2OVDA

Crystal structure of human complement protein c8gamma with laurate
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
170
structure length
162
Chain Sequence
b'SPISTIQPKANFDAQQFAGTWLLVAVGSAARAEATTLHVAPQGTAMAVSTFRKLDGICWQVRQLYGDTGVLGRFLLQARGARGAVHVVVAETDYQSFAVLYLERAGQLSVKLYARSLPVSDSVLSGFEQRVQEAHLTEDQIFYFPKYGFCEAADQFHVLDEV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Complement component 8, gamma polypeptide
publication title Structural features of the ligand binding site on human complement protein C8gamma: A member of the lipocalin family
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein,ligand binding protein
total genus 36
structure length 162
sequence length 170
ec nomenclature
pdb deposition date 2007-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00061 Lipocalin Lipocalin / cytosolic fatty-acid binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 2ovdA00
3B2HA 3BDRA 1BSOA 1LIFA 4HPCA 2AT8X 5LJEA 2A3FX 2A2GA 2OFMX 1O1VA 1FENA 3B2JA 3DTQA 2WR6A 4TQ2A 4ORSA 1MVGA 2FS7A 1GT4A 5H9KA 5LJGA 4N7DA 3EBWA 4EEJA 3NADA 3FELA 1UREA 3NQ3A 1QFVA 4NNTA 2Q2MA 1GX8A 1SA8A 2R73A 1OBQA 4XMDA 4YGHA 2QOSC 4ORWA 2A2UA 1GT3A 5HAEA 2ASNX 4K19A 3I17A 2RQ0A 1T68X 1CBRA 3RZYA 3BX8A 2RA6A 5HCEC 2R56A 3BY0A 1ICMA 4ZH9A 1LNMA 3BU1A 4HPBA 2Q2PA 3K3LA 1E00A 1ALBA 3KZAA 1IIUA 4I3DA 2A0AA 3ZUIA 1NGLA 3P6CA 1BRQA 1QY1A 5F1EA 1JBHA 1QQSA 1VYFA 1ERBA 3T1DA 1ZNKA 4KIIA 3APWA 2WEWA 1VPRA 2QO6A 3FLLA 5LJHA 3BRNA 3GAQA 5LKEA 1PEEA 1U17A 2W2AA 1PBOA 5HCDC 1GGLA 3STKA 5HBSA 4ZR2A 4I9RA 4WBKA 3WJGA 3D96A 3UEWA 3KFFA 3CWKA 5D48A 3TZSA 2NNEA 3FW4A 2CZUA 3FEKA 3PH6A 1ZNDA 1EXSA 4ARHA 3P6EA 4XMFA 2CM9A 1S2PA 3HWDA 1EW3A 3UEXA 4WFUA 3RSWA 4ZHDA 2QO4A 2QM9A 4IMOA 5HZ6A 4IAXA 1ZNEA 1TW4A 4ORRA 5IO7A 2CZTA 4GH7A 4OS8A 2WQ9A 5F6ZA 4OMXA 3SAOA 5HZ5A 2XKLA 4TLJA 4YCEA 1KT7A 1KZWA 3OJYC 2WWPA 1LFOA 1EUOA 4OMWA 5CE4A 3P6FA 2JU7A 1GXAA 1OEJA 1A2DA 4ZJ0A 1N0SA 1QFTA 2CM4A 3FR2A 1JYJA 2OVAA 3WXQA 4YGGA 4BOEA 1CBQA 5F58A 2AH7X 3BSZE 3D95A 3EMMA 2OZQA 1SXUA 4XMGA 2DM5A 1G7NA 4HFOA 4NYQA 4WFVA 1YIVA 2AT0X 3IFBA 4XMHA 1VYGA 2Q39A 4ODDA 2MJIA 1A18A 2NP1A 1ZNGA 2LBVA 1LKEA 1FEMA 2X46A 3PEDA 3FIQA 3UEUA 2Q9SA 4GNWA 4MVIA 1SY2A 1X71A 1YWAA 2AKQA 3D97A 1Z24A 5HA1A 2FR3A 1TOUA 1KT3A 3P6HA 1L6MA 1U0XA 1EIOA 1BJ7A 1SXYA 1RLBE 4AZNA 1CRBA 2G7BA 4QGVA 2K62A 3NR3A 2PY1A 1R0UA 4A60A 1BEBA 1X8UA 1OPBA 3FW5A 5EPQA 1B4MA 2POAA 4IBAA 1X8QA 3STNA 1BM5A 3TGAA 2L9CA 3F8AA 1QY2A 3MVFA 2A13A 4IAWA 5L8IA 2WSJA 1JJJA 1D2UA 2JU3A 5FFHA 3BX7A 1E06A 1QG5A 2OFRX 3MBTA 1SXXA 3TGBA 2ACPX 5EDCA 4EXZA 3BU9A 3U0DA 3P6DA 5HCCC 4I3CA 4NYRA 3FR4A 2L68A 3NX1A 1XCAA 2LB6A 1PMPA 1H91A 3VG4A 1OEEA 1GT1A 1YWCA 3KFHA 4PSQA 5F6BA 2HZQA 3ELZA 2JOZA 4O9SA 4Y0PA 5HTEA 3VG6A 3AKMA 4IB7A 4UU3A 3CBCA 4Y0QA 3B2LA 5IO5A 2FTBA 1IFCA 1ICNA 3WJDA 1NP1A 1KOIA 3CQNA 4QGWA 2QO5A 5D8JA 4YMYA 1OEKA 3FR5A 3CBSA 3HWGA 5H8TA 1KT6A 3WJBA 4YKOA 2JU8A 1U18A 1OBUA 5F7GA 3FA9A 4BQUA 4YH0A 1S44A 1E02A 1JV4A 3PPTA 2LFOA 4YCHA 1I05A 2AT5X 2LBAA 4A8ZA 1FTPA 4IMNA 3UEVA 1SXWA 4M7MA 4AZPA 5EEEA 5C0NA 5K06A 4ORXA 2XSTA 2W2FA 2L5PA 1LF7A 3G7XA 4HPDA 1KXOA 1EPAA 4A1YA 3S26A 4GRJA 4BVMA 1IKEA 4XMEA 1XKIA 3QKGA 3BLGA 3DSZA 1YP6A 2FWVA 3WJEA 1B0OA 1ML7A 3FA7A 4IB6A 4EFGA 3TGCA 1X8PA 1MX8A 1IFBA 3FA6A 1YUPA 4YKMA 2RCQA 2MM3A 3EM0A 5FAZA 1JYDA 2GC9A 1S7DA 1QWDA 1OPAA 2AT3X 4ORYA 3WJCA 2WQAE 4DQ4A 2FR2A 3U9PC 2O62A 4IB8A 2L67A 1I4UA 3AKNA 5H9AA 4ZH6A 4TKHA 1EALA 3PECA 5D45A 5H9NA 3ZQ3A 4I3BA 2X45A 4TNNA 1DF3A 1A3YA 2ALLX 1AQBA 4NLJA 1KQWA 4LKPA 5EZ2A 5JR8A 2N93A 4ORUA 4AW8A 5HA0A 1ADLA 5IO6A 2HMBA 4XMCA 2KT4B 1LICA 3VG7A 2NNQA 3APVA 4ZFXA 1E5PA 5LJBA 3EBKA 5LJKA 2ANSA 1IW2A 1BSQA 1QABE 4ZHHA 2FRSA 1HMRA 5B27A 2W2BA 3O19A 1T8VA 3APUA 2YG2A 4LKTA 4QYPA 3O2YA 1EIIA 4MVLA 2OVEA 4QZUA 4QAEA 3PH5A 5HWZA 3TF6A 3PP6A 5AQ6A 4OS0A 4TKBA 2FS6A 4YDAA 5EEDA 4TKJA 2NNDA 4YFRA 1GKAB 2AT6X 5EDBA 1TOWA 5D47A 2AL0X 2KTDA 1HBPA 3I0AA 5KICA 4ALBA 2CBRA 3NX2A 4AZQA 4ZHCA 1A57A 2WEXA 4ES7A 3KFIA 1DZKA 1OBPA 2OVDA 3EYCA 4RUUA 3NQ9A 2HYSA 1HMTA 3B2KA 1X8NA 1NP4A 1YWBA 3CR6A 1O1UA 1AVGI 1I06A 3NP1A 4I9SA 2K23A 4GE1A 1ZRYA 1D3SA 5B29A 3FA8A 4AZOA 4DQ3A 5LJCA 1B56A 1G74A 1DC9A 1ACDA 3HWFA 1PM1X 3FENA 3BS2A 1YP7A 5BVQA 3IA8A 4ALOA 1G85A 1DZPA 1KT4A 2GJ5A 4ZHGA 1KGLA 1AB0A 1KQXA 5HTDA 4NNSA 1MUPA 3ZUOA 1SY1A 2P8GA 4QGXA 2JN3A 1DFVA 4ZGUA 4NLIA 3FMZA 2EU7X 2G78A 1HN2A 1BBPA 3FEPA 1HMSA 4AYHA 1MDCA 4Y0RA 4QYNA 2GTFX 4OS3A 3VG3A 5HZ8A 1EQDA 2LKKA 2MO5A 4YFQA 5KIDA 3HWEA 4D6AA 1ZNLA 3CQRA 1IKJA 1P6PA 1LIDA 4RUNA 4HPAA 3P6GA 3WBGA 1ERXA 2E4JA 2FT9A 3O22A 1SY0A 2HLVA 5H9LA 3VG5A 4TJZA 1GX9A 4YFPA 1TXLA 3C78X 2AMMX 2HNXA 1MX7A 3B2IA 5HZ9A 4GKCA 3CMPA 5L8OA 4YBPA 1LPJA 3APXA 1DZMA 4GNYA 3STMX 4CK4A 1GM6A 4MVKA 2FLJA 3WJFA 4YGZA 1LIBA 4YDBA 4GETA 3VG2A 4ZHFA 1QY0A 1KT5A 1KZXA 5FENA 3C77X 5KHPA 3U03A 3JSQA 1EPBA 2HZRA 3KFGA 1AELA 4ZCBA 1HBQA 4AZRA 1FDQA 1BLRA 2RCTA 4QZTA 1UZ2X 1BRPA 3C76X 1BSYA 3Q6LA 2WUTA 5LJDA 2RD7C 3HK1A 2Q4NA 5D4AA 3WVMA 1GKAA 1CBIA 1TVQA 3ELXA 3L4RA 1T0VA 4IB9A 4NP1A 1CBSA 2F73A 4LZUA 1RBPA 1GT5A 5DPQA 5LKFA 1JZUA 2R74A 2ACOA 1ZNHA 2BLGA 1HQPA 4R0BA 4AZMA 1X89A 1FELA 5BVTA 5L8NA 5BVSA 1YWDA 1DZJA 3KQ0A 1LIEA 1DV9A 1FE3A 1JJXA 3JS1A 1BWYA 4UU2A 1CJ5A 2G79A 4N7CA 4D6BA 5DG4A 4M6SA 1G5WA 4EDEA 3NPOA 4Y0SA 1X8OA 2IFBA 1SY3A 3F9DA 1I04A 1B8EA 2CBSA 4YBUA 1O8VA 5HZQA 4LZVA 4A1HA
chains in the Genus database with same CATH superfamily
3VU1A 2QOMA 3GE2A 4OELA 2OY8A 3B2HA 1BSOA 3BDRA 3KVNA 1LIFA 4HPCA 2Z4HA 2AT8X 5LJEA 2A3FX 2A2GA 2OFMX 5B10O 1O1VA 2KW1A 4BX6A 4CDDA 4CDEA 1FENA 1NQNA 2X34A 3B2JA 3DTQA 5B5GA 2WR6A 4TQ2A 4ORSA 1MVGA 2FS7A 1GT4A 4QQ1A 5H9KA 5LJGA 4N7DA 1SWCA 3EBWA 4EEJA 3NADA 1VWCB 1JMZA 3FELA 2C1QA 1UREA 3NQ3A 1QFVA 1VYOA 4NNTA 2Q2MA 1EI5A 1GX8A 1SA8A 1VWHB 2R73A 1OBQA 3FYFA 4XMDA 4YGHA 2QOSC 4ORWA 2A2UA 2WPUA 1GT3A 1VWDB 4BBOA 4DCBA 5HAEA 2ASNX 3P24A 3I17A 4K19A 2C4IA 1I9HA 1T68X 2RQ0A 2ZAIA 1CBRA 3RZYA 3VGWA 4CDFA 3BX8A 2RA6A 5HCEC 2R56A 3BY0A 4ON1A 1ICMA 4NW4A 2Y3EA 4ZH9A 1LNMA 3BU1A 4U3QA 4HPBA 3WYPA 2Q2PA 3K3LA 1SWLA 4YVBA 1E00A 1ALBA 3KZAA 4BX7A 1IIUA 4I3DA 4MVEA 2A0AA 3WZOA 3ZUIA 4GDZA 3S60A 1NGLA 2BS5A 2X8TA 3QQ2A 3P6CA 1BRQA 1QY1A 5F1EA 1JBHA 4FGIB 1QQSA 1VYFA 1ERBA 3T1DA 1ZNKA 4JHQA 4KIIA 1RXJA 3APWA 1HY2A 2WEWA 1VPRA 2QO6A 3LTWA 3FLLA 5LJHA 3BRNA 3GAQA 2A5BA 1PEEA 5LKEA 1U17A 3E3CA 1WUBA 1SWHA 2W2AA 2ZAGA 1PBOA 5HCDC 1GGLA 2OF8A 2RTKA 3STKA 4OEMA 5HBSA 1N9YA 4ZR2A 4I9RA 3RDXA 1MM9A 3MX7A 4WBKA 3WJGA 3D96A 2FHNX 3UEWA 1JIWI 4Z28A 3KFFA 3CWKA 3WZNA 3P02A 5D48A 3TZSA 4XMGA 2OFAA 2NNEA 3FW4A 2CZUA 2RTBB 3FEKA 3PH6A 5K68A 1OSPO 1ZNDA 2OL8O 3UAQA 1EXSA 4ARHA 2UYWA 5CYBA 3P6EA 4XMFA 3RBYA 2CM9A 1S2PA 1VWIB 2I5ZO 3HWDA 3PK2A 2VDFA 1EW3A 3UEXA 4WFUA 3RSWA 1NBXA 4EQAC 2QO4A 2QM9A 4IMOA 4ZHDA 5HZ6A 4IAXA 1ZNEA 4Y59A 4L3RA 1TW4A 3RE5A 4ORRA 5IO7A 3AUMO 2CZTA 4GH7A 1Y52X 4OS8A 2WQ9A 2IZDB 5F6ZA 4OMXA 3SAOA 4CPHA 5HZ5A 2XKLA 4TLJA 4YCEA 1KT7A 3S5XA 1KZWA 3OJYC 2WWPA 1LFOA 1EUOA 4QRLA 4OMWA 2JGSA 1LDQA 4U46A 4B55A 4ID2A 3P6FA 4KT5A 1HQQA 4BX5B 5CE4A 2JU7A 2OVSA 1GXAA 1OEJA 1A2DA 3VHIA 4ZJ0A 1N0SA 1QFTA 1SLDB 1SWOA 2CM4A 3FR2A 1JYJA 2OVAA 3WXQA 4YGGA 4Y5DA 2BSZA 2JMBA 4BOEA 1CBQA 4CPEA 5F58A 5B3MO 2AH7X 4EKVA 3BSZE 3AEHA 3D95A 2OZQA 1SXUA 1W6FA 3EMMA 4INNA 2DM5A 4OKAA 2HKDA 4U9CA 1G7NA 4GGRA 4HFOA 4NYQA 4WFVA 1YIVA 2AT0X 3IFBA 4XMHA 1VYGA 2Q39A 4ODDA 2MJIA 4O3XB 4Z2OA 1A18A 3CKGA 2NP1A 1ZNGA 3RDUA 2LBVA 1LKEA 1SWNA 1FEMA 2X46A 3PEDA 3FIQA 3SZJA 3UEUA 1KGLA 2Q9SA 2RTCB 4GNWA 1SLEB 1SY2A 4MVIA 1X71A 1YWAA 2AKQA 1LCWA 2X4MA 1NDJA 3D97A 1KL5A 1Z24A 5HA1A 2FHLA 2FR3A 1TOUA 1KT3A 3P6HA 1L6MA 1U0XA 1EIOA 1BJ7A 1SRGA 1SXYA 1RLBE 2RN4A 4AZNA 1CRBA 2G7BA 2OL6O 4GGZA 5F2BA 1VWJB 1SWUA 2K62A 1VWBB 3D4RA 2PY1A 3NR3A 4CDCA 3RWXA 1R0UA 4A60A 2M4LA 4O4XA 4WHIA 3WZQA 1JMXA 1BEBA 1STSB 1VWMB 3CKFA 4NV7A 1X8UA 3RDQA 3VHHA 1OPBA 3FW5A 2RTPB 3H3IA 1STRB 1WBIA 5EPQA 1B4MA 1SWPA 1SWBA 2POAA 4IBAA 1X8QA 3N91A 3PQUA 5CSEA 1LUQA 3STNA 1BM5A 3TGAA 2IZBA 2L9CA 3F8AA 1QY2A 3MVFA 2A13A 4IAWA 5L8IA 2WSJA 2OY7A 1D2UA 2JU3A 4GJVA 1JJJA 5FFHA 3BX7A 1E06A 2FKJA 1VWOB 1QG5A 2OFRX 3MBTA 1SXXA 3ZW0B 3TGBA 4GD9A 4JGLA 2ACPX 4NV8A 5EDCA 4EXZA 2BHVA 3BU9A 2X8SA 1Y53X 5IXGA 1PBYA 3P6DA 3U0DA 2Y32A 5HCCC 1KL4A 4I3CA 2I5VO 4ML7B 4NYRA 3FR4A 3LHNA 2L68A 3NX1A 1XCAA 1GX3A 4CSBA 2LB6A 1PMPA 4O4UA 1H91A 3WOVA 3VG4A 1FJ1E 1OEEA 4GDAA 1GT1A 1YWCA 4QGVA 3KFHA 4PSQA 5F6BA 2HZQA 3ELZA 2JOZA 4O9SA 4U8UO 4Y0PA 5HTEA 1SREA 3VG6A 3AKMA 4IB7A 4UU3A 5KICA 2QMIA 1UYNX 3CBCA 4Y0QA 2G8CO 3B2LA 2MF6A 2FTBA 5IO5A 1IFCA 1ICNA 4U8UM 3WJDA 1NP1A 3SZHA 4BGFA 1KOIA 3CQNA 2IZKA 1JQPA 4QGWA 2QO5A 1HXLA 2AVIA 5D8JA 4YMYA 1OEKA 2RTAA 2RTLA 3FR5A 3CBSA 3HWGA 5H8TA 1KT6A 3WJBA 4YKOA 2JU8A 1U18A 1OBUA 1MOYA 1N43A 3FA9A 5F7GA 4BQUA 4YH0A 1S44A 1E02A 1JV4A 1SRHA 3PPTA 2LFOA 4YCHA 1I05A 5IRUA 2AT5X 2X8FA 2LBAA 3LV4A 4A8ZA 1FTPA 4KC7A 4IMNA 3TGCA 4PJ2A 3UEVA 2GH7A 1SXWA 2RTHB 4M7MA 4AZPA 1N4JA 2F09A 2RTMA 5AEOA 5EEEA 4O4OA 2Z4IA 4GUZA 5C0NA 4JO6A 4BX5A 3SZIA 3ZWEA 4Z2VA 1DF8A 5K06A 1SWQA 4ORXA 4GGTA 2XSTA 2W2FA 2L5PA 1LF7A 3G7XA 4HPDA 1KXOA 1EPAA 4IRWA 3ZI8A 4A1YA 3HOEA 3S26A 4GRJA 3SLJA 4I6SA 4BVMA 1IKEA 4XMEA 3ZW2A 1XKIA 2AF5A 3QKGA 3BLGA 3DSZA 1YP6A 2FWVA 4O3WA 1B0OA 1ML7A 2BC3A 3FA7A 4IB6A 3WJEA 1X8PA 4EFGA 1MX8A 1IFBA 1MK5A 1YUPA 3FA6A 2RCQA 2MM3A 3EM0A 4YKMA 5FAZA 3SLOA 3WZPA 5B5FA 4GZVA 1JYDA 2GC9A 1S7DA 1RAVA 2X56A 1QWDA 2MHDA 2OY1O 1OPAA 2AT3X 4GJSA 4MISA 2RTJA 4ORYA 1SWAA 5FQ8E 1UYOX 3WJCA 2WQAE 4DQ4A 4O3YA 2FR2A 3U9PC 2O62A 1SMPI 4IB8A 2L67A 1I4UA 3AKNA 5H9AA 4ZH6A 3RDMA 4FQBB 4C5PA 4TKHA 2RTOB 1EALA 3PECA 5D45A 5H9NA 3ZQ3A 4I3BA 2X45A 4TNNA 3RKGA 1DF3A 1A3YA 2ALLX 1AQBA 3HOLA 1KQWA 3FIDA 3MM0A 4LKPA 4NLJA 5EZ2A 3RY2A 2N93A 5JR8A 4ORUA 4FBVA 4AW8A 5HA0A 1ADLA 2DJGA 2LA7A 5IO6A 2HMBA 4XMCA 2KT4B 1LICA 2A8GA 3T6LA 3VG7A 1LCZA 2NNQA 3APVA 2QCBA 2A5CA 4ZFXA 1E5PA 5LJBA 3EBKA 5LJKA 2ANSA 1IW2A 1BSQA 1QABE 3D9WA 4ZHHA 2FRSA 1HMRA 5B27A 1SWGA 1SLFB 1SRFA 2W2BA 3O19A 2RTEB 1T8VA 3APUA 2YG2A 2OYBO 4LKTA 4QYPA 4GK9A 4CPHB 2RTRB 3EC5A 3O2YA 1HXZA 4MVLA 1EIIA 2OVEA 4QZUA 2RTFB 5AJCA 5B2AO 4BJ8A 4QAEA 3PH5A 5HWZA 3TF6A 3PP6A 4KC8A 2OY5O 5AQ6A 4OS0A 4TKBA 2FS6A 4YDAA 5EEDA 4TKJA 2NNDA 3ZW0A 4YFRA 1GKAB 3ZW1B 2AT6X 5EDBA 1TOWA 2ZSCA 3X00A 5D47A 2AL0X 2KTDA 2OL7A 1HBPA 2IZAA 2RTQB 1VWAB 2IZFB 3I0AA 1AVEA 2G5LA 2CBRA 3NX2A 2IZLB 2KD2A 3OE3A 4ALBA 4AZQA 4CPIA 4ZHCA 1SWSA 2RTIB 2WEXA 1A57A 4ES7A 3KFIA 3S5VA 1DZKA 1OBPA 2OVDA 3EYCA 1SWKA 3NQ9A 4RUUA 4I60A 2HYSA 1HMTA 1VWRB 4I95A 3B2KA 4FBRA 5L3YA 4O3ZA 1X8NA 3HPEA 1NP4A 1YWBA 1Y0GA 4U8UN 4KCAA 3CR6A 4DNEA 1SWFA 1O1UA 5JD2A 1AVGI 1I06A 3NP1A 4I9SA 2K23A 1AVDA 4GE1A 3SOTA 1ZRYA 1D3SA 2OF9A 4QNIA 5B29A 1SLGB 3FA8A 4AZOA 3F6ZB 4LQZA 4DQ3A 5LJCA 1B56A 1G74A 1VWKB 1JJUA 1DC9A 1MEPA 2IZEB 2MWHA 4O4SA 1ACDA 2KTSA 3HWFA 1PM1X 2CAMA 3FENA 1I78A 2VFBA 3BS2A 1RXKA 1KL3A 1Y9TA 1YP7A 5BVQA 1LELA 3IA8A 4ALOA 1SWEA 3OBLA 1N9MA 4L1NA 1G85A 1DZPA 4BX6B 1KT4A 2GJ5A 3RY1A 4ZHGA 5K67A 1AB0A 1KQXA 1STPA 1SWDA 1MUPA 4NNSA 4FBOA 1SY1A 3ZUOA 5HTDA 2P8GA 2RTNB 3OD9A 4Z2PA 2VFCA 1SWRA 1RXHA 4QGXA 2JN3A 1NC9A 1SRJA 1DFVA 4ZGUA 4NLIA 3FMZA 2EU7X 3VPJE 1Y55X 2G78A 1HN2A 4ZGFA 1VWNB 1BBPA 1LCVA 2DJFA 1HMSA 2F01A 3FEPA 5B11O 4AYHA 1MDCA 4Y0RA 4QYNA 2GTFX 4OS3A 5CHKA 3VG3A 5HZ8A 3RDOA 1EQDA 2IZJA 2LKKA 2MO5A 4YFQA 5KIDA 3SLTA 3HWEA 3T2WA 2RTDB 4D6AA 1ZNLA 3CQRA 3VE2A 1IKJA 1P6PA 1LIDA 4RUNA 2PI3O 4HPAA 3P6GA 3Q34A 3WBGA 1E2TA 1ERXA 4GU8A 5FQ7E 3ZZVA 2E4JA 2FT9A 4O49A 3HTYA 3O22A 4BX7B 1SY0A 2HLVA 1RSTB 5H9LA 3VG5A 3EW2A 4TJZA 1GX9A 4IABA 1TXLA 1N7YA 1RSUB 2AMMX 2RTGB 3C78X 3NBXX 2HNXA 4YFPA 1MX7A 3B2IA 5HZ9A 4GKCA 3CMPA 2GTLN 4KH8A 5L8OA 3VHMA 2C1SA 2IZHB 4YBPA 1LPJA 3APXA 1DZMA 1NQMA 1IJ8A 4GNYA 1VWGB 3STMX 4HWMA 4CK4A 1GM6A 3PDFA 2IZCB 4MVKA 3PQSA 3VE1A 2FLJA 2X55A 5AJBA 4YGZA 1LIBA 4YDBA 4GETA 3VG2A 3WJFA 4ZHFA 3T2XA 1QY0A 1KT5A 5IRWA 1KZXA 4CV7A 3C77X 5FENA 5KHPA 1W5RA 1LDOA 3U03A 3JSQA 1EPBA 2HZRA 3KFGA 1AELA 4ZCBA 1HBQA 1Y9LA 3FDCA 2FKGA 2Y3FA 4Z27A 4AZRA 1FDQA 2BS6A 2GTLO 1BLRA 1VWLB 2RCTA 4QZTA 1UZ2X 4BCSA 1BRPA 3C76X 1BSYA 3Q6LA 2WUTA 3RDSA 5LJDA 1K3BA 2OFBA 2BT9A 2GTLM 2RD7C 2IZGB 3HK1A 2Q4NA 1KFFA 5D4AA 3WVMA 2UZ2A 1GKAA 3ZW1A 1CBIA 1TVQA 3ELXA 3L4RA 4JNJA 1T0VA 4IB9A 4NP1A 5FQ6E 4CPFA 1CBSA 1VWQB 2F73A 1SWJA 4LZUA 3MG5A 1RBPA 4MIRA 5IRAA 1GT5A 5DPQA 5LKFA 4Z6JA 1JZUA 2FGSA 1K24A 2ACOA 2R74A 3JQOA 2YMSA 1VWFB 1ZNHA 1HQPA 2BLGA 4R0BA 4AZMA 1X89A 1FELA 5BVTA 3T6FA 5L8NA 5BVSA 1YWDA 1W4TA 1DZJA 1VWPB 3KQ0A 1LIEA 1DV9A 1FE3A 4MEEA 3JS1A 1JJXA 1PTSA 3V8UA 4UU2A 1BWYA 2X32A 1VWEB 1CJ5A 2G79A 4N7CA 3WYQA 4D6BA 3NQKA 5DG4A 5BYPA 4M6SA 1G5WA 1SWTA 2JW1A 4EDEA 3NPOA 1SRIA 4Y0SA 1X8OA 2IFBA 1SY3A 3F9DA 1I04A 1B8EA 2CBSA 4YBUA 1O8VA 3EW1A 5HZQA 4COTA 2IZIA 4LZVA 3RE6A 4A1HA
chains in the Genus database with same CATH topology
3VU1A 3GE2A 3B2HA 3BDRA 1BSOA 1LIFA 4HPCA 2Z4HA 2AT8X 5LJEA 2A3FX 2A2GA 2OFMX 1O1VA 2KW1A 1FENA 3B2JA 3DTQA 2WR6A 4TQ2A 4ORSA 1MVGA 2FS7A 1GT4A 4QQ1A 5H9KA 5LJGA 4N7DA 3EBWA 4EEJA 3NADA 3FELA 1UREA 3NQ3A 1QFVA 4NNTA 2Q2MA 1EI5A 1GX8A 1SA8A 2R73A 3FYFA 1OBQA 4XMDA 4YGHA 2QOSC 4ORWA 2A2UA 1GT3A 5HAEA 2ASNX 3P24A 3I17A 4K19A 2RQ0A 1T68X 2ZAIA 1CBRA 3RZYA 3BX8A 2RA6A 5HCEC 2R56A 3BY0A 4ON1A 1ICMA 4NW4A 4ZH9A 1LNMA 3BU1A 4U3QA 4HPBA 2Q2PA 3K3LA 1E00A 1ALBA 3KZAA 1IIUA 4I3DA 4MVEA 2A0AA 3ZUIA 4GDZA 3S60A 1NGLA 2BS5A 2X8TA 3P6CA 1BRQA 1QY1A 5F1EA 1JBHA 4FGIB 1QQSA 1VYFA 1ERBA 3T1DA 1ZNKA 4KIIA 3APWA 2WEWA 1VPRA 2QO6A 3FLLA 5LJHA 3BRNA 3GAQA 5LKEA 1PEEA 1U17A 3E3CA 2W2AA 2ZAGA 1PBOA 5HCDC 1GGLA 3STKA 5HBSA 4ZR2A 4I9RA 3MX7A 4WBKA 3WJGA 3D96A 3UEWA 1JIWI 3KFFA 3CWKA 3P02A 5D48A 3TZSA 2NNEA 3FW4A 2CZUA 3FEKA 3PH6A 1ZNDA 3UAQA 1EXSA 4ARHA 5CYBA 3P6EA 4XMFA 3RBYA 2CM9A 1S2PA 3HWDA 1EW3A 3UEXA 4WFUA 3RSWA 4EQAC 2QO4A 2QM9A 4IMOA 4ZHDA 5HZ6A 4IAXA 1ZNEA 4L3RA 1TW4A 4ORRA 5IO7A 2CZTA 4GH7A 4OS8A 2WQ9A 5F6ZA 4OMXA 3SAOA 5HZ5A 2XKLA 4TLJA 4YCEA 1KT7A 3S5XA 1KZWA 3OJYC 2WWPA 1LFOA 1EUOA 4QRLA 4OMWA 5CE4A 4ID2A 3P6FA 4KT5A 2JU7A 2OVSA 1GXAA 1OEJA 1A2DA 4ZJ0A 1N0SA 1QFTA 2CM4A 3FR2A 1JYJA 2OVAA 3WXQA 4YGGA 2JMBA 4BOEA 1CBQA 5F58A 2AH7X 3BSZE 3D95A 3EMMA 2OZQA 1SXUA 4INNA 4U9CA 4XMGA 2DM5A 1G7NA 4HFOA 4NYQA 4WFVA 1YIVA 2AT0X 3IFBA 4XMHA 1VYGA 2Q39A 4ODDA 2MJIA 4O3XB 1A18A 2NP1A 1ZNGA 2LBVA 1LKEA 1FEMA 2X46A 3PEDA 3FIQA 3UEUA 2Q9SA 4GNWA 4MVIA 1SY2A 1X71A 1YWAA 2AKQA 3D97A 1Z24A 5HA1A 2FR3A 1TOUA 1KT3A 3P6HA 1L6MA 1U0XA 1EIOA 1BJ7A 1SXYA 1RLBE 2RN4A 4AZNA 1CRBA 2G7BA 4QGVA 2K62A 3NR3A 3D4RA 2PY1A 3RWXA 1R0UA 4A60A 2M4LA 4O4XA 4WHIA 1BEBA 1X8UA 1OPBA 3FW5A 3H3IA 5EPQA 1B4MA 2POAA 4IBAA 1X8QA 3N91A 3PQUA 3STNA 1BM5A 3TGAA 2L9CA 3F8AA 1QY2A 3MVFA 2A13A 4IAWA 5L8IA 2WSJA 1JJJA 1D2UA 2JU3A 5FFHA 3BX7A 1E06A 1QG5A 2OFRX 3MBTA 1SXXA 3ZW0B 3TGBA 4JGLA 2ACPX 5EDCA 4EXZA 2BHVA 3BU9A 2X8SA 3U0DA 3P6DA 5HCCC 4I3CA 4ML7B 4NYRA 3FR4A 3LHNA 2L68A 3NX1A 1XCAA 4CSBA 2LB6A 1PMPA 4O4UA 1H91A 3WOVA 3VG4A 1OEEA 1GT1A 1YWCA 3KFHA 4PSQA 5F6BA 2HZQA 3ELZA 2JOZA 4O9SA 4U8UO 4Y0PA 5HTEA 3VG6A 3AKMA 4IB7A 4UU3A 2QMIA 3CBCA 4Y0QA 3B2LA 5IO5A 2FTBA 1IFCA 1ICNA 4U8UM 3WJDA 1NP1A 1KOIA 3CQNA 4QGWA 2QO5A 5D8JA 4YMYA 1OEKA 3FR5A 3CBSA 3HWGA 5H8TA 1KT6A 3WJBA 4YKOA 2JU8A 1U18A 1OBUA 5F7GA 3FA9A 4BQUA 4YH0A 1S44A 1E02A 1JV4A 3PPTA 2LFOA 4YCHA 1I05A 2AT5X 2X8FA 2LBAA 3LV4A 4A8ZA 1FTPA 4KC7A 4IMNA 4PJ2A 3UEVA 1SXWA 4M7MA 4AZPA 2F09A 5AEOA 5EEEA 4O4OA 2Z4IA 5C0NA 3ZWEA 5K06A 4ORXA 2XSTA 2W2FA 2L5PA 1LF7A 3G7XA 4HPDA 1KXOA 1EPAA 3ZI8A 4A1YA 3HOEA 3S26A 4GRJA 4I6SA 4BVMA 1IKEA 4XMEA 3ZW2A 1XKIA 3QKGA 3BLGA 3DSZA 1YP6A 2FWVA 4O3WA 1B0OA 1ML7A 3FA7A 4IB6A 3WJEA 4EFGA 1X8PA 3TGCA 1MX8A 1IFBA 3FA6A 1YUPA 4YKMA 2RCQA 2MM3A 3EM0A 5FAZA 4GZVA 1JYDA 2GC9A 1S7DA 1QWDA 2MHDA 5FQ8E 1OPAA 2AT3X 4MISA 4ORYA 3WJCA 2WQAE 4DQ4A 4O3YA 2FR2A 3U9PC 2O62A 1SMPI 4IB8A 2L67A 1I4UA 3AKNA 5H9AA 4ZH6A 4FQBB 4TKHA 1EALA 3PECA 5D45A 5H9NA 3ZQ3A 4I3BA 2X45A 4TNNA 3RKGA 1DF3A 1A3YA 2ALLX 1AQBA 3HOLA 1KQWA 4NLJA 4LKPA 5EZ2A 5JR8A 2N93A 4ORUA 4FBVA 4AW8A 5HA0A 1ADLA 2LA7A 5IO6A 2HMBA 4XMCA 2KT4B 1LICA 3VG7A 2NNQA 3APVA 4ZFXA 1E5PA 5LJBA 3EBKA 5LJKA 2ANSA 1IW2A 1BSQA 1QABE 4ZHHA 2FRSA 1HMRA 5B27A 2W2BA 3O19A 1T8VA 3APUA 2YG2A 4LKTA 4QYPA 4GK9A 3O2YA 1EIIA 4MVLA 2OVEA 4QZUA 5AJCA 4QAEA 3PH5A 5HWZA 3TF6A 3PP6A 4KC8A 5AQ6A 4OS0A 4TKBA 2FS6A 4YDAA 5EEDA 4TKJA 2NNDA 3ZW0A 4YFRA 1GKAB 3ZW1B 2AT6X 5EDBA 1TOWA 5D47A 2AL0X 2KTDA 1HBPA 3I0AA 5KICA 4ALBA 2CBRA 3NX2A 4AZQA 2KD2A 3OE3A 4ZHCA 1A57A 2WEXA 4ES7A 3KFIA 3S5VA 1DZKA 1OBPA 2OVDA 3EYCA 4RUUA 3NQ9A 2HYSA 1HMTA 4FBRA 4I95A 3B2KA 4O3ZA 1X8NA 1NP4A 1YWBA 4U8UN 4KCAA 3CR6A 1O1UA 1AVGI 1I06A 3NP1A 4I9SA 2K23A 4GE1A 3SOTA 1ZRYA 1D3SA 4QNIA 5B29A 3FA8A 4AZOA 3F6ZB 4LQZA 4DQ3A 5LJCA 1B56A 1G74A 1DC9A 2MWHA 4O4SA 1ACDA 2KTSA 3HWFA 1PM1X 3FENA 3BS2A 1YP7A 1Y9TA 5BVQA 3IA8A 4ALOA 3OBLA 4L1NA 1G85A 1DZPA 1KT4A 2GJ5A 4ZHGA 1KGLA 1AB0A 1KQXA 5HTDA 4NNSA 1MUPA 4FBOA 1SY1A 3ZUOA 2P8GA 3OD9A 4QGXA 2JN3A 1DFVA 4ZGUA 4NLIA 3FMZA 2EU7X 3VPJE 2G78A 1HN2A 4ZGFA 1BBPA 3FEPA 1HMSA 4AYHA 1MDCA 4Y0RA 4QYNA 2GTFX 4OS3A 3VG3A 5HZ8A 1EQDA 2LKKA 2MO5A 4YFQA 5KIDA 3HWEA 4D6AA 1ZNLA 3CQRA 3VE2A 1IKJA 1P6PA 1LIDA 4RUNA 4HPAA 3P6GA 3WBGA 1ERXA 4GU8A 5FQ7E 3ZZVA 2E4JA 2FT9A 4O49A 3HTYA 3O22A 1SY0A 2HLVA 5H9LA 3VG5A 4TJZA 1GX9A 4IABA 1TXLA 3C78X 2AMMX 3NBXX 4YFPA 2HNXA 1MX7A 3B2IA 5HZ9A 4GKCA 3CMPA 2GTLN 4KH8A 5L8OA 4YBPA 1LPJA 3APXA 1DZMA 4GNYA 3STMX 4HWMA 4CK4A 1GM6A 4MVKA 3VE1A 3PQSA 2FLJA 5AJBA 4YGZA 1LIBA 4YDBA 4GETA 3VG2A 3WJFA 4ZHFA 1QY0A 1KT5A 1KZXA 4CV7A 3C77X 5FENA 5KHPA 3U03A 3JSQA 1EPBA 2HZRA 3KFGA 1AELA 4ZCBA 1HBQA 1Y9LA 4AZRA 1FDQA 2BS6A 2GTLO 1BLRA 2RCTA 4QZTA 1UZ2X 1BRPA 3C76X 1BSYA 3Q6LA 2WUTA 5LJDA 2BT9A 2GTLM 2RD7C 3HK1A 2Q4NA 5D4AA 3WVMA 1GKAA 3ZW1A 1CBIA 1TVQA 3ELXA 3L4RA 1T0VA 4IB9A 4NP1A 5FQ6E 1CBSA 2F73A 4LZUA 1RBPA 4MIRA 1GT5A 5DPQA 5LKFA 1JZUA 2R74A 2ACOA 3JQOA 2YMSA 1ZNHA 2BLGA 1HQPA 4R0BA 4AZMA 1X89A 1FELA 5BVTA 5L8NA 5BVSA 1YWDA 1DZJA 3KQ0A 1LIEA 1DV9A 1FE3A 1JJXA 3JS1A 3V8UA 4UU2A 1BWYA 1CJ5A 2G79A 4N7CA 4D6BA 3NQKA 5DG4A 5BYPA 4M6SA 1G5WA 2JW1A 4EDEA 3NPOA 4Y0SA 1X8OA 2IFBA 1SY3A 3F9DA 1I04A 1B8EA 2CBSA 4YBUA 1O8VA 5HZQA 4COTA 4LZVA 4A1HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B2H A;  3BDR A;  1BSO A;  1LIF A;  4HPC A;  2AT8 X;  5LJE A;  2A3F X;  2A2G A;  2OFM X;  1O1V A;  1FEN A;  3B2J A;  3DTQ A;  2WR6 A;  4TQ2 A;  4ORS A;  1MVG A;  2FS7 A;  1GT4 A;  5H9K A;  5LJG A;  4N7D A;  3EBW A;  4EEJ A;  3NAD A;  3FEL A;  1URE A;  3NQ3 A;  1QFV A;  4NNT A;  2Q2M A;  1GX8 A;  1SA8 A;  2R73 A;  1OBQ A;  4XMD A;  4YGH A;  2QOS C;  4ORW A;  2A2U A;  1GT3 A;  5HAE A;  2ASN X;  4K19 A;  3I17 A;  2RQ0 A;  1T68 X;  1CBR A;  3RZY A;  3BX8 A;  2RA6 A;  5HCE C;  2R56 A;  3BY0 A;  1ICM A;  4ZH9 A;  1LNM A;  3BU1 A;  4HPB A;  2Q2P A;  3K3L A;  1E00 A;  1ALB A;  3KZA A;  1IIU A;  4I3D A;  2A0A A;  3ZUI A;  1NGL A;  3P6C A;  1BRQ A;  1QY1 A;  5F1E A;  1JBH A;  1QQS A;  1VYF A;  1ERB A;  3T1D A;  1ZNK A;  4KII A;  3APW A;  2WEW A;  1VPR A;  2QO6 A;  3FLL A;  5LJH A;  3BRN A;  3GAQ A;  5LKE A;  1PEE A;  1U17 A;  2W2A A;  1PBO A;  5HCD C;  1GGL A;  3STK A;  5HBS A;  4ZR2 A;  4I9R A;  4WBK A;  3WJG A;  3D96 A;  3UEW A;  3KFF A;  3CWK A;  5D48 A;  3TZS A;  2NNE A;  3FW4 A;  2CZU A;  3FEK A;  3PH6 A;  1ZND A;  1EXS A;  4ARH A;  3P6E A;  4XMF A;  2CM9 A;  1S2P A;  3HWD A;  1EW3 A;  3UEX A;  4WFU A;  3RSW A;  4ZHD A;  2QO4 A;  2QM9 A;  4IMO A;  5HZ6 A;  4IAX A;  1ZNE A;  1TW4 A;  4ORR A;  5IO7 A;  2CZT A;  4GH7 A;  4OS8 A;  2WQ9 A;  5F6Z A;  4OMX A;  3SAO A;  5HZ5 A;  2XKL A;  4TLJ A;  4YCE A;  1KT7 A;  1KZW A;  3OJY C;  2WWP A;  1LFO A;  1EUO A;  4OMW A;  5CE4 A;  3P6F A;  2JU7 A;  1GXA A;  1OEJ A;  1A2D A;  4ZJ0 A;  1N0S A;  1QFT A;  2CM4 A;  3FR2 A;  1JYJ A;  2OVA A;  3WXQ A;  4YGG A;  4BOE A;  1CBQ A;  5F58 A;  2AH7 X;  3BSZ E;  3D95 A;  3EMM A;  2OZQ A;  1SXU A;  4XMG A;  2DM5 A;  1G7N A;  4HFO A;  4NYQ A;  4WFV A;  1YIV A;  2AT0 X;  3IFB A;  4XMH A;  1VYG A;  2Q39 A;  4ODD A;  2MJI A;  1A18 A;  2NP1 A;  1ZNG A;  2LBV A;  1LKE A;  1FEM A;  2X46 A;  3PED A;  3FIQ A;  3UEU A;  2Q9S A;  4GNW A;  4MVI A;  1SY2 A;  1X71 A;  1YWA A;  2AKQ A;  3D97 A;  1Z24 A;  5HA1 A;  2FR3 A;  1TOU A;  1KT3 A;  3P6H A;  1L6M A;  1U0X A;  1EIO A;  1BJ7 A;  1SXY A;  1RLB E;  4AZN A;  1CRB A;  2G7B A;  4QGV A;  2K62 A;  3NR3 A;  2PY1 A;  1R0U A;  4A60 A;  1BEB A;  1X8U A;  1OPB A;  3FW5 A;  5EPQ A;  1B4M A;  2POA A;  4IBA A;  1X8Q A;  3STN A;  1BM5 A;  3TGA A;  2L9C A;  3F8A A;  1QY2 A;  3MVF A;  2A13 A;  4IAW A;  5L8I A;  2WSJ A;  1JJJ A;  1D2U A;  2JU3 A;  5FFH A;  3BX7 A;  1E06 A;  1QG5 A;  2OFR X;  3MBT A;  1SXX A;  3TGB A;  2ACP X;  5EDC A;  4EXZ A;  3BU9 A;  3U0D A;  3P6D A;  5HCC C;  4I3C A;  4NYR A;  3FR4 A;  2L68 A;  3NX1 A;  1XCA A;  2LB6 A;  1PMP A;  1H91 A;  3VG4 A;  1OEE A;  1GT1 A;  1YWC A;  3KFH A;  4PSQ A;  5F6B A;  2HZQ A;  3ELZ A;  2JOZ A;  4O9S A;  4Y0P A;  5HTE A;  3VG6 A;  3AKM A;  4IB7 A;  4UU3 A;  3CBC A;  4Y0Q A;  3B2L A;  5IO5 A;  2FTB A;  1IFC A;  1ICN A;  3WJD A;  1NP1 A;  1KOI A;  3CQN A;  4QGW A;  2QO5 A;  5D8J A;  4YMY A;  1OEK A;  3FR5 A;  3CBS A;  3HWG A;  5H8T A;  1KT6 A;  3WJB A;  4YKO A;  2JU8 A;  1U18 A;  1OBU A;  5F7G A;  3FA9 A;  4BQU A;  4YH0 A;  1S44 A;  1E02 A;  1JV4 A;  3PPT A;  2LFO A;  4YCH A;  1I05 A;  2AT5 X;  2LBA A;  4A8Z A;  1FTP A;  4IMN A;  3UEV A;  1SXW A;  4M7M A;  4AZP A;  5EEE A;  5C0N A;  5K06 A;  4ORX A;  2XST A;  2W2F A;  2L5P A;  1LF7 A;  3G7X A;  4HPD A;  1KXO A;  1EPA A;  4A1Y A;  3S26 A;  4GRJ A;  4BVM A;  1IKE A;  4XME A;  1XKI A;  3QKG A;  3BLG A;  3DSZ A;  1YP6 A;  2FWV A;  3WJE A;  1B0O A;  1ML7 A;  3FA7 A;  4IB6 A;  4EFG A;  3TGC A;  1X8P A;  1MX8 A;  1IFB A;  3FA6 A;  1YUP A;  4YKM A;  2RCQ A;  2MM3 A;  3EM0 A;  5FAZ A;  1JYD A;  2GC9 A;  1S7D A;  1QWD A;  1OPA A;  2AT3 X;  4ORY A;  3WJC A;  2WQA E;  4DQ4 A;  2FR2 A;  3U9P C;  2O62 A;  4IB8 A;  2L67 A;  1I4U A;  3AKN A;  5H9A A;  4ZH6 A;  4TKH A;  1EAL A;  3PEC A;  5D45 A;  5H9N A;  3ZQ3 A;  4I3B A;  2X45 A;  4TNN A;  1DF3 A;  1A3Y A;  2ALL X;  1AQB A;  4NLJ A;  1KQW A;  4LKP A;  5EZ2 A;  5JR8 A;  2N93 A;  4ORU A;  4AW8 A;  5HA0 A;  1ADL A;  5IO6 A;  2HMB A;  4XMC A;  2KT4 B;  1LIC A;  3VG7 A;  2NNQ A;  3APV A;  4ZFX A;  1E5P A;  5LJB A;  3EBK A;  5LJK A;  2ANS A;  1IW2 A;  1BSQ A;  1QAB E;  4ZHH A;  2FRS A;  1HMR A;  5B27 A;  2W2B A;  3O19 A;  1T8V A;  3APU A;  2YG2 A;  4LKT A;  4QYP A;  3O2Y A;  1EII A;  4MVL A;  2OVE A;  4QZU A;  4QAE A;  3PH5 A;  5HWZ A;  3TF6 A;  3PP6 A;  5AQ6 A;  4OS0 A;  4TKB A;  2FS6 A;  4YDA A;  5EED A;  4TKJ A;  2NND A;  4YFR A;  1GKA B;  2AT6 X;  5EDB A;  1TOW A;  5D47 A;  2AL0 X;  2KTD A;  1HBP A;  3I0A A;  5KIC A;  4ALB A;  2CBR A;  3NX2 A;  4AZQ A;  4ZHC A;  1A57 A;  2WEX A;  4ES7 A;  3KFI A;  1DZK A;  1OBP A;  2OVD A;  3EYC A;  4RUU A;  3NQ9 A;  2HYS A;  1HMT A;  3B2K A;  1X8N A;  1NP4 A;  1YWB A;  3CR6 A;  1O1U A;  1AVG I;  1I06 A;  3NP1 A;  4I9S A;  2K23 A;  4GE1 A;  1ZRY A;  1D3S A;  5B29 A;  3FA8 A;  4AZO A;  4DQ3 A;  5LJC A;  1B56 A;  1G74 A;  1DC9 A;  1ACD A;  3HWF A;  1PM1 X;  3FEN A;  3BS2 A;  1YP7 A;  5BVQ A;  3IA8 A;  4ALO A;  1G85 A;  1DZP A;  1KT4 A;  2GJ5 A;  4ZHG A;  1KGL A;  1AB0 A;  1KQX A;  5HTD A;  4NNS A;  1MUP A;  3ZUO A;  1SY1 A;  2P8G A;  4QGX A;  2JN3 A;  1DFV A;  4ZGU A;  4NLI A;  3FMZ A;  2EU7 X;  2G78 A;  1HN2 A;  1BBP A;  3FEP A;  1HMS A;  4AYH A;  1MDC A;  4Y0R A;  4QYN A;  2GTF X;  4OS3 A;  3VG3 A;  5HZ8 A;  1EQD A;  2LKK A;  2MO5 A;  4YFQ A;  5KID A;  3HWE A;  4D6A A;  1ZNL A;  3CQR A;  1IKJ A;  1P6P A;  1LID A;  4RUN A;  4HPA A;  3P6G A;  3WBG A;  1ERX A;  2E4J A;  2FT9 A;  3O22 A;  1SY0 A;  2HLV A;  5H9L A;  3VG5 A;  4TJZ A;  1GX9 A;  4YFP A;  1TXL A;  3C78 X;  2AMM X;  2HNX A;  1MX7 A;  3B2I A;  5HZ9 A;  4GKC A;  3CMP A;  5L8O A;  4YBP A;  1LPJ A;  3APX A;  1DZM A;  4GNY A;  3STM X;  4CK4 A;  1GM6 A;  4MVK A;  2FLJ A;  3WJF A;  4YGZ A;  1LIB A;  4YDB A;  4GET A;  3VG2 A;  4ZHF A;  1QY0 A;  1KT5 A;  1KZX A;  5FEN A;  3C77 X;  5KHP A;  3U03 A;  3JSQ A;  1EPB A;  2HZR A;  3KFG A;  1AEL A;  4ZCB A;  1HBQ A;  4AZR A;  1FDQ A;  1BLR A;  2RCT A;  4QZT A;  1UZ2 X;  1BRP A;  3C76 X;  1BSY A;  3Q6L A;  2WUT A;  5LJD A;  2RD7 C;  3HK1 A;  2Q4N A;  5D4A A;  3WVM A;  1GKA A;  1CBI A;  1TVQ A;  3ELX A;  3L4R A;  1T0V A;  4IB9 A;  4NP1 A;  1CBS A;  2F73 A;  4LZU A;  1RBP A;  1GT5 A;  5DPQ A;  5LKF A;  1JZU A;  2R74 A;  2ACO A;  1ZNH A;  2BLG A;  1HQP A;  4R0B A;  4AZM A;  1X89 A;  1FEL A;  5BVT A;  5L8N A;  5BVS A;  1YWD A;  1DZJ A;  3KQ0 A;  1LIE A;  1DV9 A;  1FE3 A;  1JJX A;  3JS1 A;  1BWY A;  4UU2 A;  1CJ5 A;  2G79 A;  4N7C A;  4D6B A;  5DG4 A;  4M6S A;  1G5W A;  4EDE A;  3NPO A;  4Y0S A;  1X8O A;  2IFB A;  1SY3 A;  3F9D A;  1I04 A;  1B8E A;  2CBS A;  4YBU A;  1O8V A;  5HZQ A;  4LZV A;  4A1H A; 
#chains in the Genus database with same CATH topology
 3VU1 A;  2QOM A;  3GE2 A;  4OEL A;  2OY8 A;  3B2H A;  1BSO A;  3BDR A;  3KVN A;  1LIF A;  4HPC A;  2Z4H A;  2AT8 X;  5LJE A;  2A3F X;  2A2G A;  2OFM X;  5B10 O;  1O1V A;  2KW1 A;  4BX6 A;  4CDD A;  4CDE A;  1FEN A;  1NQN A;  2X34 A;  3B2J A;  3DTQ A;  5B5G A;  2WR6 A;  4TQ2 A;  4ORS A;  1MVG A;  2FS7 A;  1GT4 A;  4QQ1 A;  5H9K A;  5LJG A;  4N7D A;  1SWC A;  3EBW A;  4EEJ A;  3NAD A;  1VWC B;  1JMZ A;  3FEL A;  2C1Q A;  1URE A;  3NQ3 A;  1QFV A;  1VYO A;  4NNT A;  2Q2M A;  1EI5 A;  1GX8 A;  1SA8 A;  1VWH B;  2R73 A;  1OBQ A;  3FYF A;  4XMD A;  4YGH A;  2QOS C;  4ORW A;  2A2U A;  2WPU A;  1GT3 A;  1VWD B;  4BBO A;  4DCB A;  5HAE A;  2ASN X;  3P24 A;  3I17 A;  4K19 A;  2C4I A;  1I9H A;  1T68 X;  2RQ0 A;  2ZAI A;  1CBR A;  3RZY A;  3VGW A;  4CDF A;  3BX8 A;  2RA6 A;  5HCE C;  2R56 A;  3BY0 A;  4ON1 A;  1ICM A;  4NW4 A;  2Y3E A;  4ZH9 A;  1LNM A;  3BU1 A;  4U3Q A;  4HPB A;  3WYP A;  2Q2P A;  3K3L A;  1SWL A;  4YVB A;  1E00 A;  1ALB A;  3KZA A;  4BX7 A;  1IIU A;  4I3D A;  4MVE A;  2A0A A;  3WZO A;  3ZUI A;  4GDZ A;  3S60 A;  1NGL A;  2BS5 A;  2X8T A;  3QQ2 A;  3P6C A;  1BRQ A;  1QY1 A;  5F1E A;  1JBH A;  4FGI B;  1QQS A;  1VYF A;  1ERB A;  3T1D A;  1ZNK A;  4JHQ A;  4KII A;  1RXJ A;  3APW A;  1HY2 A;  2WEW A;  1VPR A;  2QO6 A;  3LTW A;  3FLL A;  5LJH A;  3BRN A;  3GAQ A;  2A5B A;  1PEE A;  5LKE A;  1U17 A;  3E3C A;  1WUB A;  1SWH A;  2W2A A;  2ZAG A;  1PBO A;  5HCD C;  1GGL A;  2OF8 A;  2RTK A;  3STK A;  4OEM A;  5HBS A;  1N9Y A;  4ZR2 A;  4I9R A;  3RDX A;  1MM9 A;  3MX7 A;  4WBK A;  3WJG A;  3D96 A;  2FHN X;  3UEW A;  1JIW I;  4Z28 A;  3KFF A;  3CWK A;  3WZN A;  3P02 A;  5D48 A;  3TZS A;  4XMG A;  2OFA A;  2NNE A;  3FW4 A;  2CZU A;  2RTB B;  3FEK A;  3PH6 A;  5K68 A;  1OSP O;  1ZND A;  2OL8 O;  3UAQ A;  1EXS A;  4ARH A;  2UYW A;  5CYB A;  3P6E A;  4XMF A;  3RBY A;  2CM9 A;  1S2P A;  1VWI B;  2I5Z O;  3HWD A;  3PK2 A;  2VDF A;  1EW3 A;  3UEX A;  4WFU A;  3RSW A;  1NBX A;  4EQA C;  2QO4 A;  2QM9 A;  4IMO A;  4ZHD A;  5HZ6 A;  4IAX A;  1ZNE A;  4Y59 A;  4L3R A;  1TW4 A;  3RE5 A;  4ORR A;  5IO7 A;  3AUM O;  2CZT A;  4GH7 A;  1Y52 X;  4OS8 A;  2WQ9 A;  2IZD B;  5F6Z A;  4OMX A;  3SAO A;  4CPH A;  5HZ5 A;  2XKL A;  4TLJ A;  4YCE A;  1KT7 A;  3S5X A;  1KZW A;  3OJY C;  2WWP A;  1LFO A;  1EUO A;  4QRL A;  4OMW A;  2JGS A;  1LDQ A;  4U46 A;  4B55 A;  4ID2 A;  3P6F A;  4KT5 A;  1HQQ A;  4BX5 B;  5CE4 A;  2JU7 A;  2OVS A;  1GXA A;  1OEJ A;  1A2D A;  3VHI A;  4ZJ0 A;  1N0S A;  1QFT A;  1SLD B;  1SWO A;  2CM4 A;  3FR2 A;  1JYJ A;  2OVA A;  3WXQ A;  4YGG A;  4Y5D A;  2BSZ A;  2JMB A;  4BOE A;  1CBQ A;  4CPE A;  5F58 A;  5B3M O;  2AH7 X;  4EKV A;  3BSZ E;  3AEH A;  3D95 A;  2OZQ A;  1SXU A;  1W6F A;  3EMM A;  4INN A;  2DM5 A;  4OKA A;  2HKD A;  4U9C A;  1G7N A;  4GGR A;  4HFO A;  4NYQ A;  4WFV A;  1YIV A;  2AT0 X;  3IFB A;  4XMH A;  1VYG A;  2Q39 A;  4ODD A;  2MJI A;  4O3X B;  4Z2O A;  1A18 A;  3CKG A;  2NP1 A;  1ZNG A;  3RDU A;  2LBV A;  1LKE A;  1SWN A;  1FEM A;  2X46 A;  3PED A;  3FIQ A;  3SZJ A;  3UEU A;  1KGL A;  2Q9S A;  2RTC B;  4GNW A;  1SLE B;  1SY2 A;  4MVI A;  1X71 A;  1YWA A;  2AKQ A;  1LCW A;  2X4M A;  1NDJ A;  3D97 A;  1KL5 A;  1Z24 A;  5HA1 A;  2FHL A;  2FR3 A;  1TOU A;  1KT3 A;  3P6H A;  1L6M A;  1U0X A;  1EIO A;  1BJ7 A;  1SRG A;  1SXY A;  1RLB E;  2RN4 A;  4AZN A;  1CRB A;  2G7B A;  2OL6 O;  4GGZ A;  5F2B A;  1VWJ B;  1SWU A;  2K62 A;  1VWB B;  3D4R A;  2PY1 A;  3NR3 A;  4CDC A;  3RWX A;  1R0U A;  4A60 A;  2M4L A;  4O4X A;  4WHI A;  3WZQ A;  1JMX A;  1BEB A;  1STS B;  1VWM B;  3CKF A;  4NV7 A;  1X8U A;  3RDQ A;  3VHH A;  1OPB A;  3FW5 A;  2RTP B;  3H3I A;  1STR B;  1WBI A;  5EPQ A;  1B4M A;  1SWP A;  1SWB A;  2POA A;  4IBA A;  1X8Q A;  3N91 A;  3PQU A;  5CSE A;  1LUQ A;  3STN A;  1BM5 A;  3TGA A;  2IZB A;  2L9C A;  3F8A A;  1QY2 A;  3MVF A;  2A13 A;  4IAW A;  5L8I A;  2WSJ A;  2OY7 A;  1D2U A;  2JU3 A;  4GJV A;  1JJJ A;  5FFH A;  3BX7 A;  1E06 A;  2FKJ A;  1VWO B;  1QG5 A;  2OFR X;  3MBT A;  1SXX A;  3ZW0 B;  3TGB A;  4GD9 A;  4JGL A;  2ACP X;  4NV8 A;  5EDC A;  4EXZ A;  2BHV A;  3BU9 A;  2X8S A;  1Y53 X;  5IXG A;  1PBY A;  3P6D A;  3U0D A;  2Y32 A;  5HCC C;  1KL4 A;  4I3C A;  2I5V O;  4ML7 B;  4NYR A;  3FR4 A;  3LHN A;  2L68 A;  3NX1 A;  1XCA A;  1GX3 A;  4CSB A;  2LB6 A;  1PMP A;  4O4U A;  1H91 A;  3WOV A;  3VG4 A;  1FJ1 E;  1OEE A;  4GDA A;  1GT1 A;  1YWC A;  4QGV A;  3KFH A;  4PSQ A;  5F6B A;  2HZQ A;  3ELZ A;  2JOZ A;  4O9S A;  4U8U O;  4Y0P A;  5HTE A;  1SRE A;  3VG6 A;  3AKM A;  4IB7 A;  4UU3 A;  5KIC A;  2QMI A;  1UYN X;  3CBC A;  4Y0Q A;  2G8C O;  3B2L A;  2MF6 A;  2FTB A;  5IO5 A;  1IFC A;  1ICN A;  4U8U M;  3WJD A;  1NP1 A;  3SZH A;  4BGF A;  1KOI A;  3CQN A;  2IZK A;  1JQP A;  4QGW A;  2QO5 A;  1HXL A;  2AVI A;  5D8J A;  4YMY A;  1OEK A;  2RTA A;  2RTL A;  3FR5 A;  3CBS A;  3HWG A;  5H8T A;  1KT6 A;  3WJB A;  4YKO A;  2JU8 A;  1U18 A;  1OBU A;  1MOY A;  1N43 A;  3FA9 A;  5F7G A;  4BQU A;  4YH0 A;  1S44 A;  1E02 A;  1JV4 A;  1SRH A;  3PPT A;  2LFO A;  4YCH A;  1I05 A;  5IRU A;  2AT5 X;  2X8F A;  2LBA A;  3LV4 A;  4A8Z A;  1FTP A;  4KC7 A;  4IMN A;  3TGC A;  4PJ2 A;  3UEV A;  2GH7 A;  1SXW A;  2RTH B;  4M7M A;  4AZP A;  1N4J A;  2F09 A;  2RTM A;  5AEO A;  5EEE A;  4O4O A;  2Z4I A;  4GUZ A;  5C0N A;  4JO6 A;  4BX5 A;  3SZI A;  3ZWE A;  4Z2V A;  1DF8 A;  5K06 A;  1SWQ A;  4ORX A;  4GGT A;  2XST A;  2W2F A;  2L5P A;  1LF7 A;  3G7X A;  4HPD A;  1KXO A;  1EPA A;  4IRW A;  3ZI8 A;  4A1Y A;  3HOE A;  3S26 A;  4GRJ A;  3SLJ A;  4I6S A;  4BVM A;  1IKE A;  4XME A;  3ZW2 A;  1XKI A;  2AF5 A;  3QKG A;  3BLG A;  3DSZ A;  1YP6 A;  2FWV A;  4O3W A;  1B0O A;  1ML7 A;  2BC3 A;  3FA7 A;  4IB6 A;  3WJE A;  1X8P A;  4EFG A;  1MX8 A;  1IFB A;  1MK5 A;  1YUP A;  3FA6 A;  2RCQ A;  2MM3 A;  3EM0 A;  4YKM A;  5FAZ A;  3SLO A;  3WZP A;  5B5F A;  4GZV A;  1JYD A;  2GC9 A;  1S7D A;  1RAV A;  2X56 A;  1QWD A;  2MHD A;  2OY1 O;  1OPA A;  2AT3 X;  4GJS A;  4MIS A;  2RTJ A;  4ORY A;  1SWA A;  5FQ8 E;  1UYO X;  3WJC A;  2WQA E;  4DQ4 A;  4O3Y A;  2FR2 A;  3U9P C;  2O62 A;  1SMP I;  4IB8 A;  2L67 A;  1I4U A;  3AKN A;  5H9A A;  4ZH6 A;  3RDM A;  4FQB B;  4C5P A;  4TKH A;  2RTO B;  1EAL A;  3PEC A;  5D45 A;  5H9N A;  3ZQ3 A;  4I3B A;  2X45 A;  4TNN A;  3RKG A;  1DF3 A;  1A3Y A;  2ALL X;  1AQB A;  3HOL A;  1KQW A;  3FID A;  3MM0 A;  4LKP A;  4NLJ A;  5EZ2 A;  3RY2 A;  2N93 A;  5JR8 A;  4ORU A;  4FBV A;  4AW8 A;  5HA0 A;  1ADL A;  2DJG A;  2LA7 A;  5IO6 A;  2HMB A;  4XMC A;  2KT4 B;  1LIC A;  2A8G A;  3T6L A;  3VG7 A;  1LCZ A;  2NNQ A;  3APV A;  2QCB A;  2A5C A;  4ZFX A;  1E5P A;  5LJB A;  3EBK A;  5LJK A;  2ANS A;  1IW2 A;  1BSQ A;  1QAB E;  3D9W A;  4ZHH A;  2FRS A;  1HMR A;  5B27 A;  1SWG A;  1SLF B;  1SRF A;  2W2B A;  3O19 A;  2RTE B;  1T8V A;  3APU A;  2YG2 A;  2OYB O;  4LKT A;  4QYP A;  4GK9 A;  4CPH B;  2RTR B;  3EC5 A;  3O2Y A;  1HXZ A;  4MVL A;  1EII A;  2OVE A;  4QZU A;  2RTF B;  5AJC A;  5B2A O;  4BJ8 A;  4QAE A;  3PH5 A;  5HWZ A;  3TF6 A;  3PP6 A;  4KC8 A;  2OY5 O;  5AQ6 A;  4OS0 A;  4TKB A;  2FS6 A;  4YDA A;  5EED A;  4TKJ A;  2NND A;  3ZW0 A;  4YFR A;  1GKA B;  3ZW1 B;  2AT6 X;  5EDB A;  1TOW A;  2ZSC A;  3X00 A;  5D47 A;  2AL0 X;  2KTD A;  2OL7 A;  1HBP A;  2IZA A;  2RTQ B;  1VWA B;  2IZF B;  3I0A A;  1AVE A;  2G5L A;  2CBR A;  3NX2 A;  2IZL B;  2KD2 A;  3OE3 A;  4ALB A;  4AZQ A;  4CPI A;  4ZHC A;  1SWS A;  2RTI B;  2WEX A;  1A57 A;  4ES7 A;  3KFI A;  3S5V A;  1DZK A;  1OBP A;  2OVD A;  3EYC A;  1SWK A;  3NQ9 A;  4RUU A;  4I60 A;  2HYS A;  1HMT A;  1VWR B;  4I95 A;  3B2K A;  4FBR A;  5L3Y A;  4O3Z A;  1X8N A;  3HPE A;  1NP4 A;  1YWB A;  1Y0G A;  4U8U N;  4KCA A;  3CR6 A;  4DNE A;  1SWF A;  1O1U A;  5JD2 A;  1AVG I;  1I06 A;  3NP1 A;  4I9S A;  2K23 A;  1AVD A;  4GE1 A;  3SOT A;  1ZRY A;  1D3S A;  2OF9 A;  4QNI A;  5B29 A;  1SLG B;  3FA8 A;  4AZO A;  3F6Z B;  4LQZ A;  4DQ3 A;  5LJC A;  1B56 A;  1G74 A;  1VWK B;  1JJU A;  1DC9 A;  1MEP A;  2IZE B;  2MWH A;  4O4S A;  1ACD A;  2KTS A;  3HWF A;  1PM1 X;  2CAM A;  3FEN A;  1I78 A;  2VFB A;  3BS2 A;  1RXK A;  1KL3 A;  1Y9T A;  1YP7 A;  5BVQ A;  1LEL A;  3IA8 A;  4ALO A;  1SWE A;  3OBL A;  1N9M A;  4L1N A;  1G85 A;  1DZP A;  4BX6 B;  1KT4 A;  2GJ5 A;  3RY1 A;  4ZHG A;  5K67 A;  1AB0 A;  1KQX A;  1STP A;  1SWD A;  1MUP A;  4NNS A;  4FBO A;  1SY1 A;  3ZUO A;  5HTD A;  2P8G A;  2RTN B;  3OD9 A;  4Z2P A;  2VFC A;  1SWR A;  1RXH A;  4QGX A;  2JN3 A;  1NC9 A;  1SRJ A;  1DFV A;  4ZGU A;  4NLI A;  3FMZ A;  2EU7 X;  3VPJ E;  1Y55 X;  2G78 A;  1HN2 A;  4ZGF A;  1VWN B;  1BBP A;  1LCV A;  2DJF A;  1HMS A;  2F01 A;  3FEP A;  5B11 O;  4AYH A;  1MDC A;  4Y0R A;  4QYN A;  2GTF X;  4OS3 A;  5CHK A;  3VG3 A;  5HZ8 A;  3RDO A;  1EQD A;  2IZJ A;  2LKK A;  2MO5 A;  4YFQ A;  5KID A;  3SLT A;  3HWE A;  3T2W A;  2RTD B;  4D6A A;  1ZNL A;  3CQR A;  3VE2 A;  1IKJ A;  1P6P A;  1LID A;  4RUN A;  2PI3 O;  4HPA A;  3P6G A;  3Q34 A;  3WBG A;  1E2T A;  1ERX A;  4GU8 A;  5FQ7 E;  3ZZV A;  2E4J A;  2FT9 A;  4O49 A;  3HTY A;  3O22 A;  4BX7 B;  1SY0 A;  2HLV A;  1RST B;  5H9L A;  3VG5 A;  3EW2 A;  4TJZ A;  1GX9 A;  4IAB A;  1TXL A;  1N7Y A;  1RSU B;  2AMM X;  2RTG B;  3C78 X;  3NBX X;  2HNX A;  4YFP A;  1MX7 A;  3B2I A;  5HZ9 A;  4GKC A;  3CMP A;  2GTL N;  4KH8 A;  5L8O A;  3VHM A;  2C1S A;  2IZH B;  4YBP A;  1LPJ A;  3APX A;  1DZM A;  1NQM A;  1IJ8 A;  4GNY A;  1VWG B;  3STM X;  4HWM A;  4CK4 A;  1GM6 A;  3PDF A;  2IZC B;  4MVK A;  3PQS A;  3VE1 A;  2FLJ A;  2X55 A;  5AJB A;  4YGZ A;  1LIB A;  4YDB A;  4GET A;  3VG2 A;  3WJF A;  4ZHF A;  3T2X A;  1QY0 A;  1KT5 A;  5IRW A;  1KZX A;  4CV7 A;  3C77 X;  5FEN A;  5KHP A;  1W5R A;  1LDO A;  3U03 A;  3JSQ A;  1EPB A;  2HZR A;  3KFG A;  1AEL A;  4ZCB A;  1HBQ A;  1Y9L A;  3FDC A;  2FKG A;  2Y3F A;  4Z27 A;  4AZR A;  1FDQ A;  2BS6 A;  2GTL O;  1BLR A;  1VWL B;  2RCT A;  4QZT A;  1UZ2 X;  4BCS A;  1BRP A;  3C76 X;  1BSY A;  3Q6L A;  2WUT A;  3RDS A;  5LJD A;  1K3B A;  2OFB A;  2BT9 A;  2GTL M;  2RD7 C;  2IZG B;  3HK1 A;  2Q4N A;  1KFF A;  5D4A A;  3WVM A;  2UZ2 A;  1GKA A;  3ZW1 A;  1CBI A;  1TVQ A;  3ELX A;  3L4R A;  4JNJ A;  1T0V A;  4IB9 A;  4NP1 A;  5FQ6 E;  4CPF A;  1CBS A;  1VWQ B;  2F73 A;  1SWJ A;  4LZU A;  3MG5 A;  1RBP A;  4MIR A;  5IRA A;  1GT5 A;  5DPQ A;  5LKF A;  4Z6J A;  1JZU A;  2FGS A;  1K24 A;  2ACO A;  2R74 A;  3JQO A;  2YMS A;  1VWF B;  1ZNH A;  1HQP A;  2BLG A;  4R0B A;  4AZM A;  1X89 A;  1FEL A;  5BVT A;  3T6F A;  5L8N A;  5BVS A;  1YWD A;  1W4T A;  1DZJ A;  1VWP B;  3KQ0 A;  1LIE A;  1DV9 A;  1FE3 A;  4MEE A;  3JS1 A;  1JJX A;  1PTS A;  3V8U A;  4UU2 A;  1BWY A;  2X32 A;  1VWE B;  1CJ5 A;  2G79 A;  4N7C A;  3WYQ A;  4D6B A;  3NQK A;  5DG4 A;  5BYP A;  4M6S A;  1G5W A;  1SWT A;  2JW1 A;  4EDE A;  3NPO A;  1SRI A;  4Y0S A;  1X8O A;  2IFB A;  1SY3 A;  3F9D A;  1I04 A;  1B8E A;  2CBS A;  4YBU A;  1O8V A;  3EW1 A;  5HZQ A;  4COT A;  2IZI A;  4LZV A;  3RE6 A;  4A1H A; 
#chains in the Genus database with same CATH homology
 3VU1 A;  3GE2 A;  3B2H A;  3BDR A;  1BSO A;  1LIF A;  4HPC A;  2Z4H A;  2AT8 X;  5LJE A;  2A3F X;  2A2G A;  2OFM X;  1O1V A;  2KW1 A;  1FEN A;  3B2J A;  3DTQ A;  2WR6 A;  4TQ2 A;  4ORS A;  1MVG A;  2FS7 A;  1GT4 A;  4QQ1 A;  5H9K A;  5LJG A;  4N7D A;  3EBW A;  4EEJ A;  3NAD A;  3FEL A;  1URE A;  3NQ3 A;  1QFV A;  4NNT A;  2Q2M A;  1EI5 A;  1GX8 A;  1SA8 A;  2R73 A;  3FYF A;  1OBQ A;  4XMD A;  4YGH A;  2QOS C;  4ORW A;  2A2U A;  1GT3 A;  5HAE A;  2ASN X;  3P24 A;  3I17 A;  4K19 A;  2RQ0 A;  1T68 X;  2ZAI A;  1CBR A;  3RZY A;  3BX8 A;  2RA6 A;  5HCE C;  2R56 A;  3BY0 A;  4ON1 A;  1ICM A;  4NW4 A;  4ZH9 A;  1LNM A;  3BU1 A;  4U3Q A;  4HPB A;  2Q2P A;  3K3L A;  1E00 A;  1ALB A;  3KZA A;  1IIU A;  4I3D A;  4MVE A;  2A0A A;  3ZUI A;  4GDZ A;  3S60 A;  1NGL A;  2BS5 A;  2X8T A;  3P6C A;  1BRQ A;  1QY1 A;  5F1E A;  1JBH A;  4FGI B;  1QQS A;  1VYF A;  1ERB A;  3T1D A;  1ZNK A;  4KII A;  3APW A;  2WEW A;  1VPR A;  2QO6 A;  3FLL A;  5LJH A;  3BRN A;  3GAQ A;  5LKE A;  1PEE A;  1U17 A;  3E3C A;  2W2A A;  2ZAG A;  1PBO A;  5HCD C;  1GGL A;  3STK A;  5HBS A;  4ZR2 A;  4I9R A;  3MX7 A;  4WBK A;  3WJG A;  3D96 A;  3UEW A;  1JIW I;  3KFF A;  3CWK A;  3P02 A;  5D48 A;  3TZS A;  2NNE A;  3FW4 A;  2CZU A;  3FEK A;  3PH6 A;  1ZND A;  3UAQ A;  1EXS A;  4ARH A;  5CYB A;  3P6E A;  4XMF A;  3RBY A;  2CM9 A;  1S2P A;  3HWD A;  1EW3 A;  3UEX A;  4WFU A;  3RSW A;  4EQA C;  2QO4 A;  2QM9 A;  4IMO A;  4ZHD A;  5HZ6 A;  4IAX A;  1ZNE A;  4L3R A;  1TW4 A;  4ORR A;  5IO7 A;  2CZT A;  4GH7 A;  4OS8 A;  2WQ9 A;  5F6Z A;  4OMX A;  3SAO A;  5HZ5 A;  2XKL A;  4TLJ A;  4YCE A;  1KT7 A;  3S5X A;  1KZW A;  3OJY C;  2WWP A;  1LFO A;  1EUO A;  4QRL A;  4OMW A;  5CE4 A;  4ID2 A;  3P6F A;  4KT5 A;  2JU7 A;  2OVS A;  1GXA A;  1OEJ A;  1A2D A;  4ZJ0 A;  1N0S A;  1QFT A;  2CM4 A;  3FR2 A;  1JYJ A;  2OVA A;  3WXQ A;  4YGG A;  2JMB A;  4BOE A;  1CBQ A;  5F58 A;  2AH7 X;  3BSZ E;  3D95 A;  3EMM A;  2OZQ A;  1SXU A;  4INN A;  4U9C A;  4XMG A;  2DM5 A;  1G7N A;  4HFO A;  4NYQ A;  4WFV A;  1YIV A;  2AT0 X;  3IFB A;  4XMH A;  1VYG A;  2Q39 A;  4ODD A;  2MJI A;  4O3X B;  1A18 A;  2NP1 A;  1ZNG A;  2LBV A;  1LKE A;  1FEM A;  2X46 A;  3PED A;  3FIQ A;  3UEU A;  2Q9S A;  4GNW A;  4MVI A;  1SY2 A;  1X71 A;  1YWA A;  2AKQ A;  3D97 A;  1Z24 A;  5HA1 A;  2FR3 A;  1TOU A;  1KT3 A;  3P6H A;  1L6M A;  1U0X A;  1EIO A;  1BJ7 A;  1SXY A;  1RLB E;  2RN4 A;  4AZN A;  1CRB A;  2G7B A;  4QGV A;  2K62 A;  3NR3 A;  3D4R A;  2PY1 A;  3RWX A;  1R0U A;  4A60 A;  2M4L A;  4O4X A;  4WHI A;  1BEB A;  1X8U A;  1OPB A;  3FW5 A;  3H3I A;  5EPQ A;  1B4M A;  2POA A;  4IBA A;  1X8Q A;  3N91 A;  3PQU A;  3STN A;  1BM5 A;  3TGA A;  2L9C A;  3F8A A;  1QY2 A;  3MVF A;  2A13 A;  4IAW A;  5L8I A;  2WSJ A;  1JJJ A;  1D2U A;  2JU3 A;  5FFH A;  3BX7 A;  1E06 A;  1QG5 A;  2OFR X;  3MBT A;  1SXX A;  3ZW0 B;  3TGB A;  4JGL A;  2ACP X;  5EDC A;  4EXZ A;  2BHV A;  3BU9 A;  2X8S A;  3U0D A;  3P6D A;  5HCC C;  4I3C A;  4ML7 B;  4NYR A;  3FR4 A;  3LHN A;  2L68 A;  3NX1 A;  1XCA A;  4CSB A;  2LB6 A;  1PMP A;  4O4U A;  1H91 A;  3WOV A;  3VG4 A;  1OEE A;  1GT1 A;  1YWC A;  3KFH A;  4PSQ A;  5F6B A;  2HZQ A;  3ELZ A;  2JOZ A;  4O9S A;  4U8U O;  4Y0P A;  5HTE A;  3VG6 A;  3AKM A;  4IB7 A;  4UU3 A;  2QMI A;  3CBC A;  4Y0Q A;  3B2L A;  5IO5 A;  2FTB A;  1IFC A;  1ICN A;  4U8U M;  3WJD A;  1NP1 A;  1KOI A;  3CQN A;  4QGW A;  2QO5 A;  5D8J A;  4YMY A;  1OEK A;  3FR5 A;  3CBS A;  3HWG A;  5H8T A;  1KT6 A;  3WJB A;  4YKO A;  2JU8 A;  1U18 A;  1OBU A;  5F7G A;  3FA9 A;  4BQU A;  4YH0 A;  1S44 A;  1E02 A;  1JV4 A;  3PPT A;  2LFO A;  4YCH A;  1I05 A;  2AT5 X;  2X8F A;  2LBA A;  3LV4 A;  4A8Z A;  1FTP A;  4KC7 A;  4IMN A;  4PJ2 A;  3UEV A;  1SXW A;  4M7M A;  4AZP A;  2F09 A;  5AEO A;  5EEE A;  4O4O A;  2Z4I A;  5C0N A;  3ZWE A;  5K06 A;  4ORX A;  2XST A;  2W2F A;  2L5P A;  1LF7 A;  3G7X A;  4HPD A;  1KXO A;  1EPA A;  3ZI8 A;  4A1Y A;  3HOE A;  3S26 A;  4GRJ A;  4I6S A;  4BVM A;  1IKE A;  4XME A;  3ZW2 A;  1XKI A;  3QKG A;  3BLG A;  3DSZ A;  1YP6 A;  2FWV A;  4O3W A;  1B0O A;  1ML7 A;  3FA7 A;  4IB6 A;  3WJE A;  4EFG A;  1X8P A;  3TGC A;  1MX8 A;  1IFB A;  3FA6 A;  1YUP A;  4YKM A;  2RCQ A;  2MM3 A;  3EM0 A;  5FAZ A;  4GZV A;  1JYD A;  2GC9 A;  1S7D A;  1QWD A;  2MHD A;  5FQ8 E;  1OPA A;  2AT3 X;  4MIS A;  4ORY A;  3WJC A;  2WQA E;  4DQ4 A;  4O3Y A;  2FR2 A;  3U9P C;  2O62 A;  1SMP I;  4IB8 A;  2L67 A;  1I4U A;  3AKN A;  5H9A A;  4ZH6 A;  4FQB B;  4TKH A;  1EAL A;  3PEC A;  5D45 A;  5H9N A;  3ZQ3 A;  4I3B A;  2X45 A;  4TNN A;  3RKG A;  1DF3 A;  1A3Y A;  2ALL X;  1AQB A;  3HOL A;  1KQW A;  4NLJ A;  4LKP A;  5EZ2 A;  5JR8 A;  2N93 A;  4ORU A;  4FBV A;  4AW8 A;  5HA0 A;  1ADL A;  2LA7 A;  5IO6 A;  2HMB A;  4XMC A;  2KT4 B;  1LIC A;  3VG7 A;  2NNQ A;  3APV A;  4ZFX A;  1E5P A;  5LJB A;  3EBK A;  5LJK A;  2ANS A;  1IW2 A;  1BSQ A;  1QAB E;  4ZHH A;  2FRS A;  1HMR A;  5B27 A;  2W2B A;  3O19 A;  1T8V A;  3APU A;  2YG2 A;  4LKT A;  4QYP A;  4GK9 A;  3O2Y A;  1EII A;  4MVL A;  2OVE A;  4QZU A;  5AJC A;  4QAE A;  3PH5 A;  5HWZ A;  3TF6 A;  3PP6 A;  4KC8 A;  5AQ6 A;  4OS0 A;  4TKB A;  2FS6 A;  4YDA A;  5EED A;  4TKJ A;  2NND A;  3ZW0 A;  4YFR A;  1GKA B;  3ZW1 B;  2AT6 X;  5EDB A;  1TOW A;  5D47 A;  2AL0 X;  2KTD A;  1HBP A;  3I0A A;  5KIC A;  4ALB A;  2CBR A;  3NX2 A;  4AZQ A;  2KD2 A;  3OE3 A;  4ZHC A;  1A57 A;  2WEX A;  4ES7 A;  3KFI A;  3S5V A;  1DZK A;  1OBP A;  2OVD A;  3EYC A;  4RUU A;  3NQ9 A;  2HYS A;  1HMT A;  4FBR A;  4I95 A;  3B2K A;  4O3Z A;  1X8N A;  1NP4 A;  1YWB A;  4U8U N;  4KCA A;  3CR6 A;  1O1U A;  1AVG I;  1I06 A;  3NP1 A;  4I9S A;  2K23 A;  4GE1 A;  3SOT A;  1ZRY A;  1D3S A;  4QNI A;  5B29 A;  3FA8 A;  4AZO A;  3F6Z B;  4LQZ A;  4DQ3 A;  5LJC A;  1B56 A;  1G74 A;  1DC9 A;  2MWH A;  4O4S A;  1ACD A;  2KTS A;  3HWF A;  1PM1 X;  3FEN A;  3BS2 A;  1YP7 A;  1Y9T A;  5BVQ A;  3IA8 A;  4ALO A;  3OBL A;  4L1N A;  1G85 A;  1DZP A;  1KT4 A;  2GJ5 A;  4ZHG A;  1KGL A;  1AB0 A;  1KQX A;  5HTD A;  4NNS A;  1MUP A;  4FBO A;  1SY1 A;  3ZUO A;  2P8G A;  3OD9 A;  4QGX A;  2JN3 A;  1DFV A;  4ZGU A;  4NLI A;  3FMZ A;  2EU7 X;  3VPJ E;  2G78 A;  1HN2 A;  4ZGF A;  1BBP A;  3FEP A;  1HMS A;  4AYH A;  1MDC A;  4Y0R A;  4QYN A;  2GTF X;  4OS3 A;  3VG3 A;  5HZ8 A;  1EQD A;  2LKK A;  2MO5 A;  4YFQ A;  5KID A;  3HWE A;  4D6A A;  1ZNL A;  3CQR A;  3VE2 A;  1IKJ A;  1P6P A;  1LID A;  4RUN A;  4HPA A;  3P6G A;  3WBG A;  1ERX A;  4GU8 A;  5FQ7 E;  3ZZV A;  2E4J A;  2FT9 A;  4O49 A;  3HTY A;  3O22 A;  1SY0 A;  2HLV A;  5H9L A;  3VG5 A;  4TJZ A;  1GX9 A;  4IAB A;  1TXL A;  3C78 X;  2AMM X;  3NBX X;  4YFP A;  2HNX A;  1MX7 A;  3B2I A;  5HZ9 A;  4GKC A;  3CMP A;  2GTL N;  4KH8 A;  5L8O A;  4YBP A;  1LPJ A;  3APX A;  1DZM A;  4GNY A;  3STM X;  4HWM A;  4CK4 A;  1GM6 A;  4MVK A;  3VE1 A;  3PQS A;  2FLJ A;  5AJB A;  4YGZ A;  1LIB A;  4YDB A;  4GET A;  3VG2 A;  3WJF A;  4ZHF A;  1QY0 A;  1KT5 A;  1KZX A;  4CV7 A;  3C77 X;  5FEN A;  5KHP A;  3U03 A;  3JSQ A;  1EPB A;  2HZR A;  3KFG A;  1AEL A;  4ZCB A;  1HBQ A;  1Y9L A;  4AZR A;  1FDQ A;  2BS6 A;  2GTL O;  1BLR A;  2RCT A;  4QZT A;  1UZ2 X;  1BRP A;  3C76 X;  1BSY A;  3Q6L A;  2WUT A;  5LJD A;  2BT9 A;  2GTL M;  2RD7 C;  3HK1 A;  2Q4N A;  5D4A A;  3WVM A;  1GKA A;  3ZW1 A;  1CBI A;  1TVQ A;  3ELX A;  3L4R A;  1T0V A;  4IB9 A;  4NP1 A;  5FQ6 E;  1CBS A;  2F73 A;  4LZU A;  1RBP A;  4MIR A;  1GT5 A;  5DPQ A;  5LKF A;  1JZU A;  2R74 A;  2ACO A;  3JQO A;  2YMS A;  1ZNH A;  2BLG A;  1HQP A;  4R0B A;  4AZM A;  1X89 A;  1FEL A;  5BVT A;  5L8N A;  5BVS A;  1YWD A;  1DZJ A;  3KQ0 A;  1LIE A;  1DV9 A;  1FE3 A;  1JJX A;  3JS1 A;  3V8U A;  4UU2 A;  1BWY A;  1CJ5 A;  2G79 A;  4N7C A;  4D6B A;  3NQK A;  5DG4 A;  5BYP A;  4M6S A;  1G5W A;  2JW1 A;  4EDE A;  3NPO A;  4Y0S A;  1X8O A;  2IFB A;  1SY3 A;  3F9D A;  1I04 A;  1B8E A;  2CBS A;  4YBU A;  1O8V A;  5HZQ A;  4COT A;  4LZV A;  4A1H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...