 1G85A 1TOUA 2NP1A 4QAEA 1O8VA 3CBCA 1LIFA 2IFBA 2X46A 3FIQA 4EFGA 3FEPA 4ES7A 3QKGA 3APWA 1ZNGA 1T68X 4OMXA 3KFIA 1FE3A 3ELXA 2MO5A 2HMBA 1S2PA 1H91A 3FA9A 4ZH6A 5HZQA 1HMRA 1BRQA 4N7DA 4TKBA 1VPRA 4GRJA 5L8IA 1JV4A 2OVAA 1IKEA 5DPQA 4BOEA 2RQ0A 4EXZA 1BSQA 1ADLA 4LKTA 3U9PC 5BVQA 4DQ3A 1ZNHA 1KT6A 1EW3A 5FENA 2K23A 2W2BA 1X89A 2CZUA 2FR2A 1QQSA 4BQUA 4Y0QA 4ODDA 3CMPA 1YUPA 5FAZA 3O2YA 1FELA 4WFVA 5C0NA 5KIDA 2XKLA 1I06A 5LJHA 3KFFA 2A13A 4XMEA 3U03A 4I9RA 2OVEA 3EMMA 3TGCA 1HQPA 3UEVA 4YGHA 1DC9A 5HA0A 1IFCA 1JJJA 2FRSA 1EXSA 1A2DA 1E02A 2CBRA 4QYPA 2GJ5A 1VYGA 4AZMA 1GKAB 1XKIA 3JSQA 4NNSA 5HBSA 1S44A 3G7XA 1N0SA 4IBAA 5L8OA 5L8NA 4WBKA 2JOZA 3L4RA 3D95A 1GX8A 1EQDA 3TF6A 4OS8A 5HWZA 2G7BA 4AZQA 1BSYA 1DF3A 1X8PA 2QO5A 2LB6A 3P6CA 4I3DA 2Q9SA 1EUOA 3VG2A 4TQ2A 1LICA 2AT8X 4XMFA 5IO6A 5LJEA 1T0VA 2HLVA 1GM6A 1KZWA 1MX7A 4AYHA 2HYSA 4IB6A 1QG5A 2OFRX 2FS6A 4D6BA 1DZMA 4IAXA 1KQXA 3NP1A 3KFHA 3VG5A 3FR2A 4IMNA 4ZJ0A 1ICNA 3FW4A 1SY0A 4XMGA 4YFRA 5B29A 3EBWA 3MVFA 1KT7A 1HN2A 4ORRA 3APXA 4ZR2A 3UEXA 1A3YA 1R0UA 1TXLA 3FELA 1YP7A 1CBSA 4QGXA 4ZH9A 1SA8A 3STKA 3BU1A 4M7MA 2YG2A 3NQ9A 2AT5X 1ZNKA 3NPOA 3NADA 1MX8A 4NYQA 2WQ9A 4Y0RA 4I9SA 1BLRA 4YH0A 1CBQA 1UREA 4IAWA 3BS2A 3DTQA 2O62A 1LF7A 4I3BA 1B8EA 5DG4A 4R0BA 2L67A 2MJIA 1SXYA 2FR3A 1B4MA 3HWGA 3AKNA 5EPQA 3FENA 1SXXA 4YKOA 2GC9A 4ALOA 1SY3A 4ZCBA 4YDBA 3CR6A 1O1VA 2WSJA 2PY1A 1LIDA 5F6ZA 3C78X 1IKJA 1HMTA 1ZNLA 3T1DA 2LBAA 4M6SA 3CQNA 4YBPA 3JS1A 3FMZA 2L5PA 4I3CA 5KICA 1BBPA 4IB7A 1AB0A 3TGAA 1G5WA 1B56A 2A2GA 2X45A 1TW4A 4OS0A 1KT5A 1U0XA 1QABE 5FFHA 4XMDA 3F9DA 2FT9A 2OFMX 1I05A 2AMMX 1KT4A 2JN3A 4QYNA 3DSZA 3PH6A 4QZTA 1EIIA 5EDCA 3STMX 2XSTA 5HZ9A 1Z24A 1NGLA 4HPBA 1MVGA 2HZRA 2W2FA 3P6FA 4OS3A 2ACPX 1OBQA 2L68A 3CQRA 1FTPA 1SY2A 2FTBA 3HWDA 3O22A 2FWVA 5JR8A 4NP1A 1ZRYA 1JBHA 1D3SA 1HMSA 2KT4B 4YCEA 3VG6A 4GKCA 1A18A 2E4JA 5IO7A 4YMYA 4YBUA 1LIBA 1MDCA 1AELA 4QGVA 1FENA 4A1YA 2QO4A 3ZQ3A 1AVGI 1E00A 4ORWA 1KT3A 1GX9A 1ICMA 2AT6X 3EBKA 4EEJA 4MVIA 1UZ2X 3WBGA 3PEDA 5HZ8A 1S7DA 3O19A 1AQBA 4YGZA 5D47A 2A2UA 1CBRA 3B2LA 1L6MA 2NNDA 5LKFA 4A1HA 3F8AA 1KXOA 1EPAA 5HAEA 3I17A 1KGLA 1JYJA 1PM1X 1QY0A 4YKMA 1DV9A 3VG7A 3BLGA 3BY0A 3HWEA 5HA1A 2WQAE 4GH7A 4ZFXA 5BVSA 3EM0A 3WJDA 4K19A 4TKHA 4YFPA 1PBOA 5LJCA 3BX7A 1BSOA 3KQ0A 2R56A 2AT0X 1G7NA 3U0DA
chains in the Genus database with same CATH superfamily
2JU7A 3OJYC 4A60A 1GT4A 2A3FX 2ASNX 2OY1O 3FR4A 3AKMA 1T8VA 3NX2A 2MHDA 2DJFA 2OZQA 4Z6JA 1A57A 3WZNA 4BGFA 4AZRA 5EEEA 4CK4A 1BJ7A 1PMPA 2ANSA 1DFVA 1JYDA 1NC9A 2Q2PA 3OD9A 3S26A 5KHPA 4CPHB 3C77X 4HWMA 3VHHA 2RA6A 4GDAA 4BX6B 1JZUA 1YWBA 3B2JA 4ORSA 2RTEB 2F09A 4GNWA 4ORXA 4DQ4A 1NP1A 3Q6LA 1YIVA 2DJGA 1AVEA 1X8UA 3UAQA 4NW4A 1RSUB 2QO6A 1KQWA 5IO5A 4C5PA 2CM4A 1SWUA 3VG3A 1BRPA 2P8GA 3WYQA 2OF9A 3FA7A 1B0OA 3B2KA 1MM9A 2Q39A 4MVKA 3NBXX 1HY2A 3BDRA 4ON1A 4YGGA 3SZHA 4KCAA 1QFTA 1VWHB 3VPJE 1D2UA 1GGLA 1U17A 2RTQB 4KT5A 2IZCB 4AZPA 4BX5A 3TGBA 1G74A 4XMCA 2BT9A 2M4LA 3S5VA 1OBUA 4ORYA 4YDAA 4YFQA 2NNEA 2A5BA 4GJVA 4LZUA 1NQMA 1YWAA 1ML7A 3UEWA 1VWRB 3FA8A 4Z2OA 1VWLB 3D9WA 4IB8A 5H9AA 2QMIA 4CSBA 3PP6A 3NQ3A 1OEJA 4INNA 2AKQA 4ZHGA 3IFBA 2ACOA 1JIWI 3T2XA 1WBIA 2G78A 3WJGA 3P6EA 1VYFA 4HPDA 1OEEA 1O1UA 4OMWA 1RXJA 2FGSA 1N9MA 1SWPA 4CPHA 4ZHFA 2FKGA 1SREA 3LTWA 2A8GA 2IZHB 3BU9A 1LFOA 2R73A 1IFBA 2GTFX 2MF6A 2WUTA 3B2IA 3CKFA 2X56A 4RUUA 5EEDA 3SAOA 4U46A 3UEUA 5LJBA 4GETA 1I78A 2FHNX 1EPBA 4HFOA 1SXUA 1N43A 2X34A 3APVA 4N7CA 1EALA 1DZPA 3RZYA 4Y0PA 3ZW1A 5K68A 5H8TA 4ZHDA 2RD7C 3WVMA 1QWDA 2A0AA 1I04A 5HCEC 3BSZE 1VWIB 5LJDA 1GT3A 2RTFB 3E3CA 1TVQA 3RSWA 3VG4A 1VWCB 5BYPA 4GD9A 4XMHA 1KZXA 2JMBA 2IZGB 4O9SA 1SWNA 4EDEA 1Y9LA 5H9KA 5LJGA 5K06A 2NNQA 3HOLA 3P6HA 4KIIA 1E5PA 3FLLA 3WJEA 5AJCA 5AQ6A 3MBTA 4NLIA 3NX1A 4UU2A 4I6SA 1EI5A 3PECA 2Y32A 1JJUA 1QY1A 1EIOA 1KOIA 4MVEA 4KH8A 3BRNA 4MEEA 3WXQA 4O4XA 3B2HA 3FR5A 3FDCA 2ALLX 4GGTA 3WJFA 1GT5A 1VWGB 5CHKA 4QNIA 1LDOA 1LELA 1X8QA 1MUPA 1TOWA 3FEKA 1RXKA 2OY8A 1NP4A 5F7GA 2RCTA 1KFFA 1OSPO 2FS7A 2WPUA 3F6ZB 3HWFA 1X8NA 3N91A 4RUNA 2MM3A 1Y53X 2AF5A 3ELZA 2IZAA 3I0AA 4NNTA 1CJ5A 5D4AA 4BVMA 1BEBA 5B5GA 1ACDA 4LZVA 1UYNX 5F58A 2JU8A 2GH7A 1ZNEA 4KC8A 5B2AO 2LKKA 3RY2A 5HTDA 2HNXA 3TZSA 2QM9A 1Y0GA 1XCAA 1HBQA 2BS5A 4O4SA 1YWDA 3K3LA 1U18A 1GXAA 3HTYA 2OL7A 1IIUA 1VWKB 1P6PA 2CBSA 3ZUOA 4PSQA 5BVTA 2X8SA 4EKVA 5CE4A 1I4UA 2UYWA 2RTHB 5B11O 4BX5B 5D48A 5EDBA 4QGWA 2FHLA 5B5FA 1SXWA 1LPJA 3FA6A 3VE2A 2W2AA 1ALBA 5F6BA 2WWPA 4MISA 3SLJA 4Y0SA 3CWKA 3D97A 1SLGB 5HCDC 4HPAA 1N7YA 2CAMA 2F73A 3P6DA 3BX8A 4TKJA 2LBVA 1QY2A 5B27A 1HXLA 4JNJA 4QZUA 5HZ5A 5HTEA 2QOSC 3NR3A 4D6AA 1SWDA 1X8OA 1RXHA 5D8JA 3WJCA 4YCHA 1HXZA 4ARHA 5K67A 1W6FA 1OEKA 3HK1A 5EZ2A 4TLJA 5D45A 2EU7X 2K62A 3C76X 2Q2MA 3APUA 1YWCA 4TNNA 1N9YA 2CZTA 3P6GA 4GE1A 4IB9A 1LKEA 1UYOX 4NLJA 1SY1A 2JU3A 3LV4A 1GT1A 1FDQA 4IRWA 4L3RA 4LKPA 4NYRA 4WHIA 5H9NA 2KTDA 3ZUIA 1ERXA 2BLGA 4AZOA 1DZJA 1YP6A 4GNYA 4OELA 4BBOA 2POAA 2N93A 3WZQA 1OPBA 4FBOA 5H9LA 2R74A 4AW8A 4TQ2A 2X8FA 2AH7X 3ZW1B 5IXGA 3RDOA 4ZHCA 5LKEA 4TJZA 2Q4NA 1PEEA 1JJXA 3FW5A 1QFVA 4AZNA 5HCCC 1RBPA 4ID2A 1X71A 5F1EA 1RLBE 3STNA 3ZZVA 5AEOA 4GK9A 1GKAA 1IW2A 3KFGA 1DZKA 1LNMA 4GU8A 4KC7A 3VE1A 3RWXA 4CPEA 5LJKA 2OL8O 2CM9A 4GJSA 3SZJA 3PH5A 3Q34A 1SWGA 2FKJA 2Z4IA 3RDXA 1BM5A 2RTBB 1HBPA 1OBPA 3KZAA 3PPTA 1FEMA 2FLJA 3RDMA 4CV7A 2YMSA 4WFUA 4ZHHA 3HOEA 4DNEA 3WJBA 2WR6A 5JD2A 4IMOA 3WOVA 2G79A 2HZQA 2RTAA 2VFBA 1LIEA 2OVDA 4HPCA 2AT3X 2RCQA 1RAVA 2WEXA 2OVSA 3D96A 5HZ6A 4COTA 1OPAA 3GAQA 2DM5A 4ORUA 3S5XA 1CBIA 4ALBA 4QQ1A 3IA8A 2AL0X 1KL4A 1SWAA 2BC3A 3EYCA 4A8ZA 4GZVA 4UU3A 1ZNDA 3MM0A 4MVLA 4ZGUA 1SLEB 4IABA 1ERBA 4O4UA 3WYPA 1MEPA 4U9CA 2L9CA 2RTOB 3AEHA 2BS6A 3RKGA 1CRBA 2RTCB 2LFOA 5IRUA 1E06A 4BJ8A 3CBSA 1SWSA 5B10O 2WEWA 4Z27A 1G85A 1TOUA 2NP1A 1W4TA 4QAEA 4JGLA 1O8VA 3CBCA 1LIFA 2IFBA 2X46A 3FIQA 4EFGA 3FEPA 3RDUA 4ES7A 3QKGA 3APWA 1ZNGA 2KD2A 1T68X 4OMXA 3KFIA 2X8TA 1FE3A 2IZEB 3ELXA 1VWBB 2MO5A 2X4MA 3T2WA 3QQ2A 1S2PA 2HMBA 1H91A 1NDJA 5L3YA 1N4JA 3FA9A 4FQBB 2OY7A 4ZH6A 4U8UN 4QRLA 5HZQA 2C1SA 1HMRA 3PQSA 4BCSA 1BRQA 2PI3O 4N7DA 1BWYA 4TKBA 1Y9TA 1VPRA 4GRJA 5L8IA 1JV4A 1SWLA 2OVAA 1IKEA 4I95A 4L1NA 2RQ0A 1STSB 5DPQA 3WZPA 4BOEA 1BSQA 1ADLA 4LKTA 2RTNB 2X55A 3U9PC 5BVQA 1AVDA 4DQ3A 1JMZA 1ZNHA 1KT6A 1EW3A 5FENA 2K23A 2W2BA 1LDQA 2RTMA 1X89A 3RE6A 3ZW0A 2CZUA 2FR2A 1QQSA 1LUQA 4FBVA 4BQUA 3SLTA 4Y0QA 4ODDA 3CMPA 1YUPA 5FAZA 4Z2VA 2LA7A 3O2YA 1FELA 4WFVA 5C0NA 5KIDA 2XKLA 1PBYA 1I06A 1NQNA 1K3BA 3KFFA 5LJHA 2RTLA 2A13A 4XMEA 3U03A 4I9RA 3LHNA 3S60A 2OVEA 3EMMA 4Z2PA 3ZI8A 3PK2A 3TGCA 1HQPA 2C4IA 4YGHA 3UEVA 1DC9A 5HA0A 1IFCA 4DCBA 2RTDB 2ZAGA 1LCWA 4GDZA 1JJJA 2FRSA 1SWEA 4LQZA 1EXSA 3H3IA 4FBRA 1A2DA 4MIRA 3JQOA 1WUBA 4FGIB 1E02A 3VU1A 2CBRA 4QYPA 2GJ5A 1VYGA 4AZMA 4ZGFA 1FJ1E 1GKAB 1XKIA 3JSQA 3RDSA 1SWRA 4B55A 1SRHA 3V8UA 4NNSA 5HBSA 1SRIA 1S44A 2BHVA 1N0SA 2ZAIA 2IZFB 3G7XA 4IBAA 4PJ2A 5F2BA 4CDFA 5L8OA 5L8NA 1NBXA 4WBKA 1SWOA 2JOZA 3T6LA 3L4RA 3D95A 1GX8A 1EQDA 1IJ8A 2G8CO 4OS8A 3TF6A 3FIDA 5HWZA 2RN4A 1VWAB 1W5RA 3SZIA 5FQ6E 4O3WA 2RTIB 2G7BA 2IZBA 4AZQA 1BSYA 1DF3A 1X8PA 2QO5A 2I5ZO 2LB6A 3EC5A 3P6CA 1MK5A 1EUOA 2Q9SA 4GGRA 4I3DA 3KVNA 1LICA 2AT8X 4XMFA 3VG2A 3D4RA 1HQQA 5IO6A 5LJEA 1T0VA 2HLVA 1GM6A 4CPFA 4GGZA 1KZWA 1MX7A 3RDQA 4AYHA 2HYSA 4IB6A 1SRFA 1PTSA 1QG5A 2I5VO 2OFRX 2FS6A 4D6BA 1DZMA 3RY1A 4IAXA 1KQXA 1I9HA 3NP1A 3KFHA 2Z4HA 1LCVA 3VG5A 3FR2A 1JQPA 3NQKA 2OFAA 4IMNA 3SLOA 4ZJ0A 1ICNA 3FW4A 1SY0A 4XMGA 4YFRA 2HKDA 5B29A 3EBWA 1VWQB 3MVFA 1KT7A 4BX7A 1HN2A 4ORRA 3APXA 4OKAA 5CSEA 4ZR2A 3UEXA 4JO6A 1Y55X 1RSTB 5FQ7E 1A3YA 1R0UA 3GE2A 1TXLA 3FELA 4CDDA 3AUMO 1YP7A 1CBSA 2JW1A 4QGXA 2VFCA 4U8UM 2OYBO 3VHMA 1SRGA 4NV8A 4ZH9A 2GTLN 1SA8A 3STKA 4ML7B 3BU1A 4M7MA 1SMPI 2YG2A 3FYFA 3NQ9A 1ZNKA 2AT5X 2IZDB 3NPOA 3NADA 4CPIA 1MX8A 3PQUA 2WQ9A 4NYQA 5AJBA 4Y0RA 4I9SA 3VGWA 4YH0A 1CBQA 1UREA 1BLRA 4IAWA 3BS2A 3DTQA 2O62A 4O3XB 3ZW0B 1LF7A 1SWBA 2IZKA 1B8EA 4I3BA 5DG4A 4R0BA 2L67A 3X00A 2MJIA 1SXYA 2FR3A 5IRWA 1B4MA 3HWGA 3AKNA 2A5CA 5EPQA 3FENA 1SXXA 4JHQA 4YKOA 2GC9A 4Z28A 4ALOA 1SY3A 4ZCBA 2GTLO 2X32A 3EW2A 2RTKA 4YDBA 3CR6A 1O1VA 2WSJA 2PY1A 1LIDA 4NV7A 5F6ZA 3C78X 1IKJA 3RE5A 3RBYA 1HMTA 1ZNLA 3T1DA 2LBAA 3PDFA 4M6SA 3CQNA 2KW1A 3JS1A 4YBPA 3FMZA 2L5PA 4I3CA 3T6FA 5KICA 3EW1A 1VWOB 4O3ZA 1BBPA 4IB7A 1AB0A 3TGAA 4CDCA 1B56A 2A2GA 2X45A 1STRB 3WZOA 1G5WA 1TW4A 4OS0A 1KT5A 1U0XA 4BX6A 4O4OA 2QCBA 1QABE 5FFHA 4GUZA 2QOMA 4XMDA 3F9DA 1VWFB 2FT9A 2OFMX 1I05A 1JMXA 1STPA 1KT4A 2AMMX 2JN3A 3DSZA 3PH6A 4QYNA 4QZTA 5EDCA 5FQ8E 1EIIA 3STMX 2Y3EA 4Y59A 1LCZA 2XSTA 2RTPB 3VHIA 1Z24A 5HZ9A 1NGLA 2IZJA 3P24A 3P02A 4HPBA 1MVGA 2HZRA 2W2FA 3P6FA 4OS3A 1SLFB 2ACPX 4I60A 1OBQA 4U8UO 2L68A 3CQRA 1KL3A 1SWFA 1FTPA 1SY2A 2RTRB 5CYBA 2FTBA 1SRJA 3HWDA 3O22A 4U3QA 2FWVA 5JR8A 2VDFA 4NP1A 1ZRYA 1SWTA 4EXZA 1D3SA 1HMSA 2KT4B 1JBHA 4YCEA 3VG6A 4GKCA 2IZLB 2OY5O 1A18A 1DF8A 1SLDB 2E4JA 2OFBA 4YMYA 5IO7A 4YBUA 1LIBA 1MDCA 1AELA 3MX7A 1VWNB 4QGVA 1FENA 4A1YA 2QO4A 2RTGB 3ZQ3A 3MG5A 1AVGI 1E00A 3OE3A 2KTSA 4ORWA 1KT3A 1GX9A 1ICMA 2AT6X 3EBKA 1VWPB 1Y52X 2RTJA 4EEJA 1VWDB 4MVIA 2G5LA 1UZ2X 2Y3FA 3ZW2A 2BSZA 3WBGA 3PEDA 4BX7B 1S7DA 5HZ8A 1VWJB 2UZ2A 3O19A 1AQBA 4YGZA 5D47A 2A2UA 1CBRA 3B2LA 4O49A 1L6MA 2NNDA 2IZIA 1K24A 1MOYA 5LKFA 4A1HA 3F8AA 1SWHA 4Y5DA 3HPEA 1KXOA 1EPAA 2GTLM 5HAEA 4EQAC 3I17A 2OF8A 4O3YA 1KGLA 1KL5A 1SWCA 1JYJA 1E2TA 1PM1X 1QY0A 1VWMB 4YKMA 1SWQA 5B3MO 2AVIA 3ZWEA 1VWEB 2F01A 2OL6O 2ZSCA 1DV9A 3VG7A 1GX3A 1SWJA 3CKGA 3BLGA 4OEMA 4CDEA 5IRAA 2MWHA 3OBLA 3BY0A 3HWEA 5HA1A 2WQAE 4GH7A 1VYOA 4ZFXA 5BVSA 3EM0A 2JGSA 3WJDA 4K19A 4YVBA 1SWKA 4TKHA 4YFPA 1PBOA 3SOTA 3BX7A 5LJCA 1BSOA 3KQ0A 2C1QA 2R56A 2AT0X 1G7NA 3U0DA
chains in the Genus database with same CATH topology
2JU7A 3OJYC 4A60A 1GT4A 2A3FX 2ASNX 3FR4A 3AKMA 1T8VA 3NX2A 2MHDA 1A57A 2OZQA 4CK4A 4AZRA 5EEEA 1BJ7A 1PMPA 2ANSA 1DFVA 1JYDA 2Q2PA 3OD9A 3S26A 5KHPA 3C77X 4HWMA 2RA6A 1JZUA 1YWBA 3B2JA 4ORSA 4GNWA 2F09A 4ORXA 4DQ4A 1NP1A 3Q6LA 1YIVA 1X8UA 3UAQA 4NW4A 2QO6A 1KQWA 5IO5A 2CM4A 3VG3A 1BRPA 2P8GA 3FA7A 1B0OA 3B2KA 4MVKA 2Q39A 3NBXX 4ON1A 3BDRA 4YGGA 4KCAA 1QFTA 3VPJE 1D2UA 1GGLA 1U17A 4KT5A 4AZPA 3TGBA 1G74A 4XMCA 2BT9A 2M4LA 3S5VA 1OBUA 4ORYA 4YDAA 4YFQA 2NNEA 4LZUA 1YWAA 1ML7A 3UEWA 3FA8A 4IB8A 5H9AA 2QMIA 4CSBA 3PP6A 3NQ3A 1OEJA 4INNA 2AKQA 4ZHGA 3IFBA 2ACOA 1JIWI 2G78A 3WJGA 3P6EA 1VYFA 4HPDA 1OEEA 1O1UA 4OMWA 4ZHFA 3BU9A 1LFOA 2R73A 1IFBA 2GTFX 2WUTA 3B2IA 4RUUA 3SAOA 5EEDA 3UEUA 5LJBA 4GETA 1EPBA 4HFOA 1SXUA 4N7CA 3APVA 1EALA 1DZPA 3RZYA 4Y0PA 3ZW1A 5H8TA 4ZHDA 2RD7C 3WVMA 1QWDA 2A0AA 1I04A 5HCEC 3BSZE 5LJDA 1GT3A 3E3CA 3RSWA 1TVQA 3VG4A 5BYPA 4XMHA 1KZXA 2JMBA 4O9SA 4EDEA 1Y9LA 5H9KA 5LJGA 5K06A 2NNQA 3HOLA 3P6HA 4KIIA 1E5PA 3FLLA 3WJEA 5AJCA 5AQ6A 3MBTA 4NLIA 3NX1A 4UU2A 4I6SA 1EI5A 3PECA 1EIOA 1QY1A 1KOIA 4MVEA 4KH8A 3BRNA 3WXQA 4O4XA 3B2HA 3FR5A 2ALLX 3WJFA 1GT5A 4QNIA 1MUPA 1X8QA 1TOWA 3FEKA 1NP4A 5F7GA 2RCTA 3F6ZB 2FS7A 3HWFA 1X8NA 3N91A 4RUNA 2MM3A 3ELZA 3I0AA 4NNTA 1CJ5A 5D4AA 4BVMA 1BEBA 1ACDA 4LZVA 5F58A 5HTDA 2JU8A 4KC8A 1ZNEA 3TZSA 2LKKA 2HNXA 2QM9A 1XCAA 1HBQA 2BS5A 4O4SA 1YWDA 3K3LA 1U18A 1GXAA 3HTYA 1IIUA 1P6PA 2CBSA 3ZUOA 4PSQA 5BVTA 2X8SA 5CE4A 1I4UA 5D48A 5EDBA 4QGWA 1SXWA 1LPJA 3FA6A 3VE2A 2W2AA 1ALBA 5F6BA 2WWPA 4MISA 4Y0SA 3CWKA 3D97A 5HCDC 4HPAA 2F73A 3P6DA 3BX8A 4TKJA 2LBVA 1QY2A 5B27A 5HZ5A 4QZUA 5HTEA 2QOSC 3NR3A 4D6AA 1X8OA 5D8JA 3WJCA 4YCHA 4ARHA 1OEKA 3HK1A 5EZ2A 4TLJA 5D45A 2EU7X 2K62A 3C76X 2Q2MA 3APUA 1YWCA 4TNNA 3P6GA 2CZTA 4GE1A 4IB9A 4NLJA 1LKEA 1SY1A 2JU3A 3LV4A 1GT1A 1FDQA 4L3RA 4LKPA 4NYRA 4WHIA 5H9NA 2KTDA 3ZUIA 1ERXA 2BLGA 4AZOA 1DZJA 1YP6A 4GNYA 1BWYA 2POAA 2N93A 4AW8A 1OPBA 4FBOA 5H9LA 2R74A 2X8FA 2AH7X 3ZW1B 4ZHCA 5LKEA 4TJZA 2Q4NA 1PEEA 1JJXA 3FW5A 1QFVA 4AZNA 5HCCC 1RBPA 4ID2A 1X71A 5F1EA 1RLBE 3STNA 3ZZVA 5AEOA 4GK9A 1GKAA 1IW2A 3KFGA 1DZKA 1LNMA 4GU8A 4KC7A 3VE1A 3RWXA 5LJKA 2CM9A 3PH5A 2Z4IA 1BM5A 3PPTA 1HBPA 1OBPA 3KZAA 1FEMA 2FLJA 4CV7A 2YMSA 4WFUA 4ZHHA 3HOEA 3WJBA 2WR6A 4IMOA 3WOVA 2G79A 2HZQA 1LIEA 2OVDA 4HPCA 2AT3X 2RCQA 2WEXA 2OVSA 3D96A 5HZ6A 4COTA 1OPAA 3GAQA 2DM5A 4ORUA 3S5XA 1CBIA 4ALBA 4QQ1A 3IA8A 2AL0X 3EYCA 4A8ZA 4GZVA 4UU3A 1ZNDA 4MVLA 4ZGUA 4IABA 4O4UA 1ERBA 4U9CA 2L9CA 3RKGA 2BS6A 1CRBA 2LFOA 1E06A 3CBSA 2WEWA 1G85A 1TOUA 2NP1A 4QAEA 4JGLA 1O8VA 3CBCA 1LIFA 2IFBA 2X46A 3FIQA 4EFGA 3FEPA 4ES7A 3QKGA 3APWA 1ZNGA 2KD2A 1T68X 4OMXA 3KFIA 2X8TA 1FE3A 3ELXA 2MO5A 2HMBA 1S2PA 1H91A 4FQBB 3FA9A 4ZH6A 4U8UN 4QRLA 5HZQA 1HMRA 3PQSA 1BRQA 4N7DA 4TKBA 1Y9TA 1VPRA 4GRJA 5L8IA 1JV4A 2OVAA 4I95A 1IKEA 4L1NA 5DPQA 2RQ0A 4BOEA 4EXZA 1BSQA 1ADLA 4LKTA 3U9PC 5BVQA 4DQ3A 1ZNHA 1KT6A 1EW3A 5FENA 2K23A 2W2BA 1X89A 3ZW0A 2CZUA 2FR2A 1QQSA 4BQUA 4FBVA 4Y0QA 4ODDA 3CMPA 1YUPA 5FAZA 2LA7A 3O2YA 1FELA 4WFVA 5C0NA 5KIDA 2XKLA 1I06A 5LJHA 3KFFA 2A13A 4XMEA 3U03A 4I9RA 3LHNA 3S60A 2OVEA 3EMMA 3ZI8A 3TGCA 1HQPA 3UEVA 4YGHA 1DC9A 5HA0A 1IFCA 2ZAGA 1JJJA 4GDZA 2FRSA 4LQZA 1EXSA 3H3IA 4FBRA 1A2DA 4MIRA 3JQOA 3VU1A 4FGIB 1E02A 2CBRA 4QYPA 2GJ5A 1VYGA 4AZMA 4ZGFA 1GKAB 1XKIA 3JSQA 3V8UA 4NNSA 5HBSA 1S44A 2BHVA 1N0SA 2ZAIA 3G7XA 4IBAA 4PJ2A 5L8OA 5L8NA 4WBKA 2JOZA 3L4RA 3D95A 1GX8A 1EQDA 3TF6A 4OS8A 5HWZA 2RN4A 5FQ6E 4O3WA 2G7BA 4AZQA 1BSYA 1DF3A 1X8PA 2QO5A 2LB6A 3P6CA 4I3DA 2Q9SA 1EUOA 3VG2A 4TQ2A 1LICA 2AT8X 4XMFA 3D4RA 5IO6A 5LJEA 1T0VA 2HLVA 1GM6A 1KZWA 1MX7A 4AYHA 2HYSA 4IB6A 1QG5A 2OFRX 2FS6A 4D6BA 1DZMA 4IAXA 1KQXA 3NP1A 3KFHA 2Z4HA 3VG5A 3FR2A 3NQKA 4IMNA 4ZJ0A 1ICNA 3FW4A 1SY0A 4XMGA 4YFRA 5B29A 3EBWA 3MVFA 1KT7A 1HN2A 4ORRA 3APXA 4ZR2A 3UEXA 5FQ7E 1A3YA 1R0UA 3GE2A 1TXLA 3FELA 1YP7A 1CBSA 2JW1A 4QGXA 4U8UM 4ZH9A 2GTLN 1SA8A 3STKA 4ML7B 3BU1A 4M7MA 2YG2A 3FYFA 3NQ9A 2AT5X 1ZNKA 3NPOA 3NADA 1MX8A 3PQUA 2WQ9A 4NYQA 5AJBA 4Y0RA 4I9SA 1BLRA 4YH0A 1CBQA 1UREA 4IAWA 3BS2A 3DTQA 2O62A 4O3XB 3ZW0B 1LF7A 4I3BA 1B8EA 5DG4A 4R0BA 2L67A 2MJIA 1SXYA 2FR3A 1B4MA 3HWGA 3AKNA 5EPQA 3FENA 1SXXA 4YKOA 2GC9A 4ALOA 1SY3A 4ZCBA 2GTLO 4YDBA 3CR6A 1O1VA 2WSJA 2PY1A 1LIDA 5F6ZA 3C78X 1IKJA 3RBYA 1HMTA 1ZNLA 3T1DA 2LBAA 4M6SA 3CQNA 2KW1A 3JS1A 4YBPA 3FMZA 2L5PA 4I3CA 5KICA 1G7NA 4O3ZA 1BBPA 4IB7A 1AB0A 3TGAA 1G5WA 1B56A 2A2GA 2X45A 1TW4A 4OS0A 1KT5A 1U0XA 4O4OA 1QABE 5FFHA 4XMDA 3F9DA 2FT9A 2OFMX 1I05A 2AMMX 1KT4A 2JN3A 4QYNA 3DSZA 3PH6A 4QZTA 1EIIA 5EDCA 5FQ8E 3STMX 2XSTA 5HZ9A 1Z24A 1NGLA 3P24A 3P02A 4HPBA 1MVGA 2HZRA 2W2FA 3P6FA 4OS3A 2ACPX 1OBQA 4U8UO 2L68A 3CQRA 1FTPA 1SY2A 5CYBA 2FTBA 3HWDA 3O22A 4U3QA 2FWVA 5JR8A 4NP1A 1ZRYA 1JBHA 1D3SA 1HMSA 2KT4B 4YCEA 3VG6A 4GKCA 1A18A 2E4JA 5IO7A 4YMYA 4YBUA 1LIBA 1MDCA 1AELA 3MX7A 4QGVA 1FENA 4A1YA 2QO4A 3ZQ3A 1AVGI 1E00A 3OE3A 2KTSA 4ORWA 1KT3A 1GX9A 1ICMA 2AT6X 3EBKA 4EEJA 4MVIA 1UZ2X 3ZW2A 3WBGA 3PEDA 5HZ8A 1S7DA 3O19A 1AQBA 4YGZA 5D47A 2A2UA 1CBRA 3B2LA 4O49A 1L6MA 2NNDA 5LKFA 4A1HA 3F8AA 1KXOA 1EPAA 2GTLM 5HAEA 4EQAC 3I17A 4O3YA 1KGLA 1JYJA 1PM1X 1QY0A 4YKMA 3ZWEA 1DV9A 3VG7A 3BLGA 2MWHA 3OBLA 3BY0A 3HWEA 5HA1A 2WQAE 4GH7A 4ZFXA 5BVSA 3EM0A 3WJDA 4K19A 4TKHA 4YFPA 1PBOA 3SOTA 3BX7A 5LJCA 1BSOA 3KQ0A 2R56A 2AT0X 1SMPI 3U0DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JU7 A;  3OJY C;  4A60 A;  1GT4 A;  2A3F X;  2ASN X;  3FR4 A;  3AKM A;  1T8V A;  3NX2 A;  1A57 A;  2OZQ A;  4CK4 A;  4AZR A;  5EEE A;  1BJ7 A;  1PMP A;  2ANS A;  1DFV A;  1JYD A;  2Q2P A;  3S26 A;  5KHP A;  3C77 X;  2RA6 A;  1JZU A;  1YWB A;  3B2J A;  4ORS A;  4GNW A;  4ORX A;  4DQ4 A;  1NP1 A;  3Q6L A;  1YIV A;  1X8U A;  2QO6 A;  1KQW A;  5IO5 A;  2CM4 A;  3VG3 A;  1BRP A;  2P8G A;  3FA7 A;  1B0O A;  3B2K A;  4MVK A;  2Q39 A;  3BDR A;  4YGG A;  1QFT A;  1D2U A;  1GGL A;  1U17 A;  4AZP A;  3TGB A;  1G74 A;  4XMC A;  1OBU A;  4ORY A;  4YDA A;  4YFQ A;  2NNE A;  4LZU A;  1YWA A;  1ML7 A;  3UEW A;  3FA8 A;  4IB8 A;  5H9A A;  3PP6 A;  3NQ3 A;  1OEJ A;  2AKQ A;  4ZHG A;  3IFB A;  2ACO A;  2G78 A;  3WJG A;  3P6E A;  1VYF A;  4HPD A;  1OEE A;  1O1U A;  4OMW A;  4ZHF A;  3BU9 A;  1LFO A;  2R73 A;  1IFB A;  2GTF X;  2WUT A;  3B2I A;  4RUU A;  3SAO A;  5EED A;  3UEU A;  5LJB A;  4GET A;  1EPB A;  4HFO A;  1SXU A;  4N7C A;  3APV A;  1EAL A;  1DZP A;  3RZY A;  4Y0P A;  5H8T A;  4ZHD A;  2RD7 C;  3WVM A;  1QWD A;  2A0A A;  1I04 A;  5HCE C;  3BSZ E;  5LJD A;  1GT3 A;  3RSW A;  3VG4 A;  1TVQ A;  4XMH A;  1KZX A;  4O9S A;  4EDE A;  5H9K A;  5LJG A;  5K06 A;  2NNQ A;  3P6H A;  4KII A;  1E5P A;  3FLL A;  3WJE A;  5AQ6 A;  3MBT A;  4NLI A;  3NX1 A;  4UU2 A;  3PEC A;  1EIO A;  1QY1 A;  1KOI A;  3BRN A;  3WXQ A;  3B2H A;  3FR5 A;  2ALL X;  3WJF A;  1GT5 A;  1MUP A;  1X8Q A;  1TOW A;  3FEK A;  1NP4 A;  5F7G A;  2RCT A;  2FS7 A;  3HWF A;  1X8N A;  4RUN A;  2MM3 A;  3ELZ A;  3I0A A;  4NNT A;  1CJ5 A;  5D4A A;  4BVM A;  1BEB A;  1ACD A;  4LZV A;  5F58 A;  5HTD A;  2JU8 A;  1ZNE A;  3TZS A;  2LKK A;  2HNX A;  2QM9 A;  1XCA A;  1HBQ A;  1YWD A;  3K3L A;  1U18 A;  1GXA A;  1IIU A;  1P6P A;  2CBS A;  3ZUO A;  4PSQ A;  5BVT A;  5CE4 A;  1I4U A;  5D48 A;  5EDB A;  4QGW A;  1SXW A;  1LPJ A;  3FA6 A;  2W2A A;  1ALB A;  5F6B A;  2WWP A;  4Y0S A;  3CWK A;  3D97 A;  5HCD C;  4HPA A;  2F73 A;  3P6D A;  3BX8 A;  4TKJ A;  2LBV A;  1QY2 A;  5B27 A;  5HZ5 A;  4QZU A;  5HTE A;  2QOS C;  3NR3 A;  4D6A A;  1X8O A;  5D8J A;  3WJC A;  4YCH A;  4ARH A;  1OEK A;  3HK1 A;  5EZ2 A;  4TLJ A;  5D45 A;  2EU7 X;  2K62 A;  3C76 X;  2Q2M A;  3APU A;  1YWC A;  4TNN A;  3P6G A;  2CZT A;  4GE1 A;  4IB9 A;  4NLJ A;  1LKE A;  1SY1 A;  2JU3 A;  4LKP A;  1GT1 A;  1FDQ A;  4NYR A;  5H9N A;  2KTD A;  3ZUI A;  1ERX A;  2BLG A;  4AZO A;  1DZJ A;  1YP6 A;  4GNY A;  1BWY A;  2POA A;  2N93 A;  4AW8 A;  1OPB A;  5H9L A;  2R74 A;  2AH7 X;  4ZHC A;  5LKE A;  4TJZ A;  2Q4N A;  1PEE A;  1JJX A;  3FW5 A;  1QFV A;  4AZN A;  5HCC C;  1RBP A;  1X71 A;  5F1E A;  1RLB E;  3STN A;  1GKA A;  1IW2 A;  3KFG A;  1DZK A;  1LNM A;  5LJK A;  2CM9 A;  3PH5 A;  1BM5 A;  3PPT A;  1HBP A;  1OBP A;  3KZA A;  1FEM A;  2FLJ A;  4WFU A;  4ZHH A;  3WJB A;  2WR6 A;  4IMO A;  2G79 A;  2HZQ A;  1LIE A;  2OVD A;  4HPC A;  2AT3 X;  2RCQ A;  2WEX A;  3D96 A;  5HZ6 A;  1OPA A;  3GAQ A;  2DM5 A;  4ORU A;  1CBI A;  4ALB A;  3IA8 A;  2AL0 X;  3EYC A;  4A8Z A;  4UU3 A;  1ZND A;  4MVL A;  4ZGU A;  1ERB A;  2L9C A;  1CRB A;  2LFO A;  1E06 A;  3CBS A;  2WEW A;  1G85 A;  1TOU A;  2NP1 A;  4QAE A;  1O8V A;  3CBC A;  1LIF A;  2IFB A;  2X46 A;  3FIQ A;  4EFG A;  3FEP A;  4ES7 A;  3QKG A;  3APW A;  1ZNG A;  1T68 X;  4OMX A;  3KFI A;  1FE3 A;  3ELX A;  2MO5 A;  2HMB A;  1S2P A;  1H91 A;  3FA9 A;  4ZH6 A;  5HZQ A;  1HMR A;  1BRQ A;  4N7D A;  4TKB A;  1VPR A;  4GRJ A;  5L8I A;  1JV4 A;  2OVA A;  1IKE A;  5DPQ A;  4BOE A;  2RQ0 A;  4EXZ A;  1BSQ A;  1ADL A;  4LKT A;  3U9P C;  5BVQ A;  4DQ3 A;  1ZNH A;  1KT6 A;  1EW3 A;  5FEN A;  2K23 A;  2W2B A;  1X89 A;  2CZU A;  2FR2 A;  1QQS A;  4BQU A;  4Y0Q A;  4ODD A;  3CMP A;  1YUP A;  5FAZ A;  3O2Y A;  1FEL A;  4WFV A;  5C0N A;  5KID A;  2XKL A;  1I06 A;  5LJH A;  3KFF A;  2A13 A;  4XME A;  3U03 A;  4I9R A;  2OVE A;  3EMM A;  3TGC A;  1HQP A;  3UEV A;  4YGH A;  1DC9 A;  5HA0 A;  1IFC A;  1JJJ A;  2FRS A;  1EXS A;  1A2D A;  1E02 A;  2CBR A;  4QYP A;  2GJ5 A;  1VYG A;  4AZM A;  1GKA B;  1XKI A;  3JSQ A;  4NNS A;  5HBS A;  1S44 A;  3G7X A;  1N0S A;  4IBA A;  5L8O A;  5L8N A;  4WBK A;  2JOZ A;  3L4R A;  3D95 A;  1GX8 A;  1EQD A;  3TF6 A;  4OS8 A;  5HWZ A;  2G7B A;  4AZQ A;  1BSY A;  1DF3 A;  1X8P A;  2QO5 A;  2LB6 A;  3P6C A;  4I3D A;  2Q9S A;  1EUO A;  3VG2 A;  4TQ2 A;  1LIC A;  2AT8 X;  4XMF A;  5IO6 A;  5LJE A;  1T0V A;  2HLV A;  1GM6 A;  1KZW A;  1MX7 A;  4AYH A;  2HYS A;  4IB6 A;  1QG5 A;  2OFR X;  2FS6 A;  4D6B A;  1DZM A;  4IAX A;  1KQX A;  3NP1 A;  3KFH A;  3VG5 A;  3FR2 A;  4IMN A;  4ZJ0 A;  1ICN A;  3FW4 A;  1SY0 A;  4XMG A;  4YFR A;  5B29 A;  3EBW A;  3MVF A;  1KT7 A;  1HN2 A;  4ORR A;  3APX A;  4ZR2 A;  3UEX A;  1A3Y A;  1R0U A;  1TXL A;  3FEL A;  1YP7 A;  1CBS A;  4QGX A;  4ZH9 A;  1SA8 A;  3STK A;  3BU1 A;  4M7M A;  2YG2 A;  3NQ9 A;  2AT5 X;  1ZNK A;  3NPO A;  3NAD A;  1MX8 A;  4NYQ A;  2WQ9 A;  4Y0R A;  4I9S A;  1BLR A;  4YH0 A;  1CBQ A;  1URE A;  4IAW A;  3BS2 A;  3DTQ A;  2O62 A;  1LF7 A;  4I3B A;  1B8E A;  5DG4 A;  4R0B A;  2L67 A;  2MJI A;  1SXY A;  2FR3 A;  1B4M A;  3HWG A;  3AKN A;  5EPQ A;  3FEN A;  1SXX A;  4YKO A;  2GC9 A;  4ALO A;  1SY3 A;  4ZCB A;  4YDB A;  3CR6 A;  1O1V A;  2WSJ A;  2PY1 A;  1LID A;  5F6Z A;  3C78 X;  1IKJ A;  1HMT A;  1ZNL A;  3T1D A;  2LBA A;  4M6S A;  3CQN A;  4YBP A;  3JS1 A;  3FMZ A;  2L5P A;  4I3C A;  5KIC A;  1BBP A;  4IB7 A;  1AB0 A;  3TGA A;  1G5W A;  1B56 A;  2A2G A;  2X45 A;  1TW4 A;  4OS0 A;  1KT5 A;  1U0X A;  1QAB E;  5FFH A;  4XMD A;  3F9D A;  2FT9 A;  2OFM X;  1I05 A;  2AMM X;  1KT4 A;  2JN3 A;  4QYN A;  3DSZ A;  3PH6 A;  4QZT A;  1EII A;  5EDC A;  3STM X;  2XST A;  5HZ9 A;  1Z24 A;  1NGL A;  4HPB A;  1MVG A;  2HZR A;  2W2F A;  3P6F A;  4OS3 A;  2ACP X;  1OBQ A;  2L68 A;  3CQR A;  1FTP A;  1SY2 A;  2FTB A;  3HWD A;  3O22 A;  2FWV A;  5JR8 A;  4NP1 A;  1ZRY A;  1JBH A;  1D3S A;  1HMS A;  2KT4 B;  4YCE A;  3VG6 A;  4GKC A;  1A18 A;  2E4J A;  5IO7 A;  4YMY A;  4YBU A;  1LIB A;  1MDC A;  1AEL A;  4QGV A;  1FEN A;  4A1Y A;  2QO4 A;  3ZQ3 A;  1AVG I;  1E00 A;  4ORW A;  1KT3 A;  1GX9 A;  1ICM A;  2AT6 X;  3EBK A;  4EEJ A;  4MVI A;  1UZ2 X;  3WBG A;  3PED A;  5HZ8 A;  1S7D A;  3O19 A;  1AQB A;  4YGZ A;  5D47 A;  2A2U A;  1CBR A;  3B2L A;  1L6M A;  2NND A;  5LKF A;  4A1H A;  3F8A A;  1KXO A;  1EPA A;  5HAE A;  3I17 A;  1KGL A;  1JYJ A;  1PM1 X;  1QY0 A;  4YKM A;  1DV9 A;  3VG7 A;  3BLG A;  3BY0 A;  3HWE A;  5HA1 A;  2WQA E;  4GH7 A;  4ZFX A;  5BVS A;  3EM0 A;  3WJD A;  4K19 A;  4TKH A;  4YFP A;  1PBO A;  5LJC A;  3BX7 A;  1BSO A;  3KQ0 A;  2R56 A;  2AT0 X;  1G7N A;  3U0D A; 
#chains in the Genus database with same CATH topology
 2JU7 A;  3OJY C;  4A60 A;  1GT4 A;  2A3F X;  2ASN X;  2OY1 O;  3FR4 A;  3AKM A;  1T8V A;  3NX2 A;  2MHD A;  2DJF A;  2OZQ A;  4Z6J A;  1A57 A;  3WZN A;  4BGF A;  4AZR A;  5EEE A;  4CK4 A;  1BJ7 A;  1PMP A;  2ANS A;  1DFV A;  1JYD A;  1NC9 A;  2Q2P A;  3OD9 A;  3S26 A;  5KHP A;  4CPH B;  3C77 X;  4HWM A;  3VHH A;  2RA6 A;  4GDA A;  4BX6 B;  1JZU A;  1YWB A;  3B2J A;  4ORS A;  2RTE B;  2F09 A;  4GNW A;  4ORX A;  4DQ4 A;  1NP1 A;  3Q6L A;  1YIV A;  2DJG A;  1AVE A;  1X8U A;  3UAQ A;  4NW4 A;  1RSU B;  2QO6 A;  1KQW A;  5IO5 A;  4C5P A;  2CM4 A;  1SWU A;  3VG3 A;  1BRP A;  2P8G A;  3WYQ A;  2OF9 A;  3FA7 A;  1B0O A;  3B2K A;  1MM9 A;  2Q39 A;  4MVK A;  3NBX X;  1HY2 A;  3BDR A;  4ON1 A;  4YGG A;  3SZH A;  4KCA A;  1QFT A;  1VWH B;  3VPJ E;  1D2U A;  1GGL A;  1U17 A;  2RTQ B;  4KT5 A;  2IZC B;  4AZP A;  4BX5 A;  3TGB A;  1G74 A;  4XMC A;  2BT9 A;  2M4L A;  3S5V A;  1OBU A;  4ORY A;  4YDA A;  4YFQ A;  2NNE A;  2A5B A;  4GJV A;  4LZU A;  1NQM A;  1YWA A;  1ML7 A;  3UEW A;  1VWR B;  3FA8 A;  4Z2O A;  1VWL B;  3D9W A;  4IB8 A;  5H9A A;  2QMI A;  4CSB A;  3PP6 A;  3NQ3 A;  1OEJ A;  4INN A;  2AKQ A;  4ZHG A;  3IFB A;  2ACO A;  1JIW I;  3T2X A;  1WBI A;  2G78 A;  3WJG A;  3P6E A;  1VYF A;  4HPD A;  1OEE A;  1O1U A;  4OMW A;  1RXJ A;  2FGS A;  1N9M A;  1SWP A;  4CPH A;  4ZHF A;  2FKG A;  1SRE A;  3LTW A;  2A8G A;  2IZH B;  3BU9 A;  1LFO A;  2R73 A;  1IFB A;  2GTF X;  2MF6 A;  2WUT A;  3B2I A;  3CKF A;  2X56 A;  4RUU A;  5EED A;  3SAO A;  4U46 A;  3UEU A;  5LJB A;  4GET A;  1I78 A;  2FHN X;  1EPB A;  4HFO A;  1SXU A;  1N43 A;  2X34 A;  3APV A;  4N7C A;  1EAL A;  1DZP A;  3RZY A;  4Y0P A;  3ZW1 A;  5K68 A;  5H8T A;  4ZHD A;  2RD7 C;  3WVM A;  1QWD A;  2A0A A;  1I04 A;  5HCE C;  3BSZ E;  1VWI B;  5LJD A;  1GT3 A;  2RTF B;  3E3C A;  1TVQ A;  3RSW A;  3VG4 A;  1VWC B;  5BYP A;  4GD9 A;  4XMH A;  1KZX A;  2JMB A;  2IZG B;  4O9S A;  1SWN A;  4EDE A;  1Y9L A;  5H9K A;  5LJG A;  5K06 A;  2NNQ A;  3HOL A;  3P6H A;  4KII A;  1E5P A;  3FLL A;  3WJE A;  5AJC A;  5AQ6 A;  3MBT A;  4NLI A;  3NX1 A;  4UU2 A;  4I6S A;  1EI5 A;  3PEC A;  2Y32 A;  1JJU A;  1QY1 A;  1EIO A;  1KOI A;  4MVE A;  4KH8 A;  3BRN A;  4MEE A;  3WXQ A;  4O4X A;  3B2H A;  3FR5 A;  3FDC A;  2ALL X;  4GGT A;  3WJF A;  1GT5 A;  1VWG B;  5CHK A;  4QNI A;  1LDO A;  1LEL A;  1X8Q A;  1MUP A;  1TOW A;  3FEK A;  1RXK A;  2OY8 A;  1NP4 A;  5F7G A;  2RCT A;  1KFF A;  1OSP O;  2FS7 A;  2WPU A;  3F6Z B;  3HWF A;  1X8N A;  3N91 A;  4RUN A;  2MM3 A;  1Y53 X;  2AF5 A;  3ELZ A;  2IZA A;  3I0A A;  4NNT A;  1CJ5 A;  5D4A A;  4BVM A;  1BEB A;  5B5G A;  1ACD A;  4LZV A;  1UYN X;  5F58 A;  2JU8 A;  2GH7 A;  1ZNE A;  4KC8 A;  5B2A O;  2LKK A;  3RY2 A;  5HTD A;  2HNX A;  3TZS A;  2QM9 A;  1Y0G A;  1XCA A;  1HBQ A;  2BS5 A;  4O4S A;  1YWD A;  3K3L A;  1U18 A;  1GXA A;  3HTY A;  2OL7 A;  1IIU A;  1VWK B;  1P6P A;  2CBS A;  3ZUO A;  4PSQ A;  5BVT A;  2X8S A;  4EKV A;  5CE4 A;  1I4U A;  2UYW A;  2RTH B;  5B11 O;  4BX5 B;  5D48 A;  5EDB A;  4QGW A;  2FHL A;  5B5F A;  1SXW A;  1LPJ A;  3FA6 A;  3VE2 A;  2W2A A;  1ALB A;  5F6B A;  2WWP A;  4MIS A;  3SLJ A;  4Y0S A;  3CWK A;  3D97 A;  1SLG B;  5HCD C;  4HPA A;  1N7Y A;  2CAM A;  2F73 A;  3P6D A;  3BX8 A;  4TKJ A;  2LBV A;  1QY2 A;  5B27 A;  1HXL A;  4JNJ A;  4QZU A;  5HZ5 A;  5HTE A;  2QOS C;  3NR3 A;  4D6A A;  1SWD A;  1X8O A;  1RXH A;  5D8J A;  3WJC A;  4YCH A;  1HXZ A;  4ARH A;  5K67 A;  1W6F A;  1OEK A;  3HK1 A;  5EZ2 A;  4TLJ A;  5D45 A;  2EU7 X;  2K62 A;  3C76 X;  2Q2M A;  3APU A;  1YWC A;  4TNN A;  1N9Y A;  2CZT A;  3P6G A;  4GE1 A;  4IB9 A;  1LKE A;  1UYO X;  4NLJ A;  1SY1 A;  2JU3 A;  3LV4 A;  1GT1 A;  1FDQ A;  4IRW A;  4L3R A;  4LKP A;  4NYR A;  4WHI A;  5H9N A;  2KTD A;  3ZUI A;  1ERX A;  2BLG A;  4AZO A;  1DZJ A;  1YP6 A;  4GNY A;  4OEL A;  4BBO A;  2POA A;  2N93 A;  3WZQ A;  1OPB A;  4FBO A;  5H9L A;  2R74 A;  4AW8 A;  4TQ2 A;  2X8F A;  2AH7 X;  3ZW1 B;  5IXG A;  3RDO A;  4ZHC A;  5LKE A;  4TJZ A;  2Q4N A;  1PEE A;  1JJX A;  3FW5 A;  1QFV A;  4AZN A;  5HCC C;  1RBP A;  4ID2 A;  1X71 A;  5F1E A;  1RLB E;  3STN A;  3ZZV A;  5AEO A;  4GK9 A;  1GKA A;  1IW2 A;  3KFG A;  1DZK A;  1LNM A;  4GU8 A;  4KC7 A;  3VE1 A;  3RWX A;  4CPE A;  5LJK A;  2OL8 O;  2CM9 A;  4GJS A;  3SZJ A;  3PH5 A;  3Q34 A;  1SWG A;  2FKJ A;  2Z4I A;  3RDX A;  1BM5 A;  2RTB B;  1HBP A;  1OBP A;  3KZA A;  3PPT A;  1FEM A;  2FLJ A;  3RDM A;  4CV7 A;  2YMS A;  4WFU A;  4ZHH A;  3HOE A;  4DNE A;  3WJB A;  2WR6 A;  5JD2 A;  4IMO A;  3WOV A;  2G79 A;  2HZQ A;  2RTA A;  2VFB A;  1LIE A;  2OVD A;  4HPC A;  2AT3 X;  2RCQ A;  1RAV A;  2WEX A;  2OVS A;  3D96 A;  5HZ6 A;  4COT A;  1OPA A;  3GAQ A;  2DM5 A;  4ORU A;  3S5X A;  1CBI A;  4ALB A;  4QQ1 A;  3IA8 A;  2AL0 X;  1KL4 A;  1SWA A;  2BC3 A;  3EYC A;  4A8Z A;  4GZV A;  4UU3 A;  1ZND A;  3MM0 A;  4MVL A;  4ZGU A;  1SLE B;  4IAB A;  1ERB A;  4O4U A;  3WYP A;  1MEP A;  4U9C A;  2L9C A;  2RTO B;  3AEH A;  2BS6 A;  3RKG A;  1CRB A;  2RTC B;  2LFO A;  5IRU A;  1E06 A;  4BJ8 A;  3CBS A;  1SWS A;  5B10 O;  2WEW A;  4Z27 A;  1G85 A;  1TOU A;  2NP1 A;  1W4T A;  4QAE A;  4JGL A;  1O8V A;  3CBC A;  1LIF A;  2IFB A;  2X46 A;  3FIQ A;  4EFG A;  3FEP A;  3RDU A;  4ES7 A;  3QKG A;  3APW A;  1ZNG A;  2KD2 A;  1T68 X;  4OMX A;  3KFI A;  2X8T A;  1FE3 A;  2IZE B;  3ELX A;  1VWB B;  2MO5 A;  2X4M A;  3T2W A;  3QQ2 A;  1S2P A;  2HMB A;  1H91 A;  1NDJ A;  5L3Y A;  1N4J A;  3FA9 A;  4FQB B;  2OY7 A;  4ZH6 A;  4U8U N;  4QRL A;  5HZQ A;  2C1S A;  1HMR A;  3PQS A;  4BCS A;  1BRQ A;  2PI3 O;  4N7D A;  1BWY A;  4TKB A;  1Y9T A;  1VPR A;  4GRJ A;  5L8I A;  1JV4 A;  1SWL A;  2OVA A;  1IKE A;  4I95 A;  4L1N A;  2RQ0 A;  1STS B;  5DPQ A;  3WZP A;  4BOE A;  1BSQ A;  1ADL A;  4LKT A;  2RTN B;  2X55 A;  3U9P C;  5BVQ A;  1AVD A;  4DQ3 A;  1JMZ A;  1ZNH A;  1KT6 A;  1EW3 A;  5FEN A;  2K23 A;  2W2B A;  1LDQ A;  2RTM A;  1X89 A;  3RE6 A;  3ZW0 A;  2CZU A;  2FR2 A;  1QQS A;  1LUQ A;  4FBV A;  4BQU A;  3SLT A;  4Y0Q A;  4ODD A;  3CMP A;  1YUP A;  5FAZ A;  4Z2V A;  2LA7 A;  3O2Y A;  1FEL A;  4WFV A;  5C0N A;  5KID A;  2XKL A;  1PBY A;  1I06 A;  1NQN A;  1K3B A;  3KFF A;  5LJH A;  2RTL A;  2A13 A;  4XME A;  3U03 A;  4I9R A;  3LHN A;  3S60 A;  2OVE A;  3EMM A;  4Z2P A;  3ZI8 A;  3PK2 A;  3TGC A;  1HQP A;  2C4I A;  4YGH A;  3UEV A;  1DC9 A;  5HA0 A;  1IFC A;  4DCB A;  2RTD B;  2ZAG A;  1LCW A;  4GDZ A;  1JJJ A;  2FRS A;  1SWE A;  4LQZ A;  1EXS A;  3H3I A;  4FBR A;  1A2D A;  4MIR A;  3JQO A;  1WUB A;  4FGI B;  1E02 A;  3VU1 A;  2CBR A;  4QYP A;  2GJ5 A;  1VYG A;  4AZM A;  4ZGF A;  1FJ1 E;  1GKA B;  1XKI A;  3JSQ A;  3RDS A;  1SWR A;  4B55 A;  1SRH A;  3V8U A;  4NNS A;  5HBS A;  1SRI A;  1S44 A;  2BHV A;  1N0S A;  2ZAI A;  2IZF B;  3G7X A;  4IBA A;  4PJ2 A;  5F2B A;  4CDF A;  5L8O A;  5L8N A;  1NBX A;  4WBK A;  1SWO A;  2JOZ A;  3T6L A;  3L4R A;  3D95 A;  1GX8 A;  1EQD A;  1IJ8 A;  2G8C O;  4OS8 A;  3TF6 A;  3FID A;  5HWZ A;  2RN4 A;  1VWA B;  1W5R A;  3SZI A;  5FQ6 E;  4O3W A;  2RTI B;  2G7B A;  2IZB A;  4AZQ A;  1BSY A;  1DF3 A;  1X8P A;  2QO5 A;  2I5Z O;  2LB6 A;  3EC5 A;  3P6C A;  1MK5 A;  1EUO A;  2Q9S A;  4GGR A;  4I3D A;  3KVN A;  1LIC A;  2AT8 X;  4XMF A;  3VG2 A;  3D4R A;  1HQQ A;  5IO6 A;  5LJE A;  1T0V A;  2HLV A;  1GM6 A;  4CPF A;  4GGZ A;  1KZW A;  1MX7 A;  3RDQ A;  4AYH A;  2HYS A;  4IB6 A;  1SRF A;  1PTS A;  1QG5 A;  2I5V O;  2OFR X;  2FS6 A;  4D6B A;  1DZM A;  3RY1 A;  4IAX A;  1KQX A;  1I9H A;  3NP1 A;  3KFH A;  2Z4H A;  1LCV A;  3VG5 A;  3FR2 A;  1JQP A;  3NQK A;  2OFA A;  4IMN A;  3SLO A;  4ZJ0 A;  1ICN A;  3FW4 A;  1SY0 A;  4XMG A;  4YFR A;  2HKD A;  5B29 A;  3EBW A;  1VWQ B;  3MVF A;  1KT7 A;  4BX7 A;  1HN2 A;  4ORR A;  3APX A;  4OKA A;  5CSE A;  4ZR2 A;  3UEX A;  4JO6 A;  1Y55 X;  1RST B;  5FQ7 E;  1A3Y A;  1R0U A;  3GE2 A;  1TXL A;  3FEL A;  4CDD A;  3AUM O;  1YP7 A;  1CBS A;  2JW1 A;  4QGX A;  2VFC A;  4U8U M;  2OYB O;  3VHM A;  1SRG A;  4NV8 A;  4ZH9 A;  2GTL N;  1SA8 A;  3STK A;  4ML7 B;  3BU1 A;  4M7M A;  1SMP I;  2YG2 A;  3FYF A;  3NQ9 A;  1ZNK A;  2AT5 X;  2IZD B;  3NPO A;  3NAD A;  4CPI A;  1MX8 A;  3PQU A;  2WQ9 A;  4NYQ A;  5AJB A;  4Y0R A;  4I9S A;  3VGW A;  4YH0 A;  1CBQ A;  1URE A;  1BLR A;  4IAW A;  3BS2 A;  3DTQ A;  2O62 A;  4O3X B;  3ZW0 B;  1LF7 A;  1SWB A;  2IZK A;  1B8E A;  4I3B A;  5DG4 A;  4R0B A;  2L67 A;  3X00 A;  2MJI A;  1SXY A;  2FR3 A;  5IRW A;  1B4M A;  3HWG A;  3AKN A;  2A5C A;  5EPQ A;  3FEN A;  1SXX A;  4JHQ A;  4YKO A;  2GC9 A;  4Z28 A;  4ALO A;  1SY3 A;  4ZCB A;  2GTL O;  2X32 A;  3EW2 A;  2RTK A;  4YDB A;  3CR6 A;  1O1V A;  2WSJ A;  2PY1 A;  1LID A;  4NV7 A;  5F6Z A;  3C78 X;  1IKJ A;  3RE5 A;  3RBY A;  1HMT A;  1ZNL A;  3T1D A;  2LBA A;  3PDF A;  4M6S A;  3CQN A;  2KW1 A;  3JS1 A;  4YBP A;  3FMZ A;  2L5P A;  4I3C A;  3T6F A;  5KIC A;  3EW1 A;  1VWO B;  4O3Z A;  1BBP A;  4IB7 A;  1AB0 A;  3TGA A;  4CDC A;  1B56 A;  2A2G A;  2X45 A;  1STR B;  3WZO A;  1G5W A;  1TW4 A;  4OS0 A;  1KT5 A;  1U0X A;  4BX6 A;  4O4O A;  2QCB A;  1QAB E;  5FFH A;  4GUZ A;  2QOM A;  4XMD A;  3F9D A;  1VWF B;  2FT9 A;  2OFM X;  1I05 A;  1JMX A;  1STP A;  1KT4 A;  2AMM X;  2JN3 A;  3DSZ A;  3PH6 A;  4QYN A;  4QZT A;  5EDC A;  5FQ8 E;  1EII A;  3STM X;  2Y3E A;  4Y59 A;  1LCZ A;  2XST A;  2RTP B;  3VHI A;  1Z24 A;  5HZ9 A;  1NGL A;  2IZJ A;  3P24 A;  3P02 A;  4HPB A;  1MVG A;  2HZR A;  2W2F A;  3P6F A;  4OS3 A;  1SLF B;  2ACP X;  4I60 A;  1OBQ A;  4U8U O;  2L68 A;  3CQR A;  1KL3 A;  1SWF A;  1FTP A;  1SY2 A;  2RTR B;  5CYB A;  2FTB A;  1SRJ A;  3HWD A;  3O22 A;  4U3Q A;  2FWV A;  5JR8 A;  2VDF A;  4NP1 A;  1ZRY A;  1SWT A;  4EXZ A;  1D3S A;  1HMS A;  2KT4 B;  1JBH A;  4YCE A;  3VG6 A;  4GKC A;  2IZL B;  2OY5 O;  1A18 A;  1DF8 A;  1SLD B;  2E4J A;  2OFB A;  4YMY A;  5IO7 A;  4YBU A;  1LIB A;  1MDC A;  1AEL A;  3MX7 A;  1VWN B;  4QGV A;  1FEN A;  4A1Y A;  2QO4 A;  2RTG B;  3ZQ3 A;  3MG5 A;  1AVG I;  1E00 A;  3OE3 A;  2KTS A;  4ORW A;  1KT3 A;  1GX9 A;  1ICM A;  2AT6 X;  3EBK A;  1VWP B;  1Y52 X;  2RTJ A;  4EEJ A;  1VWD B;  4MVI A;  2G5L A;  1UZ2 X;  2Y3F A;  3ZW2 A;  2BSZ A;  3WBG A;  3PED A;  4BX7 B;  1S7D A;  5HZ8 A;  1VWJ B;  2UZ2 A;  3O19 A;  1AQB A;  4YGZ A;  5D47 A;  2A2U A;  1CBR A;  3B2L A;  4O49 A;  1L6M A;  2NND A;  2IZI A;  1K24 A;  1MOY A;  5LKF A;  4A1H A;  3F8A A;  1SWH A;  4Y5D A;  3HPE A;  1KXO A;  1EPA A;  2GTL M;  5HAE A;  4EQA C;  3I17 A;  2OF8 A;  4O3Y A;  1KGL A;  1KL5 A;  1SWC A;  1JYJ A;  1E2T A;  1PM1 X;  1QY0 A;  1VWM B;  4YKM A;  1SWQ A;  5B3M O;  2AVI A;  3ZWE A;  1VWE B;  2F01 A;  2OL6 O;  2ZSC A;  1DV9 A;  3VG7 A;  1GX3 A;  1SWJ A;  3CKG A;  3BLG A;  4OEM A;  4CDE A;  5IRA A;  2MWH A;  3OBL A;  3BY0 A;  3HWE A;  5HA1 A;  2WQA E;  4GH7 A;  1VYO A;  4ZFX A;  5BVS A;  3EM0 A;  2JGS A;  3WJD A;  4K19 A;  4YVB A;  1SWK A;  4TKH A;  4YFP A;  1PBO A;  3SOT A;  3BX7 A;  5LJC A;  1BSO A;  3KQ0 A;  2C1Q A;  2R56 A;  2AT0 X;  1G7N A;  3U0D A; 
#chains in the Genus database with same CATH homology
 2JU7 A;  3OJY C;  4A60 A;  1GT4 A;  2A3F X;  2ASN X;  3FR4 A;  3AKM A;  1T8V A;  3NX2 A;  2MHD A;  1A57 A;  2OZQ A;  4CK4 A;  4AZR A;  5EEE A;  1BJ7 A;  1PMP A;  2ANS A;  1DFV A;  1JYD A;  2Q2P A;  3OD9 A;  3S26 A;  5KHP A;  3C77 X;  4HWM A;  2RA6 A;  1JZU A;  1YWB A;  3B2J A;  4ORS A;  4GNW A;  2F09 A;  4ORX A;  4DQ4 A;  1NP1 A;  3Q6L A;  1YIV A;  1X8U A;  3UAQ A;  4NW4 A;  2QO6 A;  1KQW A;  5IO5 A;  2CM4 A;  3VG3 A;  1BRP A;  2P8G A;  3FA7 A;  1B0O A;  3B2K A;  4MVK A;  2Q39 A;  3NBX X;  4ON1 A;  3BDR A;  4YGG A;  4KCA A;  1QFT A;  3VPJ E;  1D2U A;  1GGL A;  1U17 A;  4KT5 A;  4AZP A;  3TGB A;  1G74 A;  4XMC A;  2BT9 A;  2M4L A;  3S5V A;  1OBU A;  4ORY A;  4YDA A;  4YFQ A;  2NNE A;  4LZU A;  1YWA A;  1ML7 A;  3UEW A;  3FA8 A;  4IB8 A;  5H9A A;  2QMI A;  4CSB A;  3PP6 A;  3NQ3 A;  1OEJ A;  4INN A;  2AKQ A;  4ZHG A;  3IFB A;  2ACO A;  1JIW I;  2G78 A;  3WJG A;  3P6E A;  1VYF A;  4HPD A;  1OEE A;  1O1U A;  4OMW A;  4ZHF A;  3BU9 A;  1LFO A;  2R73 A;  1IFB A;  2GTF X;  2WUT A;  3B2I A;  4RUU A;  3SAO A;  5EED A;  3UEU A;  5LJB A;  4GET A;  1EPB A;  4HFO A;  1SXU A;  4N7C A;  3APV A;  1EAL A;  1DZP A;  3RZY A;  4Y0P A;  3ZW1 A;  5H8T A;  4ZHD A;  2RD7 C;  3WVM A;  1QWD A;  2A0A A;  1I04 A;  5HCE C;  3BSZ E;  5LJD A;  1GT3 A;  3E3C A;  3RSW A;  1TVQ A;  3VG4 A;  5BYP A;  4XMH A;  1KZX A;  2JMB A;  4O9S A;  4EDE A;  1Y9L A;  5H9K A;  5LJG A;  5K06 A;  2NNQ A;  3HOL A;  3P6H A;  4KII A;  1E5P A;  3FLL A;  3WJE A;  5AJC A;  5AQ6 A;  3MBT A;  4NLI A;  3NX1 A;  4UU2 A;  4I6S A;  1EI5 A;  3PEC A;  1EIO A;  1QY1 A;  1KOI A;  4MVE A;  4KH8 A;  3BRN A;  3WXQ A;  4O4X A;  3B2H A;  3FR5 A;  2ALL X;  3WJF A;  1GT5 A;  4QNI A;  1MUP A;  1X8Q A;  1TOW A;  3FEK A;  1NP4 A;  5F7G A;  2RCT A;  3F6Z B;  2FS7 A;  3HWF A;  1X8N A;  3N91 A;  4RUN A;  2MM3 A;  3ELZ A;  3I0A A;  4NNT A;  1CJ5 A;  5D4A A;  4BVM A;  1BEB A;  1ACD A;  4LZV A;  5F58 A;  5HTD A;  2JU8 A;  4KC8 A;  1ZNE A;  3TZS A;  2LKK A;  2HNX A;  2QM9 A;  1XCA A;  1HBQ A;  2BS5 A;  4O4S A;  1YWD A;  3K3L A;  1U18 A;  1GXA A;  3HTY A;  1IIU A;  1P6P A;  2CBS A;  3ZUO A;  4PSQ A;  5BVT A;  2X8S A;  5CE4 A;  1I4U A;  5D48 A;  5EDB A;  4QGW A;  1SXW A;  1LPJ A;  3FA6 A;  3VE2 A;  2W2A A;  1ALB A;  5F6B A;  2WWP A;  4MIS A;  4Y0S A;  3CWK A;  3D97 A;  5HCD C;  4HPA A;  2F73 A;  3P6D A;  3BX8 A;  4TKJ A;  2LBV A;  1QY2 A;  5B27 A;  5HZ5 A;  4QZU A;  5HTE A;  2QOS C;  3NR3 A;  4D6A A;  1X8O A;  5D8J A;  3WJC A;  4YCH A;  4ARH A;  1OEK A;  3HK1 A;  5EZ2 A;  4TLJ A;  5D45 A;  2EU7 X;  2K62 A;  3C76 X;  2Q2M A;  3APU A;  1YWC A;  4TNN A;  3P6G A;  2CZT A;  4GE1 A;  4IB9 A;  4NLJ A;  1LKE A;  1SY1 A;  2JU3 A;  3LV4 A;  1GT1 A;  1FDQ A;  4L3R A;  4LKP A;  4NYR A;  4WHI A;  5H9N A;  2KTD A;  3ZUI A;  1ERX A;  2BLG A;  4AZO A;  1DZJ A;  1YP6 A;  4GNY A;  1BWY A;  2POA A;  2N93 A;  4AW8 A;  1OPB A;  4FBO A;  5H9L A;  2R74 A;  2X8F A;  2AH7 X;  3ZW1 B;  4ZHC A;  5LKE A;  4TJZ A;  2Q4N A;  1PEE A;  1JJX A;  3FW5 A;  1QFV A;  4AZN A;  5HCC C;  1RBP A;  4ID2 A;  1X71 A;  5F1E A;  1RLB E;  3STN A;  3ZZV A;  5AEO A;  4GK9 A;  1GKA A;  1IW2 A;  3KFG A;  1DZK A;  1LNM A;  4GU8 A;  4KC7 A;  3VE1 A;  3RWX A;  5LJK A;  2CM9 A;  3PH5 A;  2Z4I A;  1BM5 A;  3PPT A;  1HBP A;  1OBP A;  3KZA A;  1FEM A;  2FLJ A;  4CV7 A;  2YMS A;  4WFU A;  4ZHH A;  3HOE A;  3WJB A;  2WR6 A;  4IMO A;  3WOV A;  2G79 A;  2HZQ A;  1LIE A;  2OVD A;  4HPC A;  2AT3 X;  2RCQ A;  2WEX A;  2OVS A;  3D96 A;  5HZ6 A;  4COT A;  1OPA A;  3GAQ A;  2DM5 A;  4ORU A;  3S5X A;  1CBI A;  4ALB A;  4QQ1 A;  3IA8 A;  2AL0 X;  3EYC A;  4A8Z A;  4GZV A;  4UU3 A;  1ZND A;  4MVL A;  4ZGU A;  4IAB A;  4O4U A;  1ERB A;  4U9C A;  2L9C A;  3RKG A;  2BS6 A;  1CRB A;  2LFO A;  1E06 A;  3CBS A;  2WEW A;  1G85 A;  1TOU A;  2NP1 A;  4QAE A;  4JGL A;  1O8V A;  3CBC A;  1LIF A;  2IFB A;  2X46 A;  3FIQ A;  4EFG A;  3FEP A;  4ES7 A;  3QKG A;  3APW A;  1ZNG A;  2KD2 A;  1T68 X;  4OMX A;  3KFI A;  2X8T A;  1FE3 A;  3ELX A;  2MO5 A;  2HMB A;  1S2P A;  1H91 A;  4FQB B;  3FA9 A;  4ZH6 A;  4U8U N;  4QRL A;  5HZQ A;  1HMR A;  3PQS A;  1BRQ A;  4N7D A;  4TKB A;  1Y9T A;  1VPR A;  4GRJ A;  5L8I A;  1JV4 A;  2OVA A;  4I95 A;  1IKE A;  4L1N A;  5DPQ A;  2RQ0 A;  4BOE A;  4EXZ A;  1BSQ A;  1ADL A;  4LKT A;  3U9P C;  5BVQ A;  4DQ3 A;  1ZNH A;  1KT6 A;  1EW3 A;  5FEN A;  2K23 A;  2W2B A;  1X89 A;  3ZW0 A;  2CZU A;  2FR2 A;  1QQS A;  4BQU A;  4FBV A;  4Y0Q A;  4ODD A;  3CMP A;  1YUP A;  5FAZ A;  2LA7 A;  3O2Y A;  1FEL A;  4WFV A;  5C0N A;  5KID A;  2XKL A;  1I06 A;  5LJH A;  3KFF A;  2A13 A;  4XME A;  3U03 A;  4I9R A;  3LHN A;  3S60 A;  2OVE A;  3EMM A;  3ZI8 A;  3TGC A;  1HQP A;  3UEV A;  4YGH A;  1DC9 A;  5HA0 A;  1IFC A;  2ZAG A;  1JJJ A;  4GDZ A;  2FRS A;  4LQZ A;  1EXS A;  3H3I A;  4FBR A;  1A2D A;  4MIR A;  3JQO A;  3VU1 A;  4FGI B;  1E02 A;  2CBR A;  4QYP A;  2GJ5 A;  1VYG A;  4AZM A;  4ZGF A;  1GKA B;  1XKI A;  3JSQ A;  3V8U A;  4NNS A;  5HBS A;  1S44 A;  2BHV A;  1N0S A;  2ZAI A;  3G7X A;  4IBA A;  4PJ2 A;  5L8O A;  5L8N A;  4WBK A;  2JOZ A;  3L4R A;  3D95 A;  1GX8 A;  1EQD A;  3TF6 A;  4OS8 A;  5HWZ A;  2RN4 A;  5FQ6 E;  4O3W A;  2G7B A;  4AZQ A;  1BSY A;  1DF3 A;  1X8P A;  2QO5 A;  2LB6 A;  3P6C A;  4I3D A;  2Q9S A;  1EUO A;  3VG2 A;  4TQ2 A;  1LIC A;  2AT8 X;  4XMF A;  3D4R A;  5IO6 A;  5LJE A;  1T0V A;  2HLV A;  1GM6 A;  1KZW A;  1MX7 A;  4AYH A;  2HYS A;  4IB6 A;  1QG5 A;  2OFR X;  2FS6 A;  4D6B A;  1DZM A;  4IAX A;  1KQX A;  3NP1 A;  3KFH A;  2Z4H A;  3VG5 A;  3FR2 A;  3NQK A;  4IMN A;  4ZJ0 A;  1ICN A;  3FW4 A;  1SY0 A;  4XMG A;  4YFR A;  5B29 A;  3EBW A;  3MVF A;  1KT7 A;  1HN2 A;  4ORR A;  3APX A;  4ZR2 A;  3UEX A;  5FQ7 E;  1A3Y A;  1R0U A;  3GE2 A;  1TXL A;  3FEL A;  1YP7 A;  1CBS A;  2JW1 A;  4QGX A;  4U8U M;  4ZH9 A;  2GTL N;  1SA8 A;  3STK A;  4ML7 B;  3BU1 A;  4M7M A;  2YG2 A;  3FYF A;  3NQ9 A;  2AT5 X;  1ZNK A;  3NPO A;  3NAD A;  1MX8 A;  3PQU A;  2WQ9 A;  4NYQ A;  5AJB A;  4Y0R A;  4I9S A;  1BLR A;  4YH0 A;  1CBQ A;  1URE A;  4IAW A;  3BS2 A;  3DTQ A;  2O62 A;  4O3X B;  3ZW0 B;  1LF7 A;  4I3B A;  1B8E A;  5DG4 A;  4R0B A;  2L67 A;  2MJI A;  1SXY A;  2FR3 A;  1B4M A;  3HWG A;  3AKN A;  5EPQ A;  3FEN A;  1SXX A;  4YKO A;  2GC9 A;  4ALO A;  1SY3 A;  4ZCB A;  2GTL O;  4YDB A;  3CR6 A;  1O1V A;  2WSJ A;  2PY1 A;  1LID A;  5F6Z A;  3C78 X;  1IKJ A;  3RBY A;  1HMT A;  1ZNL A;  3T1D A;  2LBA A;  4M6S A;  3CQN A;  2KW1 A;  3JS1 A;  4YBP A;  3FMZ A;  2L5P A;  4I3C A;  5KIC A;  1G7N A;  4O3Z A;  1BBP A;  4IB7 A;  1AB0 A;  3TGA A;  1G5W A;  1B56 A;  2A2G A;  2X45 A;  1TW4 A;  4OS0 A;  1KT5 A;  1U0X A;  4O4O A;  1QAB E;  5FFH A;  4XMD A;  3F9D A;  2FT9 A;  2OFM X;  1I05 A;  2AMM X;  1KT4 A;  2JN3 A;  4QYN A;  3DSZ A;  3PH6 A;  4QZT A;  1EII A;  5EDC A;  5FQ8 E;  3STM X;  2XST A;  5HZ9 A;  1Z24 A;  1NGL A;  3P24 A;  3P02 A;  4HPB A;  1MVG A;  2HZR A;  2W2F A;  3P6F A;  4OS3 A;  2ACP X;  1OBQ A;  4U8U O;  2L68 A;  3CQR A;  1FTP A;  1SY2 A;  5CYB A;  2FTB A;  3HWD A;  3O22 A;  4U3Q A;  2FWV A;  5JR8 A;  4NP1 A;  1ZRY A;  1JBH A;  1D3S A;  1HMS A;  2KT4 B;  4YCE A;  3VG6 A;  4GKC A;  1A18 A;  2E4J A;  5IO7 A;  4YMY A;  4YBU A;  1LIB A;  1MDC A;  1AEL A;  3MX7 A;  4QGV A;  1FEN A;  4A1Y A;  2QO4 A;  3ZQ3 A;  1AVG I;  1E00 A;  3OE3 A;  2KTS A;  4ORW A;  1KT3 A;  1GX9 A;  1ICM A;  2AT6 X;  3EBK A;  4EEJ A;  4MVI A;  1UZ2 X;  3ZW2 A;  3WBG A;  3PED A;  5HZ8 A;  1S7D A;  3O19 A;  1AQB A;  4YGZ A;  5D47 A;  2A2U A;  1CBR A;  3B2L A;  4O49 A;  1L6M A;  2NND A;  5LKF A;  4A1H A;  3F8A A;  1KXO A;  1EPA A;  2GTL M;  5HAE A;  4EQA C;  3I17 A;  4O3Y A;  1KGL A;  1JYJ A;  1PM1 X;  1QY0 A;  4YKM A;  3ZWE A;  1DV9 A;  3VG7 A;  3BLG A;  2MWH A;  3OBL A;  3BY0 A;  3HWE A;  5HA1 A;  2WQA E;  4GH7 A;  4ZFX A;  5BVS A;  3EM0 A;  3WJD A;  4K19 A;  4TKH A;  4YFP A;  1PBO A;  3SOT A;  3BX7 A;  5LJC A;  1BSO A;  3KQ0 A;  2R56 A;  2AT0 X;  1SMP I;  3U0D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...