2OVRB

Structure of the skp1-fbw7-cyclinedegn complex
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
444
structure length
442
Chain Sequence
TQVKHMMQVIEPQFQRDFISLLPKELALYVLSFLEPKDLLQAAQTCRYWRILAEDNLLWREKCKEEGIDEPLHIKRVIKPGFIHSPWKSAYIRQHRIDTNWRRGELKSPKVLKGHDDHVITCLQFCGNRIVSGSDDNTLKVWSAVTGKCLRTLVGHTGGVWSSQMRDNIIISGSTDRTLKVWNAETGECIHTLYGHTSTVRCMHLHEKRVVSGSRDATLRVWDIETGQCLHVLMGHVAAVRCVQYDGRRVVSGAYDFMVKVWDPETETCLHTLQGHTNRVYSLQFDGIHVVSGSLDTSIRVWDVETGNCIHTLTGHQSLTSGMELKDNILVSGNADSTVKIWDIKTGQCLQTLQGPNKHQSAVTCLQFNKNFVITSSDDGTVKLWDLKTGEFIRNLVTLESGGSGGVVWRIRASNTKLVCAVGSRNGTEETKLLVLDFDVDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords S-phase kinase-associated protein 1A
publication title Structure of a Fbw7-Skp1-Cyclin E Complex: Multisite-Phosphorylated Substrate Recognition by SCF Ubiquitin Ligases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/cell cycle
total genus 132
structure length 442
sequence length 444
ec nomenclature
pdb deposition date 2007-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00400 WD40 WD domain, G-beta repeat
B PF12937 F-box-like F-box-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.50 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 2ovrB01
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2ovrB02
4J84A 2YMUA 4O45A 3L4OD 2AH1A 4PXWA 2H14A 3HFQA 1VYHC 3B7FA 4ES0A 4FAND 4FA4D 3I7HA 3I7KA 2HKRA 3FRXA 4OWRA 5EAMA 5AFU3 2H6QA 5GXHA 3C5MA 1OMWB 4J81A 5EARA 5H1MA 2Z2PA 2J56H 5CYKA 4CI3A 4Y5RD 3PXTD 2HESX 3SN6B 2H9PA 5EMLB 5H14A 2CO0C 3SMRA 2J57G 4A2MA 4X61B 4XEIC 1GP2B 4MK0B 5FKSA 3SVWD 3SCYA 5B4WA 2AGZA 2I3SA 5GSAA 1NEXB 1JOFA 4FA1D 2H3XA 2P9NC 1K32A 1B9YA 2IWFA 2I0SA 4BH6A 5FLXg 2PM9B 4BUJC 4CY1A 4J77A 5HE1B 4JSVC 4J86A 3OGMB 2OVRB 4ESGA 2CO0A 3C75H 1FS1A 4A2LA 2IURA 2AGXA 2I3TA 4H5JA 1OLZA 4GGAA 5IC7A 3EI3B 1XIPA 3C99A 3I2NA 2UZYB 4Z8LA 1A0RB 1U2VC 3I7PA 4J78A 2YNOA 4JT6C 1PBYB 4FB1D 3BWSA 4J87A 3IKOA 4I6JB 3JAMg 2OK4A 2I0TA 5GXIA 4PSWB 5C2VB 2H68A 3UKRC 3OKYB 3K26A 2HKMA 4JD2C 2XL3A 3OTTA 3WSOA 2XU7A 5TEEA 4ZOYA 3EI2A 5HE3B 2Z2NA 1FWXA 3UVLA 3I8CA 5CXBB 3EI3A 4TZ4A 2H6KA 4N14A 5SXMA 2GC4A 4GGCA 1SQJA 3UVOA 5EMMB 4JT5C 3GFCA 4QT8A 3MMYA 3RN0D 4LG8A 5IJ8E 5HE2B 3JROA 4IMMA 4CY2A 2AH0A 2P9UC 3JZNA 4X3EA 2YBAA 4E54B 3ULEC 3RFGA 3MZKA 5H17A 5IBKB 3KRWB 5CXCB 1SHYB 4A0AB 5EMJB 3AL9A 4ERZA 3MZLA 4L9OA 4PC0A 3ORVD 4QQEA 4A11B 4D6VA 5FKRA 5EAPA 4J79A 5CXBA 4Y7RA 4D0KA 1GOTB 2H13A 3I7OA 2P1QB 2H9LA 4KFMB 1LDKE 5KDOB 1RI6A 4A08B 4FA9D 2B5MA 4J0XA 5TDHB 4E54A 1NR0A 5IGOA 2YNPA 5CXCA 3C9CA 4O1QD 2YNNA 4A0AA 3NVQA 2CNXA 4ZOZA 3K27A 3MXXA 4FWWA 1XHMA 4GM8A 2P9IC 4CI1A 4YVDA 4ZN4A 4LGNA 1B9XA 2HXCA 3DWLC 4ERYA 3RFHA 4GM9A 4A11A 4ZOXA 2P9LC 3IJ1A 5AMSA 4CC9A 2P1OB 4K3ID 3BG0A 3GREA 3PVUB 5K19A 4PNKB 4A08A 2IUPA 1ERJA 2OIZA 3I7LA 2P1MB 2B5NA 2P1PB 4GQ1A 4OZUA 4QL1A 1JJUB 3EI2B 2XYIA 2QC5A 1R5MA 3DM0A 1GG2B 3VA6A 5TEFA 2BBKH 2AGLA 4U1EI 2O9KA 1JMXB 2CN3A 4U7AA 4J8GA 2AGYA 5FKTA 3OW8A 3EU7A 2CE9A 3V7DB 3AFCA 2H47A 3IJCA 2TRCB 4PBZA 4O3UB 4AOWA 3MKSB 1PGUA 5HYNB 4NSXA 3JPXA 4GMBA 5FQDA 3RLMD 4XYHA 4JSNC 4CZXA 2OVQB 2HYEA 5I5MA 4J0WA 5EM2A 3AH8B 3FM0A 2P1NB 1QNIA 1PEVA 1N6DA 3SJLD 3C6NB 3OKTA 3IJ0A 3EI1B 1XKSA 3I89A 3SFZA 3OL2B 2IUVA 2CN2A 2H9NA 5EMKB 3SHFA 5FA5B 4J73A 4XYIA 4JSPC 2OK6A 1MDAH 3UVKA 2IAAA 4FAVD 2OJYA 4A7JA 2EBSA 3EI4B 3CFVA 3ODTA 2YB8B 3L2OB 2OVPB 3SWSD 4L1QD 5C9ZB 4K3JB 2CE8A 4L3HD 4X60B 2AGWA 3EI1A 1JMZB 3OL2A 2P9PC 1L0QA 3EMHA 4O3TB 2Q7QA 3UVNA 4A09B 3U4YA 3PE7A 2PM7B 1P22A 1S4UX 1N6EA 1N6FA 2H6NA 2B5LA 3CIKB 3EI4A 3JB9L 2GC7A 3DSMA 3NVNA 5HE0B 3IIWA 2J55H 3L4MD 3OGKB 3PXSD 5K1CC 1TYQC 4CZYA 3VGZA 4L3GD 4A0BB 3DXMC 2QXVA 2I0RA 3JZHA 4CI2A 4E5ZB 3NVXA 3C6PB 4CY5A 4LG9A 4JXMA 3DXKC 3UKUC 1MG3A 3F3PA 3UR4A 3EWEA 5GMKn 4A09A 4X63B 4PBYA 3OGLB 4I79A 5EM2B 2GNQA 1TBGA 2HJBA 4CI8A 3BG1A 3F3FA 4GQ2P 4PSXB 3C6OB 5I5IA 3SBPA 2MTAH 4A0BA 3SLED 4GM3A 2Z2OA 1U4CA 3AL8B 3UVMA 1GXRA 2P9KC 4J82A 4E5ZA 2AQ5A 3RMZD 3J81g 4HDJA 3RN1D 2IUQA 1SQ9A 3FGBA 1MG2A 4G56B 5IGQA 3V9FA 3N0DA 5IT9g 4EWRA 4ZOVA 3PVWB 4JSXC 3V5WB 4GZ8A 5THAA 5I5JA 2PM6B 2H9MA 4UI9R 5FXYA 3I7NA 4IA9A 5EALA 2E31A 5IJ7E 4R7AB 3JZGA 3RRMC 4CY3A 2PM9A 4GQBB 3EG6A 3J80g 2BCJB 4J8BA 3AL8A 2P9SC 2G9AA 2W18A 3E0CA 3A0FA 3VH0A 3RSEC 4AEZA 4FA5D 3CFSB 3MKQA 2IWKA 3P4FA 5HQGA 2E32A 4FHLA 3SXTD 2G99A 3PSCB 4BL0A 4ERQA 1YFQA 1Q47A 2PBIB 3PXWD 5C2WB 4O9DA 2UZXB 1PI6A 2XL2A 3F3GA 3OKWA 3IIYA 1K8KC 5JWZA 5CYKB 3W15A 5FKQA 3SBRA 3I8EA 3ZWLB 3OKYA 5TF2A 4CZVA 3KRXB 3N0EA 2HJ4A 3PSLA 4QRJA 3SBQA 4GGDA 5AJAA 2B4EA 4H5IA 3JRPA 5A2Qg
chains in the Genus database with same CATH superfamily
5E6UA 4J84A 3RMBA 1M1XA 2YMUA 3L4OD 1JV2A 2AH1A 4O45A 4PXWA 2H14A 4FJLA 3HFQA 1VYHC 5M5TA 3B7FA 1H2YA 4ES0A 1XVEE 4FAND 4QNCA 4FA4D 4DTPA 3I7HA 2HKRA 3I7KA 3FRXA 4OWRA 5EAMA 1FXXA 5AFU3 2H6QA 1A12A 4FVMA 5GXHA 3C5MA 3FCUA 1OMWB 3IVMA 2EIDA 4J81A 3IUQA 5EARA 5H1MA 2Z2PA 4M3YA 3SI6A 3SVIA 1GOFA 4FK4A 2J56H 5CYKA 5E6SA 5C86A 4CI3A 4Y5RD 3PXTD 2HESX 3SN6B 3QHYB 1FZ3E 4ADNA 2H9PA 4E4BA 5EMLB 5H14A 3IJEA 3ZE2A 2CO0C 3NE6A 3SMRA 4BP8A 4FJHA 5M5SA 2J57G 4AKGA 3QERA 3E4YA 2XE4A 4QAMA 3V4PA 4A2MA 4X61B 4XEIC 1GP2B 4MK0B 4FJXA 5FKSA 1QFSA 2VJ5A 4O2WA 3SVWD 3SCYA 1VZ2A 5B4WA 4JHNA 2AGZA 2B1EA 3UIQA 4FK2A 1BPOA 2I3SA 3MUNA 4FJKA 5H37A 3QESA 1NEXB 5GSAA 1JOFA 4M41A 3SUNA 4AN1A 4WK4A 4FA1D 3HGKE 2H3XA 2P9NC 1K32A 1B9YA 4BCDA 3CFPA 1UOPA 2I0SA 2IWFA 4BH6A 5FLXg 2PM9B 4BUJC 4CY1A 3IURA 5M5VA 3FCSA 4J77A 1FZ8E 5HE1B 4JSVC 4J86A 3KD5E 4G1EA 3ZDXA 3OGMB 2OVRB 4DU4A 1VE7A 4ESGA 3K72A 2CO0A 3C75H 1FS1A 4A2LA 1MMOG 3TAGA 2FW3A 4FJMA 2AGXA 2IURA 2I3TA 4H5JA 1OLZA 4GGAA 5IC7A 3EI3B 3N1BA 1XIPA 3C99A 3I2NA 4ICGC 2UZYB 4Z8LA 3QEIA 1N1CA 3LDBA 4KHYA 1A0RB 1U2VC 2JH8A 3I7PA 2JKXA 4J78A 2YNOA 3L8BA 4JT6C 4BCCA 1PBYB 4FB1D 3BWSA 3TAFA 4J87A 2DTUA 3IKOA 4RE6A 4I6JB 4RL5A 3JAMg 2LF3A 2OK4A 2I0TA 5GXIA 4PSWB 1T2XA 5C2VB 4JS4A 2H68A 3UKRC 3OKYB 3K26A 3UO2A 2WQ8A 4NC4A 2HKMA 1MTYG 3SQ0A 4JD2C 1XVBE 4IT5A 2XL3A 3OTTA 4M3ZA 3WSOA 3SQ1A 1VE6A 3QEPA 2XU7A 5TEEA 4ZOYA 5M61A 3EI2A 5HE3B 2Z2NA 1FWXA 4FJJA 3SPZA 3UVLA 3SJJA 3I8CA 5CXBB 3EI3A 4TZ4A 2H6KA 4N14A 1FZ4E 2EIEA 5SXMA 2GC4A 4GGCA 3IUJA 1SQJA 3UVOA 3NHGA 5EMMB 2P5OA 2QR5A 3EQ9A 3GFCA 4JT5C 4QT8A 2PFTA 3MMYA 3RN0D 4LG8A 5IJ8E 2ATQA 5HE2B 3JROA 4IMMA 4CY2A 2AH0A 2P9UC 2JHCA 2MZWB 3JZNA 3SQ4A 1WAJA 3LDSA 4X3EA 2YBAA 4JS5A 2VJ4A 3ULEC 4E54B 3UO3A 3QEWA 3RFGA 3MZKA 5H17A 5IBKB 3KRWB 5CXCB 1SHYB 1MHYG 3MVDK 3RMAA 1O6GA 4A0AB 2OZMA 1FPOA 5EMJB 4FK0A 3AL9A 4I9LA 1E5TA 4FJ9A 4ERZA 3MZLA 3EQ8A 4L9OA 4PC0A 3N1EA 4WK0A 3TJYA 3ORVD 1FZIE 4QQEA 3TABA 2DY4A 4A11B 4D6VA 5FKRA 5EAPA 1IH7A 3TAEA 4J79A 5CXBA 3QNNA 4Y7RA 2JPNA 1FYZE 2VIXA 4D0KA 1GOTB 2H13A 3I7OA 2BKLA 2P1QB 2H9LA 4KHUA 4KFMB 3ZDYA 4J2BA 1LDKE 5KDOB 1RI6A 4A08B 4FA9D 2B5MA 4J0XA 5TDHB 4E54A 3QNOA 3GD1I 1NR0A 2EICA 2VZ3A 5IGOA 2YNPA 5CXCA 3K2OA 3C9CA 4O1QD 2YNNA 3C94A 4A0AA 4BP9A 3NVQA 2H4TA 3RMDA 1Q9XA 1H2ZA 4JRPA 2CNXA 4ZOZA 3K27A 4EPHA 3MXXA 4J2AA 4M45A 4KHQA 4FWWA 1XHMA 4ADOA 4GM8A 2P9IC 4CI1A 4YVDA 4ZN4A 4LGNA 2PFVA 1B9XA 5M5UA 2HXCA 3HP9A 1I2MB 2B8IA 3DWLC 4ERYA 3NGIA 3RFHA 4GM9A 4A11A 4ZOXA 4D9SA 2P9LC 4KI4A 3IJ1A 4RG8A 4FJ7A 5AMSA 3QETA 4CC9A 3K6SA 2P1OB 2RKHA 4K3ID 4HCBA 3NDKA 3E4WA 3BG0A 3GREA 3PVUB 5K19A 4PNKB 4DTUA 1XVGE 4A08A 2IUPA 4G55A 1ERJA 1FZ6E 2QXFA 2P1MB 2OIZA 3I7LA 2B5NA 2P1PB 4GQ1A 4OZUA 4QL1A 1JJUB 3EI2B 2HU8A 2XYIA 2QC5A 5A2Qg 3SUPA 1R5MA 2QZPA 3DM0A 5FFGA 1GG2B 3VA6A 1C9IA 5TEFA 2EIBA 2BBKH 2K5SA 3SUQA 2AGLA 4U1EI 4WK2A 3IUMA 2P5GA 2O9KA 1JMXB 2CN3A 4U7AA 4J8GA 2AGYA 1FZ5E 5FKTA 3OW8A 2MMBA 3EU7A 3QI0A 2CE9A 3LZJA 3V7DB 3AFCA 2H47A 3K71A 4DU1A 2TRCB 3IJCA 4PBZA 3EQ7A 4O3UB 4AOWA 3MKSB 1PGUA 2VDOA 3DDUA 5HYNB 4AI6A 3MUOA 4L1MA 4NSXA 4DTSA 4O02A 3JPXA 4GMBA 5FQDA 3RLMD 1IG9A 4XYHA 4JSNC 4CZXA 2OVQB 2HYEA 4NAAA 2HU5A 3OF7A 5I5MA 1XU3E 3RMCA 4J0WA 1E8NA 5EM2A 3AH8B 3FM0A 2P1NB 4QNDA 1QNIA 1PEVA 1N6DA 3SJLD 3NIFA 3C6NB 2VDLA 4AN0A 3OKTA 3IJ0A 1H2XA 3EI1B 1XKSA 3I89A 3SFZA 3OL2B 4M3XA 2IUVA 1JW2A 2CN2A 1GOGA 2H9NA 5EMKB 3SHFA 4RNGA 5FA5B 3VI4A 4J73A 3CFRA 4JSPC 4XYIA 2OK6A 3KCIA 4M3TA 1MDAH 3VI3A 4G1MA 3UVKA 2IAAA 1TYEA 4FAVD 3SQ2A 2OJYA 4A7JA 2JHAA 2RCUA 4DTRA 1U8CA 4AKIA 4KI6A 2EBSA 3CFOA 4AKHA 4DU3A 3CFVA 3EI4B 3ODTA 2DEBA 4GAMC 2YB8B 4FJNA 1CLQA 3L2OB 4FJ5A 2OVPB 1YR2A 4L1QD 3SWSD 3ZE0A 2HD0A 5C9ZB 2FYOA 4K3JB 3SCXA 4M3RA 2CE8A 1O6FA 4L3HD 3SUOA 4X60B 4MMXA 4EYWA 4X5NA 1XVCE 2AGWA 3O4GA 3EI1A 4KHNA 1JMZB 3IULA 3OL2A 2P9PC 1L0QA 2OYQA 1VZ3A 2VC2A 4M3WA 4FJ8A 3EMHA 4O3TB 2Q7QA 1UOOA 3UVNA 4A09B 1XL3C 3HL8A 3U4YA 3PE7A 3IUNA 2PM7B 1P22A 3ZE1A 3JB9L 4FJIA 5FFOA 1N6EA 1N6FA 1S4UX 2H6NA 2B5LA 3CIKB 3HGLA 3EI4A 2VDPA 3NCIA 3L1NA 1Q9YA 1UTCA 2GC7A 3DSMA 3NVNA 5HE0B 4AMZA 1C9LA 3IIWA 2J55H 3L4MD 3OGKB 3PXSD 5K1CC 1TYQC 4CZYA 4DNVA 3VGZA 4L3GD 4A0BB 3DXMC 3T3PA 1L5GA 2QXVA 4MMZA 4UM9A 1K3IA 2I0RA 3JRPA 3JZHA 4CI2A 4E5ZB 4KHWA 4UM8A 3NVXA 1XVFE 3C6PB 5IZ7A 4CY5A 4LG9A 4JXMA 1XMHE 3DXKC 3UKUC 1MG3A 5HDBA 3F3PA 3UR4A 3EWEA 5GMKn 1FZHE 4Z7OA 3GC3B 4A09A 4X63B 1XVDE 2HU7A 4PBYA 3OGLB 4M42A 4I79A 5EM2B 2GNQA 1UOQA 3QEXA 1TBGA 2HJBA 4B08A 4CI8A 1MHZG 3BG1A 3F3FA 4DTJA 4GQ2P 3LZIA 4Z7NA 4JRQA 4JHPC 4PSXB 3C6OB 5I5IA 4EP9A 3SBPA 2MTAH 4A0BA 3NAEA 3SLED 4GM3A 2Z2OA 3RWUA 1U4CA 3AL8B 3UVMA 1GXRA 2P9KC 3SNNA 4DTMA 4J82A 4E5ZA 2AQ5A 3RMZD 1XMGE 3CQ8A 4DTXA 3J81g 4HDJA 3RN1D 2IUQA 2JHPA 1SQ9A 4J2DA 3FGBA 1MG2A 4G56B 2JQTA 2MW2A 3V9FA 5IGQA 4HCCA 2XDWA 3N0DA 4NENA 4EWRA 5IT9g 1E8MA 4ZOVA 3S9HA 3PVWB 4JSXC 3V5WB 4DNUA 4GZ8A 5THAA 4DNWA 4X5MA 4MMYA 4FJGA 3QEVA 1GOHA 5I5JA 3O4IA 2JH9A 2PM6B 3KD1E 2H9MA 3SPYA 5E6RA 4UI9R 1JTDB 3O4JA 4BCBA 5FXYA 3I7NA 1QFMA 4IA9A 5EALA 2E31A 5IJ7E 5C92A 4R7AB 3O4HA 3JZGA 1WAFA 3RRMC 4CY3A 4RE5A 2PM9A 3EG6A 4GQBB 3J2PA 3J80g 2BCJB 4J8BA 2XZGA 3AL8A 2P9SC 4AX4A 2G9AA 4DTNA 2W18A 3E0CA 3A0FA 3J27A 3VH0A 4IRZA 3RSEC 4AEZA 2LF6A 1FZ0E 4FA5D 3CFSB 3MKQA 2IWKA 3P4FA 5M5RA 5HQGA 3NIDA 2E32A 2VZ1A 4FHLA 3SXTD 2G99A 1XU5E 3PSCB 4BL0A 3C95A 4DTOA 2VDRA 4ERQA 3L0MA 4NBMA 1YFQA 1Q47A 2PBIB 3PXWD 3TL8B 5C2WB 1FZ2E 4O9DA 3NIGA 2UZXB 2OZSA 3LD8A 1PI6A 2XL2A 3F3GA 2YB5A 4E3SA 3OKWA 3V4VA 2VDQA 3IIYA 1K8KC 5JWZA 5CYKB 4AMYA 3W15A 4KHSA 5FKQA 1FZ1E 3SBRA 3I8EA 1FZ7E 3ZWLB 1XMFE 3OKYA 5TF2A 4Z7QA 2VDKA 4CZVA 3BVOA 3KRXB 3T3MA 3N0EA 5IREA 2HJ4A 3PSLA 4QRJA 3SBQA 4J2EA 1H2WA 4GGDA 4I9QA 2B7MA 5AJAA 4M3UA 3ZDZA 2B4EA 2VDMA 4H5IA 2VDNA 1FZ9E 4WJKA
chains in the Genus database with same CATH topology
4J84A 3RMBA 2YMUA 3L4OD 4O45A 2AH1A 4PXWA 2H14A 4FJLA 3HFQA 1VYHC 3B7FA 4ES0A 1XVEE 4FAND 4QNCA 4FA4D 4DTPA 3I7HA 2HKRA 3I7KA 3FRXA 4OWRA 5EAMA 1FXXA 5AFU3 2H6QA 4FVMA 5GXHA 3C5MA 1OMWB 4J81A 5EARA 5H1MA 2Z2PA 4M3YA 3SI6A 3SVIA 2J56H 4FK4A 5CYKA 4CI3A 4Y5RD 3PXTD 2HESX 3SN6B 1FZ3E 4ADNA 2H9PA 4E4BA 5EMLB 5H14A 2CO0C 3NE6A 3SMRA 4FJHA 2J57G 4AKGA 3QERA 3E4YA 4A2MA 4X61B 4XEIC 1GP2B 4MK0B 4FJXA 5FKSA 2VJ5A 3SVWD 3SCYA 5B4WA 2AGZA 2B1EA 3UIQA 4FK2A 2I3SA 4FJKA 5H37A 3QESA 1NEXB 5GSAA 1JOFA 4M41A 3SUNA 4FA1D 3HGKE 2H3XA 2P9NC 1K32A 1B9YA 3CFPA 2IWFA 2I0SA 4BH6A 5FLXg 2PM9B 4BUJC 4CY1A 4J77A 1FZ8E 5HE1B 4JSVC 4J86A 3KD5E 3OGMB 2OVRB 4DU4A 4ESGA 2CO0A 3C75H 1FS1A 4A2LA 1MMOG 3TAGA 2FW3A 4FJMA 2AGXA 2IURA 2I3TA 4H5JA 1OLZA 4GGAA 5IC7A 3EI3B 3N1BA 1XIPA 3C99A 3I2NA 2UZYB 4Z8LA 3QEIA 3LDBA 4KHYA 1A0RB 1U2VC 2JH8A 3I7PA 4J78A 2YNOA 3L8BA 4JT6C 1PBYB 4FB1D 3BWSA 3TAFA 4J87A 2DTUA 3IKOA 4I6JB 4RL5A 3JAMg 2LF3A 2OK4A 2I0TA 5GXIA 4PSWB 5C2VB 4JS4A 2H68A 3UKRC 3OKYB 3K26A 2HKMA 1MTYG 3SQ0A 4JD2C 1XVBE 2XL3A 3OTTA 4M3ZA 3WSOA 3SQ1A 3QEPA 2XU7A 5TEEA 4ZOYA 3EI2A 5HE3B 2Z2NA 1FWXA 4FJJA 3SPZA 3UVLA 3SJJA 3I8CA 5CXBB 3EI3A 4TZ4A 2H6KA 4N14A 1FZ4E 5SXMA 2GC4A 4GGCA 1SQJA 3UVOA 3NHGA 5EMMB 2P5OA 4JT5C 3GFCA 4QT8A 2PFTA 3MMYA 3RN0D 4LG8A 5IJ8E 2ATQA 5HE2B 3JROA 4IMMA 4CY2A 2AH0A 2P9UC 2JHCA 2MZWB 3JZNA 3SQ4A 1WAJA 3LDSA 4X3EA 2YBAA 4JS5A 2VJ4A 3ULEC 4E54B 3QEWA 3RFGA 3MZKA 5H17A 5IBKB 3KRWB 5CXCB 1SHYB 1MHYG 3RMAA 4A0AB 2OZMA 5EMJB 4FK0A 3AL9A 4I9LA 4FJ9A 4ERZA 3MZLA 4L9OA 4PC0A 3N1EA 3TJYA 3ORVD 1FZIE 4QQEA 3TABA 2DY4A 4A11B 4D6VA 5FKRA 5EAPA 1IH7A 3TAEA 4J79A 5CXBA 3QNNA 4Y7RA 2JPNA 1FYZE 2VIXA 4D0KA 1GOTB 2H13A 3I7OA 2P1QB 2H9LA 4KHUA 4KFMB 4J2BA 1LDKE 5KDOB 1RI6A 4A08B 4FA9D 2B5MA 4J0XA 5TDHB 4E54A 3QNOA 1NR0A 5IGOA 2YNPA 5CXCA 3K2OA 3C9CA 4O1QD 2YNNA 3C94A 4A0AA 3NVQA 2H4TA 3RMDA 1Q9XA 4JRPA 2CNXA 4ZOZA 3K27A 4EPHA 3MXXA 4J2AA 4M45A 4KHQA 4FWWA 1XHMA 4ADOA 4GM8A 2P9IC 4CI1A 4YVDA 4ZN4A 4LGNA 2PFVA 1B9XA 2HXCA 3HP9A 2B8IA 3DWLC 4ERYA 3NGIA 3RFHA 4GM9A 4A11A 4ZOXA 2P9LC 4KI4A 3IJ1A 4RG8A 4FJ7A 5AMSA 3QETA 4CC9A 2P1OB 4K3ID 4HCBA 3NDKA 3E4WA 3BG0A 3GREA 3PVUB 5K19A 4PNKB 4DTUA 1XVGE 4A08A 2IUPA 1ERJA 1FZ6E 2QXFA 2P1MB 2OIZA 3I7LA 2B5NA 2P1PB 4GQ1A 4OZUA 4QL1A 1JJUB 3EI2B 2XYIA 2QC5A 3SUPA 1R5MA 3DM0A 1GG2B 3VA6A 5TEFA 2BBKH 3SUQA 2AGLA 4U1EI 2P5GA 2O9KA 1JMXB 2CN3A 4U7AA 4J8GA 2AGYA 1FZ5E 5FKTA 3OW8A 2MMBA 3EU7A 2CE9A 3LZJA 3V7DB 3AFCA 2H47A 4DU1A 2TRCB 3IJCA 4PBZA 4O3UB 4AOWA 3MKSB 1PGUA 5HYNB 4AI6A 4NSXA 4DTSA 3JPXA 4GMBA 5FQDA 3RLMD 1IG9A 4XYHA 4JSNC 4CZXA 2OVQB 2HYEA 5I5MA 1XU3E 3RMCA 4J0WA 5EM2A 3AH8B 3FM0A 2P1NB 4QNDA 1QNIA 1PEVA 1N6DA 3SJLD 3C6NB 3OKTA 3IJ0A 3EI1B 1XKSA 3I89A 3SFZA 3OL2B 4M3XA 2IUVA 2CN2A 2H9NA 5EMKB 3SHFA 4RNGA 5FA5B 4J73A 3CFRA 4JSPC 4XYIA 2OK6A 4M3TA 1MDAH 3UVKA 2IAAA 4FAVD 3SQ2A 2OJYA 4A7JA 2JHAA 2RCUA 4DTRA 4AKIA 4KI6A 2EBSA 3CFOA 4AKHA 4DU3A 3CFVA 3EI4B 3ODTA 2DEBA 4GAMC 2YB8B 4FJNA 1CLQA 3L2OB 4FJ5A 2OVPB 3SWSD 4L1QD 2HD0A 5C9ZB 2FYOA 4K3JB 3SCXA 4M3RA 2CE8A 4L3HD 3SUOA 4X60B 4EYWA 4X5NA 1XVCE 2AGWA 3EI1A 4KHNA 1JMZB 3OL2A 2P9PC 1L0QA 2OYQA 4M3WA 4FJ8A 3EMHA 4O3TB 2Q7QA 3UVNA 4A09B 1XL3C 3HL8A 3U4YA 3PE7A 2PM7B 1P22A 4FJIA 1N6EA 1N6FA 1S4UX 2H6NA 2B5LA 3CIKB 3HGLA 3EI4A 3JB9L 3NCIA 3L1NA 1Q9YA 2GC7A 3DSMA 3NVNA 5HE0B 3IIWA 2J55H 3L4MD 3OGKB 3PXSD 5K1CC 1TYQC 4CZYA 3VGZA 4L3GD 4A0BB 3DXMC 2QXVA 2I0RA 3JZHA 4CI2A 4E5ZB 4KHWA 3NVXA 1XVFE 3C6PB 5IZ7A 4CY5A 4LG9A 4JXMA 1XMHE 3DXKC 3UKUC 1MG3A 3F3PA 3UR4A 3EWEA 5GMKn 1FZHE 4A09A 4X63B 1XVDE 4PBYA 3OGLB 4M42A 4I79A 5EM2B 2GNQA 3QEXA 1TBGA 2HJBA 4B08A 4CI8A 1MHZG 3BG1A 3F3FA 4DTJA 4GQ2P 3LZIA 4JRQA 4PSXB 3C6OB 5I5IA 4EP9A 3SBPA 2MTAH 4A0BA 3NAEA 3SLED 4GM3A 2Z2OA 3RWUA 1U4CA 3AL8B 3UVMA 1GXRA 2P9KC 3SNNA 4DTMA 4J82A 4E5ZA 2AQ5A 3RMZD 1XMGE 3CQ8A 4DTXA 3J81g 4HDJA 3RN1D 2IUQA 2JHPA 1SQ9A 4J2DA 3FGBA 1MG2A 4G56B 5IGQA 3V9FA 4HCCA 3N0DA 5IT9g 4EWRA 4ZOVA 3S9HA 3PVWB 4JSXC 3V5WB 4GZ8A 5THAA 4X5MA 4FJGA 3QEVA 5I5JA 2JH9A 2PM6B 3KD1E 2H9MA 3SPYA 4UI9R 5FXYA 3I7NA 4IA9A 5EALA 2E31A 5IJ7E 4R7AB 3JZGA 1WAFA 3RRMC 4CY3A 2PM9A 3EG6A 4GQBB 3J2PA 3J80g 2BCJB 4J8BA 3AL8A 2P9SC 2G9AA 4DTNA 2W18A 3E0CA 3A0FA 3J27A 3VH0A 3RSEC 4AEZA 2LF6A 1FZ0E 4FA5D 3CFSB 3MKQA 2IWKA 3P4FA 5HQGA 2E32A 4FHLA 3SXTD 2G99A 1XU5E 3PSCB 4BL0A 3C95A 4DTOA 4ERQA 3L0MA 1YFQA 1Q47A 2PBIB 3PXWD 3TL8B 5C2WB 1FZ2E 4O9DA 2UZXB 2OZSA 3LD8A 1PI6A 2XL2A 3F3GA 2YB5A 4E3SA 3OKWA 3IIYA 1K8KC 5JWZA 5CYKB 3W15A 4KHSA 5FKQA 1FZ1E 3SBRA 3I8EA 1FZ7E 3ZWLB 1XMFE 3OKYA 5TF2A 4CZVA 3KRXB 3N0EA 5IREA 2HJ4A 3PSLA 4QRJA 3SBQA 4J2EA 4GGDA 4I9QA 2B7MA 5AJAA 4M3UA 2B4EA 4H5IA 3JRPA 1FZ9E 5A2Qg
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J84 A;  2YMU A;  4O45 A;  3L4O D;  2AH1 A;  4PXW A;  2H14 A;  3HFQ A;  1VYH C;  3B7F A;  4ES0 A;  4FAN D;  4FA4 D;  3I7H A;  3I7K A;  2HKR A;  3FRX A;  4OWR A;  5EAM A;  5AFU 3;  2H6Q A;  5GXH A;  3C5M A;  1OMW B;  4J81 A;  5EAR A;  5H1M A;  2Z2P A;  2J56 H;  5CYK A;  4CI3 A;  4Y5R D;  3PXT D;  2HES X;  3SN6 B;  2H9P A;  5EML B;  5H14 A;  2CO0 C;  3SMR A;  2J57 G;  4A2M A;  4X61 B;  4XEI C;  1GP2 B;  4MK0 B;  5FKS A;  3SVW D;  3SCY A;  5B4W A;  2AGZ A;  2I3S A;  5GSA A;  1NEX B;  1JOF A;  4FA1 D;  2H3X A;  2P9N C;  1K32 A;  1B9Y A;  2IWF A;  2I0S A;  4BH6 A;  5FLX g;  2PM9 B;  4BUJ C;  4CY1 A;  4J77 A;  5HE1 B;  4JSV C;  4J86 A;  3OGM B;  2OVR B;  4ESG A;  2CO0 A;  3C75 H;  1FS1 A;  4A2L A;  2IUR A;  2AGX A;  2I3T A;  4H5J A;  1OLZ A;  4GGA A;  5IC7 A;  3EI3 B;  1XIP A;  3C99 A;  3I2N A;  2UZY B;  4Z8L A;  1A0R B;  1U2V C;  3I7P A;  4J78 A;  2YNO A;  4JT6 C;  1PBY B;  4FB1 D;  3BWS A;  4J87 A;  3IKO A;  4I6J B;  3JAM g;  2OK4 A;  2I0T A;  5GXI A;  4PSW B;  5C2V B;  2H68 A;  3UKR C;  3OKY B;  3K26 A;  2HKM A;  4JD2 C;  2XL3 A;  3OTT A;  3WSO A;  2XU7 A;  5TEE A;  4ZOY A;  3EI2 A;  5HE3 B;  2Z2N A;  1FWX A;  3UVL A;  3I8C A;  5CXB B;  3EI3 A;  4TZ4 A;  2H6K A;  4N14 A;  5SXM A;  2GC4 A;  4GGC A;  1SQJ A;  3UVO A;  5EMM B;  4JT5 C;  3GFC A;  4QT8 A;  3MMY A;  3RN0 D;  4LG8 A;  5IJ8 E;  5HE2 B;  3JRO A;  4IMM A;  4CY2 A;  2AH0 A;  2P9U C;  3JZN A;  4X3E A;  2YBA A;  4E54 B;  3ULE C;  3RFG A;  3MZK A;  5H17 A;  5IBK B;  3KRW B;  5CXC B;  1SHY B;  4A0A B;  5EMJ B;  3AL9 A;  4ERZ A;  3MZL A;  4L9O A;  4PC0 A;  3ORV D;  4QQE A;  4A11 B;  4D6V A;  5FKR A;  5EAP A;  4J79 A;  5CXB A;  4Y7R A;  4D0K A;  1GOT B;  2H13 A;  3I7O A;  2P1Q B;  2H9L A;  4KFM B;  1LDK E;  5KDO B;  1RI6 A;  4A08 B;  4FA9 D;  2B5M A;  4J0X A;  5TDH B;  4E54 A;  1NR0 A;  5IGO A;  2YNP A;  5CXC A;  3C9C A;  4O1Q D;  2YNN A;  4A0A A;  3NVQ A;  2CNX A;  4ZOZ A;  3K27 A;  3MXX A;  4FWW A;  1XHM A;  4GM8 A;  2P9I C;  4CI1 A;  4YVD A;  4ZN4 A;  4LGN A;  1B9X A;  2HXC A;  3DWL C;  4ERY A;  3RFH A;  4GM9 A;  4A11 A;  4ZOX A;  2P9L C;  3IJ1 A;  5AMS A;  4CC9 A;  2P1O B;  4K3I D;  3BG0 A;  3GRE A;  3PVU B;  5K19 A;  4PNK B;  4A08 A;  2IUP A;  1ERJ A;  2OIZ A;  3I7L A;  2P1M B;  2B5N A;  2P1P B;  4GQ1 A;  4OZU A;  4QL1 A;  1JJU B;  3EI2 B;  2XYI A;  2QC5 A;  1R5M A;  3DM0 A;  1GG2 B;  3VA6 A;  5TEF A;  2BBK H;  2AGL A;  4U1E I;  2O9K A;  1JMX B;  2CN3 A;  4U7A A;  4J8G A;  2AGY A;  5FKT A;  3OW8 A;  3EU7 A;  2CE9 A;  3V7D B;  3AFC A;  2H47 A;  3IJC A;  2TRC B;  4PBZ A;  4O3U B;  4AOW A;  3MKS B;  1PGU A;  5HYN B;  4NSX A;  3JPX A;  4GMB A;  5FQD A;  3RLM D;  4XYH A;  4JSN C;  4CZX A;  2OVQ B;  2HYE A;  5I5M A;  4J0W A;  5EM2 A;  3AH8 B;  3FM0 A;  2P1N B;  1QNI A;  1PEV A;  1N6D A;  3SJL D;  3C6N B;  3OKT A;  3IJ0 A;  3EI1 B;  1XKS A;  3I89 A;  3SFZ A;  3OL2 B;  2IUV A;  2CN2 A;  2H9N A;  5EMK B;  3SHF A;  5FA5 B;  4J73 A;  4XYI A;  4JSP C;  2OK6 A;  1MDA H;  3UVK A;  2IAA A;  4FAV D;  2OJY A;  4A7J A;  2EBS A;  3EI4 B;  3CFV A;  3ODT A;  2YB8 B;  3L2O B;  2OVP B;  3SWS D;  4L1Q D;  5C9Z B;  4K3J B;  2CE8 A;  4L3H D;  4X60 B;  2AGW A;  3EI1 A;  1JMZ B;  3OL2 A;  2P9P C;  1L0Q A;  3EMH A;  4O3T B;  2Q7Q A;  3UVN A;  4A09 B;  3U4Y A;  3PE7 A;  2PM7 B;  1P22 A;  1S4U X;  1N6E A;  1N6F A;  2H6N A;  2B5L A;  3CIK B;  3EI4 A;  3JB9 L;  2GC7 A;  3DSM A;  3NVN A;  5HE0 B;  3IIW A;  2J55 H;  3L4M D;  3OGK B;  3PXS D;  5K1C C;  1TYQ C;  4CZY A;  3VGZ A;  4L3G D;  4A0B B;  3DXM C;  2QXV A;  2I0R A;  3JZH A;  4CI2 A;  4E5Z B;  3NVX A;  3C6P B;  4CY5 A;  4LG9 A;  4JXM A;  3DXK C;  3UKU C;  1MG3 A;  3F3P A;  3UR4 A;  3EWE A;  5GMK n;  4A09 A;  4X63 B;  4PBY A;  3OGL B;  4I79 A;  5EM2 B;  2GNQ A;  1TBG A;  2HJB A;  4CI8 A;  3BG1 A;  3F3F A;  4GQ2 P;  4PSX B;  3C6O B;  5I5I A;  3SBP A;  2MTA H;  4A0B A;  3SLE D;  4GM3 A;  2Z2O A;  1U4C A;  3AL8 B;  3UVM A;  1GXR A;  2P9K C;  4J82 A;  4E5Z A;  2AQ5 A;  3RMZ D;  3J81 g;  4HDJ A;  3RN1 D;  2IUQ A;  1SQ9 A;  3FGB A;  1MG2 A;  4G56 B;  5IGQ A;  3V9F A;  3N0D A;  5IT9 g;  4EWR A;  4ZOV A;  3PVW B;  4JSX C;  3V5W B;  4GZ8 A;  5THA A;  5I5J A;  2PM6 B;  2H9M A;  4UI9 R;  5FXY A;  3I7N A;  4IA9 A;  5EAL A;  2E31 A;  5IJ7 E;  4R7A B;  3JZG A;  3RRM C;  4CY3 A;  2PM9 A;  4GQB B;  3EG6 A;  3J80 g;  2BCJ B;  4J8B A;  3AL8 A;  2P9S C;  2G9A A;  2W18 A;  3E0C A;  3A0F A;  3VH0 A;  3RSE C;  4AEZ A;  4FA5 D;  3CFS B;  3MKQ A;  2IWK A;  3P4F A;  5HQG A;  2E32 A;  4FHL A;  3SXT D;  2G99 A;  3PSC B;  4BL0 A;  4ERQ A;  1YFQ A;  1Q47 A;  2PBI B;  3PXW D;  5C2W B;  4O9D A;  2UZX B;  1PI6 A;  2XL2 A;  3F3G A;  3OKW A;  3IIY A;  1K8K C;  5JWZ A;  5CYK B;  3W15 A;  5FKQ A;  3SBR A;  3I8E A;  3ZWL B;  3OKY A;  5TF2 A;  4CZV A;  3KRX B;  3N0E A;  2HJ4 A;  3PSL A;  4QRJ A;  3SBQ A;  4GGD A;  5AJA A;  2B4E A;  4H5I A;  3JRP A;  5A2Q g; 
#chains in the Genus database with same CATH topology
 5E6U A;  4J84 A;  3RMB A;  1M1X A;  2YMU A;  3L4O D;  1JV2 A;  2AH1 A;  4O45 A;  4PXW A;  2H14 A;  4FJL A;  3HFQ A;  1VYH C;  5M5T A;  3B7F A;  1H2Y A;  4ES0 A;  1XVE E;  4FAN D;  4QNC A;  4FA4 D;  4DTP A;  3I7H A;  2HKR A;  3I7K A;  3FRX A;  4OWR A;  5EAM A;  1FXX A;  5AFU 3;  2H6Q A;  1A12 A;  4FVM A;  5GXH A;  3C5M A;  3FCU A;  1OMW B;  3IVM A;  2EID A;  4J81 A;  3IUQ A;  5EAR A;  5H1M A;  2Z2P A;  4M3Y A;  3SI6 A;  3SVI A;  1GOF A;  4FK4 A;  2J56 H;  5CYK A;  5E6S A;  5C86 A;  4CI3 A;  4Y5R D;  3PXT D;  2HES X;  3SN6 B;  3QHY B;  1FZ3 E;  4ADN A;  2H9P A;  4E4B A;  5EML B;  5H14 A;  3IJE A;  3ZE2 A;  2CO0 C;  3NE6 A;  3SMR A;  4BP8 A;  4FJH A;  5M5S A;  2J57 G;  4AKG A;  3QER A;  3E4Y A;  2XE4 A;  4QAM A;  3V4P A;  4A2M A;  4X61 B;  4XEI C;  1GP2 B;  4MK0 B;  4FJX A;  5FKS A;  1QFS A;  2VJ5 A;  4O2W A;  3SVW D;  3SCY A;  1VZ2 A;  5B4W A;  4JHN A;  2AGZ A;  2B1E A;  3UIQ A;  4FK2 A;  1BPO A;  2I3S A;  3MUN A;  4FJK A;  5H37 A;  3QES A;  1NEX B;  5GSA A;  1JOF A;  4M41 A;  3SUN A;  4AN1 A;  4WK4 A;  4FA1 D;  3HGK E;  2H3X A;  2P9N C;  1K32 A;  1B9Y A;  4BCD A;  3CFP A;  1UOP A;  2I0S A;  2IWF A;  4BH6 A;  5FLX g;  2PM9 B;  4BUJ C;  4CY1 A;  3IUR A;  5M5V A;  3FCS A;  4J77 A;  1FZ8 E;  5HE1 B;  4JSV C;  4J86 A;  3KD5 E;  4G1E A;  3ZDX A;  3OGM B;  2OVR B;  4DU4 A;  1VE7 A;  4ESG A;  3K72 A;  2CO0 A;  3C75 H;  1FS1 A;  4A2L A;  1MMO G;  3TAG A;  2FW3 A;  4FJM A;  2AGX A;  2IUR A;  2I3T A;  4H5J A;  1OLZ A;  4GGA A;  5IC7 A;  3EI3 B;  3N1B A;  1XIP A;  3C99 A;  3I2N A;  4ICG C;  2UZY B;  4Z8L A;  3QEI A;  1N1C A;  3LDB A;  4KHY A;  1A0R B;  1U2V C;  2JH8 A;  3I7P A;  2JKX A;  4J78 A;  2YNO A;  3L8B A;  4JT6 C;  4BCC A;  1PBY B;  4FB1 D;  3BWS A;  3TAF A;  4J87 A;  2DTU A;  3IKO A;  4RE6 A;  4I6J B;  4RL5 A;  3JAM g;  2LF3 A;  2OK4 A;  2I0T A;  5GXI A;  4PSW B;  1T2X A;  5C2V B;  4JS4 A;  2H68 A;  3UKR C;  3OKY B;  3K26 A;  3UO2 A;  2WQ8 A;  4NC4 A;  2HKM A;  1MTY G;  3SQ0 A;  4JD2 C;  1XVB E;  4IT5 A;  2XL3 A;  3OTT A;  4M3Z A;  3WSO A;  3SQ1 A;  1VE6 A;  3QEP A;  2XU7 A;  5TEE A;  4ZOY A;  5M61 A;  3EI2 A;  5HE3 B;  2Z2N A;  1FWX A;  4FJJ A;  3SPZ A;  3UVL A;  3SJJ A;  3I8C A;  5CXB B;  3EI3 A;  4TZ4 A;  2H6K A;  4N14 A;  1FZ4 E;  2EIE A;  5SXM A;  2GC4 A;  4GGC A;  3IUJ A;  1SQJ A;  3UVO A;  3NHG A;  5EMM B;  2P5O A;  2QR5 A;  3EQ9 A;  3GFC A;  4JT5 C;  4QT8 A;  2PFT A;  3MMY A;  3RN0 D;  4LG8 A;  5IJ8 E;  2ATQ A;  5HE2 B;  3JRO A;  4IMM A;  4CY2 A;  2AH0 A;  2P9U C;  2JHC A;  2MZW B;  3JZN A;  3SQ4 A;  1WAJ A;  3LDS A;  4X3E A;  2YBA A;  4JS5 A;  2VJ4 A;  3ULE C;  4E54 B;  3UO3 A;  3QEW A;  3RFG A;  3MZK A;  5H17 A;  5IBK B;  3KRW B;  5CXC B;  1SHY B;  1MHY G;  3MVD K;  3RMA A;  1O6G A;  4A0A B;  2OZM A;  1FPO A;  5EMJ B;  4FK0 A;  3AL9 A;  4I9L A;  1E5T A;  4FJ9 A;  4ERZ A;  3MZL A;  3EQ8 A;  4L9O A;  4PC0 A;  3N1E A;  4WK0 A;  3TJY A;  3ORV D;  1FZI E;  4QQE A;  3TAB A;  2DY4 A;  4A11 B;  4D6V A;  5FKR A;  5EAP A;  1IH7 A;  3TAE A;  4J79 A;  5CXB A;  3QNN A;  4Y7R A;  2JPN A;  1FYZ E;  2VIX A;  4D0K A;  1GOT B;  2H13 A;  3I7O A;  2BKL A;  2P1Q B;  2H9L A;  4KHU A;  4KFM B;  3ZDY A;  4J2B A;  1LDK E;  5KDO B;  1RI6 A;  4A08 B;  4FA9 D;  2B5M A;  4J0X A;  5TDH B;  4E54 A;  3QNO A;  3GD1 I;  1NR0 A;  2EIC A;  2VZ3 A;  5IGO A;  2YNP A;  5CXC A;  3K2O A;  3C9C A;  4O1Q D;  2YNN A;  3C94 A;  4A0A A;  4BP9 A;  3NVQ A;  2H4T A;  3RMD A;  1Q9X A;  1H2Z A;  4JRP A;  2CNX A;  4ZOZ A;  3K27 A;  4EPH A;  3MXX A;  4J2A A;  4M45 A;  4KHQ A;  4FWW A;  1XHM A;  4ADO A;  4GM8 A;  2P9I C;  4CI1 A;  4YVD A;  4ZN4 A;  4LGN A;  2PFV A;  1B9X A;  5M5U A;  2HXC A;  3HP9 A;  1I2M B;  2B8I A;  3DWL C;  4ERY A;  3NGI A;  3RFH A;  4GM9 A;  4A11 A;  4ZOX A;  4D9S A;  2P9L C;  4KI4 A;  3IJ1 A;  4RG8 A;  4FJ7 A;  5AMS A;  3QET A;  4CC9 A;  3K6S A;  2P1O B;  2RKH A;  4K3I D;  4HCB A;  3NDK A;  3E4W A;  3BG0 A;  3GRE A;  3PVU B;  5K19 A;  4PNK B;  4DTU A;  1XVG E;  4A08 A;  2IUP A;  4G55 A;  1ERJ A;  1FZ6 E;  2QXF A;  2P1M B;  2OIZ A;  3I7L A;  2B5N A;  2P1P B;  4GQ1 A;  4OZU A;  4QL1 A;  1JJU B;  3EI2 B;  2HU8 A;  2XYI A;  2QC5 A;  5A2Q g;  3SUP A;  1R5M A;  2QZP A;  3DM0 A;  5FFG A;  1GG2 B;  3VA6 A;  1C9I A;  5TEF A;  2EIB A;  2BBK H;  2K5S A;  3SUQ A;  2AGL A;  4U1E I;  4WK2 A;  3IUM A;  2P5G A;  2O9K A;  1JMX B;  2CN3 A;  4U7A A;  4J8G A;  2AGY A;  1FZ5 E;  5FKT A;  3OW8 A;  2MMB A;  3EU7 A;  3QI0 A;  2CE9 A;  3LZJ A;  3V7D B;  3AFC A;  2H47 A;  3K71 A;  4DU1 A;  2TRC B;  3IJC A;  4PBZ A;  3EQ7 A;  4O3U B;  4AOW A;  3MKS B;  1PGU A;  2VDO A;  3DDU A;  5HYN B;  4AI6 A;  3MUO A;  4L1M A;  4NSX A;  4DTS A;  4O02 A;  3JPX A;  4GMB A;  5FQD A;  3RLM D;  1IG9 A;  4XYH A;  4JSN C;  4CZX A;  2OVQ B;  2HYE A;  4NAA A;  2HU5 A;  3OF7 A;  5I5M A;  1XU3 E;  3RMC A;  4J0W A;  1E8N A;  5EM2 A;  3AH8 B;  3FM0 A;  2P1N B;  4QND A;  1QNI A;  1PEV A;  1N6D A;  3SJL D;  3NIF A;  3C6N B;  2VDL A;  4AN0 A;  3OKT A;  3IJ0 A;  1H2X A;  3EI1 B;  1XKS A;  3I89 A;  3SFZ A;  3OL2 B;  4M3X A;  2IUV A;  1JW2 A;  2CN2 A;  1GOG A;  2H9N A;  5EMK B;  3SHF A;  4RNG A;  5FA5 B;  3VI4 A;  4J73 A;  3CFR A;  4JSP C;  4XYI A;  2OK6 A;  3KCI A;  4M3T A;  1MDA H;  3VI3 A;  4G1M A;  3UVK A;  2IAA A;  1TYE A;  4FAV D;  3SQ2 A;  2OJY A;  4A7J A;  2JHA A;  2RCU A;  4DTR A;  1U8C A;  4AKI A;  4KI6 A;  2EBS A;  3CFO A;  4AKH A;  4DU3 A;  3CFV A;  3EI4 B;  3ODT A;  2DEB A;  4GAM C;  2YB8 B;  4FJN A;  1CLQ A;  3L2O B;  4FJ5 A;  2OVP B;  1YR2 A;  4L1Q D;  3SWS D;  3ZE0 A;  2HD0 A;  5C9Z B;  2FYO A;  4K3J B;  3SCX A;  4M3R A;  2CE8 A;  1O6F A;  4L3H D;  3SUO A;  4X60 B;  4MMX A;  4EYW A;  4X5N A;  1XVC E;  2AGW A;  3O4G A;  3EI1 A;  4KHN A;  1JMZ B;  3IUL A;  3OL2 A;  2P9P C;  1L0Q A;  2OYQ A;  1VZ3 A;  2VC2 A;  4M3W A;  4FJ8 A;  3EMH A;  4O3T B;  2Q7Q A;  1UOO A;  3UVN A;  4A09 B;  1XL3 C;  3HL8 A;  3U4Y A;  3PE7 A;  3IUN A;  2PM7 B;  1P22 A;  3ZE1 A;  3JB9 L;  4FJI A;  5FFO A;  1N6E A;  1N6F A;  1S4U X;  2H6N A;  2B5L A;  3CIK B;  3HGL A;  3EI4 A;  2VDP A;  3NCI A;  3L1N A;  1Q9Y A;  1UTC A;  2GC7 A;  3DSM A;  3NVN A;  5HE0 B;  4AMZ A;  1C9L A;  3IIW A;  2J55 H;  3L4M D;  3OGK B;  3PXS D;  5K1C C;  1TYQ C;  4CZY A;  4DNV A;  3VGZ A;  4L3G D;  4A0B B;  3DXM C;  3T3P A;  1L5G A;  2QXV A;  4MMZ A;  4UM9 A;  1K3I A;  2I0R A;  3JRP A;  3JZH A;  4CI2 A;  4E5Z B;  4KHW A;  4UM8 A;  3NVX A;  1XVF E;  3C6P B;  5IZ7 A;  4CY5 A;  4LG9 A;  4JXM A;  1XMH E;  3DXK C;  3UKU C;  1MG3 A;  5HDB A;  3F3P A;  3UR4 A;  3EWE A;  5GMK n;  1FZH E;  4Z7O A;  3GC3 B;  4A09 A;  4X63 B;  1XVD E;  2HU7 A;  4PBY A;  3OGL B;  4M42 A;  4I79 A;  5EM2 B;  2GNQ A;  1UOQ A;  3QEX A;  1TBG A;  2HJB A;  4B08 A;  4CI8 A;  1MHZ G;  3BG1 A;  3F3F A;  4DTJ A;  4GQ2 P;  3LZI A;  4Z7N A;  4JRQ A;  4JHP C;  4PSX B;  3C6O B;  5I5I A;  4EP9 A;  3SBP A;  2MTA H;  4A0B A;  3NAE A;  3SLE D;  4GM3 A;  2Z2O A;  3RWU A;  1U4C A;  3AL8 B;  3UVM A;  1GXR A;  2P9K C;  3SNN A;  4DTM A;  4J82 A;  4E5Z A;  2AQ5 A;  3RMZ D;  1XMG E;  3CQ8 A;  4DTX A;  3J81 g;  4HDJ A;  3RN1 D;  2IUQ A;  2JHP A;  1SQ9 A;  4J2D A;  3FGB A;  1MG2 A;  4G56 B;  2JQT A;  2MW2 A;  3V9F A;  5IGQ A;  4HCC A;  2XDW A;  3N0D A;  4NEN A;  4EWR A;  5IT9 g;  1E8M A;  4ZOV A;  3S9H A;  3PVW B;  4JSX C;  3V5W B;  4DNU A;  4GZ8 A;  5THA A;  4DNW A;  4X5M A;  4MMY A;  4FJG A;  3QEV A;  1GOH A;  5I5J A;  3O4I A;  2JH9 A;  2PM6 B;  3KD1 E;  2H9M A;  3SPY A;  5E6R A;  4UI9 R;  1JTD B;  3O4J A;  4BCB A;  5FXY A;  3I7N A;  1QFM A;  4IA9 A;  5EAL A;  2E31 A;  5IJ7 E;  5C92 A;  4R7A B;  3O4H A;  3JZG A;  1WAF A;  3RRM C;  4CY3 A;  4RE5 A;  2PM9 A;  3EG6 A;  4GQB B;  3J2P A;  3J80 g;  2BCJ B;  4J8B A;  2XZG A;  3AL8 A;  2P9S C;  4AX4 A;  2G9A A;  4DTN A;  2W18 A;  3E0C A;  3A0F A;  3J27 A;  3VH0 A;  4IRZ A;  3RSE C;  4AEZ A;  2LF6 A;  1FZ0 E;  4FA5 D;  3CFS B;  3MKQ A;  2IWK A;  3P4F A;  5M5R A;  5HQG A;  3NID A;  2E32 A;  2VZ1 A;  4FHL A;  3SXT D;  2G99 A;  1XU5 E;  3PSC B;  4BL0 A;  3C95 A;  4DTO A;  2VDR A;  4ERQ A;  3L0M A;  4NBM A;  1YFQ A;  1Q47 A;  2PBI B;  3PXW D;  3TL8 B;  5C2W B;  1FZ2 E;  4O9D A;  3NIG A;  2UZX B;  2OZS A;  3LD8 A;  1PI6 A;  2XL2 A;  3F3G A;  2YB5 A;  4E3S A;  3OKW A;  3V4V A;  2VDQ A;  3IIY A;  1K8K C;  5JWZ A;  5CYK B;  4AMY A;  3W15 A;  4KHS A;  5FKQ A;  1FZ1 E;  3SBR A;  3I8E A;  1FZ7 E;  3ZWL B;  1XMF E;  3OKY A;  5TF2 A;  4Z7Q A;  2VDK A;  4CZV A;  3BVO A;  3KRX B;  3T3M A;  3N0E A;  5IRE A;  2HJ4 A;  3PSL A;  4QRJ A;  3SBQ A;  4J2E A;  1H2W A;  4GGD A;  4I9Q A;  2B7M A;  5AJA A;  4M3U A;  3ZDZ A;  2B4E A;  2VDM A;  4H5I A;  2VDN A;  1FZ9 E;  4WJK A; 
#chains in the Genus database with same CATH homology
 4J84 A;  3RMB A;  2YMU A;  3L4O D;  4O45 A;  2AH1 A;  4PXW A;  2H14 A;  4FJL A;  3HFQ A;  1VYH C;  3B7F A;  4ES0 A;  1XVE E;  4FAN D;  4QNC A;  4FA4 D;  4DTP A;  3I7H A;  2HKR A;  3I7K A;  3FRX A;  4OWR A;  5EAM A;  1FXX A;  5AFU 3;  2H6Q A;  4FVM A;  5GXH A;  3C5M A;  1OMW B;  4J81 A;  5EAR A;  5H1M A;  2Z2P A;  4M3Y A;  3SI6 A;  3SVI A;  2J56 H;  4FK4 A;  5CYK A;  4CI3 A;  4Y5R D;  3PXT D;  2HES X;  3SN6 B;  1FZ3 E;  4ADN A;  2H9P A;  4E4B A;  5EML B;  5H14 A;  2CO0 C;  3NE6 A;  3SMR A;  4FJH A;  2J57 G;  4AKG A;  3QER A;  3E4Y A;  4A2M A;  4X61 B;  4XEI C;  1GP2 B;  4MK0 B;  4FJX A;  5FKS A;  2VJ5 A;  3SVW D;  3SCY A;  5B4W A;  2AGZ A;  2B1E A;  3UIQ A;  4FK2 A;  2I3S A;  4FJK A;  5H37 A;  3QES A;  1NEX B;  5GSA A;  1JOF A;  4M41 A;  3SUN A;  4FA1 D;  3HGK E;  2H3X A;  2P9N C;  1K32 A;  1B9Y A;  3CFP A;  2IWF A;  2I0S A;  4BH6 A;  5FLX g;  2PM9 B;  4BUJ C;  4CY1 A;  4J77 A;  1FZ8 E;  5HE1 B;  4JSV C;  4J86 A;  3KD5 E;  3OGM B;  2OVR B;  4DU4 A;  4ESG A;  2CO0 A;  3C75 H;  1FS1 A;  4A2L A;  1MMO G;  3TAG A;  2FW3 A;  4FJM A;  2AGX A;  2IUR A;  2I3T A;  4H5J A;  1OLZ A;  4GGA A;  5IC7 A;  3EI3 B;  3N1B A;  1XIP A;  3C99 A;  3I2N A;  2UZY B;  4Z8L A;  3QEI A;  3LDB A;  4KHY A;  1A0R B;  1U2V C;  2JH8 A;  3I7P A;  4J78 A;  2YNO A;  3L8B A;  4JT6 C;  1PBY B;  4FB1 D;  3BWS A;  3TAF A;  4J87 A;  2DTU A;  3IKO A;  4I6J B;  4RL5 A;  3JAM g;  2LF3 A;  2OK4 A;  2I0T A;  5GXI A;  4PSW B;  5C2V B;  4JS4 A;  2H68 A;  3UKR C;  3OKY B;  3K26 A;  2HKM A;  1MTY G;  3SQ0 A;  4JD2 C;  1XVB E;  2XL3 A;  3OTT A;  4M3Z A;  3WSO A;  3SQ1 A;  3QEP A;  2XU7 A;  5TEE A;  4ZOY A;  3EI2 A;  5HE3 B;  2Z2N A;  1FWX A;  4FJJ A;  3SPZ A;  3UVL A;  3SJJ A;  3I8C A;  5CXB B;  3EI3 A;  4TZ4 A;  2H6K A;  4N14 A;  1FZ4 E;  5SXM A;  2GC4 A;  4GGC A;  1SQJ A;  3UVO A;  3NHG A;  5EMM B;  2P5O A;  4JT5 C;  3GFC A;  4QT8 A;  2PFT A;  3MMY A;  3RN0 D;  4LG8 A;  5IJ8 E;  2ATQ A;  5HE2 B;  3JRO A;  4IMM A;  4CY2 A;  2AH0 A;  2P9U C;  2JHC A;  2MZW B;  3JZN A;  3SQ4 A;  1WAJ A;  3LDS A;  4X3E A;  2YBA A;  4JS5 A;  2VJ4 A;  3ULE C;  4E54 B;  3QEW A;  3RFG A;  3MZK A;  5H17 A;  5IBK B;  3KRW B;  5CXC B;  1SHY B;  1MHY G;  3RMA A;  4A0A B;  2OZM A;  5EMJ B;  4FK0 A;  3AL9 A;  4I9L A;  4FJ9 A;  4ERZ A;  3MZL A;  4L9O A;  4PC0 A;  3N1E A;  3TJY A;  3ORV D;  1FZI E;  4QQE A;  3TAB A;  2DY4 A;  4A11 B;  4D6V A;  5FKR A;  5EAP A;  1IH7 A;  3TAE A;  4J79 A;  5CXB A;  3QNN A;  4Y7R A;  2JPN A;  1FYZ E;  2VIX A;  4D0K A;  1GOT B;  2H13 A;  3I7O A;  2P1Q B;  2H9L A;  4KHU A;  4KFM B;  4J2B A;  1LDK E;  5KDO B;  1RI6 A;  4A08 B;  4FA9 D;  2B5M A;  4J0X A;  5TDH B;  4E54 A;  3QNO A;  1NR0 A;  5IGO A;  2YNP A;  5CXC A;  3K2O A;  3C9C A;  4O1Q D;  2YNN A;  3C94 A;  4A0A A;  3NVQ A;  2H4T A;  3RMD A;  1Q9X A;  4JRP A;  2CNX A;  4ZOZ A;  3K27 A;  4EPH A;  3MXX A;  4J2A A;  4M45 A;  4KHQ A;  4FWW A;  1XHM A;  4ADO A;  4GM8 A;  2P9I C;  4CI1 A;  4YVD A;  4ZN4 A;  4LGN A;  2PFV A;  1B9X A;  2HXC A;  3HP9 A;  2B8I A;  3DWL C;  4ERY A;  3NGI A;  3RFH A;  4GM9 A;  4A11 A;  4ZOX A;  2P9L C;  4KI4 A;  3IJ1 A;  4RG8 A;  4FJ7 A;  5AMS A;  3QET A;  4CC9 A;  2P1O B;  4K3I D;  4HCB A;  3NDK A;  3E4W A;  3BG0 A;  3GRE A;  3PVU B;  5K19 A;  4PNK B;  4DTU A;  1XVG E;  4A08 A;  2IUP A;  1ERJ A;  1FZ6 E;  2QXF A;  2P1M B;  2OIZ A;  3I7L A;  2B5N A;  2P1P B;  4GQ1 A;  4OZU A;  4QL1 A;  1JJU B;  3EI2 B;  2XYI A;  2QC5 A;  3SUP A;  1R5M A;  3DM0 A;  1GG2 B;  3VA6 A;  5TEF A;  2BBK H;  3SUQ A;  2AGL A;  4U1E I;  2P5G A;  2O9K A;  1JMX B;  2CN3 A;  4U7A A;  4J8G A;  2AGY A;  1FZ5 E;  5FKT A;  3OW8 A;  2MMB A;  3EU7 A;  2CE9 A;  3LZJ A;  3V7D B;  3AFC A;  2H47 A;  4DU1 A;  2TRC B;  3IJC A;  4PBZ A;  4O3U B;  4AOW A;  3MKS B;  1PGU A;  5HYN B;  4AI6 A;  4NSX A;  4DTS A;  3JPX A;  4GMB A;  5FQD A;  3RLM D;  1IG9 A;  4XYH A;  4JSN C;  4CZX A;  2OVQ B;  2HYE A;  5I5M A;  1XU3 E;  3RMC A;  4J0W A;  5EM2 A;  3AH8 B;  3FM0 A;  2P1N B;  4QND A;  1QNI A;  1PEV A;  1N6D A;  3SJL D;  3C6N B;  3OKT A;  3IJ0 A;  3EI1 B;  1XKS A;  3I89 A;  3SFZ A;  3OL2 B;  4M3X A;  2IUV A;  2CN2 A;  2H9N A;  5EMK B;  3SHF A;  4RNG A;  5FA5 B;  4J73 A;  3CFR A;  4JSP C;  4XYI A;  2OK6 A;  4M3T A;  1MDA H;  3UVK A;  2IAA A;  4FAV D;  3SQ2 A;  2OJY A;  4A7J A;  2JHA A;  2RCU A;  4DTR A;  4AKI A;  4KI6 A;  2EBS A;  3CFO A;  4AKH A;  4DU3 A;  3CFV A;  3EI4 B;  3ODT A;  2DEB A;  4GAM C;  2YB8 B;  4FJN A;  1CLQ A;  3L2O B;  4FJ5 A;  2OVP B;  3SWS D;  4L1Q D;  2HD0 A;  5C9Z B;  2FYO A;  4K3J B;  3SCX A;  4M3R A;  2CE8 A;  4L3H D;  3SUO A;  4X60 B;  4EYW A;  4X5N A;  1XVC E;  2AGW A;  3EI1 A;  4KHN A;  1JMZ B;  3OL2 A;  2P9P C;  1L0Q A;  2OYQ A;  4M3W A;  4FJ8 A;  3EMH A;  4O3T B;  2Q7Q A;  3UVN A;  4A09 B;  1XL3 C;  3HL8 A;  3U4Y A;  3PE7 A;  2PM7 B;  1P22 A;  4FJI A;  1N6E A;  1N6F A;  1S4U X;  2H6N A;  2B5L A;  3CIK B;  3HGL A;  3EI4 A;  3JB9 L;  3NCI A;  3L1N A;  1Q9Y A;  2GC7 A;  3DSM A;  3NVN A;  5HE0 B;  3IIW A;  2J55 H;  3L4M D;  3OGK B;  3PXS D;  5K1C C;  1TYQ C;  4CZY A;  3VGZ A;  4L3G D;  4A0B B;  3DXM C;  2QXV A;  2I0R A;  3JZH A;  4CI2 A;  4E5Z B;  4KHW A;  3NVX A;  1XVF E;  3C6P B;  5IZ7 A;  4CY5 A;  4LG9 A;  4JXM A;  1XMH E;  3DXK C;  3UKU C;  1MG3 A;  3F3P A;  3UR4 A;  3EWE A;  5GMK n;  1FZH E;  4A09 A;  4X63 B;  1XVD E;  4PBY A;  3OGL B;  4M42 A;  4I79 A;  5EM2 B;  2GNQ A;  3QEX A;  1TBG A;  2HJB A;  4B08 A;  4CI8 A;  1MHZ G;  3BG1 A;  3F3F A;  4DTJ A;  4GQ2 P;  3LZI A;  4JRQ A;  4PSX B;  3C6O B;  5I5I A;  4EP9 A;  3SBP A;  2MTA H;  4A0B A;  3NAE A;  3SLE D;  4GM3 A;  2Z2O A;  3RWU A;  1U4C A;  3AL8 B;  3UVM A;  1GXR A;  2P9K C;  3SNN A;  4DTM A;  4J82 A;  4E5Z A;  2AQ5 A;  3RMZ D;  1XMG E;  3CQ8 A;  4DTX A;  3J81 g;  4HDJ A;  3RN1 D;  2IUQ A;  2JHP A;  1SQ9 A;  4J2D A;  3FGB A;  1MG2 A;  4G56 B;  5IGQ A;  3V9F A;  4HCC A;  3N0D A;  5IT9 g;  4EWR A;  4ZOV A;  3S9H A;  3PVW B;  4JSX C;  3V5W B;  4GZ8 A;  5THA A;  4X5M A;  4FJG A;  3QEV A;  5I5J A;  2JH9 A;  2PM6 B;  3KD1 E;  2H9M A;  3SPY A;  4UI9 R;  5FXY A;  3I7N A;  4IA9 A;  5EAL A;  2E31 A;  5IJ7 E;  4R7A B;  3JZG A;  1WAF A;  3RRM C;  4CY3 A;  2PM9 A;  3EG6 A;  4GQB B;  3J2P A;  3J80 g;  2BCJ B;  4J8B A;  3AL8 A;  2P9S C;  2G9A A;  4DTN A;  2W18 A;  3E0C A;  3A0F A;  3J27 A;  3VH0 A;  3RSE C;  4AEZ A;  2LF6 A;  1FZ0 E;  4FA5 D;  3CFS B;  3MKQ A;  2IWK A;  3P4F A;  5HQG A;  2E32 A;  4FHL A;  3SXT D;  2G99 A;  1XU5 E;  3PSC B;  4BL0 A;  3C95 A;  4DTO A;  4ERQ A;  3L0M A;  1YFQ A;  1Q47 A;  2PBI B;  3PXW D;  3TL8 B;  5C2W B;  1FZ2 E;  4O9D A;  2UZX B;  2OZS A;  3LD8 A;  1PI6 A;  2XL2 A;  3F3G A;  2YB5 A;  4E3S A;  3OKW A;  3IIY A;  1K8K C;  5JWZ A;  5CYK B;  3W15 A;  4KHS A;  5FKQ A;  1FZ1 E;  3SBR A;  3I8E A;  1FZ7 E;  3ZWL B;  1XMF E;  3OKY A;  5TF2 A;  4CZV A;  3KRX B;  3N0E A;  5IRE A;  2HJ4 A;  3PSL A;  4QRJ A;  3SBQ A;  4J2E A;  4GGD A;  4I9Q A;  2B7M A;  5AJA A;  4M3U A;  2B4E A;  4H5I A;  3JRP A;  1FZ9 E;  5A2Q g; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...