2OVRB

Structure of the skp1-fbw7-cyclinedegn complex
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
444
structure length
442
Chain Sequence
TQVKHMMQVIEPQFQRDFISLLPKELALYVLSFLEPKDLLQAAQTCRYWRILAEDNLLWREKCKEEGIDEPLHIKRVIKPGFIHSPWKSAYIRQHRIDTNWRRGELKSPKVLKGHDDHVITCLQFCGNRIVSGSDDNTLKVWSAVTGKCLRTLVGHTGGVWSSQMRDNIIISGSTDRTLKVWNAETGECIHTLYGHTSTVRCMHLHEKRVVSGSRDATLRVWDIETGQCLHVLMGHVAAVRCVQYDGRRVVSGAYDFMVKVWDPETETCLHTLQGHTNRVYSLQFDGIHVVSGSLDTSIRVWDVETGNCIHTLTGHQSLTSGMELKDNILVSGNADSTVKIWDIKTGQCLQTLQGPNKHQSAVTCLQFNKNFVITSSDDGTVKLWDLKTGEFIRNLVTLESGGSGGVVWRIRASNTKLVCAVGSRNGTEETKLLVLDFDVDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of a Fbw7-Skp1-Cyclin E Complex: Multisite-Phosphorylated Substrate Recognition by SCF Ubiquitin Ligases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/cell cycle
molecule keywords S-phase kinase-associated protein 1A
total genus 132
structure length 442
sequence length 444
ec nomenclature
pdb deposition date 2007-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00400 WD40 WD domain, G-beta repeat
B PF12937 F-box-like F-box-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.50 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 2ovrB01
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2ovrB02
4A0BB 2B5MA 1NEXB 2P9KC 4CZXA 4QL1A 2HESX 4GM9A 5HE1B 4CY2A 3KRWB 2HKMA 4J8BA 2P9IC 2IUPA 4CI1A 5HQGA 5K1CC 1K8KC 3A0FA 4YVDA 3F3FA 1Q47A 1GG2B 5EAPA 4CY3A 4PSWB 4X63B 5FKTA 3GREA 2P1PB 4O3TB 2HKRA 5IT9g 2I0SA 2MTAH 2AGLA 3ORVD 3V7DB 4HDJA 2P1NB 2YB8B 4GQBB 3UVNA 2H6QA 2GC7A 4FA4D 3SLED 3EI1B 4ZOZA 3OW8A 4L1QD 5CXCB 4EWRA 3OL2A 4D6VA 4J78A 1N6EA 3K26A 5I5IA 2YNNA 2E31A 3SBQA 3RLMD 3JAMg 4K3ID 5FLXg 4LGNA 2YMUA 3OGLB 4PBZA 4A11A 4ZN4A 3EI3A 3I7OA 1L0QA 3L4MD 3UVOA 2H9LA 3UR4A 3SCYA 3PVUB 5SXMA 5FA5B 1XKSA 2Q7QA 4L3HD 4CZVA 2Z2NA 1NR0A 2QXVA 3PVWB 4IMMA 3SFZA 3EI2A 5H1MA 1N6FA 4BH6A 4TZ4A 4ERYA 1U2VC 1XIPA 4J77A 1TBGA 2P9PC 3NVXA 3F3GA 1XHMA 4A0AB 5HYNB 4AOWA 4ZOXA 4CC9A 4CZYA 4FAVD 4FHLA 5I5JA 2IWFA 2AGWA 2PM7B 5AFU3 2P9NC 4FWWA 1R5MA 3AL8B 4A7JA 4FAND 3PXSD 2XU7A 4R7AB 3EU7A 3OL2B 3PSLA 3NVNA 3IIWA 4CI2A 5I5MA 3UKUC 3OGMB 5AMSA 3SBPA 4BL0A 2P9UC 2J55H 2CE9A 2CO0A 2CN2A 2IAAA 1PGUA 4XYHA 5JWZA 3OGKB 2CN3A 2AGZA 2H47A 3JZHA 4PXWA 2YNOA 3MXXA 5B4WA 2OK6A 4CI3A 4A0BA 1LDKE 3IJCA 4D0KA 4E54A 4NSXA 3C6OB 3SWSD 4E5ZB 2OJYA 4J81A 3RN0D 1GXRA 3EI4B 4I6JB 2G99A 3RMZD 5C9ZB 3RSEC 1FWXA 2B4EA 1FS1A 5IJ8E 5FKSA 1RI6A 2AGXA 3V9FA 1P22A 4PC0A 1GP2B 1OMWB 2AGYA 4J86A 5A2Qg 4H5JA 3GFCA 3JZNA 4JD2C 5EMLB 3KRXB 4GZ8A 5EMJB 2I3SA 3MZKA 4XYIA 2PM9B 4KFMB 2J56H 1SQJA 2Z2OA 2I0TA 3SXTD 3ODTA 3OKTA 4L9OA 1K32A 2HXCA 4J8GA 5H17A 4J0XA 3SN6B 3I7KA 2CE8A 3IJ0A 5CXBA 2GNQA 3OKYA 5TEEA 3C5MA 3CFSB 3SJLD 3EMHA 4JSVC 2GC4A 5CXCA 1SQ9A 4IA9A 4JSNC 3F3PA 4ZOYA 3FM0A 1JOFA 2HYEA 2G9AA 3JPXA 4QT8A 2AQ5A 3E0CA 4ERZA 4U7AA 4O45A 2BBKH 4L3GD 4PSXB 3FGBA 2OVQB 3CIKB 3FRXA 2P9SC 2AH0A 3EG6A 3PE7A 1A0RB 5EM2B 3WSOA 2O9KA 3BG0A 3DSMA 2IUVA 2TRCB 2YBAA 3ZWLB 4MK0B 4A09B 3PSCB 2BCJB 3C6NB 3AH8B 4A2MA 3J81g 2PM6B 4LG8A 3MZLA 4O3UB 2CO0C 5GXIA 3OKWA 1TYQC 3MMYA 3UVLA 3RFGA 3CFVA 3I7LA 3RFHA 1PBYB 4FA1D 1GOTB 5CYKB 3C9CA 4GQ1A 5IGOA 4CY1A 2IURA 3K27A 4ES0A 2OIZA 2H9PA 4A0AA 5IJ7E 5K19A 4GGDA 3EWEA 3IJ1A 2OVPB 5TDHB 5GXHA 1N6DA 3P4FA 3PXTD 1YFQA 3L4OD 4X61B 4U1EI 4GM8A 5CYKA 2H9MA 4O9DA 2XL3A 4OWRA 3UKRC 2UZXB 4GMBA 3C99A 4Y5RD 4I79A 3JB9L 4FA5D 3BWSA 3SBRA 3I89A 2B5NA 3N0EA 3DWLC 5IC7A 1VYHC 3JRPA 3N0DA 2I0RA 3BG1A 3UVKA 5IBKB 4AEZA 2P1MB 4K3JB 5EALA 5EMKB 5EARA 3JZGA 3OKYB 2HJ4A 2YNPA 3UVMA 5CXBB 5EAMA 3DXKC 2OVRB 3C6PB 1B9XA 2QC5A 5FKRA 1S4UX 1MG2A 4PBYA 1MDAH 4E5ZA 2HJBA 3VGZA 5TF2A 3PXWD 4Y7RA 4QQEA 2H3XA 5EMMB 2E32A 5GMKn 2I3TA 3OTTA 1QNIA 4JSXC 3SVWD 4JT6C 4X3EA 4ERQA 2EBSA 3HFQA 3I7HA 4H5IA 3SHFA 2J57G 5FKQA 4CY5A 2OK4A 3AL8A 4GGCA 3L2OB 3I8CA 1B9YA 2IUQA 3IIYA 4QRJA 1SHYB 4J84A 4E54B 3VA6A 3DM0A 5HE0B 4JXMA 5TEFA 4JT5C 2CNXA 2UZYB 2H9NA 3SMRA 3VH0A 4A09A 4PNKB 2PM9A 2H14A 3I8EA 4LG9A 2B5LA 4GGAA 5IGQA 3MKQA 4A08A 5C2WB 3NVQA 5C2VB 3C75H 5HE2B 3DXMC 5KDOB 4ESGA 2H6KA 4JSPC 5EM2A 4FA9D 5HE3B 3IKOA 2H68A 3JROA 3I7NA 4G56B 5AJAA 3U4YA 2IWKA 2H6NA 5FXYA 3RN1D 1JJUB 2W18A 4A2LA 3B7FA 3AL9A 3EI4A 1U4CA 3V5WB 4J73A 2Z2PA 4N14A 4J0WA 4X60B 4GQ2P 2P1OB 2XL2A 5GSAA 2P9LC 4FB1D 3J80g 2AH1A 1JMXB 4GM3A 4J79A 2PBIB 3AFCA 1JMZB 2P1QB 3ULEC 4Z8LA 3I2NA 3EI2B 3EI1A 4J87A 2XYIA 4UI9R 1OLZA 5FQDA 3I7PA 4A08B 4XEIC 5H14A 4J82A 4OZUA 4BUJC 2H13A 1MG3A 4CI8A 3RRMC 4O1QD 1ERJA 5THAA 3EI3B 4ZOVA 1PEVA 3MKSB 1PI6A 4A11B 3W15A
chains in the Genus database with same CATH superfamily
4A0BB 2VDPA 1XVEE 2B5MA 1FZ4E 1GOGA 2EIDA 2VDRA 3DDUA 4AKGA 4I9LA 3IUQA 1NEXB 2P9KC 4CZXA 4QL1A 2HESX 4GM9A 5HE1B 4CY2A 3KRWB 2HKMA 2QR5A 4J8BA 4M41A 1FZ7E 2P9IC 2IUPA 4CI1A 3LDSA 2FYOA 5HQGA 3L1NA 5K1CC 3E4WA 4AX4A 1K8KC 3A0FA 4YVDA 3K6SA 3F3FA 1Q47A 4DNVA 1GG2B 5EAPA 4CY3A 4PSWB 4X63B 3UIQA 1Q9XA 1FYZE 5FKTA 3HL8A 4MMXA 3SCXA 3GREA 2P1PB 4O3TB 1MHYG 3QETA 1H2WA 2HKRA 2I0SA 5E6SA 5IT9g 2MTAH 5C92A 4DTJA 2AGLA 3ORVD 3V7DB 2P5OA 4HDJA 4NBMA 2P1NB 4G1EA 2EIBA 2YB8B 4GQBB 3UVNA 2MW2A 2H6QA 4J2DA 2GC7A 4FA4D 3SLED 3EI1B 4ZOZA 3OW8A 4L1QD 5CXCB 4EWRA 3BVOA 3CFRA 4J2AA 3MUOA 3OL2A 4D6VA 4J78A 1N6EA 3K26A 4RE6A 5I5IA 2YNNA 2E31A 3RMCA 1I2MB 3SBQA 3V4PA 4KHWA 3RLMD 3JAMg 3E4YA 4DTOA 4K3ID 5FLXg 4J2BA 4LGNA 2YMUA 4M3UA 1FPOA 3OGLB 2WQ8A 4FJHA 2HU7A 4PBZA 4A11A 4ZN4A 4FJNA 4X5MA 3O4JA 3EI3A 3I7OA 1L0QA 3L4MD 1FZ6E 4BCCA 3QI0A 3UVOA 2PFTA 2H9LA 3UR4A 3SCYA 3PVUB 1H2YA 4RE5A 5SXMA 5FA5B 1XKSA 2Q7QA 4ICGC 4L3HD 4CZVA 4KHNA 2JPNA 3NIFA 2Z2NA 4DU3A 1N1CA 1NR0A 2QXVA 3PVWB 4IMMA 1XVGE 3SFZA 3EI2A 3IUMA 3QNNA 5H1MA 1N6FA 4BH6A 3NCIA 2RKHA 4TZ4A 1VE7A 3V4VA 1XL3C 4ERYA 1U2VC 4L1MA 1XIPA 3RMBA 4WJKA 4J77A 1VZ3A 5HDBA 3NIGA 3ZE2A 1TBGA 4M3RA 2P9PC 3NVXA 3F3GA 4FJMA 1XHMA 4A0AB 5HYNB 4AOWA 4FJGA 2VDKA 4DTPA 4ZOXA 4D9SA 4CC9A 4CZYA 4FAVD 4KI4A 4FHLA 5I5JA 2IWFA 2AGWA 2PM7B 4DNWA 5AFU3 2P9NC 4FWWA 1R5MA 3AL8B 1L5GA 3RMAA 4A7JA 5IZ7A 4FJ5A 4FAND 3PXSD 2XU7A 3EU7A 4R7AB 3OL2B 3PSLA 3CFOA 4ADOA 3NVNA 3IIWA 4CI2A 5I5MA 3SQ4A 2MMBA 3UKUC 1XU5E 3OGMB 5AMSA 4HCCA 2JQTA 1IH7A 3SBPA 4AMYA 3SQ2A 4BL0A 2P9UC 2J55H 3O4HA 2CE9A 4DU1A 2CO0A 1UOPA 2CN2A 2IAAA 3IURA 1PGUA 4XYHA 5JWZA 3C95A 3OGKB 2CN3A 1VE6A 2AGZA 2H47A 3JZHA 1FZ3E 3CFPA 2JHAA 2YNOA 3IUNA 4PXWA 3MXXA 5B4WA 2OK6A 3IULA 2DTUA 1GOFA 4O02A 1O6GA 4CI3A 4A0BA 1C9IA 1LDKE 3IJCA 1U8CA 1H2XA 4O2WA 4D0KA 4E54A 4NSXA 3C6OB 3SWSD 4E5ZB 2OJYA 4J81A 3RMDA 4KI6A 3RN0D 1GXRA 2YB5A 3EI4B 4I6JB 2G99A 3RMZD 4M3XA 3MUNA 5C9ZB 4MMZA 3RSEC 1FWXA 4EYWA 2B4EA 1FS1A 5IJ8E 1YR2A 5FKSA 1FZ1E 4J2EA 3VI3A 1RI6A 5C86A 3QEPA 1K3IA 2AGXA 5E6RA 3V9FA 3UO3A 1P22A 3SQ0A 2OYQA 4QNCA 4PC0A 1XVDE 4QAMA 1GP2B 4IRZA 5M61A 4JRPA 2OZMA 3QESA 1OMWB 2JKXA 3KD1E 2JHPA 2AGYA 4J86A 5A2Qg 4H5JA 3GFCA 3JZNA 4JD2C 5EMLB 3KRXB 4GZ8A 2LF3A 4I9QA 5EMJB 1XU3E 4AKIA 1E8MA 2I3SA 3MZKA 1MTYG 4XYIA 2PM9B 5H37A 4KFMB 5FFGA 2J56H 3OF7A 1SQJA 4RG8A 2Z2OA 2I0TA 2VDMA 3SXTD 3ODTA 3OKTA 3QEXA 4L9OA 1K32A 3HGLA 2HXCA 4J8GA 5H17A 4J0XA 3SN6B 3I7KA 2CE8A 3IJ0A 5CXBA 2JH8A 2GNQA 3O4IA 3OKYA 3QHYB 5TEEA 3LZIA 3C5MA 4GAMC 3CFSB 3SJLD 3EMHA 4BP9A 4JSVC 4NAAA 2GC4A 5CXCA 3J2PA 3SJJA 1SQ9A 4IA9A 3F3PA 4JSNC 5M5TA 4ZOYA 1UOOA 1JTDB 3FM0A 1JOFA 2HYEA 2G9AA 3JPXA 3O4GA 4QT8A 2AQ5A 3E0CA 3N1EA 4U7AA 3LD8A 4ERZA 3SUOA 4O45A 4DTSA 3RWUA 2BBKH 3HGKE 4KHSA 4L3GD 4PSXB 3FGBA 2OVQB 3SPZA 4BCBA 2QXFA 3CIKB 3FRXA 2P9SC 4RNGA 2AH0A 2EICA 4NC4A 1UOQA 1T2XA 3EG6A 3PE7A 1A0RB 5EM2B 3WSOA 4AI6A 2O9KA 3BG0A 4MMYA 3IUJA 3T3MA 3DSMA 5M5SA 2LF6A 1Q9YA 2IUVA 4WK2A 2TRCB 2YBAA 3ZWLB 4WK4A 2HU8A 3NDKA 3FCUA 4MK0B 4A09B 3PSCB 2BCJB 3C6NB 3AH8B 4A2MA 3ZE1A 2B7MA 3J81g 3NAEA 2PM6B 2FW3A 3TABA 4LG8A 3MZLA 3ZDZA 4O3UB 2CO0C 5GXIA 3T3PA 2VZ3A 4ADNA 3IJEA 3OKWA 1TYQC 3CQ8A 3MMYA 5M5RA 3UVLA 2HD0A 4G55A 3RFGA 3CFVA 3MVDK 3N1BA 5FFOA 3K71A 3SVIA 1E5TA 3I7LA 3RFHA 1PBYB 4FA1D 4EPHA 3KD5E 1GOTB 1FXXA 3FCSA 3L0MA 2VIXA 5CYKB 1XVFE 3GD1I 3TAGA 3QNOA 3TL8B 4DTNA 4M3YA 3C9CA 4FJ8A 4GQ1A 2IURA 4DU4A 1XMHE 2VC2A 5IGOA 4AKHA 4CY1A 1M1XA 3K27A 4Z7OA 4ES0A 2OIZA 2H9PA 4A0AA 5IJ7E 5K19A 1QFSA 4GGDA 3K72A 3EWEA 3IJ1A 1XVCE 2OVPB 4EP9A 3J27A 4JHNA 5TDHB 2MZWB 4KHYA 5GXHA 4JS4A 1N6DA 3P4FA 3PXTD 3EQ7A 4RL5A 1YFQA 4KHQA 1JV2A 3L4OD 4X61B 4FVMA 2VDOA 3QEIA 2VZ1A 1BPOA 4GM8A 1FZ0E 4U1EI 5CYKA 2H9MA 4O9DA 2XL3A 4FJJA 4OWRA 4M3TA 2VDNA 3UKRC 2UZXB 5E6UA 1VZ2A 3C99A 3EQ8A 4GMBA 4NENA 4Y5RD 4I79A 3JB9L 4FA5D 3BWSA 3SBRA 3NIDA 4IT5A 3I89A 2B5NA 3N0EA 1E8NA 3DWLC 5IC7A 1TYEA 3SUPA 1VYHC 3EQ9A 4FJLA 3JRPA 3N0DA 4M3WA 2I0RA 1H2ZA 3BG1A 2K5SA 1C9LA 3UVKA 2B1EA 3TJYA 5IBKB 2P1MB 4AEZA 4K3JB 5EALA 5EMKB 2XZGA 1JW2A 5EARA 3JZGA 4DTXA 3OKYB 2HJ4A 2YNPA 3UVMA 1XVBE 5CXBB 5EAMA 3DXKC 2VDQA 2OVRB 3HP9A 1FZ5E 3C6PB 4BCDA 4Z7NA 1B9XA 2QC5A 4UM9A 1S4UX 5FKRA 4AN1A 1MG2A 4PBYA 1MDAH 4E5ZA 4JHPC 2HJBA 3VGZA 4FJXA 5TF2A 1FZ2E 3QERA 3PXWD 4Y7RA 4QQEA 3NHGA 2H3XA 3ZE0A 3SPYA 2JH9A 5EMMB 2E32A 1FZHE 2BKLA 4JS5A 3TAEA 5GMKn 2I3TA 3SUNA 3OTTA 1QNIA 4JSXC 4FK2A 4JT6C 3SVWD 3UO2A 4FJIA 5IREA 3ZDYA 4X3EA 4ERQA 2EBSA 3HFQA 3I7HA 2HU5A 4H5IA 3IVMA 1FZ8E 3SI6A 3SHFA 1GOHA 2J57G 2P5GA 5FKQA 4CY5A 2ATQA 2OK4A 3AL8A 3QEWA 3L2OB 3TAFA 1B9YA 2IUQA 3I8CA 4GGCA 3IIYA 4QRJA 1SHYB 4J84A 1WAFA 4E54B 3VA6A 4X5NA 3DM0A 5HE0B 4JXMA 5TEFA 4DNUA 4JT5C 2CNXA 2UZYB 3K2OA 2H9NA 3SMRA 3VH0A 2XDWA 4A09A 1QFMA 4PNKB 2PM9A 2H14A 3I8EA 4LG9A 2B5LA 4GGAA 1XMFE 1O6FA 5IGQA 3MKQA 4A08A 5C2WB 3NVQA 5C2VB 2JHCA 3C75H 2DEBA 5HE2B 3DXMC 5KDOB 4ESGA 2H6KA 4JSPC 4FJ7A 1MHZG 5EM2A 3S9HA 4FA9D 4M42A 4AN0A 5HE3B 2EIEA 3IKOA 1FZ9E 2H68A 4UM8A 3JROA 3I7NA 4G56B 2XE4A 5AJAA 3U4YA 2IWKA 3SUQA 2H6NA 5FXYA 1UTCA 2RCUA 3NGIA 4DTRA 4DTUA 3ZDXA 4M45A 4M3ZA 1JJUB 3RN1D 2W18A 3GC3B 4A2LA 3B7FA 3AL9A 2H4TA 4DTMA 3EI4A 4AMZA 2PFVA 1U4CA 1WAJA 3V5WB 4J73A 3SQ1A 2Z2PA 4J0WA 4N14A 4X60B 4GQ2P 2P1OB 2XL2A 5GSAA 2P9LC 4FB1D 3J80g 2OZSA 2AH1A 2VDLA 4B08A 5M5UA 1JMXB 4GM3A 4JRQA 4J79A 3KCIA 2PBIB 2QZPA 3VI4A 3AFCA 4Z7QA 4E3SA 1CLQA 1FZIE 1JMZB 4BP8A 2P1QB 4FK4A 3ULEC 4Z8LA 2VJ5A 3I2NA 3EI2B 3EI1A 4J87A 2DY4A 5M5VA 4WK0A 2XYIA 4UI9R 1OLZA 2VJ4A 5FQDA 4E4BA 3I7PA 4FJKA 1MMOG 4A08B 4XEIC 1XMGE 5H14A 4J82A 4OZUA 3C94A 2H13A 4BUJC 2B8IA 4KHUA 3QEVA 1IG9A 1MG3A 3LZJA 4FK0A 4CI8A 4HCBA 1A12A 3RRMC 3LDBA 4O1QD 1ERJA 5THAA 4G1MA 3EI3B 4ZOVA 3L8BA 4FJ9A 3SNNA 1PEVA 3MKSB 1PI6A 4A11B 4QNDA 3NE6A 3W15A
chains in the Genus database with same CATH topology
4A0BB 1XVEE 2B5MA 1FZ4E 4AKGA 4I9LA 1NEXB 2P9KC 4CZXA 4QL1A 2HESX 4GM9A 5HE1B 4CY2A 3KRWB 2HKMA 4J8BA 4M41A 1FZ7E 2P9IC 2IUPA 4CI1A 3LDSA 2FYOA 5HQGA 3L1NA 5K1CC 3E4WA 1K8KC 3A0FA 4YVDA 3F3FA 1Q47A 1GG2B 5EAPA 4CY3A 4PSWB 4X63B 3UIQA 1Q9XA 1FYZE 5FKTA 3HL8A 3SCXA 3GREA 2P1PB 4O3TB 1MHYG 3QETA 2HKRA 5IT9g 2I0SA 2MTAH 4DTJA 2AGLA 3ORVD 3V7DB 2P5OA 4HDJA 2P1NB 2YB8B 4GQBB 3UVNA 2H6QA 4J2DA 2GC7A 4FA4D 3SLED 3EI1B 4ZOZA 3OW8A 4L1QD 5CXCB 4EWRA 3CFRA 4J2AA 3OL2A 4D6VA 4J78A 1N6EA 3K26A 5I5IA 2YNNA 2E31A 3RMCA 3SBQA 4KHWA 3RLMD 3JAMg 3E4YA 4DTOA 4K3ID 5FLXg 4J2BA 4LGNA 2YMUA 4M3UA 3OGLB 4FJHA 4PBZA 4A11A 4ZN4A 4FJNA 4X5MA 3EI3A 3I7OA 1L0QA 3L4MD 1FZ6E 3UVOA 2PFTA 2H9LA 3UR4A 3SCYA 3PVUB 5SXMA 5FA5B 1XKSA 2Q7QA 4L3HD 4CZVA 4KHNA 2JPNA 2Z2NA 4DU3A 1NR0A 2QXVA 3PVWB 4IMMA 1XVGE 3SFZA 3EI2A 3QNNA 5H1MA 1N6FA 4BH6A 3NCIA 4TZ4A 4ERYA 1XL3C 1U2VC 1XIPA 3RMBA 4J77A 1TBGA 4M3RA 2P9PC 3NVXA 3F3GA 4FJMA 1XHMA 4A0AB 5HYNB 4AOWA 4FJGA 4DTPA 4ZOXA 4CC9A 4CZYA 4FAVD 4KI4A 4FHLA 5I5JA 2IWFA 2AGWA 2PM7B 5AFU3 2P9NC 4FWWA 1R5MA 3AL8B 3RMAA 4A7JA 5IZ7A 4FJ5A 4FAND 3PXSD 2XU7A 3EU7A 4R7AB 3OL2B 3PSLA 3CFOA 4ADOA 3NVNA 3IIWA 4CI2A 5I5MA 3SQ4A 2MMBA 3UKUC 1XU5E 3OGMB 5AMSA 4HCCA 1IH7A 3SBPA 3SQ2A 4BL0A 2P9UC 2J55H 2CE9A 4DU1A 2CO0A 2CN2A 2IAAA 1PGUA 4XYHA 5JWZA 3C95A 3OGKB 2CN3A 2AGZA 2H47A 3JZHA 1FZ3E 3CFPA 2JHAA 2YNOA 4PXWA 3MXXA 5B4WA 2OK6A 2DTUA 4CI3A 4A0BA 1LDKE 3IJCA 4D0KA 4E54A 4NSXA 3C6OB 3SWSD 4E5ZB 2OJYA 4J81A 3RMDA 4KI6A 3RN0D 1GXRA 2YB5A 3EI4B 4I6JB 2G99A 3RMZD 4M3XA 5C9ZB 3RSEC 1FWXA 4EYWA 2B4EA 1FS1A 5IJ8E 5FKSA 1FZ1E 4J2EA 1RI6A 3QEPA 2AGXA 3V9FA 1P22A 3SQ0A 2OYQA 4QNCA 4PC0A 1XVDE 1GP2B 4JRPA 2OZMA 3QESA 1OMWB 3KD1E 2JHPA 2AGYA 4J86A 5A2Qg 4H5JA 3GFCA 3JZNA 4JD2C 5EMLB 3KRXB 4GZ8A 2LF3A 4I9QA 5EMJB 1XU3E 4AKIA 2I3SA 3MZKA 1MTYG 4XYIA 2PM9B 5H37A 4KFMB 2J56H 1SQJA 4RG8A 2Z2OA 2I0TA 3SXTD 3ODTA 3OKTA 3QEXA 4L9OA 1K32A 3HGLA 2HXCA 4J8GA 5H17A 4J0XA 3SN6B 3I7KA 2CE8A 3IJ0A 5CXBA 2JH8A 2GNQA 3OKYA 5TEEA 3LZIA 3C5MA 4GAMC 3CFSB 3SJLD 3EMHA 4JSVC 2GC4A 5CXCA 3J2PA 3SJJA 1SQ9A 4IA9A 3F3PA 4JSNC 4ZOYA 3FM0A 1JOFA 2HYEA 2G9AA 3JPXA 4QT8A 2AQ5A 3E0CA 3N1EA 4U7AA 3LD8A 4ERZA 3SUOA 4O45A 4DTSA 3RWUA 2BBKH 3HGKE 4KHSA 4L3GD 4PSXB 3FGBA 2OVQB 3SPZA 2QXFA 3CIKB 3FRXA 2P9SC 2AH0A 4RNGA 3EG6A 3PE7A 1A0RB 5EM2B 3WSOA 4AI6A 2O9KA 3BG0A 3DSMA 2LF6A 1Q9YA 2IUVA 2TRCB 2YBAA 3ZWLB 3NDKA 4MK0B 4A09B 3PSCB 2BCJB 3C6NB 3AH8B 4A2MA 2B7MA 3J81g 3NAEA 2PM6B 2FW3A 3TABA 4LG8A 3MZLA 4O3UB 2CO0C 5GXIA 4ADNA 3OKWA 1TYQC 3CQ8A 3MMYA 3UVLA 2HD0A 3RFGA 3CFVA 3N1BA 3SVIA 3I7LA 3RFHA 1PBYB 4FA1D 4EPHA 3KD5E 1GOTB 1FXXA 3L0MA 2VIXA 5CYKB 1XVFE 3TAGA 3QNOA 3TL8B 4DTNA 4M3YA 3C9CA 4FJ8A 4GQ1A 2IURA 4DU4A 1XMHE 5IGOA 4CY1A 4AKHA 3K27A 4ES0A 2OIZA 2H9PA 4A0AA 5IJ7E 5K19A 4GGDA 3EWEA 3IJ1A 1XVCE 2OVPB 4EP9A 3J27A 5TDHB 2MZWB 4KHYA 5GXHA 4JS4A 1N6DA 3P4FA 3PXTD 4RL5A 1YFQA 4KHQA 3L4OD 4X61B 4FVMA 4U1EI 3QEIA 4GM8A 5CYKA 1FZ0E 2H9MA 4O9DA 2XL3A 4FJJA 4OWRA 4M3TA 3UKRC 2UZXB 4GMBA 3C99A 4Y5RD 4I79A 3JB9L 4FA5D 3BWSA 3SBRA 3I89A 2B5NA 3N0EA 3DWLC 5IC7A 3SUPA 1VYHC 3JRPA 4FJLA 3N0DA 4M3WA 2I0RA 3BG1A 3UVKA 2B1EA 3TJYA 5IBKB 2P1MB 4AEZA 4K3JB 5EALA 5EMKB 5EARA 3JZGA 4DTXA 3OKYB 2HJ4A 2YNPA 3UVMA 1XVBE 5CXBB 5EAMA 3DXKC 2OVRB 3HP9A 1FZ5E 3C6PB 1B9XA 2QC5A 5FKRA 1S4UX 1MG2A 4PBYA 1MDAH 4E5ZA 2HJBA 3VGZA 4FJXA 5TF2A 1FZ2E 3QERA 3PXWD 4Y7RA 4QQEA 3NHGA 2H3XA 3SPYA 2JH9A 5EMMB 2E32A 1FZHE 4JS5A 3TAEA 5GMKn 2I3TA 3SUNA 3OTTA 1QNIA 4JSXC 4FK2A 4JT6C 3SVWD 4FJIA 5IREA 4X3EA 4ERQA 2EBSA 3HFQA 3I7HA 4H5IA 1FZ8E 3SI6A 3SHFA 2J57G 2P5GA 5FKQA 4CY5A 2ATQA 2OK4A 3AL8A 3QEWA 3L2OB 3TAFA 1B9YA 2IUQA 3I8CA 4GGCA 3IIYA 4QRJA 1SHYB 4J84A 1WAFA 4E54B 3VA6A 4X5NA 3DM0A 5HE0B 4JXMA 5TEFA 4JT5C 2CNXA 2UZYB 3K2OA 2H9NA 3SMRA 3VH0A 4A09A 4PNKB 2PM9A 2H14A 3I8EA 4LG9A 2B5LA 4GGAA 1XMFE 5IGQA 3MKQA 4A08A 5C2WB 3NVQA 5C2VB 2JHCA 3C75H 2DEBA 5HE2B 3DXMC 5KDOB 4ESGA 2H6KA 4JSPC 4FJ7A 1MHZG 5EM2A 3S9HA 4FA9D 4M42A 5HE3B 3IKOA 1FZ9E 2H68A 3JROA 3I7NA 4G56B 5AJAA 3U4YA 2IWKA 3SUQA 2H6NA 5FXYA 2RCUA 3NGIA 4DTRA 4DTUA 4M45A 4M3ZA 1JJUB 3RN1D 2W18A 4A2LA 3B7FA 3AL9A 2H4TA 4DTMA 3EI4A 2PFVA 1U4CA 1WAJA 3V5WB 4J73A 3SQ1A 2Z2PA 4J0WA 4N14A 4X60B 4GQ2P 2P1OB 2XL2A 5GSAA 2P9LC 4FB1D 3J80g 2OZSA 2AH1A 4B08A 1JMXB 4GM3A 4JRQA 4J79A 2PBIB 3AFCA 4E3SA 1CLQA 1FZIE 1JMZB 2P1QB 4FK4A 3ULEC 4Z8LA 2VJ5A 3I2NA 3EI2B 3EI1A 4J87A 2DY4A 2XYIA 4UI9R 1OLZA 2VJ4A 5FQDA 4E4BA 3I7PA 4FJKA 1MMOG 4A08B 4XEIC 1XMGE 5H14A 4J82A 4OZUA 3C94A 2H13A 4BUJC 2B8IA 4KHUA 3QEVA 1IG9A 1MG3A 3LZJA 4FK0A 4CI8A 4HCBA 3RRMC 3LDBA 4O1QD 1ERJA 5THAA 3EI3B 4ZOVA 3L8BA 4FJ9A 3SNNA 1PEVA 3MKSB 1PI6A 4A11B 4QNDA 3NE6A 3W15A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A0B B;  2B5M A;  1NEX B;  2P9K C;  4CZX A;  4QL1 A;  2HES X;  4GM9 A;  5HE1 B;  4CY2 A;  3KRW B;  2HKM A;  4J8B A;  2P9I C;  2IUP A;  4CI1 A;  5HQG A;  5K1C C;  1K8K C;  3A0F A;  4YVD A;  3F3F A;  1Q47 A;  1GG2 B;  5EAP A;  4CY3 A;  4PSW B;  4X63 B;  5FKT A;  3GRE A;  2P1P B;  4O3T B;  2HKR A;  5IT9 g;  2I0S A;  2MTA H;  2AGL A;  3ORV D;  3V7D B;  4HDJ A;  2P1N B;  2YB8 B;  4GQB B;  3UVN A;  2H6Q A;  2GC7 A;  4FA4 D;  3SLE D;  3EI1 B;  4ZOZ A;  3OW8 A;  4L1Q D;  5CXC B;  4EWR A;  3OL2 A;  4D6V A;  4J78 A;  1N6E A;  3K26 A;  5I5I A;  2YNN A;  2E31 A;  3SBQ A;  3RLM D;  3JAM g;  4K3I D;  5FLX g;  4LGN A;  2YMU A;  3OGL B;  4PBZ A;  4A11 A;  4ZN4 A;  3EI3 A;  3I7O A;  1L0Q A;  3L4M D;  3UVO A;  2H9L A;  3UR4 A;  3SCY A;  3PVU B;  5SXM A;  5FA5 B;  1XKS A;  2Q7Q A;  4L3H D;  4CZV A;  2Z2N A;  1NR0 A;  2QXV A;  3PVW B;  4IMM A;  3SFZ A;  3EI2 A;  5H1M A;  1N6F A;  4BH6 A;  4TZ4 A;  4ERY A;  1U2V C;  1XIP A;  4J77 A;  1TBG A;  2P9P C;  3NVX A;  3F3G A;  1XHM A;  4A0A B;  5HYN B;  4AOW A;  4ZOX A;  4CC9 A;  4CZY A;  4FAV D;  4FHL A;  5I5J A;  2IWF A;  2AGW A;  2PM7 B;  5AFU 3;  2P9N C;  4FWW A;  1R5M A;  3AL8 B;  4A7J A;  4FAN D;  3PXS D;  2XU7 A;  4R7A B;  3EU7 A;  3OL2 B;  3PSL A;  3NVN A;  3IIW A;  4CI2 A;  5I5M A;  3UKU C;  3OGM B;  5AMS A;  3SBP A;  4BL0 A;  2P9U C;  2J55 H;  2CE9 A;  2CO0 A;  2CN2 A;  2IAA A;  1PGU A;  4XYH A;  5JWZ A;  3OGK B;  2CN3 A;  2AGZ A;  2H47 A;  3JZH A;  4PXW A;  2YNO A;  3MXX A;  5B4W A;  2OK6 A;  4CI3 A;  4A0B A;  1LDK E;  3IJC A;  4D0K A;  4E54 A;  4NSX A;  3C6O B;  3SWS D;  4E5Z B;  2OJY A;  4J81 A;  3RN0 D;  1GXR A;  3EI4 B;  4I6J B;  2G99 A;  3RMZ D;  5C9Z B;  3RSE C;  1FWX A;  2B4E A;  1FS1 A;  5IJ8 E;  5FKS A;  1RI6 A;  2AGX A;  3V9F A;  1P22 A;  4PC0 A;  1GP2 B;  1OMW B;  2AGY A;  4J86 A;  5A2Q g;  4H5J A;  3GFC A;  3JZN A;  4JD2 C;  5EML B;  3KRX B;  4GZ8 A;  5EMJ B;  2I3S A;  3MZK A;  4XYI A;  2PM9 B;  4KFM B;  2J56 H;  1SQJ A;  2Z2O A;  2I0T A;  3SXT D;  3ODT A;  3OKT A;  4L9O A;  1K32 A;  2HXC A;  4J8G A;  5H17 A;  4J0X A;  3SN6 B;  3I7K A;  2CE8 A;  3IJ0 A;  5CXB A;  2GNQ A;  3OKY A;  5TEE A;  3C5M A;  3CFS B;  3SJL D;  3EMH A;  4JSV C;  2GC4 A;  5CXC A;  1SQ9 A;  4IA9 A;  4JSN C;  3F3P A;  4ZOY A;  3FM0 A;  1JOF A;  2HYE A;  2G9A A;  3JPX A;  4QT8 A;  2AQ5 A;  3E0C A;  4ERZ A;  4U7A A;  4O45 A;  2BBK H;  4L3G D;  4PSX B;  3FGB A;  2OVQ B;  3CIK B;  3FRX A;  2P9S C;  2AH0 A;  3EG6 A;  3PE7 A;  1A0R B;  5EM2 B;  3WSO A;  2O9K A;  3BG0 A;  3DSM A;  2IUV A;  2TRC B;  2YBA A;  3ZWL B;  4MK0 B;  4A09 B;  3PSC B;  2BCJ B;  3C6N B;  3AH8 B;  4A2M A;  3J81 g;  2PM6 B;  4LG8 A;  3MZL A;  4O3U B;  2CO0 C;  5GXI A;  3OKW A;  1TYQ C;  3MMY A;  3UVL A;  3RFG A;  3CFV A;  3I7L A;  3RFH A;  1PBY B;  4FA1 D;  1GOT B;  5CYK B;  3C9C A;  4GQ1 A;  5IGO A;  4CY1 A;  2IUR A;  3K27 A;  4ES0 A;  2OIZ A;  2H9P A;  4A0A A;  5IJ7 E;  5K19 A;  4GGD A;  3EWE A;  3IJ1 A;  2OVP B;  5TDH B;  5GXH A;  1N6D A;  3P4F A;  3PXT D;  1YFQ A;  3L4O D;  4X61 B;  4U1E I;  4GM8 A;  5CYK A;  2H9M A;  4O9D A;  2XL3 A;  4OWR A;  3UKR C;  2UZX B;  4GMB A;  3C99 A;  4Y5R D;  4I79 A;  3JB9 L;  4FA5 D;  3BWS A;  3SBR A;  3I89 A;  2B5N A;  3N0E A;  3DWL C;  5IC7 A;  1VYH C;  3JRP A;  3N0D A;  2I0R A;  3BG1 A;  3UVK A;  5IBK B;  4AEZ A;  2P1M B;  4K3J B;  5EAL A;  5EMK B;  5EAR A;  3JZG A;  3OKY B;  2HJ4 A;  2YNP A;  3UVM A;  5CXB B;  5EAM A;  3DXK C;  2OVR B;  3C6P B;  1B9X A;  2QC5 A;  5FKR A;  1S4U X;  1MG2 A;  4PBY A;  1MDA H;  4E5Z A;  2HJB A;  3VGZ A;  5TF2 A;  3PXW D;  4Y7R A;  4QQE A;  2H3X A;  5EMM B;  2E32 A;  5GMK n;  2I3T A;  3OTT A;  1QNI A;  4JSX C;  3SVW D;  4JT6 C;  4X3E A;  4ERQ A;  2EBS A;  3HFQ A;  3I7H A;  4H5I A;  3SHF A;  2J57 G;  5FKQ A;  4CY5 A;  2OK4 A;  3AL8 A;  4GGC A;  3L2O B;  3I8C A;  1B9Y A;  2IUQ A;  3IIY A;  4QRJ A;  1SHY B;  4J84 A;  4E54 B;  3VA6 A;  3DM0 A;  5HE0 B;  4JXM A;  5TEF A;  4JT5 C;  2CNX A;  2UZY B;  2H9N A;  3SMR A;  3VH0 A;  4A09 A;  4PNK B;  2PM9 A;  2H14 A;  3I8E A;  4LG9 A;  2B5L A;  4GGA A;  5IGQ A;  3MKQ A;  4A08 A;  5C2W B;  3NVQ A;  5C2V B;  3C75 H;  5HE2 B;  3DXM C;  5KDO B;  4ESG A;  2H6K A;  4JSP C;  5EM2 A;  4FA9 D;  5HE3 B;  3IKO A;  2H68 A;  3JRO A;  3I7N A;  4G56 B;  5AJA A;  3U4Y A;  2IWK A;  2H6N A;  5FXY A;  3RN1 D;  1JJU B;  2W18 A;  4A2L A;  3B7F A;  3AL9 A;  3EI4 A;  1U4C A;  3V5W B;  4J73 A;  2Z2P A;  4N14 A;  4J0W A;  4X60 B;  4GQ2 P;  2P1O B;  2XL2 A;  5GSA A;  2P9L C;  4FB1 D;  3J80 g;  2AH1 A;  1JMX B;  4GM3 A;  4J79 A;  2PBI B;  3AFC A;  1JMZ B;  2P1Q B;  3ULE C;  4Z8L A;  3I2N A;  3EI2 B;  3EI1 A;  4J87 A;  2XYI A;  4UI9 R;  1OLZ A;  5FQD A;  3I7P A;  4A08 B;  4XEI C;  5H14 A;  4J82 A;  4OZU A;  4BUJ C;  2H13 A;  1MG3 A;  4CI8 A;  3RRM C;  4O1Q D;  1ERJ A;  5THA A;  3EI3 B;  4ZOV A;  1PEV A;  3MKS B;  1PI6 A;  4A11 B;  3W15 A; 
#chains in the Genus database with same CATH topology
 4A0B B;  2VDP A;  1XVE E;  2B5M A;  1FZ4 E;  1GOG A;  2EID A;  2VDR A;  3DDU A;  4AKG A;  4I9L A;  3IUQ A;  1NEX B;  2P9K C;  4CZX A;  4QL1 A;  2HES X;  4GM9 A;  5HE1 B;  4CY2 A;  3KRW B;  2HKM A;  2QR5 A;  4J8B A;  4M41 A;  1FZ7 E;  2P9I C;  2IUP A;  4CI1 A;  3LDS A;  2FYO A;  5HQG A;  3L1N A;  5K1C C;  3E4W A;  4AX4 A;  1K8K C;  3A0F A;  4YVD A;  3K6S A;  3F3F A;  1Q47 A;  4DNV A;  1GG2 B;  5EAP A;  4CY3 A;  4PSW B;  4X63 B;  3UIQ A;  1Q9X A;  1FYZ E;  5FKT A;  3HL8 A;  4MMX A;  3SCX A;  3GRE A;  2P1P B;  4O3T B;  1MHY G;  3QET A;  1H2W A;  2HKR A;  2I0S A;  5E6S A;  5IT9 g;  2MTA H;  5C92 A;  4DTJ A;  2AGL A;  3ORV D;  3V7D B;  2P5O A;  4HDJ A;  4NBM A;  2P1N B;  4G1E A;  2EIB A;  2YB8 B;  4GQB B;  3UVN A;  2MW2 A;  2H6Q A;  4J2D A;  2GC7 A;  4FA4 D;  3SLE D;  3EI1 B;  4ZOZ A;  3OW8 A;  4L1Q D;  5CXC B;  4EWR A;  3BVO A;  3CFR A;  4J2A A;  3MUO A;  3OL2 A;  4D6V A;  4J78 A;  1N6E A;  3K26 A;  4RE6 A;  5I5I A;  2YNN A;  2E31 A;  3RMC A;  1I2M B;  3SBQ A;  3V4P A;  4KHW A;  3RLM D;  3JAM g;  3E4Y A;  4DTO A;  4K3I D;  5FLX g;  4J2B A;  4LGN A;  2YMU A;  4M3U A;  1FPO A;  3OGL B;  2WQ8 A;  4FJH A;  2HU7 A;  4PBZ A;  4A11 A;  4ZN4 A;  4FJN A;  4X5M A;  3O4J A;  3EI3 A;  3I7O A;  1L0Q A;  3L4M D;  1FZ6 E;  4BCC A;  3QI0 A;  3UVO A;  2PFT A;  2H9L A;  3UR4 A;  3SCY A;  3PVU B;  1H2Y A;  4RE5 A;  5SXM A;  5FA5 B;  1XKS A;  2Q7Q A;  4ICG C;  4L3H D;  4CZV A;  4KHN A;  2JPN A;  3NIF A;  2Z2N A;  4DU3 A;  1N1C A;  1NR0 A;  2QXV A;  3PVW B;  4IMM A;  1XVG E;  3SFZ A;  3EI2 A;  3IUM A;  3QNN A;  5H1M A;  1N6F A;  4BH6 A;  3NCI A;  2RKH A;  4TZ4 A;  1VE7 A;  3V4V A;  1XL3 C;  4ERY A;  1U2V C;  4L1M A;  1XIP A;  3RMB A;  4WJK A;  4J77 A;  1VZ3 A;  5HDB A;  3NIG A;  3ZE2 A;  1TBG A;  4M3R A;  2P9P C;  3NVX A;  3F3G A;  4FJM A;  1XHM A;  4A0A B;  5HYN B;  4AOW A;  4FJG A;  2VDK A;  4DTP A;  4ZOX A;  4D9S A;  4CC9 A;  4CZY A;  4FAV D;  4KI4 A;  4FHL A;  5I5J A;  2IWF A;  2AGW A;  2PM7 B;  4DNW A;  5AFU 3;  2P9N C;  4FWW A;  1R5M A;  3AL8 B;  1L5G A;  3RMA A;  4A7J A;  5IZ7 A;  4FJ5 A;  4FAN D;  3PXS D;  2XU7 A;  3EU7 A;  4R7A B;  3OL2 B;  3PSL A;  3CFO A;  4ADO A;  3NVN A;  3IIW A;  4CI2 A;  5I5M A;  3SQ4 A;  2MMB A;  3UKU C;  1XU5 E;  3OGM B;  5AMS A;  4HCC A;  2JQT A;  1IH7 A;  3SBP A;  4AMY A;  3SQ2 A;  4BL0 A;  2P9U C;  2J55 H;  3O4H A;  2CE9 A;  4DU1 A;  2CO0 A;  1UOP A;  2CN2 A;  2IAA A;  3IUR A;  1PGU A;  4XYH A;  5JWZ A;  3C95 A;  3OGK B;  2CN3 A;  1VE6 A;  2AGZ A;  2H47 A;  3JZH A;  1FZ3 E;  3CFP A;  2JHA A;  2YNO A;  3IUN A;  4PXW A;  3MXX A;  5B4W A;  2OK6 A;  3IUL A;  2DTU A;  1GOF A;  4O02 A;  1O6G A;  4CI3 A;  4A0B A;  1C9I A;  1LDK E;  3IJC A;  1U8C A;  1H2X A;  4O2W A;  4D0K A;  4E54 A;  4NSX A;  3C6O B;  3SWS D;  4E5Z B;  2OJY A;  4J81 A;  3RMD A;  4KI6 A;  3RN0 D;  1GXR A;  2YB5 A;  3EI4 B;  4I6J B;  2G99 A;  3RMZ D;  4M3X A;  3MUN A;  5C9Z B;  4MMZ A;  3RSE C;  1FWX A;  4EYW A;  2B4E A;  1FS1 A;  5IJ8 E;  1YR2 A;  5FKS A;  1FZ1 E;  4J2E A;  3VI3 A;  1RI6 A;  5C86 A;  3QEP A;  1K3I A;  2AGX A;  5E6R A;  3V9F A;  3UO3 A;  1P22 A;  3SQ0 A;  2OYQ A;  4QNC A;  4PC0 A;  1XVD E;  4QAM A;  1GP2 B;  4IRZ A;  5M61 A;  4JRP A;  2OZM A;  3QES A;  1OMW B;  2JKX A;  3KD1 E;  2JHP A;  2AGY A;  4J86 A;  5A2Q g;  4H5J A;  3GFC A;  3JZN A;  4JD2 C;  5EML B;  3KRX B;  4GZ8 A;  2LF3 A;  4I9Q A;  5EMJ B;  1XU3 E;  4AKI A;  1E8M A;  2I3S A;  3MZK A;  1MTY G;  4XYI A;  2PM9 B;  5H37 A;  4KFM B;  5FFG A;  2J56 H;  3OF7 A;  1SQJ A;  4RG8 A;  2Z2O A;  2I0T A;  2VDM A;  3SXT D;  3ODT A;  3OKT A;  3QEX A;  4L9O A;  1K32 A;  3HGL A;  2HXC A;  4J8G A;  5H17 A;  4J0X A;  3SN6 B;  3I7K A;  2CE8 A;  3IJ0 A;  5CXB A;  2JH8 A;  2GNQ A;  3O4I A;  3OKY A;  3QHY B;  5TEE A;  3LZI A;  3C5M A;  4GAM C;  3CFS B;  3SJL D;  3EMH A;  4BP9 A;  4JSV C;  4NAA A;  2GC4 A;  5CXC A;  3J2P A;  3SJJ A;  1SQ9 A;  4IA9 A;  3F3P A;  4JSN C;  5M5T A;  4ZOY A;  1UOO A;  1JTD B;  3FM0 A;  1JOF A;  2HYE A;  2G9A A;  3JPX A;  3O4G A;  4QT8 A;  2AQ5 A;  3E0C A;  3N1E A;  4U7A A;  3LD8 A;  4ERZ A;  3SUO A;  4O45 A;  4DTS A;  3RWU A;  2BBK H;  3HGK E;  4KHS A;  4L3G D;  4PSX B;  3FGB A;  2OVQ B;  3SPZ A;  4BCB A;  2QXF A;  3CIK B;  3FRX A;  2P9S C;  4RNG A;  2AH0 A;  2EIC A;  4NC4 A;  1UOQ A;  1T2X A;  3EG6 A;  3PE7 A;  1A0R B;  5EM2 B;  3WSO A;  4AI6 A;  2O9K A;  3BG0 A;  4MMY A;  3IUJ A;  3T3M A;  3DSM A;  5M5S A;  2LF6 A;  1Q9Y A;  2IUV A;  4WK2 A;  2TRC B;  2YBA A;  3ZWL B;  4WK4 A;  2HU8 A;  3NDK A;  3FCU A;  4MK0 B;  4A09 B;  3PSC B;  2BCJ B;  3C6N B;  3AH8 B;  4A2M A;  3ZE1 A;  2B7M A;  3J81 g;  3NAE A;  2PM6 B;  2FW3 A;  3TAB A;  4LG8 A;  3MZL A;  3ZDZ A;  4O3U B;  2CO0 C;  5GXI A;  3T3P A;  2VZ3 A;  4ADN A;  3IJE A;  3OKW A;  1TYQ C;  3CQ8 A;  3MMY A;  5M5R A;  3UVL A;  2HD0 A;  4G55 A;  3RFG A;  3CFV A;  3MVD K;  3N1B A;  5FFO A;  3K71 A;  3SVI A;  1E5T A;  3I7L A;  3RFH A;  1PBY B;  4FA1 D;  4EPH A;  3KD5 E;  1GOT B;  1FXX A;  3FCS A;  3L0M A;  2VIX A;  5CYK B;  1XVF E;  3GD1 I;  3TAG A;  3QNO A;  3TL8 B;  4DTN A;  4M3Y A;  3C9C A;  4FJ8 A;  4GQ1 A;  2IUR A;  4DU4 A;  1XMH E;  2VC2 A;  5IGO A;  4AKH A;  4CY1 A;  1M1X A;  3K27 A;  4Z7O A;  4ES0 A;  2OIZ A;  2H9P A;  4A0A A;  5IJ7 E;  5K19 A;  1QFS A;  4GGD A;  3K72 A;  3EWE A;  3IJ1 A;  1XVC E;  2OVP B;  4EP9 A;  3J27 A;  4JHN A;  5TDH B;  2MZW B;  4KHY A;  5GXH A;  4JS4 A;  1N6D A;  3P4F A;  3PXT D;  3EQ7 A;  4RL5 A;  1YFQ A;  4KHQ A;  1JV2 A;  3L4O D;  4X61 B;  4FVM A;  2VDO A;  3QEI A;  2VZ1 A;  1BPO A;  4GM8 A;  1FZ0 E;  4U1E I;  5CYK A;  2H9M A;  4O9D A;  2XL3 A;  4FJJ A;  4OWR A;  4M3T A;  2VDN A;  3UKR C;  2UZX B;  5E6U A;  1VZ2 A;  3C99 A;  3EQ8 A;  4GMB A;  4NEN A;  4Y5R D;  4I79 A;  3JB9 L;  4FA5 D;  3BWS A;  3SBR A;  3NID A;  4IT5 A;  3I89 A;  2B5N A;  3N0E A;  1E8N A;  3DWL C;  5IC7 A;  1TYE A;  3SUP A;  1VYH C;  3EQ9 A;  4FJL A;  3JRP A;  3N0D A;  4M3W A;  2I0R A;  1H2Z A;  3BG1 A;  2K5S A;  1C9L A;  3UVK A;  2B1E A;  3TJY A;  5IBK B;  2P1M B;  4AEZ A;  4K3J B;  5EAL A;  5EMK B;  2XZG A;  1JW2 A;  5EAR A;  3JZG A;  4DTX A;  3OKY B;  2HJ4 A;  2YNP A;  3UVM A;  1XVB E;  5CXB B;  5EAM A;  3DXK C;  2VDQ A;  2OVR B;  3HP9 A;  1FZ5 E;  3C6P B;  4BCD A;  4Z7N A;  1B9X A;  2QC5 A;  4UM9 A;  1S4U X;  5FKR A;  4AN1 A;  1MG2 A;  4PBY A;  1MDA H;  4E5Z A;  4JHP C;  2HJB A;  3VGZ A;  4FJX A;  5TF2 A;  1FZ2 E;  3QER A;  3PXW D;  4Y7R A;  4QQE A;  3NHG A;  2H3X A;  3ZE0 A;  3SPY A;  2JH9 A;  5EMM B;  2E32 A;  1FZH E;  2BKL A;  4JS5 A;  3TAE A;  5GMK n;  2I3T A;  3SUN A;  3OTT A;  1QNI A;  4JSX C;  4FK2 A;  4JT6 C;  3SVW D;  3UO2 A;  4FJI A;  5IRE A;  3ZDY A;  4X3E A;  4ERQ A;  2EBS A;  3HFQ A;  3I7H A;  2HU5 A;  4H5I A;  3IVM A;  1FZ8 E;  3SI6 A;  3SHF A;  1GOH A;  2J57 G;  2P5G A;  5FKQ A;  4CY5 A;  2ATQ A;  2OK4 A;  3AL8 A;  3QEW A;  3L2O B;  3TAF A;  1B9Y A;  2IUQ A;  3I8C A;  4GGC A;  3IIY A;  4QRJ A;  1SHY B;  4J84 A;  1WAF A;  4E54 B;  3VA6 A;  4X5N A;  3DM0 A;  5HE0 B;  4JXM A;  5TEF A;  4DNU A;  4JT5 C;  2CNX A;  2UZY B;  3K2O A;  2H9N A;  3SMR A;  3VH0 A;  2XDW A;  4A09 A;  1QFM A;  4PNK B;  2PM9 A;  2H14 A;  3I8E A;  4LG9 A;  2B5L A;  4GGA A;  1XMF E;  1O6F A;  5IGQ A;  3MKQ A;  4A08 A;  5C2W B;  3NVQ A;  5C2V B;  2JHC A;  3C75 H;  2DEB A;  5HE2 B;  3DXM C;  5KDO B;  4ESG A;  2H6K A;  4JSP C;  4FJ7 A;  1MHZ G;  5EM2 A;  3S9H A;  4FA9 D;  4M42 A;  4AN0 A;  5HE3 B;  2EIE A;  3IKO A;  1FZ9 E;  2H68 A;  4UM8 A;  3JRO A;  3I7N A;  4G56 B;  2XE4 A;  5AJA A;  3U4Y A;  2IWK A;  3SUQ A;  2H6N A;  5FXY A;  1UTC A;  2RCU A;  3NGI A;  4DTR A;  4DTU A;  3ZDX A;  4M45 A;  4M3Z A;  1JJU B;  3RN1 D;  2W18 A;  3GC3 B;  4A2L A;  3B7F A;  3AL9 A;  2H4T A;  4DTM A;  3EI4 A;  4AMZ A;  2PFV A;  1U4C A;  1WAJ A;  3V5W B;  4J73 A;  3SQ1 A;  2Z2P A;  4J0W A;  4N14 A;  4X60 B;  4GQ2 P;  2P1O B;  2XL2 A;  5GSA A;  2P9L C;  4FB1 D;  3J80 g;  2OZS A;  2AH1 A;  2VDL A;  4B08 A;  5M5U A;  1JMX B;  4GM3 A;  4JRQ A;  4J79 A;  3KCI A;  2PBI B;  2QZP A;  3VI4 A;  3AFC A;  4Z7Q A;  4E3S A;  1CLQ A;  1FZI E;  1JMZ B;  4BP8 A;  2P1Q B;  4FK4 A;  3ULE C;  4Z8L A;  2VJ5 A;  3I2N A;  3EI2 B;  3EI1 A;  4J87 A;  2DY4 A;  5M5V A;  4WK0 A;  2XYI A;  4UI9 R;  1OLZ A;  2VJ4 A;  5FQD A;  4E4B A;  3I7P A;  4FJK A;  1MMO G;  4A08 B;  4XEI C;  1XMG E;  5H14 A;  4J82 A;  4OZU A;  3C94 A;  2H13 A;  4BUJ C;  2B8I A;  4KHU A;  3QEV A;  1IG9 A;  1MG3 A;  3LZJ A;  4FK0 A;  4CI8 A;  4HCB A;  1A12 A;  3RRM C;  3LDB A;  4O1Q D;  1ERJ A;  5THA A;  4G1M A;  3EI3 B;  4ZOV A;  3L8B A;  4FJ9 A;  3SNN A;  1PEV A;  3MKS B;  1PI6 A;  4A11 B;  4QND A;  3NE6 A;  3W15 A; 
#chains in the Genus database with same CATH homology
 4A0B B;  1XVE E;  2B5M A;  1FZ4 E;  4AKG A;  4I9L A;  1NEX B;  2P9K C;  4CZX A;  4QL1 A;  2HES X;  4GM9 A;  5HE1 B;  4CY2 A;  3KRW B;  2HKM A;  4J8B A;  4M41 A;  1FZ7 E;  2P9I C;  2IUP A;  4CI1 A;  3LDS A;  2FYO A;  5HQG A;  3L1N A;  5K1C C;  3E4W A;  1K8K C;  3A0F A;  4YVD A;  3F3F A;  1Q47 A;  1GG2 B;  5EAP A;  4CY3 A;  4PSW B;  4X63 B;  3UIQ A;  1Q9X A;  1FYZ E;  5FKT A;  3HL8 A;  3SCX A;  3GRE A;  2P1P B;  4O3T B;  1MHY G;  3QET A;  2HKR A;  5IT9 g;  2I0S A;  2MTA H;  4DTJ A;  2AGL A;  3ORV D;  3V7D B;  2P5O A;  4HDJ A;  2P1N B;  2YB8 B;  4GQB B;  3UVN A;  2H6Q A;  4J2D A;  2GC7 A;  4FA4 D;  3SLE D;  3EI1 B;  4ZOZ A;  3OW8 A;  4L1Q D;  5CXC B;  4EWR A;  3CFR A;  4J2A A;  3OL2 A;  4D6V A;  4J78 A;  1N6E A;  3K26 A;  5I5I A;  2YNN A;  2E31 A;  3RMC A;  3SBQ A;  4KHW A;  3RLM D;  3JAM g;  3E4Y A;  4DTO A;  4K3I D;  5FLX g;  4J2B A;  4LGN A;  2YMU A;  4M3U A;  3OGL B;  4FJH A;  4PBZ A;  4A11 A;  4ZN4 A;  4FJN A;  4X5M A;  3EI3 A;  3I7O A;  1L0Q A;  3L4M D;  1FZ6 E;  3UVO A;  2PFT A;  2H9L A;  3UR4 A;  3SCY A;  3PVU B;  5SXM A;  5FA5 B;  1XKS A;  2Q7Q A;  4L3H D;  4CZV A;  4KHN A;  2JPN A;  2Z2N A;  4DU3 A;  1NR0 A;  2QXV A;  3PVW B;  4IMM A;  1XVG E;  3SFZ A;  3EI2 A;  3QNN A;  5H1M A;  1N6F A;  4BH6 A;  3NCI A;  4TZ4 A;  4ERY A;  1XL3 C;  1U2V C;  1XIP A;  3RMB A;  4J77 A;  1TBG A;  4M3R A;  2P9P C;  3NVX A;  3F3G A;  4FJM A;  1XHM A;  4A0A B;  5HYN B;  4AOW A;  4FJG A;  4DTP A;  4ZOX A;  4CC9 A;  4CZY A;  4FAV D;  4KI4 A;  4FHL A;  5I5J A;  2IWF A;  2AGW A;  2PM7 B;  5AFU 3;  2P9N C;  4FWW A;  1R5M A;  3AL8 B;  3RMA A;  4A7J A;  5IZ7 A;  4FJ5 A;  4FAN D;  3PXS D;  2XU7 A;  3EU7 A;  4R7A B;  3OL2 B;  3PSL A;  3CFO A;  4ADO A;  3NVN A;  3IIW A;  4CI2 A;  5I5M A;  3SQ4 A;  2MMB A;  3UKU C;  1XU5 E;  3OGM B;  5AMS A;  4HCC A;  1IH7 A;  3SBP A;  3SQ2 A;  4BL0 A;  2P9U C;  2J55 H;  2CE9 A;  4DU1 A;  2CO0 A;  2CN2 A;  2IAA A;  1PGU A;  4XYH A;  5JWZ A;  3C95 A;  3OGK B;  2CN3 A;  2AGZ A;  2H47 A;  3JZH A;  1FZ3 E;  3CFP A;  2JHA A;  2YNO A;  4PXW A;  3MXX A;  5B4W A;  2OK6 A;  2DTU A;  4CI3 A;  4A0B A;  1LDK E;  3IJC A;  4D0K A;  4E54 A;  4NSX A;  3C6O B;  3SWS D;  4E5Z B;  2OJY A;  4J81 A;  3RMD A;  4KI6 A;  3RN0 D;  1GXR A;  2YB5 A;  3EI4 B;  4I6J B;  2G99 A;  3RMZ D;  4M3X A;  5C9Z B;  3RSE C;  1FWX A;  4EYW A;  2B4E A;  1FS1 A;  5IJ8 E;  5FKS A;  1FZ1 E;  4J2E A;  1RI6 A;  3QEP A;  2AGX A;  3V9F A;  1P22 A;  3SQ0 A;  2OYQ A;  4QNC A;  4PC0 A;  1XVD E;  1GP2 B;  4JRP A;  2OZM A;  3QES A;  1OMW B;  3KD1 E;  2JHP A;  2AGY A;  4J86 A;  5A2Q g;  4H5J A;  3GFC A;  3JZN A;  4JD2 C;  5EML B;  3KRX B;  4GZ8 A;  2LF3 A;  4I9Q A;  5EMJ B;  1XU3 E;  4AKI A;  2I3S A;  3MZK A;  1MTY G;  4XYI A;  2PM9 B;  5H37 A;  4KFM B;  2J56 H;  1SQJ A;  4RG8 A;  2Z2O A;  2I0T A;  3SXT D;  3ODT A;  3OKT A;  3QEX A;  4L9O A;  1K32 A;  3HGL A;  2HXC A;  4J8G A;  5H17 A;  4J0X A;  3SN6 B;  3I7K A;  2CE8 A;  3IJ0 A;  5CXB A;  2JH8 A;  2GNQ A;  3OKY A;  5TEE A;  3LZI A;  3C5M A;  4GAM C;  3CFS B;  3SJL D;  3EMH A;  4JSV C;  2GC4 A;  5CXC A;  3J2P A;  3SJJ A;  1SQ9 A;  4IA9 A;  3F3P A;  4JSN C;  4ZOY A;  3FM0 A;  1JOF A;  2HYE A;  2G9A A;  3JPX A;  4QT8 A;  2AQ5 A;  3E0C A;  3N1E A;  4U7A A;  3LD8 A;  4ERZ A;  3SUO A;  4O45 A;  4DTS A;  3RWU A;  2BBK H;  3HGK E;  4KHS A;  4L3G D;  4PSX B;  3FGB A;  2OVQ B;  3SPZ A;  2QXF A;  3CIK B;  3FRX A;  2P9S C;  2AH0 A;  4RNG A;  3EG6 A;  3PE7 A;  1A0R B;  5EM2 B;  3WSO A;  4AI6 A;  2O9K A;  3BG0 A;  3DSM A;  2LF6 A;  1Q9Y A;  2IUV A;  2TRC B;  2YBA A;  3ZWL B;  3NDK A;  4MK0 B;  4A09 B;  3PSC B;  2BCJ B;  3C6N B;  3AH8 B;  4A2M A;  2B7M A;  3J81 g;  3NAE A;  2PM6 B;  2FW3 A;  3TAB A;  4LG8 A;  3MZL A;  4O3U B;  2CO0 C;  5GXI A;  4ADN A;  3OKW A;  1TYQ C;  3CQ8 A;  3MMY A;  3UVL A;  2HD0 A;  3RFG A;  3CFV A;  3N1B A;  3SVI A;  3I7L A;  3RFH A;  1PBY B;  4FA1 D;  4EPH A;  3KD5 E;  1GOT B;  1FXX A;  3L0M A;  2VIX A;  5CYK B;  1XVF E;  3TAG A;  3QNO A;  3TL8 B;  4DTN A;  4M3Y A;  3C9C A;  4FJ8 A;  4GQ1 A;  2IUR A;  4DU4 A;  1XMH E;  5IGO A;  4CY1 A;  4AKH A;  3K27 A;  4ES0 A;  2OIZ A;  2H9P A;  4A0A A;  5IJ7 E;  5K19 A;  4GGD A;  3EWE A;  3IJ1 A;  1XVC E;  2OVP B;  4EP9 A;  3J27 A;  5TDH B;  2MZW B;  4KHY A;  5GXH A;  4JS4 A;  1N6D A;  3P4F A;  3PXT D;  4RL5 A;  1YFQ A;  4KHQ A;  3L4O D;  4X61 B;  4FVM A;  4U1E I;  3QEI A;  4GM8 A;  5CYK A;  1FZ0 E;  2H9M A;  4O9D A;  2XL3 A;  4FJJ A;  4OWR A;  4M3T A;  3UKR C;  2UZX B;  4GMB A;  3C99 A;  4Y5R D;  4I79 A;  3JB9 L;  4FA5 D;  3BWS A;  3SBR A;  3I89 A;  2B5N A;  3N0E A;  3DWL C;  5IC7 A;  3SUP A;  1VYH C;  3JRP A;  4FJL A;  3N0D A;  4M3W A;  2I0R A;  3BG1 A;  3UVK A;  2B1E A;  3TJY A;  5IBK B;  2P1M B;  4AEZ A;  4K3J B;  5EAL A;  5EMK B;  5EAR A;  3JZG A;  4DTX A;  3OKY B;  2HJ4 A;  2YNP A;  3UVM A;  1XVB E;  5CXB B;  5EAM A;  3DXK C;  2OVR B;  3HP9 A;  1FZ5 E;  3C6P B;  1B9X A;  2QC5 A;  5FKR A;  1S4U X;  1MG2 A;  4PBY A;  1MDA H;  4E5Z A;  2HJB A;  3VGZ A;  4FJX A;  5TF2 A;  1FZ2 E;  3QER A;  3PXW D;  4Y7R A;  4QQE A;  3NHG A;  2H3X A;  3SPY A;  2JH9 A;  5EMM B;  2E32 A;  1FZH E;  4JS5 A;  3TAE A;  5GMK n;  2I3T A;  3SUN A;  3OTT A;  1QNI A;  4JSX C;  4FK2 A;  4JT6 C;  3SVW D;  4FJI A;  5IRE A;  4X3E A;  4ERQ A;  2EBS A;  3HFQ A;  3I7H A;  4H5I A;  1FZ8 E;  3SI6 A;  3SHF A;  2J57 G;  2P5G A;  5FKQ A;  4CY5 A;  2ATQ A;  2OK4 A;  3AL8 A;  3QEW A;  3L2O B;  3TAF A;  1B9Y A;  2IUQ A;  3I8C A;  4GGC A;  3IIY A;  4QRJ A;  1SHY B;  4J84 A;  1WAF A;  4E54 B;  3VA6 A;  4X5N A;  3DM0 A;  5HE0 B;  4JXM A;  5TEF A;  4JT5 C;  2CNX A;  2UZY B;  3K2O A;  2H9N A;  3SMR A;  3VH0 A;  4A09 A;  4PNK B;  2PM9 A;  2H14 A;  3I8E A;  4LG9 A;  2B5L A;  4GGA A;  1XMF E;  5IGQ A;  3MKQ A;  4A08 A;  5C2W B;  3NVQ A;  5C2V B;  2JHC A;  3C75 H;  2DEB A;  5HE2 B;  3DXM C;  5KDO B;  4ESG A;  2H6K A;  4JSP C;  4FJ7 A;  1MHZ G;  5EM2 A;  3S9H A;  4FA9 D;  4M42 A;  5HE3 B;  3IKO A;  1FZ9 E;  2H68 A;  3JRO A;  3I7N A;  4G56 B;  5AJA A;  3U4Y A;  2IWK A;  3SUQ A;  2H6N A;  5FXY A;  2RCU A;  3NGI A;  4DTR A;  4DTU A;  4M45 A;  4M3Z A;  1JJU B;  3RN1 D;  2W18 A;  4A2L A;  3B7F A;  3AL9 A;  2H4T A;  4DTM A;  3EI4 A;  2PFV A;  1U4C A;  1WAJ A;  3V5W B;  4J73 A;  3SQ1 A;  2Z2P A;  4J0W A;  4N14 A;  4X60 B;  4GQ2 P;  2P1O B;  2XL2 A;  5GSA A;  2P9L C;  4FB1 D;  3J80 g;  2OZS A;  2AH1 A;  4B08 A;  1JMX B;  4GM3 A;  4JRQ A;  4J79 A;  2PBI B;  3AFC A;  4E3S A;  1CLQ A;  1FZI E;  1JMZ B;  2P1Q B;  4FK4 A;  3ULE C;  4Z8L A;  2VJ5 A;  3I2N A;  3EI2 B;  3EI1 A;  4J87 A;  2DY4 A;  2XYI A;  4UI9 R;  1OLZ A;  2VJ4 A;  5FQD A;  4E4B A;  3I7P A;  4FJK A;  1MMO G;  4A08 B;  4XEI C;  1XMG E;  5H14 A;  4J82 A;  4OZU A;  3C94 A;  2H13 A;  4BUJ C;  2B8I A;  4KHU A;  3QEV A;  1IG9 A;  1MG3 A;  3LZJ A;  4FK0 A;  4CI8 A;  4HCB A;  3RRM C;  3LDB A;  4O1Q D;  1ERJ A;  5THA A;  3EI3 B;  4ZOV A;  3L8B A;  4FJ9 A;  3SNN A;  1PEV A;  3MKS B;  1PI6 A;  4A11 B;  4QND A;  3NE6 A;  3W15 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...