2OVRB

Structure of the skp1-fbw7-cyclinedegn complex
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
444
structure length
442
Chain Sequence
TQVKHMMQVIEPQFQRDFISLLPKELALYVLSFLEPKDLLQAAQTCRYWRILAEDNLLWREKCKEEGIDEPLHIKRVIKPGFIHSPWKSAYIRQHRIDTNWRRGELKSPKVLKGHDDHVITCLQFCGNRIVSGSDDNTLKVWSAVTGKCLRTLVGHTGGVWSSQMRDNIIISGSTDRTLKVWNAETGECIHTLYGHTSTVRCMHLHEKRVVSGSRDATLRVWDIETGQCLHVLMGHVAAVRCVQYDGRRVVSGAYDFMVKVWDPETETCLHTLQGHTNRVYSLQFDGIHVVSGSLDTSIRVWDVETGNCIHTLTGHQSLTSGMELKDNILVSGNADSTVKIWDIKTGQCLQTLQGPNKHQSAVTCLQFNKNFVITSSDDGTVKLWDLKTGEFIRNLVTLESGGSGGVVWRIRASNTKLVCAVGSRNGTEETKLLVLDFDVDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of a Fbw7-Skp1-Cyclin E Complex: Multisite-Phosphorylated Substrate Recognition by SCF Ubiquitin Ligases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/cell cycle
molecule keywords S-phase kinase-associated protein 1A
total genus 132
structure length 442
sequence length 444
ec nomenclature
pdb deposition date 2007-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00400 WD40 WD domain, G-beta repeat
B PF12937 F-box-like F-box-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.50 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 2ovrB01
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2ovrB02
3RSEC 4CY1A 5H1MA 5GMKn 1NEXB 3CIKB 3I7PA 2H6KA 2E32A 2J57G 3C5MA 2OIZA 5IT9g 4UI9R 3BWSA 1L0QA 4ESGA 3UVMA 3AL8A 3JAMg 4ERZA 1A0RB 4ZOXA 2OJYA 2CE8A 3DSMA 3PSLA 1XKSA 2PBIB 2IURA 3I89A 3I7OA 5H17A 4FA5D 1SQ9A 3RRMC 4QQEA 3EI4A 4A08A 3NVXA 3P4FA 4A08B 4QL1A 4GGCA 4U1EI 4EWRA 3RFGA 4PBYA 5EAMA 4JT6C 4CI2A 4R7AB 1P22A 2IUPA 2BBKH 5HYNB 4FAVD 3C6PB 3DWLC 3IIYA 2YNOA 3EI4B 3BG1A 3EI3A 5TEFA 2CN3A 5EM2A 3I7LA 4MK0B 1LDKE 3EI2B 5FA5B 2H9NA 5IC7A 3UVNA 1XHMA 4PBZA 4AEZA 4YVDA 4A0AB 3JZGA 4L3GD 4D6VA 2P9LC 4FAND 2I3SA 5AJAA 4XEIC 2G9AA 2H3XA 2P9UC 3K26A 4NSXA 4FA9D 3SMRA 3N0DA 1GXRA 2YBAA 4O1QD 3VGZA 3V9FA 4FHLA 1GP2B 1VYHC 3K27A 4JSPC 3IJCA 1TBGA 4ZN4A 2Z2OA 3UVLA 2P1PB 4A11B 4E54A 4JXMA 3EI1A 2HJ4A 3OKTA 5JWZA 4CZVA 1SQJA 2B5LA 4J8GA 4A11A 3OKWA 3ODTA 3VH0A 3E0CA 1JMZB 3SFZA 3WSOA 3C75H 3RN1D 3SHFA 2HJBA 4ES0A 3SCYA 3AL9A 3MKQA 3MZLA 4QRJA 4E54B 4N14A 4ZOVA 3SBPA 3V5WB 2CN2A 3I8EA 2AGYA 5FKQA 3I7HA 5CXBA 1N6FA 2IUQA 2HYEA 5GXIA 4A2LA 2PM9B 4PNKB 4L1QD 4PSWB 3NVQA 2AGZA 2YMUA 2CE9A 4J82A 3SN6B 3OGKB 2Z2PA 1OLZA 1N6DA 3KRXB 3MKSB 2P9IC 2I0SA 1S4UX 3I7NA 4H5IA 4PSXB 5SXMA 5K1CC 4I79A 3C9CA 5TDHB 4CI1A 4GGAA 2PM9A 3AL8B 1Q47A 2OVQB 2TRCB 3C6OB 3EI3B 4A09B 4L3HD 2Z2NA 2XU7A 5EMKB 3SXTD 5EMLB 3NVNA 3HFQA 4JSXC 5I5JA 2GC4A 2AGXA 4CY5A 4CI8A 2CO0A 3U4YA 2OVPB 2UZXB 3UKRC 3FRXA 4IMMA 4J81A 1PI6A 3J80g 3F3GA 4GQ1A 3OL2B 2XYIA 3J81g 3UKUC 4K3JB 2P1QB 2W18A 3B7FA 3RN0D 2HKMA 1GOTB 2XL3A 3IJ0A 5FKRA 1B9YA 4O9DA 4FWWA 2P9PC 3CFSB 4JSNC 4GZ8A 2YNPA 3JPXA 5EAPA 5CXCB 3VA6A 1OMWB 2P1MB 3SBRA 2XL2A 3W15A 4A7JA 4CZYA 5FLXg 4QT8A 2YNNA 3CFVA 1JJUB 1JOFA 1FWXA 5HE1B 2OVRB 4BH6A 3DXKC 3JZHA 5K19A 3FM0A 3OTTA 1U4CA 3C99A 4J78A 4G56B 1MDAH 3BG0A 5TEEA 1XIPA 4A0AA 5CXCA 4J79A 1ERJA 1QNIA 3JROA 4ZOZA 3RMZD 3AFCA 3PXWD 4GM8A 3PXTD 3PE7A 5EM2B 5B4WA 4O3TB 4XYIA 2H6NA 5A2Qg 4CI3A 3EU7A 4J87A 3FGBA 3ZWLB 5IJ7E 4A0BA 2P9SC 2J56H 3PXSD 2OK6A 5FKSA 4J77A 2J55H 1PGUA 4ZOYA 5EMJB 1FS1A 1GG2B 1U2VC 2B5MA 3F3FA 5FQDA 3I8CA 3DXMC 2GC7A 2H6QA 3RFHA 4X61B 3EWEA 1N6EA 2CO0C 4E5ZB 2I0RA 4BL0A 3EI1B 4X60B 3DM0A 4IA9A 2IWFA 5IGQA 5C2VB 3N0EA 5C9ZB 4J73A 1PBYB 3AH8B 4K3ID 1R5MA 4J86A 4BUJC 5THAA 4ERYA 3SWSD 4JSVC 4TZ4A 3PVWB 3ULEC 5I5MA 5GXHA 4J0XA 4A2MA 4LG9A 5CYKA 3SBQA 4FA4D 5EARA 3L4OD 1K8KC 4H5JA 4X3EA 5FKTA 4HDJA 3EMHA 1TYQC 3MZKA 3JRPA 3I2NA 3KRWB 5IJ8E 3OGMB 3MMYA 4D0KA 5GSAA 5HE3B 2B4EA 1JMXB 2E31A 2G99A 2QXVA 4PXWA 2AGWA 4GM9A 1PEVA 2H9MA 3PVUB 4J0WA 5HE0B 3UR4A 2H13A 3UVOA 2BCJB 2Q7QA 2HESX 2CNXA 4A09A 3C6NB 4GM3A 4PC0A 2P9NC 4LGNA 4CY2A 2AGLA 5HE2B 4I6JB 1YFQA 2MTAH 2UZYB 2P1NB 2IUVA 4A0BB 2H68A 1B9XA 3OGLB 4CY3A 4L9OA 4OWRA 2H9LA 4GQ2P 2AH0A 5EALA 2IAAA 3SJLD 3MXXA 2PM7B 1MG2A 5KDOB 1NR0A 5TF2A 5I5IA 3F3PA 5AMSA 2IWKA 3EI2A 2P1OB 3A0FA 1K32A 3L4MD 2I3TA 4E5ZA 2HXCA 5IGOA 3OL2A 5FXYA 4LG8A 3JZNA 2YB8B 3IJ1A 3OKYB 2H14A 5AFU3 4GMBA 2QC5A 2B5NA 4GQBB 1SHYB 4JD2C 2O9KA 3GREA 5CXBB 4Y5RD 5EMMB 3SLED 3RLMD 2GNQA 4U7AA 3IIWA 4OZUA 5HQGA 2P9KC 3IKOA 4Z8LA 3OW8A 2HKRA 3EG6A 3PSCB 4JT5C 3UVKA 4FB1D 1RI6A 2H47A 4J84A 3I7KA 2I0TA 4ERQA 1MG3A 3OKYA 3L2OB 3V7DB 5H14A 4KFMB 5IBKB 4X63B 3JB9L 2EBSA 4CC9A 2H9PA 3ORVD 4Y7RA 5C2WB 2AQ5A 2AH1A 4GGDA 3SVWD 3GFCA 2OK4A 4CZXA 4J8BA 4O3UB 5CYKB 4O45A 4FA1D 4XYHA 4AOWA 2PM6B
chains in the Genus database with same CATH superfamily
2JKXA 3RSEC 4WK0A 5H1MA 4CY1A 5GMKn 1NEXB 3LZIA 3CIKB 3I7PA 2MZWB 2H6KA 2E32A 2J57G 3C5MA 3KCIA 4NC4A 2OIZA 5IT9g 4UI9R 4B08A 1A12A 3BWSA 1L0QA 4AMZA 2LF3A 4X5NA 4ESGA 3UVMA 3TAEA 3AL8A 3JAMg 4ERZA 1XVDE 1A0RB 4ZOXA 4FJMA 2OJYA 2CE8A 4KHUA 3DSMA 3PSLA 3ZE1A 4DNUA 3QEVA 1MTYG 1XKSA 2PBIB 3NIDA 4AKHA 2IURA 3I89A 4EP9A 3I7OA 3EQ8A 2RCUA 5H17A 4QAMA 4FA5D 3RWUA 1SQ9A 3RRMC 4QQEA 4G55A 3EI4A 4A08A 4FJ5A 5FFGA 3QERA 3NVXA 3P4FA 4WJKA 4DNWA 3LDSA 2DTUA 4A08B 4QL1A 4GGCA 4U1EI 4EWRA 3RFGA 4PBYA 3C94A 3EQ7A 5EAMA 4JT6C 1FZ0E 4CI2A 5E6RA 4O2WA 4R7AB 1P22A 2IUPA 4DTPA 2JHAA 2BBKH 3KD5E 5HYNB 2EICA 4FAVD 1BPOA 3C6PB 3DWLC 3QEPA 3IIYA 2YNOA 3EI4B 4UM9A 3SI6A 3SQ2A 5M5TA 1VE6A 3BG1A 4KHQA 3ZE2A 4FJXA 1E5TA 3EQ9A 3EI3A 5TEFA 4FJHA 4RE6A 4HCBA 2CN3A 2HU5A 5EM2A 1XVFE 5M5RA 3I7LA 4FK4A 1XVBE 4MK0B 1LDKE 2VJ5A 3EI2B 3K2OA 5FA5B 2H9NA 5IC7A 2JPNA 1VZ2A 4FJJA 3UVNA 1XHMA 2VZ3A 3NIGA 4PBZA 4M3YA 4NBMA 4AEZA 4YVDA 4A0AB 3JZGA 4L3GD 1MMOG 4G1EA 4FJ8A 4D6VA 2P9LC 4FAND 2I3SA 5AJAA 4XEIC 3ZE0A 2G9AA 2H3XA 2P9UC 3K26A 3IJEA 4NSXA 3L8BA 4FA9D 3QEWA 3SMRA 3N0DA 1GXRA 2YBAA 4O1QD 3VGZA 3V9FA 4FHLA 1MHYG 1GP2B 4HCCA 1VYHC 3K27A 2H4TA 4JSPC 3IJCA 1XU3E 4IRZA 1TBGA 4ZN4A 2Z2OA 3UVLA 3RMCA 2P1PB 1XMHE 4MMZA 4A11B 4E54A 4JXMA 4FJKA 2HJ4A 3OKTA 4UM8A 5JWZA 3EI1A 2DEBA 2VC2A 3E4YA 3QEXA 4CZVA 1SQJA 4Z7OA 3TL8B 2B5LA 4DU3A 4J8GA 4A11A 3OKWA 3ODTA 4BCBA 4DU4A 3VH0A 3NHGA 3UO3A 3E0CA 1VE7A 1JMZB 3SFZA 3WSOA 1H2YA 3C75H 4FJ9A 4L1MA 3RN1D 3SHFA 2HJBA 4ES0A 2LF6A 3SCYA 2MMBA 3GC3B 3AL9A 4E4BA 3MKQA 4BP9A 3MZLA 4KHWA 4QRJA 4M45A 3SPYA 3BVOA 1FZIE 4N14A 4ZOVA 5M5UA 4E54B 2OZMA 3SBPA 3V5WB 2B1EA 2CN2A 1WAJA 3I8EA 2AGYA 3NGIA 5FKQA 3I7HA 1JTDB 3N1EA 2OYQA 5CXBA 1K3IA 1N6FA 3SUQA 4AKGA 2IUQA 2HYEA 4A2LA 2PM9B 4PNKB 5GXIA 4L1QD 3NVQA 4PSWB 2AGZA 2YMUA 2CE9A 4J82A 3SN6B 3OGKB 2Z2PA 1Q9YA 1OLZA 1H2WA 1N6DA 3KRXB 4NAAA 3MKSB 2P9IC 3CFOA 1FZ8E 1S4UX 2I0SA 3I7NA 4H5IA 4PSXB 5SXMA 5K1CC 4I79A 5IZ7A 1FZ3E 3C9CA 5TDHB 5C86A 4I9LA 4CI1A 3V4VA 3SNNA 4GGAA 4AN0A 2PM9A 4RL5A 3AL8B 1Q47A 4WK4A 2HD0A 2OVQB 2TRCB 4AX4A 2VDRA 3C6OB 3EI3B 4A09B 4L3HD 2Z2NA 2XU7A 5EMKB 4AI6A 3SXTD 5EMLB 4QNCA 2B8IA 1GOFA 3NVNA 4O02A 3HFQA 2VDLA 3RMDA 4JSXC 5I5JA 2GC4A 3SQ0A 4AMYA 2QZPA 1GOHA 1CLQA 2AGXA 4CY5A 2CO0A 4CI8A 4ICGC 3U4YA 4DTOA 2OVPB 4ADNA 2UZXB 3UKRC 1H2XA 4DNVA 2VDKA 4DTNA 3FRXA 1UOQA 3IULA 4IMMA 4J81A 1PI6A 3J80g 1UTCA 3F3GA 4GQ1A 1E8NA 4M42A 2EIDA 3QEIA 3OL2B 2XYIA 3J81g 3UKUC 3E4WA 4K3JB 2P1QB 2W18A 3B7FA 3K6SA 5E6UA 3RN0D 2HKMA 1GOTB 2XL3A 3IJ0A 5FKRA 4DTRA 1B9YA 4O9DA 1FZ9E 4FVMA 4FWWA 3T3MA 2P9PC 3C95A 3CFSB 3HP9A 4JSNC 1C9LA 4GZ8A 2YNPA 1GOGA 3ZDXA 1N1CA 4JS4A 3SUNA 1FYZE 3JPXA 4FJIA 5EAPA 3K72A 5CXCB 3VA6A 1OMWB 2P1MB 3SBRA 4J2BA 2XL2A 2EIBA 3W15A 4A7JA 3VI3A 4CZYA 4QT8A 2YNNA 3CFVA 1JJUB 1JOFA 1FZ2E 1FWXA 3T3PA 5HE1B 2OVRB 4BH6A 3DXKC 3JZHA 5K19A 3FM0A 1XVEE 3TJYA 4J2DA 3OTTA 2ATQA 1U4CA 3C99A 4J78A 4G56B 4FJNA 3RMBA 1MDAH 3IURA 3BG0A 4DU1A 5TEEA 1XIPA 4BCDA 4A0AA 5CXCA 4DTUA 3FCUA 4J79A 1ERJA 1QNIA 3JROA 4ZOZA 3KD1E 4JHNA 3RMZD 3SJJA 3S9HA 3AFCA 5H37A 3PXWD 1TYEA 4GM8A 3PXTD 5M5SA 3PE7A 5EM2B 5B4WA 4O3TB 4XYIA 2H6NA 5A2Qg 2K5SA 4CI3A 4X5MA 3HGKE 2BKLA 3EU7A 3NAEA 3FGBA 4J87A 3ZWLB 5IJ7E 2P9SC 4A0BA 2FW3A 4AKIA 1T2XA 2J56H 3PXSD 4G1MA 2OK6A 4NENA 5FKSA 1FZ6E 4J77A 4BP8A 2P5GA 2J55H 1XVCE 1PGUA 2P5OA 1C9IA 4ZOYA 5EMJB 1FS1A 1GG2B 1U2VC 2B5MA 2HU8A 3F3FA 1XU5E 3I8CA 3DXMC 5FQDA 2GC7A 4FK2A 3O4IA 2H6QA 4WK2A 3RFHA 2VDPA 4X61B 3EWEA 4D9SA 1N6EA 4GAMC 5FFOA 2CO0C 4DTSA 1XL3C 3SUPA 3O4JA 2DY4A 2I0RA 4E5ZB 4BL0A 3EI1B 4M41A 4X60B 3DM0A 4RE5A 4FJ7A 4IA9A 2VDOA 1FZ5E 2IWFA 5IGQA 4J2AA 5C2VB 3N0EA 4RG8A 5C9ZB 4J73A 1PBYB 2JHPA 3AH8B 4K3ID 1R5MA 1FZ4E 4J86A 3CFPA 4BUJC 5THAA 4ERYA 3SQ1A 3SWSD 4JSVC 4TZ4A 3PVWB 3ULEC 5I5MA 1VZ3A 4FA1D 5GXHA 2QXFA 3L0MA 3VI4A 4J0XA 4A2MA 2FYOA 4LG9A 5E6SA 1XMGE 1U8CA 3QESA 4MMXA 5CYKA 3SBQA 4BCCA 2JH8A 3IVMA 5EARA 3L4OD 2JHCA 4FA4D 1K8KC 1I2MB 2VDNA 1O6GA 2VZ1A 4H5JA 1YR2A 4X3EA 1WAFA 1FPOA 3V4PA 3O4HA 5FKTA 3HL8A 4HDJA 1JV2A 3EMHA 1TYQC 4M3XA 3MZKA 3JRPA 3I2NA 3KRWB 3GD1I 3FCSA 3OGMB 5IJ8E 3MMYA 4D0KA 5GSAA 3TAGA 3LD8A 5HE3B 2B4EA 4KHYA 4ADOA 1JMXB 2E31A 2G99A 2QXVA 5HDBA 5C92A 4FK0A 2AGWA 4PXWA 4M3RA 4GM9A 1PEVA 2H9MA 3PVUB 3MUNA 1UOPA 3NIFA 2VDQA 4J0WA 3SVIA 4E3SA 2EIEA 5HE0B 3UR4A 2H13A 3UVOA 3QI0A 2BCJB 2Q7QA 4DTXA 2HESX 2CNXA 1XMFE 4I9QA 4A09A 3UO2A 1O6FA 4KHSA 3C6NB 4GM3A 4PC0A 1QFSA 2P9NC 4LGNA 4CY2A 2AGLA 5HE2B 4I6JB 1YFQA 3IUJA 1MHZG 4QNDA 1IG9A 3IUNA 3N1BA 2MTAH 4MMYA 2UZYB 2P1NB 3CQ8A 2B7MA 2IUVA 3SUOA 3QNOA 3RMAA 4A0BB 2H68A 4M3UA 3DDUA 3OF7A 1B9XA 3SQ4A 3OGLB 1E8MA 1M1XA 4CY3A 4L9OA 4J2EA 4OWRA 2H9LA 4DTJA 2AH0A 4GQ2P 5EALA 5FLXg 4KI4A 2MW2A 1L5GA 2IAAA 3SPZA 3SJLD 3MXXA 2PM7B 4EYWA 1MG2A 3LDBA 5KDOB 1NR0A 5TF2A 1H2ZA 5I5IA 3F3PA 5AMSA 3IUQA 2IWKA 3EI2A 2JQTA 1QFMA 1IH7A 2P1OB 2HU7A 2VIXA 3A0FA 1K32A 3L4MD 2XZGA 2I3TA 4E5ZA 2HXCA 4KI6A 5IGOA 3OL2A 3TAFA 5FXYA 2RKHA 1XVGE 4LG8A 1FXXA 3QHYB 4JHPC 3JZNA 2YB8B 3IJ1A 4JRQA 2VJ4A 3J27A 4FJLA 2H14A 3OKYB 3NE6A 5AFU3 4GMBA 2QC5A 3UIQA 2B5NA 4GQBB 5M5VA 2OZSA 3QETA 1SHYB 4DTMA 3J2PA 3L1NA 4JD2C 3ZDYA 4AN1A 3TABA 2O9KA 4Z7QA 3GREA 1FZHE 4Z7NA 2XDWA 3O4GA 4Y5RD 3SCXA 5CXBB 3ZDZA 5EMMB 2XE4A 3SLED 3RLMD 4KHNA 2GNQA 2WQ8A 4U7AA 3IIWA 2PFVA 4OZUA 5M61A 3NCIA 4JS5A 5HQGA 2P9KC 3IKOA 4Z8LA 3OW8A 2HKRA 2PFTA 3EG6A 3PSCB 5IREA 1JW2A 4JT5C 3UVKA 4FB1D 1RI6A 2H47A 4J84A 3LZJA 2VDMA 3I7KA 2I0TA 3HGLA 4ERQA 3CFRA 4JRPA 1MG3A 3OKYA 3L2OB 1Q9XA 2QR5A 3MVDK 3V7DB 4EPHA 3IUMA 4M3ZA 5H14A 4M3TA 4KFMB 1FZ1E 4RNGA 5IBKB 4X63B 3JB9L 2EBSA 1UOOA 4CC9A 2H9PA 3NDKA 3ORVD 4Y7RA 4IT5A 5C2WB 4FJGA 2AQ5A 2AH1A 4GGDA 3SVWD 3GFCA 2OK4A 4CZXA 4J8BA 1FZ7E 3MUOA 2JH9A 3QNNA 4M3WA 4O3UB 5CYKB 3K71A 4O45A 2YB5A 4XYHA 4AOWA 2PM6B
chains in the Genus database with same CATH topology
3RSEC 4CY1A 5H1MA 5GMKn 1NEXB 3LZIA 3CIKB 3I7PA 2MZWB 2H6KA 2E32A 2J57G 3C5MA 2OIZA 5IT9g 4UI9R 4B08A 3BWSA 1L0QA 2LF3A 4X5NA 4ESGA 3UVMA 3TAEA 3AL8A 3JAMg 4ERZA 1XVDE 1A0RB 4ZOXA 4FJMA 2OJYA 2CE8A 4KHUA 3DSMA 3PSLA 3QEVA 1MTYG 1XKSA 2PBIB 4AKHA 2IURA 3I89A 4EP9A 3I7OA 2RCUA 5H17A 4FA5D 3RWUA 1SQ9A 3RRMC 4QQEA 3EI4A 4A08A 4FJ5A 3QERA 3NVXA 3P4FA 3LDSA 2DTUA 4A08B 4QL1A 4GGCA 4U1EI 4EWRA 3RFGA 4PBYA 3C94A 5EAMA 4JT6C 1FZ0E 4CI2A 4R7AB 1P22A 2IUPA 4DTPA 2JHAA 2BBKH 3KD5E 5HYNB 4FAVD 3C6PB 3DWLC 3QEPA 3IIYA 2YNOA 3EI4B 3SI6A 3SQ2A 3BG1A 4KHQA 4FJXA 3EI3A 5TEFA 4FJHA 4HCBA 2CN3A 5EM2A 1XVFE 3I7LA 4FK4A 1XVBE 4MK0B 1LDKE 2VJ5A 3EI2B 3K2OA 5FA5B 2H9NA 5IC7A 2JPNA 4FJJA 3UVNA 1XHMA 4PBZA 4M3YA 4AEZA 4YVDA 4A0AB 3JZGA 4L3GD 1MMOG 4FJ8A 4D6VA 2P9LC 4FAND 2I3SA 5AJAA 4XEIC 2G9AA 2H3XA 2P9UC 3K26A 4NSXA 3L8BA 4FA9D 3QEWA 3SMRA 3N0DA 1GXRA 2YBAA 4O1QD 3VGZA 3V9FA 4FHLA 1MHYG 1GP2B 4HCCA 1VYHC 3K27A 2H4TA 4JSPC 3IJCA 1XU3E 1TBGA 4ZN4A 2Z2OA 3UVLA 3RMCA 2P1PB 1XMHE 4A11B 4E54A 4JXMA 4FJKA 2HJ4A 3OKTA 5JWZA 3EI1A 2DEBA 3E4YA 3QEXA 4CZVA 1SQJA 3TL8B 2B5LA 4DU3A 4J8GA 4A11A 3OKWA 3ODTA 4DU4A 3VH0A 3NHGA 3E0CA 1JMZB 3SFZA 3WSOA 3C75H 4FJ9A 3RN1D 3SHFA 2HJBA 4ES0A 2LF6A 3SCYA 2MMBA 3AL9A 4E4BA 3MKQA 3MZLA 4KHWA 4QRJA 4M45A 3SPYA 4E54B 1FZIE 4N14A 4ZOVA 2OZMA 3SBPA 3V5WB 2B1EA 2CN2A 1WAJA 3I8EA 2AGYA 3NGIA 5FKQA 3I7HA 3N1EA 2OYQA 5CXBA 1N6FA 3SUQA 4AKGA 2IUQA 2HYEA 4A2LA 2PM9B 4PNKB 5GXIA 4L1QD 3NVQA 4PSWB 2AGZA 2YMUA 2CE9A 4J82A 3SN6B 3OGKB 2Z2PA 1Q9YA 1OLZA 1N6DA 3KRXB 3MKSB 2P9IC 3CFOA 1FZ8E 1S4UX 2I0SA 3I7NA 4H5IA 4PSXB 5SXMA 5K1CC 4I79A 5IZ7A 1FZ3E 3C9CA 5TDHB 4I9LA 4CI1A 3SNNA 4GGAA 2PM9A 4RL5A 3AL8B 1Q47A 2HD0A 2OVQB 2TRCB 3C6OB 3EI3B 4A09B 4L3HD 2Z2NA 2XU7A 5EMKB 4AI6A 3SXTD 5EMLB 4QNCA 2B8IA 3NVNA 3HFQA 3RMDA 4JSXC 5I5JA 2GC4A 3SQ0A 2AGXA 1CLQA 4CY5A 4CI8A 2CO0A 3U4YA 4DTOA 2OVPB 4ADNA 2UZXB 3UKRC 4DTNA 3FRXA 4IMMA 4J81A 1PI6A 3J80g 3F3GA 4GQ1A 4M42A 3QEIA 3OL2B 2XYIA 3J81g 3UKUC 3E4WA 4K3JB 2P1QB 2W18A 3B7FA 3RN0D 2HKMA 1GOTB 2XL3A 3IJ0A 5FKRA 4DTRA 1B9YA 4O9DA 1FZ9E 4FVMA 4FWWA 2P9PC 3C95A 3CFSB 3HP9A 4JSNC 4GZ8A 2YNPA 4JS4A 3SUNA 1FYZE 3JPXA 4FJIA 5EAPA 5CXCB 3VA6A 1OMWB 2P1MB 3SBRA 4J2BA 2XL2A 3W15A 4A7JA 4CZYA 5FLXg 4QT8A 2YNNA 3CFVA 1JJUB 1JOFA 1FZ2E 1FWXA 5HE1B 2OVRB 4BH6A 3DXKC 3JZHA 5K19A 3FM0A 1XVEE 3TJYA 4J2DA 3OTTA 2ATQA 1U4CA 3C99A 4J78A 4G56B 4FJNA 3RMBA 1MDAH 3BG0A 4DU1A 5TEEA 1XIPA 4A0AA 5CXCA 4DTUA 4J79A 1ERJA 1QNIA 3JROA 4ZOZA 3KD1E 3RMZD 3SJJA 3S9HA 3AFCA 5H37A 3PXWD 4GM8A 3PXTD 3PE7A 5EM2B 5B4WA 4O3TB 4XYIA 2H6NA 5A2Qg 4CI3A 4X5MA 3HGKE 3EU7A 3NAEA 3FGBA 4J87A 3ZWLB 5IJ7E 2P9SC 4A0BA 2FW3A 4AKIA 2J56H 3PXSD 2OK6A 5FKSA 1FZ6E 4J77A 2P5GA 2J55H 1XVCE 1PGUA 2P5OA 4ZOYA 5EMJB 1FS1A 1GG2B 1U2VC 2B5MA 3F3FA 1XU5E 3I8CA 3DXMC 5FQDA 2GC7A 4FK2A 2H6QA 3RFHA 4X61B 3EWEA 1N6EA 4GAMC 2CO0C 4DTSA 1XL3C 3SUPA 4E5ZB 2DY4A 2I0RA 4BL0A 3EI1B 4M41A 4X60B 3DM0A 4FJ7A 4IA9A 1FZ5E 2IWFA 5IGQA 4J2AA 5C2VB 3N0EA 4RG8A 5C9ZB 4J73A 1PBYB 2JHPA 3AH8B 4K3ID 1R5MA 1FZ4E 4J86A 3CFPA 4BUJC 5THAA 4ERYA 3SQ1A 3SWSD 4JSVC 4TZ4A 3PVWB 3ULEC 5I5MA 4FA1D 5GXHA 2QXFA 3L0MA 4J0XA 4A2MA 2FYOA 4LG9A 1XMGE 3QESA 5CYKA 3SBQA 2JH8A 5EARA 4FA4D 3L4OD 2JHCA 1K8KC 4H5JA 4X3EA 1WAFA 5FKTA 3HL8A 4HDJA 3EMHA 1TYQC 4M3XA 3MZKA 3JRPA 3I2NA 3KRWB 5IJ8E 3OGMB 3MMYA 4D0KA 5GSAA 3TAGA 3LD8A 5HE3B 2B4EA 4KHYA 4ADOA 1JMXB 2E31A 2G99A 2QXVA 4FK0A 2AGWA 4PXWA 4M3RA 4GM9A 1PEVA 2H9MA 3PVUB 4J0WA 3SVIA 4E3SA 5HE0B 3UR4A 2H13A 3UVOA 2BCJB 2Q7QA 4DTXA 2HESX 2CNXA 1XMFE 4I9QA 4A09A 4KHSA 3C6NB 4GM3A 4PC0A 2P9NC 4LGNA 4CY2A 2AGLA 5HE2B 4I6JB 1YFQA 1MHZG 4QNDA 1IG9A 3N1BA 2MTAH 2UZYB 2P1NB 3CQ8A 2B7MA 2IUVA 3SUOA 3QNOA 3RMAA 4A0BB 2H68A 4M3UA 1B9XA 3SQ4A 3OGLB 4CY3A 4L9OA 4J2EA 4OWRA 2H9LA 4DTJA 2AH0A 4GQ2P 5EALA 4KI4A 2IAAA 3SPZA 3SJLD 3MXXA 2PM7B 4EYWA 1MG2A 3LDBA 5KDOB 1NR0A 5TF2A 5I5IA 3F3PA 5AMSA 2IWKA 3EI2A 1IH7A 2P1OB 2VIXA 3A0FA 1K32A 3L4MD 2I3TA 4E5ZA 2HXCA 4KI6A 5IGOA 3OL2A 3TAFA 5FXYA 1XVGE 4LG8A 1FXXA 3JZNA 2YB8B 3IJ1A 4JRQA 2VJ4A 3J27A 4FJLA 2H14A 3OKYB 3NE6A 5AFU3 4GMBA 2QC5A 3UIQA 2B5NA 4GQBB 2OZSA 3QETA 4DTMA 3J2PA 1SHYB 3L1NA 4JD2C 3TABA 2O9KA 3GREA 1FZHE 5CXBB 4Y5RD 3SCXA 5EMMB 3SLED 3RLMD 4KHNA 2GNQA 4U7AA 3IIWA 2PFVA 4OZUA 3NCIA 4JS5A 5HQGA 2P9KC 3IKOA 4Z8LA 3OW8A 2HKRA 2PFTA 3EG6A 3PSCB 5IREA 4JT5C 3UVKA 4FB1D 1RI6A 2H47A 4J84A 3LZJA 3I7KA 2I0TA 3HGLA 4ERQA 3CFRA 4JRPA 1MG3A 3OKYA 3L2OB 1Q9XA 3V7DB 4EPHA 5H14A 4M3ZA 4M3TA 4KFMB 1FZ1E 4RNGA 5IBKB 4X63B 3JB9L 2EBSA 4CC9A 2H9PA 3NDKA 3ORVD 4Y7RA 5C2WB 4FJGA 2AQ5A 2AH1A 4GGDA 3SVWD 3GFCA 2OK4A 4CZXA 4J8BA 1FZ7E 2JH9A 3QNNA 4M3WA 4O3UB 5CYKB 4O45A 2YB5A 4XYHA 4AOWA 2PM6B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RSE C;  4CY1 A;  5H1M A;  5GMK n;  1NEX B;  3CIK B;  3I7P A;  2H6K A;  2E32 A;  2J57 G;  3C5M A;  2OIZ A;  5IT9 g;  4UI9 R;  3BWS A;  1L0Q A;  4ESG A;  3UVM A;  3AL8 A;  3JAM g;  4ERZ A;  1A0R B;  4ZOX A;  2OJY A;  2CE8 A;  3DSM A;  3PSL A;  1XKS A;  2PBI B;  2IUR A;  3I89 A;  3I7O A;  5H17 A;  4FA5 D;  1SQ9 A;  3RRM C;  4QQE A;  3EI4 A;  4A08 A;  3NVX A;  3P4F A;  4A08 B;  4QL1 A;  4GGC A;  4U1E I;  4EWR A;  3RFG A;  4PBY A;  5EAM A;  4JT6 C;  4CI2 A;  4R7A B;  1P22 A;  2IUP A;  2BBK H;  5HYN B;  4FAV D;  3C6P B;  3DWL C;  3IIY A;  2YNO A;  3EI4 B;  3BG1 A;  3EI3 A;  5TEF A;  2CN3 A;  5EM2 A;  3I7L A;  4MK0 B;  1LDK E;  3EI2 B;  5FA5 B;  2H9N A;  5IC7 A;  3UVN A;  1XHM A;  4PBZ A;  4AEZ A;  4YVD A;  4A0A B;  3JZG A;  4L3G D;  4D6V A;  2P9L C;  4FAN D;  2I3S A;  5AJA A;  4XEI C;  2G9A A;  2H3X A;  2P9U C;  3K26 A;  4NSX A;  4FA9 D;  3SMR A;  3N0D A;  1GXR A;  2YBA A;  4O1Q D;  3VGZ A;  3V9F A;  4FHL A;  1GP2 B;  1VYH C;  3K27 A;  4JSP C;  3IJC A;  1TBG A;  4ZN4 A;  2Z2O A;  3UVL A;  2P1P B;  4A11 B;  4E54 A;  4JXM A;  3EI1 A;  2HJ4 A;  3OKT A;  5JWZ A;  4CZV A;  1SQJ A;  2B5L A;  4J8G A;  4A11 A;  3OKW A;  3ODT A;  3VH0 A;  3E0C A;  1JMZ B;  3SFZ A;  3WSO A;  3C75 H;  3RN1 D;  3SHF A;  2HJB A;  4ES0 A;  3SCY A;  3AL9 A;  3MKQ A;  3MZL A;  4QRJ A;  4E54 B;  4N14 A;  4ZOV A;  3SBP A;  3V5W B;  2CN2 A;  3I8E A;  2AGY A;  5FKQ A;  3I7H A;  5CXB A;  1N6F A;  2IUQ A;  2HYE A;  5GXI A;  4A2L A;  2PM9 B;  4PNK B;  4L1Q D;  4PSW B;  3NVQ A;  2AGZ A;  2YMU A;  2CE9 A;  4J82 A;  3SN6 B;  3OGK B;  2Z2P A;  1OLZ A;  1N6D A;  3KRX B;  3MKS B;  2P9I C;  2I0S A;  1S4U X;  3I7N A;  4H5I A;  4PSX B;  5SXM A;  5K1C C;  4I79 A;  3C9C A;  5TDH B;  4CI1 A;  4GGA A;  2PM9 A;  3AL8 B;  1Q47 A;  2OVQ B;  2TRC B;  3C6O B;  3EI3 B;  4A09 B;  4L3H D;  2Z2N A;  2XU7 A;  5EMK B;  3SXT D;  5EML B;  3NVN A;  3HFQ A;  4JSX C;  5I5J A;  2GC4 A;  2AGX A;  4CY5 A;  4CI8 A;  2CO0 A;  3U4Y A;  2OVP B;  2UZX B;  3UKR C;  3FRX A;  4IMM A;  4J81 A;  1PI6 A;  3J80 g;  3F3G A;  4GQ1 A;  3OL2 B;  2XYI A;  3J81 g;  3UKU C;  4K3J B;  2P1Q B;  2W18 A;  3B7F A;  3RN0 D;  2HKM A;  1GOT B;  2XL3 A;  3IJ0 A;  5FKR A;  1B9Y A;  4O9D A;  4FWW A;  2P9P C;  3CFS B;  4JSN C;  4GZ8 A;  2YNP A;  3JPX A;  5EAP A;  5CXC B;  3VA6 A;  1OMW B;  2P1M B;  3SBR A;  2XL2 A;  3W15 A;  4A7J A;  4CZY A;  5FLX g;  4QT8 A;  2YNN A;  3CFV A;  1JJU B;  1JOF A;  1FWX A;  5HE1 B;  2OVR B;  4BH6 A;  3DXK C;  3JZH A;  5K19 A;  3FM0 A;  3OTT A;  1U4C A;  3C99 A;  4J78 A;  4G56 B;  1MDA H;  3BG0 A;  5TEE A;  1XIP A;  4A0A A;  5CXC A;  4J79 A;  1ERJ A;  1QNI A;  3JRO A;  4ZOZ A;  3RMZ D;  3AFC A;  3PXW D;  4GM8 A;  3PXT D;  3PE7 A;  5EM2 B;  5B4W A;  4O3T B;  4XYI A;  2H6N A;  5A2Q g;  4CI3 A;  3EU7 A;  4J87 A;  3FGB A;  3ZWL B;  5IJ7 E;  4A0B A;  2P9S C;  2J56 H;  3PXS D;  2OK6 A;  5FKS A;  4J77 A;  2J55 H;  1PGU A;  4ZOY A;  5EMJ B;  1FS1 A;  1GG2 B;  1U2V C;  2B5M A;  3F3F A;  5FQD A;  3I8C A;  3DXM C;  2GC7 A;  2H6Q A;  3RFH A;  4X61 B;  3EWE A;  1N6E A;  2CO0 C;  4E5Z B;  2I0R A;  4BL0 A;  3EI1 B;  4X60 B;  3DM0 A;  4IA9 A;  2IWF A;  5IGQ A;  5C2V B;  3N0E A;  5C9Z B;  4J73 A;  1PBY B;  3AH8 B;  4K3I D;  1R5M A;  4J86 A;  4BUJ C;  5THA A;  4ERY A;  3SWS D;  4JSV C;  4TZ4 A;  3PVW B;  3ULE C;  5I5M A;  5GXH A;  4J0X A;  4A2M A;  4LG9 A;  5CYK A;  3SBQ A;  4FA4 D;  5EAR A;  3L4O D;  1K8K C;  4H5J A;  4X3E A;  5FKT A;  4HDJ A;  3EMH A;  1TYQ C;  3MZK A;  3JRP A;  3I2N A;  3KRW B;  5IJ8 E;  3OGM B;  3MMY A;  4D0K A;  5GSA A;  5HE3 B;  2B4E A;  1JMX B;  2E31 A;  2G99 A;  2QXV A;  4PXW A;  2AGW A;  4GM9 A;  1PEV A;  2H9M A;  3PVU B;  4J0W A;  5HE0 B;  3UR4 A;  2H13 A;  3UVO A;  2BCJ B;  2Q7Q A;  2HES X;  2CNX A;  4A09 A;  3C6N B;  4GM3 A;  4PC0 A;  2P9N C;  4LGN A;  4CY2 A;  2AGL A;  5HE2 B;  4I6J B;  1YFQ A;  2MTA H;  2UZY B;  2P1N B;  2IUV A;  4A0B B;  2H68 A;  1B9X A;  3OGL B;  4CY3 A;  4L9O A;  4OWR A;  2H9L A;  4GQ2 P;  2AH0 A;  5EAL A;  2IAA A;  3SJL D;  3MXX A;  2PM7 B;  1MG2 A;  5KDO B;  1NR0 A;  5TF2 A;  5I5I A;  3F3P A;  5AMS A;  2IWK A;  3EI2 A;  2P1O B;  3A0F A;  1K32 A;  3L4M D;  2I3T A;  4E5Z A;  2HXC A;  5IGO A;  3OL2 A;  5FXY A;  4LG8 A;  3JZN A;  2YB8 B;  3IJ1 A;  3OKY B;  2H14 A;  5AFU 3;  4GMB A;  2QC5 A;  2B5N A;  4GQB B;  1SHY B;  4JD2 C;  2O9K A;  3GRE A;  5CXB B;  4Y5R D;  5EMM B;  3SLE D;  3RLM D;  2GNQ A;  4U7A A;  3IIW A;  4OZU A;  5HQG A;  2P9K C;  3IKO A;  4Z8L A;  3OW8 A;  2HKR A;  3EG6 A;  3PSC B;  4JT5 C;  3UVK A;  4FB1 D;  1RI6 A;  2H47 A;  4J84 A;  3I7K A;  2I0T A;  4ERQ A;  1MG3 A;  3OKY A;  3L2O B;  3V7D B;  5H14 A;  4KFM B;  5IBK B;  4X63 B;  3JB9 L;  2EBS A;  4CC9 A;  2H9P A;  3ORV D;  4Y7R A;  5C2W B;  2AQ5 A;  2AH1 A;  4GGD A;  3SVW D;  3GFC A;  2OK4 A;  4CZX A;  4J8B A;  4O3U B;  5CYK B;  4O45 A;  4FA1 D;  4XYH A;  4AOW A;  2PM6 B; 
#chains in the Genus database with same CATH topology
 2JKX A;  3RSE C;  4WK0 A;  5H1M A;  4CY1 A;  5GMK n;  1NEX B;  3LZI A;  3CIK B;  3I7P A;  2MZW B;  2H6K A;  2E32 A;  2J57 G;  3C5M A;  3KCI A;  4NC4 A;  2OIZ A;  5IT9 g;  4UI9 R;  4B08 A;  1A12 A;  3BWS A;  1L0Q A;  4AMZ A;  2LF3 A;  4X5N A;  4ESG A;  3UVM A;  3TAE A;  3AL8 A;  3JAM g;  4ERZ A;  1XVD E;  1A0R B;  4ZOX A;  4FJM A;  2OJY A;  2CE8 A;  4KHU A;  3DSM A;  3PSL A;  3ZE1 A;  4DNU A;  3QEV A;  1MTY G;  1XKS A;  2PBI B;  3NID A;  4AKH A;  2IUR A;  3I89 A;  4EP9 A;  3I7O A;  3EQ8 A;  2RCU A;  5H17 A;  4QAM A;  4FA5 D;  3RWU A;  1SQ9 A;  3RRM C;  4QQE A;  4G55 A;  3EI4 A;  4A08 A;  4FJ5 A;  5FFG A;  3QER A;  3NVX A;  3P4F A;  4WJK A;  4DNW A;  3LDS A;  2DTU A;  4A08 B;  4QL1 A;  4GGC A;  4U1E I;  4EWR A;  3RFG A;  4PBY A;  3C94 A;  3EQ7 A;  5EAM A;  4JT6 C;  1FZ0 E;  4CI2 A;  5E6R A;  4O2W A;  4R7A B;  1P22 A;  2IUP A;  4DTP A;  2JHA A;  2BBK H;  3KD5 E;  5HYN B;  2EIC A;  4FAV D;  1BPO A;  3C6P B;  3DWL C;  3QEP A;  3IIY A;  2YNO A;  3EI4 B;  4UM9 A;  3SI6 A;  3SQ2 A;  5M5T A;  1VE6 A;  3BG1 A;  4KHQ A;  3ZE2 A;  4FJX A;  1E5T A;  3EQ9 A;  3EI3 A;  5TEF A;  4FJH A;  4RE6 A;  4HCB A;  2CN3 A;  2HU5 A;  5EM2 A;  1XVF E;  5M5R A;  3I7L A;  4FK4 A;  1XVB E;  4MK0 B;  1LDK E;  2VJ5 A;  3EI2 B;  3K2O A;  5FA5 B;  2H9N A;  5IC7 A;  2JPN A;  1VZ2 A;  4FJJ A;  3UVN A;  1XHM A;  2VZ3 A;  3NIG A;  4PBZ A;  4M3Y A;  4NBM A;  4AEZ A;  4YVD A;  4A0A B;  3JZG A;  4L3G D;  1MMO G;  4G1E A;  4FJ8 A;  4D6V A;  2P9L C;  4FAN D;  2I3S A;  5AJA A;  4XEI C;  3ZE0 A;  2G9A A;  2H3X A;  2P9U C;  3K26 A;  3IJE A;  4NSX A;  3L8B A;  4FA9 D;  3QEW A;  3SMR A;  3N0D A;  1GXR A;  2YBA A;  4O1Q D;  3VGZ A;  3V9F A;  4FHL A;  1MHY G;  1GP2 B;  4HCC A;  1VYH C;  3K27 A;  2H4T A;  4JSP C;  3IJC A;  1XU3 E;  4IRZ A;  1TBG A;  4ZN4 A;  2Z2O A;  3UVL A;  3RMC A;  2P1P B;  1XMH E;  4MMZ A;  4A11 B;  4E54 A;  4JXM A;  4FJK A;  2HJ4 A;  3OKT A;  4UM8 A;  5JWZ A;  3EI1 A;  2DEB A;  2VC2 A;  3E4Y A;  3QEX A;  4CZV A;  1SQJ A;  4Z7O A;  3TL8 B;  2B5L A;  4DU3 A;  4J8G A;  4A11 A;  3OKW A;  3ODT A;  4BCB A;  4DU4 A;  3VH0 A;  3NHG A;  3UO3 A;  3E0C A;  1VE7 A;  1JMZ B;  3SFZ A;  3WSO A;  1H2Y A;  3C75 H;  4FJ9 A;  4L1M A;  3RN1 D;  3SHF A;  2HJB A;  4ES0 A;  2LF6 A;  3SCY A;  2MMB A;  3GC3 B;  3AL9 A;  4E4B A;  3MKQ A;  4BP9 A;  3MZL A;  4KHW A;  4QRJ A;  4M45 A;  3SPY A;  3BVO A;  1FZI E;  4N14 A;  4ZOV A;  5M5U A;  4E54 B;  2OZM A;  3SBP A;  3V5W B;  2B1E A;  2CN2 A;  1WAJ A;  3I8E A;  2AGY A;  3NGI A;  5FKQ A;  3I7H A;  1JTD B;  3N1E A;  2OYQ A;  5CXB A;  1K3I A;  1N6F A;  3SUQ A;  4AKG A;  2IUQ A;  2HYE A;  4A2L A;  2PM9 B;  4PNK B;  5GXI A;  4L1Q D;  3NVQ A;  4PSW B;  2AGZ A;  2YMU A;  2CE9 A;  4J82 A;  3SN6 B;  3OGK B;  2Z2P A;  1Q9Y A;  1OLZ A;  1H2W A;  1N6D A;  3KRX B;  4NAA A;  3MKS B;  2P9I C;  3CFO A;  1FZ8 E;  1S4U X;  2I0S A;  3I7N A;  4H5I A;  4PSX B;  5SXM A;  5K1C C;  4I79 A;  5IZ7 A;  1FZ3 E;  3C9C A;  5TDH B;  5C86 A;  4I9L A;  4CI1 A;  3V4V A;  3SNN A;  4GGA A;  4AN0 A;  2PM9 A;  4RL5 A;  3AL8 B;  1Q47 A;  4WK4 A;  2HD0 A;  2OVQ B;  2TRC B;  4AX4 A;  2VDR A;  3C6O B;  3EI3 B;  4A09 B;  4L3H D;  2Z2N A;  2XU7 A;  5EMK B;  4AI6 A;  3SXT D;  5EML B;  4QNC A;  2B8I A;  1GOF A;  3NVN A;  4O02 A;  3HFQ A;  2VDL A;  3RMD A;  4JSX C;  5I5J A;  2GC4 A;  3SQ0 A;  4AMY A;  2QZP A;  1GOH A;  1CLQ A;  2AGX A;  4CY5 A;  2CO0 A;  4CI8 A;  4ICG C;  3U4Y A;  4DTO A;  2OVP B;  4ADN A;  2UZX B;  3UKR C;  1H2X A;  4DNV A;  2VDK A;  4DTN A;  3FRX A;  1UOQ A;  3IUL A;  4IMM A;  4J81 A;  1PI6 A;  3J80 g;  1UTC A;  3F3G A;  4GQ1 A;  1E8N A;  4M42 A;  2EID A;  3QEI A;  3OL2 B;  2XYI A;  3J81 g;  3UKU C;  3E4W A;  4K3J B;  2P1Q B;  2W18 A;  3B7F A;  3K6S A;  5E6U A;  3RN0 D;  2HKM A;  1GOT B;  2XL3 A;  3IJ0 A;  5FKR A;  4DTR A;  1B9Y A;  4O9D A;  1FZ9 E;  4FVM A;  4FWW A;  3T3M A;  2P9P C;  3C95 A;  3CFS B;  3HP9 A;  4JSN C;  1C9L A;  4GZ8 A;  2YNP A;  1GOG A;  3ZDX A;  1N1C A;  4JS4 A;  3SUN A;  1FYZ E;  3JPX A;  4FJI A;  5EAP A;  3K72 A;  5CXC B;  3VA6 A;  1OMW B;  2P1M B;  3SBR A;  4J2B A;  2XL2 A;  2EIB A;  3W15 A;  4A7J A;  3VI3 A;  4CZY A;  4QT8 A;  2YNN A;  3CFV A;  1JJU B;  1JOF A;  1FZ2 E;  1FWX A;  3T3P A;  5HE1 B;  2OVR B;  4BH6 A;  3DXK C;  3JZH A;  5K19 A;  3FM0 A;  1XVE E;  3TJY A;  4J2D A;  3OTT A;  2ATQ A;  1U4C A;  3C99 A;  4J78 A;  4G56 B;  4FJN A;  3RMB A;  1MDA H;  3IUR A;  3BG0 A;  4DU1 A;  5TEE A;  1XIP A;  4BCD A;  4A0A A;  5CXC A;  4DTU A;  3FCU A;  4J79 A;  1ERJ A;  1QNI A;  3JRO A;  4ZOZ A;  3KD1 E;  4JHN A;  3RMZ D;  3SJJ A;  3S9H A;  3AFC A;  5H37 A;  3PXW D;  1TYE A;  4GM8 A;  3PXT D;  5M5S A;  3PE7 A;  5EM2 B;  5B4W A;  4O3T B;  4XYI A;  2H6N A;  5A2Q g;  2K5S A;  4CI3 A;  4X5M A;  3HGK E;  2BKL A;  3EU7 A;  3NAE A;  3FGB A;  4J87 A;  3ZWL B;  5IJ7 E;  2P9S C;  4A0B A;  2FW3 A;  4AKI A;  1T2X A;  2J56 H;  3PXS D;  4G1M A;  2OK6 A;  4NEN A;  5FKS A;  1FZ6 E;  4J77 A;  4BP8 A;  2P5G A;  2J55 H;  1XVC E;  1PGU A;  2P5O A;  1C9I A;  4ZOY A;  5EMJ B;  1FS1 A;  1GG2 B;  1U2V C;  2B5M A;  2HU8 A;  3F3F A;  1XU5 E;  3I8C A;  3DXM C;  5FQD A;  2GC7 A;  4FK2 A;  3O4I A;  2H6Q A;  4WK2 A;  3RFH A;  2VDP A;  4X61 B;  3EWE A;  4D9S A;  1N6E A;  4GAM C;  5FFO A;  2CO0 C;  4DTS A;  1XL3 C;  3SUP A;  3O4J A;  2DY4 A;  2I0R A;  4E5Z B;  4BL0 A;  3EI1 B;  4M41 A;  4X60 B;  3DM0 A;  4RE5 A;  4FJ7 A;  4IA9 A;  2VDO A;  1FZ5 E;  2IWF A;  5IGQ A;  4J2A A;  5C2V B;  3N0E A;  4RG8 A;  5C9Z B;  4J73 A;  1PBY B;  2JHP A;  3AH8 B;  4K3I D;  1R5M A;  1FZ4 E;  4J86 A;  3CFP A;  4BUJ C;  5THA A;  4ERY A;  3SQ1 A;  3SWS D;  4JSV C;  4TZ4 A;  3PVW B;  3ULE C;  5I5M A;  1VZ3 A;  4FA1 D;  5GXH A;  2QXF A;  3L0M A;  3VI4 A;  4J0X A;  4A2M A;  2FYO A;  4LG9 A;  5E6S A;  1XMG E;  1U8C A;  3QES A;  4MMX A;  5CYK A;  3SBQ A;  4BCC A;  2JH8 A;  3IVM A;  5EAR A;  3L4O D;  2JHC A;  4FA4 D;  1K8K C;  1I2M B;  2VDN A;  1O6G A;  2VZ1 A;  4H5J A;  1YR2 A;  4X3E A;  1WAF A;  1FPO A;  3V4P A;  3O4H A;  5FKT A;  3HL8 A;  4HDJ A;  1JV2 A;  3EMH A;  1TYQ C;  4M3X A;  3MZK A;  3JRP A;  3I2N A;  3KRW B;  3GD1 I;  3FCS A;  3OGM B;  5IJ8 E;  3MMY A;  4D0K A;  5GSA A;  3TAG A;  3LD8 A;  5HE3 B;  2B4E A;  4KHY A;  4ADO A;  1JMX B;  2E31 A;  2G99 A;  2QXV A;  5HDB A;  5C92 A;  4FK0 A;  2AGW A;  4PXW A;  4M3R A;  4GM9 A;  1PEV A;  2H9M A;  3PVU B;  3MUN A;  1UOP A;  3NIF A;  2VDQ A;  4J0W A;  3SVI A;  4E3S A;  2EIE A;  5HE0 B;  3UR4 A;  2H13 A;  3UVO A;  3QI0 A;  2BCJ B;  2Q7Q A;  4DTX A;  2HES X;  2CNX A;  1XMF E;  4I9Q A;  4A09 A;  3UO2 A;  1O6F A;  4KHS A;  3C6N B;  4GM3 A;  4PC0 A;  1QFS A;  2P9N C;  4LGN A;  4CY2 A;  2AGL A;  5HE2 B;  4I6J B;  1YFQ A;  3IUJ A;  1MHZ G;  4QND A;  1IG9 A;  3IUN A;  3N1B A;  2MTA H;  4MMY A;  2UZY B;  2P1N B;  3CQ8 A;  2B7M A;  2IUV A;  3SUO A;  3QNO A;  3RMA A;  4A0B B;  2H68 A;  4M3U A;  3DDU A;  3OF7 A;  1B9X A;  3SQ4 A;  3OGL B;  1E8M A;  1M1X A;  4CY3 A;  4L9O A;  4J2E A;  4OWR A;  2H9L A;  4DTJ A;  2AH0 A;  4GQ2 P;  5EAL A;  5FLX g;  4KI4 A;  2MW2 A;  1L5G A;  2IAA A;  3SPZ A;  3SJL D;  3MXX A;  2PM7 B;  4EYW A;  1MG2 A;  3LDB A;  5KDO B;  1NR0 A;  5TF2 A;  1H2Z A;  5I5I A;  3F3P A;  5AMS A;  3IUQ A;  2IWK A;  3EI2 A;  2JQT A;  1QFM A;  1IH7 A;  2P1O B;  2HU7 A;  2VIX A;  3A0F A;  1K32 A;  3L4M D;  2XZG A;  2I3T A;  4E5Z A;  2HXC A;  4KI6 A;  5IGO A;  3OL2 A;  3TAF A;  5FXY A;  2RKH A;  1XVG E;  4LG8 A;  1FXX A;  3QHY B;  4JHP C;  3JZN A;  2YB8 B;  3IJ1 A;  4JRQ A;  2VJ4 A;  3J27 A;  4FJL A;  2H14 A;  3OKY B;  3NE6 A;  5AFU 3;  4GMB A;  2QC5 A;  3UIQ A;  2B5N A;  4GQB B;  5M5V A;  2OZS A;  3QET A;  1SHY B;  4DTM A;  3J2P A;  3L1N A;  4JD2 C;  3ZDY A;  4AN1 A;  3TAB A;  2O9K A;  4Z7Q A;  3GRE A;  1FZH E;  4Z7N A;  2XDW A;  3O4G A;  4Y5R D;  3SCX A;  5CXB B;  3ZDZ A;  5EMM B;  2XE4 A;  3SLE D;  3RLM D;  4KHN A;  2GNQ A;  2WQ8 A;  4U7A A;  3IIW A;  2PFV A;  4OZU A;  5M61 A;  3NCI A;  4JS5 A;  5HQG A;  2P9K C;  3IKO A;  4Z8L A;  3OW8 A;  2HKR A;  2PFT A;  3EG6 A;  3PSC B;  5IRE A;  1JW2 A;  4JT5 C;  3UVK A;  4FB1 D;  1RI6 A;  2H47 A;  4J84 A;  3LZJ A;  2VDM A;  3I7K A;  2I0T A;  3HGL A;  4ERQ A;  3CFR A;  4JRP A;  1MG3 A;  3OKY A;  3L2O B;  1Q9X A;  2QR5 A;  3MVD K;  3V7D B;  4EPH A;  3IUM A;  4M3Z A;  5H14 A;  4M3T A;  4KFM B;  1FZ1 E;  4RNG A;  5IBK B;  4X63 B;  3JB9 L;  2EBS A;  1UOO A;  4CC9 A;  2H9P A;  3NDK A;  3ORV D;  4Y7R A;  4IT5 A;  5C2W B;  4FJG A;  2AQ5 A;  2AH1 A;  4GGD A;  3SVW D;  3GFC A;  2OK4 A;  4CZX A;  4J8B A;  1FZ7 E;  3MUO A;  2JH9 A;  3QNN A;  4M3W A;  4O3U B;  5CYK B;  3K71 A;  4O45 A;  2YB5 A;  4XYH A;  4AOW A;  2PM6 B; 
#chains in the Genus database with same CATH homology
 3RSE C;  4CY1 A;  5H1M A;  5GMK n;  1NEX B;  3LZI A;  3CIK B;  3I7P A;  2MZW B;  2H6K A;  2E32 A;  2J57 G;  3C5M A;  2OIZ A;  5IT9 g;  4UI9 R;  4B08 A;  3BWS A;  1L0Q A;  2LF3 A;  4X5N A;  4ESG A;  3UVM A;  3TAE A;  3AL8 A;  3JAM g;  4ERZ A;  1XVD E;  1A0R B;  4ZOX A;  4FJM A;  2OJY A;  2CE8 A;  4KHU A;  3DSM A;  3PSL A;  3QEV A;  1MTY G;  1XKS A;  2PBI B;  4AKH A;  2IUR A;  3I89 A;  4EP9 A;  3I7O A;  2RCU A;  5H17 A;  4FA5 D;  3RWU A;  1SQ9 A;  3RRM C;  4QQE A;  3EI4 A;  4A08 A;  4FJ5 A;  3QER A;  3NVX A;  3P4F A;  3LDS A;  2DTU A;  4A08 B;  4QL1 A;  4GGC A;  4U1E I;  4EWR A;  3RFG A;  4PBY A;  3C94 A;  5EAM A;  4JT6 C;  1FZ0 E;  4CI2 A;  4R7A B;  1P22 A;  2IUP A;  4DTP A;  2JHA A;  2BBK H;  3KD5 E;  5HYN B;  4FAV D;  3C6P B;  3DWL C;  3QEP A;  3IIY A;  2YNO A;  3EI4 B;  3SI6 A;  3SQ2 A;  3BG1 A;  4KHQ A;  4FJX A;  3EI3 A;  5TEF A;  4FJH A;  4HCB A;  2CN3 A;  5EM2 A;  1XVF E;  3I7L A;  4FK4 A;  1XVB E;  4MK0 B;  1LDK E;  2VJ5 A;  3EI2 B;  3K2O A;  5FA5 B;  2H9N A;  5IC7 A;  2JPN A;  4FJJ A;  3UVN A;  1XHM A;  4PBZ A;  4M3Y A;  4AEZ A;  4YVD A;  4A0A B;  3JZG A;  4L3G D;  1MMO G;  4FJ8 A;  4D6V A;  2P9L C;  4FAN D;  2I3S A;  5AJA A;  4XEI C;  2G9A A;  2H3X A;  2P9U C;  3K26 A;  4NSX A;  3L8B A;  4FA9 D;  3QEW A;  3SMR A;  3N0D A;  1GXR A;  2YBA A;  4O1Q D;  3VGZ A;  3V9F A;  4FHL A;  1MHY G;  1GP2 B;  4HCC A;  1VYH C;  3K27 A;  2H4T A;  4JSP C;  3IJC A;  1XU3 E;  1TBG A;  4ZN4 A;  2Z2O A;  3UVL A;  3RMC A;  2P1P B;  1XMH E;  4A11 B;  4E54 A;  4JXM A;  4FJK A;  2HJ4 A;  3OKT A;  5JWZ A;  3EI1 A;  2DEB A;  3E4Y A;  3QEX A;  4CZV A;  1SQJ A;  3TL8 B;  2B5L A;  4DU3 A;  4J8G A;  4A11 A;  3OKW A;  3ODT A;  4DU4 A;  3VH0 A;  3NHG A;  3E0C A;  1JMZ B;  3SFZ A;  3WSO A;  3C75 H;  4FJ9 A;  3RN1 D;  3SHF A;  2HJB A;  4ES0 A;  2LF6 A;  3SCY A;  2MMB A;  3AL9 A;  4E4B A;  3MKQ A;  3MZL A;  4KHW A;  4QRJ A;  4M45 A;  3SPY A;  4E54 B;  1FZI E;  4N14 A;  4ZOV A;  2OZM A;  3SBP A;  3V5W B;  2B1E A;  2CN2 A;  1WAJ A;  3I8E A;  2AGY A;  3NGI A;  5FKQ A;  3I7H A;  3N1E A;  2OYQ A;  5CXB A;  1N6F A;  3SUQ A;  4AKG A;  2IUQ A;  2HYE A;  4A2L A;  2PM9 B;  4PNK B;  5GXI A;  4L1Q D;  3NVQ A;  4PSW B;  2AGZ A;  2YMU A;  2CE9 A;  4J82 A;  3SN6 B;  3OGK B;  2Z2P A;  1Q9Y A;  1OLZ A;  1N6D A;  3KRX B;  3MKS B;  2P9I C;  3CFO A;  1FZ8 E;  1S4U X;  2I0S A;  3I7N A;  4H5I A;  4PSX B;  5SXM A;  5K1C C;  4I79 A;  5IZ7 A;  1FZ3 E;  3C9C A;  5TDH B;  4I9L A;  4CI1 A;  3SNN A;  4GGA A;  2PM9 A;  4RL5 A;  3AL8 B;  1Q47 A;  2HD0 A;  2OVQ B;  2TRC B;  3C6O B;  3EI3 B;  4A09 B;  4L3H D;  2Z2N A;  2XU7 A;  5EMK B;  4AI6 A;  3SXT D;  5EML B;  4QNC A;  2B8I A;  3NVN A;  3HFQ A;  3RMD A;  4JSX C;  5I5J A;  2GC4 A;  3SQ0 A;  2AGX A;  1CLQ A;  4CY5 A;  4CI8 A;  2CO0 A;  3U4Y A;  4DTO A;  2OVP B;  4ADN A;  2UZX B;  3UKR C;  4DTN A;  3FRX A;  4IMM A;  4J81 A;  1PI6 A;  3J80 g;  3F3G A;  4GQ1 A;  4M42 A;  3QEI A;  3OL2 B;  2XYI A;  3J81 g;  3UKU C;  3E4W A;  4K3J B;  2P1Q B;  2W18 A;  3B7F A;  3RN0 D;  2HKM A;  1GOT B;  2XL3 A;  3IJ0 A;  5FKR A;  4DTR A;  1B9Y A;  4O9D A;  1FZ9 E;  4FVM A;  4FWW A;  2P9P C;  3C95 A;  3CFS B;  3HP9 A;  4JSN C;  4GZ8 A;  2YNP A;  4JS4 A;  3SUN A;  1FYZ E;  3JPX A;  4FJI A;  5EAP A;  5CXC B;  3VA6 A;  1OMW B;  2P1M B;  3SBR A;  4J2B A;  2XL2 A;  3W15 A;  4A7J A;  4CZY A;  5FLX g;  4QT8 A;  2YNN A;  3CFV A;  1JJU B;  1JOF A;  1FZ2 E;  1FWX A;  5HE1 B;  2OVR B;  4BH6 A;  3DXK C;  3JZH A;  5K19 A;  3FM0 A;  1XVE E;  3TJY A;  4J2D A;  3OTT A;  2ATQ A;  1U4C A;  3C99 A;  4J78 A;  4G56 B;  4FJN A;  3RMB A;  1MDA H;  3BG0 A;  4DU1 A;  5TEE A;  1XIP A;  4A0A A;  5CXC A;  4DTU A;  4J79 A;  1ERJ A;  1QNI A;  3JRO A;  4ZOZ A;  3KD1 E;  3RMZ D;  3SJJ A;  3S9H A;  3AFC A;  5H37 A;  3PXW D;  4GM8 A;  3PXT D;  3PE7 A;  5EM2 B;  5B4W A;  4O3T B;  4XYI A;  2H6N A;  5A2Q g;  4CI3 A;  4X5M A;  3HGK E;  3EU7 A;  3NAE A;  3FGB A;  4J87 A;  3ZWL B;  5IJ7 E;  2P9S C;  4A0B A;  2FW3 A;  4AKI A;  2J56 H;  3PXS D;  2OK6 A;  5FKS A;  1FZ6 E;  4J77 A;  2P5G A;  2J55 H;  1XVC E;  1PGU A;  2P5O A;  4ZOY A;  5EMJ B;  1FS1 A;  1GG2 B;  1U2V C;  2B5M A;  3F3F A;  1XU5 E;  3I8C A;  3DXM C;  5FQD A;  2GC7 A;  4FK2 A;  2H6Q A;  3RFH A;  4X61 B;  3EWE A;  1N6E A;  4GAM C;  2CO0 C;  4DTS A;  1XL3 C;  3SUP A;  4E5Z B;  2DY4 A;  2I0R A;  4BL0 A;  3EI1 B;  4M41 A;  4X60 B;  3DM0 A;  4FJ7 A;  4IA9 A;  1FZ5 E;  2IWF A;  5IGQ A;  4J2A A;  5C2V B;  3N0E A;  4RG8 A;  5C9Z B;  4J73 A;  1PBY B;  2JHP A;  3AH8 B;  4K3I D;  1R5M A;  1FZ4 E;  4J86 A;  3CFP A;  4BUJ C;  5THA A;  4ERY A;  3SQ1 A;  3SWS D;  4JSV C;  4TZ4 A;  3PVW B;  3ULE C;  5I5M A;  4FA1 D;  5GXH A;  2QXF A;  3L0M A;  4J0X A;  4A2M A;  2FYO A;  4LG9 A;  1XMG E;  3QES A;  5CYK A;  3SBQ A;  2JH8 A;  5EAR A;  4FA4 D;  3L4O D;  2JHC A;  1K8K C;  4H5J A;  4X3E A;  1WAF A;  5FKT A;  3HL8 A;  4HDJ A;  3EMH A;  1TYQ C;  4M3X A;  3MZK A;  3JRP A;  3I2N A;  3KRW B;  5IJ8 E;  3OGM B;  3MMY A;  4D0K A;  5GSA A;  3TAG A;  3LD8 A;  5HE3 B;  2B4E A;  4KHY A;  4ADO A;  1JMX B;  2E31 A;  2G99 A;  2QXV A;  4FK0 A;  2AGW A;  4PXW A;  4M3R A;  4GM9 A;  1PEV A;  2H9M A;  3PVU B;  4J0W A;  3SVI A;  4E3S A;  5HE0 B;  3UR4 A;  2H13 A;  3UVO A;  2BCJ B;  2Q7Q A;  4DTX A;  2HES X;  2CNX A;  1XMF E;  4I9Q A;  4A09 A;  4KHS A;  3C6N B;  4GM3 A;  4PC0 A;  2P9N C;  4LGN A;  4CY2 A;  2AGL A;  5HE2 B;  4I6J B;  1YFQ A;  1MHZ G;  4QND A;  1IG9 A;  3N1B A;  2MTA H;  2UZY B;  2P1N B;  3CQ8 A;  2B7M A;  2IUV A;  3SUO A;  3QNO A;  3RMA A;  4A0B B;  2H68 A;  4M3U A;  1B9X A;  3SQ4 A;  3OGL B;  4CY3 A;  4L9O A;  4J2E A;  4OWR A;  2H9L A;  4DTJ A;  2AH0 A;  4GQ2 P;  5EAL A;  4KI4 A;  2IAA A;  3SPZ A;  3SJL D;  3MXX A;  2PM7 B;  4EYW A;  1MG2 A;  3LDB A;  5KDO B;  1NR0 A;  5TF2 A;  5I5I A;  3F3P A;  5AMS A;  2IWK A;  3EI2 A;  1IH7 A;  2P1O B;  2VIX A;  3A0F A;  1K32 A;  3L4M D;  2I3T A;  4E5Z A;  2HXC A;  4KI6 A;  5IGO A;  3OL2 A;  3TAF A;  5FXY A;  1XVG E;  4LG8 A;  1FXX A;  3JZN A;  2YB8 B;  3IJ1 A;  4JRQ A;  2VJ4 A;  3J27 A;  4FJL A;  2H14 A;  3OKY B;  3NE6 A;  5AFU 3;  4GMB A;  2QC5 A;  3UIQ A;  2B5N A;  4GQB B;  2OZS A;  3QET A;  4DTM A;  3J2P A;  1SHY B;  3L1N A;  4JD2 C;  3TAB A;  2O9K A;  3GRE A;  1FZH E;  5CXB B;  4Y5R D;  3SCX A;  5EMM B;  3SLE D;  3RLM D;  4KHN A;  2GNQ A;  4U7A A;  3IIW A;  2PFV A;  4OZU A;  3NCI A;  4JS5 A;  5HQG A;  2P9K C;  3IKO A;  4Z8L A;  3OW8 A;  2HKR A;  2PFT A;  3EG6 A;  3PSC B;  5IRE A;  4JT5 C;  3UVK A;  4FB1 D;  1RI6 A;  2H47 A;  4J84 A;  3LZJ A;  3I7K A;  2I0T A;  3HGL A;  4ERQ A;  3CFR A;  4JRP A;  1MG3 A;  3OKY A;  3L2O B;  1Q9X A;  3V7D B;  4EPH A;  5H14 A;  4M3Z A;  4M3T A;  4KFM B;  1FZ1 E;  4RNG A;  5IBK B;  4X63 B;  3JB9 L;  2EBS A;  4CC9 A;  2H9P A;  3NDK A;  3ORV D;  4Y7R A;  5C2W B;  4FJG A;  2AQ5 A;  2AH1 A;  4GGD A;  3SVW D;  3GFC A;  2OK4 A;  4CZX A;  4J8B A;  1FZ7 E;  2JH9 A;  3QNN A;  4M3W A;  4O3U B;  5CYK B;  4O45 A;  2YB5 A;  4XYH A;  4AOW A;  2PM6 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...