2OVRB

Structure of the skp1-fbw7-cyclinedegn complex
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
444
structure length
442
Chain Sequence
TQVKHMMQVIEPQFQRDFISLLPKELALYVLSFLEPKDLLQAAQTCRYWRILAEDNLLWREKCKEEGIDEPLHIKRVIKPGFIHSPWKSAYIRQHRIDTNWRRGELKSPKVLKGHDDHVITCLQFCGNRIVSGSDDNTLKVWSAVTGKCLRTLVGHTGGVWSSQMRDNIIISGSTDRTLKVWNAETGECIHTLYGHTSTVRCMHLHEKRVVSGSRDATLRVWDIETGQCLHVLMGHVAAVRCVQYDGRRVVSGAYDFMVKVWDPETETCLHTLQGHTNRVYSLQFDGIHVVSGSLDTSIRVWDVETGNCIHTLTGHQSLTSGMELKDNILVSGNADSTVKIWDIKTGQCLQTLQGPNKHQSAVTCLQFNKNFVITSSDDGTVKLWDLKTGEFIRNLVTLESGGSGGVVWRIRASNTKLVCAVGSRNGTEETKLLVLDFDVDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords S-phase kinase-associated protein 1A
publication title Structure of a Fbw7-Skp1-Cyclin E Complex: Multisite-Phosphorylated Substrate Recognition by SCF Ubiquitin Ligases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/cell cycle
total genus 132
structure length 442
sequence length 444
ec nomenclature
pdb deposition date 2007-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00400 WD40 WD domain, G-beta repeat
B PF12937 F-box-like F-box-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.50 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 2ovrB01
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2ovrB02
3OGMB 2P9SC 3EWEA 1R5MA 4ESGA 3ZWLB 3IIWA 4I79A 3K26A 4JSXC 2OK6A 3OW8A 2PM9A 4J81A 4CZYA 3EU7A 3PVWB 3UKUC 3OKYA 4ERZA 1MDAH 2H47A 1VYHC 5EAPA 1SQJA 4XEIC 3V5WB 2HXCA 3EMHA 3C6OB 3IJCA 2G99A 3E0CA 3SN6B 5AJAA 5IJ8E 1P22A 3CFSB 2Q7QA 3JRPA 4CI2A 3JZNA 4GM3A 1SQ9A 2AH0A 4BUJC 4LG8A 5C2WB 4O3TB 3IKOA 4L1QD 2MTAH 4J8BA 4ZN4A 3EI3A 3I7PA 3JPXA 2YNOA 4BH6A 2TRCB 3KRWB 2XL2A 3MZLA 4O45A 2BCJB 4L9OA 3UVLA 3UVNA 5THAA 2YMUA 1S4UX 3W15A 2IWFA 2XL3A 4A2MA 4A0BB 3BG0A 4FB1D 3EI1A 3PXTD 5I5JA 4L3HD 5EMMB 3L4OD 4Z8LA 4O3UB 4J82A 5CXCA 3ULEC 1OMWB 4MK0B 1NR0A 2GNQA 4A7JA 4FA1D 2AH1A 2YB8B 2H6NA 4LG9A 3AL8B 2H14A 4J0XA 4IMMA 5HE1B 4A09A 3J81g 3DWLC 4JSNC 3FRXA 2W18A 4AOWA 1A0RB 4E5ZB 5TEFA 3OGLB 4A0AA 1TYQC 2GC4A 3EI2A 3RRMC 4H5JA 4LGNA 2CE8A 2HKMA 5EALA 5HQGA 4L3GD 5CXCB 1XIPA 4QRJA 4J86A 1PGUA 3I7HA 5FKSA 2J55H 4GQBB 4PC0A 2HYEA 5IJ7E 4QQEA 5H1MA 3PVUB 3I7LA 2HKRA 3AFCA 4A08A 2P1MB 5GXHA 3ODTA 3JROA 3CFVA 2IWKA 3B7FA 4Y7RA 2J56H 4CZVA 2H13A 2YNPA 3CIKB 4FHLA 1JMXB 2P9PC 4CC9A 4QT8A 3OKWA 5H14A 3IJ1A 3L2OB 2QC5A 3RN0D 2P1QB 2P9NC 2Z2PA 3OL2A 4A11B 5FKQA 1N6FA 2OIZA 5K1CC 4J73A 5CXBB 4J79A 4TZ4A 2B5NA 3UR4A 2B4EA 2I0SA 2Z2OA 4J87A 2EBSA 5EM2A 2HJBA 2H9MA 3F3GA 2OVRB 3MXXA 4A08B 4UI9R 5FA5B 5EAMA 4GZ8A 5AFU3 2H6QA 1OLZA 3SMRA 4ZOZA 1B9YA 3NVNA 2PM6B 3C5MA 5I5IA 1N6DA 2H3XA 4ZOYA 5CYKA 5JWZA 5EMKB 4XYIA 3V9FA 3EI4A 2H9LA 3VH0A 4X3EA 4FA4D 2PM9B 3OTTA 4QL1A 4H5IA 4FWWA 5EM2B 1JMZB 3I89A 4D6VA 4CY5A 3OKYB 1JJUB 3KRXB 2CNXA 3C6NB 3RFGA 3A0FA 5HE2B 1U4CA 4E54A 4GMBA 5EMJB 3PSLA 2CN3A 3OGKB 3GFCA 5I5MA 3N0DA 4YVDA 3SBRA 2AGZA 4GM9A 5H17A 3UKRC 5FKTA 4AEZA 4EWRA 5TEEA 3NVXA 5GXIA 4N14A 2P9LC 2OVPB 5FQDA 4FA5D 3EI4B 3EI3B 4CY3A 5KDOB 2E32A 4J84A 1B9XA 3SBQA 3GREA 2P9IC 3I7OA 3RN1D 3DXMC 5FKRA 4U1EI 5FXYA 5K19A 4CY1A 3EI1B 5FLXg 3JB9L 2IAAA 4J78A 4PXWA 1TBGA 3F3PA 3V7DB 4GQ1A 1QNIA 5HE0B 2O9KA 4HDJA 2YBAA 3EG6A 3C9CA 3L4MD 4K3ID 2J57G 3PXWD 4FA9D 4A2LA 5IBKB 2AGWA 2CO0C 3AH8B 3OKTA 4PSWB 1U2VC 3UVOA 3PXSD 2XU7A 4O9DA 4A09B 3IJ0A 3MMYA 4CI1A 3AL9A 2H9NA 2G9AA 2PBIB 1LDKE 3DSMA 4A0AB 2QXVA 4O1QD 3EI2B 2UZXB 4CY2A 3RLMD 2OJYA 1GG2B 2CN2A 4JSVC 2AGYA 1FS1A 1PBYB 3WSOA 4U7AA 3RFHA 4PBYA 3UVKA 3MZKA 3U4YA 4CI8A 3RSEC 4D0KA 3P4FA 2IUVA 4R7AB 2HJ4A 2P1OB 3FGBA 4JXMA 2IUQA 5TF2A 4FAVD 5IGQA 3I2NA 1GOTB 3PE7A 1PEVA 4G56B 3OL2B 4Y5RD 3I8EA 4KFMB 5A2Qg 2P9UC 4K3JB 1GP2B 2I3TA 1XHMA 3SLED 3PSCB 4A0BA 3SJLD 4J0WA 2AQ5A 4CI3A 1Q47A 4BL0A 3C6PB 5EARA 5GSAA 2Z2NA 2P1NB 3I7KA 4JSPC 2E31A 3K27A 2B5LA 3JAMg 3SBPA 1FWXA 1N6EA 3BWSA 2H68A 4XYHA 3NVQA 3SVWD 3C99A 3SFZA 1ERJA 4PSXB 3AL8A 2UZYB 3N0EA 1XKSA 2XYIA 5C9ZB 4X60B 2P1PB 2OVQB 3VGZA 2BBKH 5CYKB 2GC7A 1L0QA 1NEXB 2CO0A 4PBZA 4J8GA 5TDHB 4E5ZA 1MG3A 5GMKn 3J80g 2I3SA 3RMZD 4IA9A 3SHFA 3MKSB 1GXRA 1K8KC 4E54B 3DM0A 3ORVD 4GQ2P 4GGDA 3BG1A 2AGXA 5C2VB 5HYNB 1SHYB 4JT5C 5B4WA 2IUPA 1JOFA 2PM7B 3SCYA 4GGCA 4CZXA 3JZHA 4GGAA 3IIYA 5SXMA 4FAND 4X63B 4ZOVA 4JT6C 4NSXA 5EMLB 3MKQA 1K32A 1PI6A 4ERYA 4A11A 2I0TA 3DXKC 1RI6A 4ZOXA 3FM0A 4J77A 5CXBA 5HE3B 5IC7A 4X61B 3SXTD 3VA6A 4I6JB 3SWSD 1YFQA 3F3FA 2H6KA 2P9KC 3UVMA 4GM8A 5IGOA 2AGLA 4JD2C 3I8CA 4OZUA 1MG2A 2CE9A 3C75H 2HESX 3I7NA 2B5MA 2IURA 2OK4A 4ES0A 4ERQA 5AMSA 5IT9g 3JZGA 2I0RA 2H9PA 4PNKB 4OWRA 2YNNA 3HFQA
chains in the Genus database with same CATH superfamily
2MW2A 3OGMB 2P9SC 3EWEA 1R5MA 1XVGE 3NIDA 3VI3A 4ESGA 3ZWLB 4M3XA 3IIWA 4I79A 3K26A 4JSXC 2OK6A 3OW8A 2PM9A 4FJMA 4J81A 5M61A 4CZYA 3OF7A 5E6RA 3EU7A 3PVWB 1FZ4E 4Z7OA 3UIQA 4NBMA 3LDBA 4FJNA 2WQ8A 3UKUC 3OKYA 4ERZA 3TABA 1MDAH 2H47A 4BCCA 1VYHC 4HCCA 5EAPA 1SQJA 4XEIC 3V5WB 3SQ1A 2HXCA 3EMHA 3C6OB 3IJCA 2G99A 3E0CA 3IUNA 3SN6B 5AJAA 1VZ3A 5IJ8E 1P22A 3CFSB 3SNNA 3VI4A 2Q7QA 3JRPA 4QAMA 4CI2A 3JZNA 4GM3A 3J27A 1SQ9A 2AH0A 4FJLA 4BUJC 4LG8A 4JHPC 5C2WB 4O3TB 4FK0A 3IKOA 4B08A 2XDWA 3NDKA 3TAEA 4FJ8A 4L1QD 2MTAH 1FZ1E 4J8BA 4ZN4A 3QEIA 3EI3A 3I7PA 2FYOA 3JPXA 2YNOA 2QZPA 4BH6A 2TRCB 3KRWB 4BP8A 2XL2A 1MHZG 3RMDA 3MZLA 2VDKA 4O45A 2BCJB 3SI6A 3SPZA 3GC3B 1IG9A 2JPNA 4L9OA 3UVLA 3UVNA 5THAA 4FJJA 1S4UX 2YMUA 2IWFA 2XL3A 3W15A 4A2MA 4A0BB 3BG0A 4FB1D 3EI1A 3PXTD 5I5JA 2OZMA 4E4BA 4L3HD 3O4GA 4M3WA 4G55A 5EMMB 3L4OD 4Z8LA 5E6UA 4O3UB 4J82A 5CXCA 2VZ3A 3ULEC 4DNWA 3N1EA 4DTNA 1OMWB 2B7MA 3SQ2A 1E8MA 4MK0B 1NR0A 2GNQA 3QNOA 4A7JA 4FA1D 2AH1A 4JS4A 2YB8B 2H6NA 4AMZA 4LG9A 3AL8B 3RMBA 1FZ8E 2H14A 4J0XA 4X5NA 2LF6A 3HL8A 4DU3A 4Z7QA 4IMMA 5HE1B 3ZDYA 4A09A 4AKGA 3J81g 3DWLC 1M1XA 3FRXA 2JH8A 2W18A 4JSNC 3EQ7A 4AOWA 4M3UA 1Q9XA 1C9LA 2RCUA 1MMOG 1A0RB 3LD8A 4E5ZB 5TEFA 4RE5A 3OGLB 5IZ7A 4A0AA 4FJ5A 1XU3E 4X5MA 1TYQC 2GC4A 3EI2A 3RRMC 4H5JA 4M41A 2JHCA 2CE8A 2HKMA 4LGNA 4L3GD 5EALA 5HQGA 1UOQA 5CXCB 1XIPA 4QRJA 4AKIA 4J86A 3QEXA 3QI0A 3SVIA 2HU8A 2OYQA 1UOOA 1PGUA 3I7HA 5FKSA 2J55H 4GQBB 4PC0A 2HYEA 5IJ7E 4QQEA 5H1MA 3PVUB 3IURA 3I7LA 4UM9A 2HKRA 4KHQA 3AFCA 2JQTA 4G1MA 2VZ1A 2VDOA 4A08A 1QFSA 2P1MB 5GXHA 1XVFE 3ODTA 1H2YA 3JROA 3CFVA 2IWKA 4MMXA 1WAJA 4FJXA 1QFMA 3B7FA 4Y7RA 2VDNA 2J56H 1XMHE 2MZWB 4CZVA 2H13A 2YNPA 4AN1A 3CIKB 4FHLA 1JMXB 2P9PC 4BCBA 4CC9A 4QT8A 1T2XA 3OKWA 4EPHA 5H14A 3IJ1A 3L2OB 2QC5A 4FVMA 3RN0D 4QNCA 2P1QB 2P9NC 2Z2PA 1FZ2E 3OL2A 4A11B 5FKQA 4KHYA 1N6FA 2OIZA 3ZE0A 5K1CC 3T3MA 4J73A 3KD1E 5CXBB 1U8CA 4J79A 2JHAA 4TZ4A 2B5NA 3UR4A 4M45A 2B4EA 1H2ZA 2I0SA 2Z2OA 4J87A 4RNGA 2EBSA 2JHPA 2VDMA 4JHNA 5EM2A 2HJBA 2H9MA 3F3GA 2OVRB 3MXXA 5C86A 2P5OA 4A08B 4UI9R 5FA5B 4ICGC 5EAMA 4GZ8A 4DU1A 2H6QA 2YNNA 1OLZA 2VJ4A 5AFU3 3EQ8A 3SMRA 4ZOZA 4AI6A 1B9YA 3QEPA 4KHWA 3MUOA 3NVNA 1XU5E 1XVEE 3S9HA 2PM6B 3LDSA 3C5MA 3UO3A 5I5IA 1N6DA 2H3XA 4ZOYA 2BKLA 5CYKA 3IUJA 5JWZA 1JTDB 5EMKB 4XYIA 3V9FA 1N1CA 3NGIA 3EI4A 2H9LA 4ADOA 3VH0A 4X3EA 2OZSA 1TYEA 2EIEA 4FA4D 2PM9B 3OTTA 4QL1A 4H5IA 4FWWA 3RWUA 5EM2B 1JMZB 4M3TA 4I9QA 3I89A 4D6VA 2JH9A 1XVBE 4CY5A 3RMAA 1JJUB 3KRXB 2CNXA 3OKYB 5E6SA 1FZ6E 4M42A 5M5TA 3K71A 3C6NB 3RFGA 3A0FA 5HE2B 1U4CA 4AN0A 2JKXA 4E54A 3V4PA 4GMBA 4DTSA 5EMJB 3PSLA 3CFOA 2CN3A 3E4YA 4DTMA 3OGKB 4EYWA 3GFCA 3L8BA 5I5MA 3N0DA 4YVDA 3SBRA 1I2MB 2AGZA 4GM9A 5H17A 3UKRC 4BCDA 3SQ4A 4WK2A 5FKTA 4O2WA 4AEZA 4EWRA 5M5UA 3FCSA 5TEEA 3ZDXA 3NVXA 5C92A 4G1EA 5GXIA 4N14A 2EIDA 4WK4A 2P9LC 3LZJA 2OVPB 5FQDA 4FA5D 3EI4B 4QNDA 4KHSA 3EI3B 1Q9YA 4CY3A 5KDOB 1O6FA 2E32A 4J84A 1B9XA 3SBQA 3NCIA 1VE7A 3L1NA 2YB5A 1XVCE 3GREA 2P9IC 3FCUA 3I7OA 3RN1D 3DXMC 3QNNA 3HGLA 3ZE2A 4M3RA 3BVOA 3O4JA 5FKRA 4U1EI 3SPYA 5FXYA 5K19A 4CY1A 1FZHE 5IREA 1UTCA 1XVDE 3HP9A 4FJIA 5FLXg 3EI1B 3JB9L 2IAAA 4J78A 1FZ3E 3TAGA 4PXWA 1TBGA 2HU7A 3F3PA 3V7DB 4GQ1A 4J2BA 4FJKA 1QNIA 5HE0B 2O9KA 3NAEA 4J2AA 3N1BA 4NENA 4HDJA 2YBAA 3EG6A 3C9CA 3L4MD 4K3ID 4NC4A 4DU4A 3NIFA 4AX4A 3SUOA 4D9SA 2J57G 3PXWD 1FPOA 4FA9D 2EIBA 4A2LA 5IBKB 2AGWA 2CO0C 4KI6A 3AH8B 3OKTA 4IT5A 2VDLA 4PSWB 2MMBA 1L5GA 4KHNA 1U2VC 3UVOA 3PXSD 2PFVA 2H4TA 3DDUA 2XU7A 3TAFA 4O9DA 4J2EA 4A09B 3CFRA 1C9IA 4GAMC 4DTOA 3IJ0A 3MMYA 4CI1A 2PFTA 3AL9A 4JRQA 3SCXA 3K2OA 2H9NA 3IUQA 2G9AA 2PBIB 4MMZA 1LDKE 3J2PA 2P5GA 3DSMA 4MMYA 3KCIA 1E8NA 4A0AB 1K3IA 2QXVA 3QETA 3O4HA 4O1QD 3EI2B 2UZXB 4CY2A 3RLMD 3NHGA 2OJYA 5M5RA 3IVMA 1GG2B 3MVDK 4JSVC 2AGYA 1FS1A 1PBYB 3WSOA 4U7AA 3RFHA 1FZ0E 2RKHA 4DTJA 4PBYA 3UVKA 3MZKA 3U4YA 3K72A 4CI8A 3RSEC 4D0KA 3SUPA 3P4FA 3QERA 2DEBA 4J2DA 1FXXA 2IUVA 4R7AB 5M5VA 2HJ4A 4AMYA 3SQ0A 2P1OB 2VC2A 4RE6A 3FGBA 4JXMA 3UO2A 2IUQA 5TF2A 4FAVD 1H2WA 5IGQA 3I2NA 1GOTB 4Z7NA 4DTXA 3O4IA 3KD5E 3PE7A 4RG8A 4DTRA 3HFQA 1PEVA 4G56B 3OL2B 1VZ2A 4Y5RD 4HCBA 3I8EA 4KFMB 4FJ9A 5A2Qg 4KI4A 2P9UC 2VIXA 4K3JB 1GP2B 3MUNA 2I3TA 1XHMA 1FYZE 3PSCB 3SLED 4A0BA 2VJ5A 3SJLD 4J0WA 2AQ5A 2LF3A 4CI3A 1MHYG 3C95A 4IRZA 1Q47A 4M3YA 1A12A 1O6GA 3C6PB 2HD0A 4M3ZA 2XZGA 3IULA 2Z2NA 5EARA 4BL0A 5GSAA 2P1NB 3I7KA 4JSPC 2E31A 3K27A 2QXFA 2B5LA 3NE6A 3JAMg 3SBPA 4I9LA 4FJ7A 1FWXA 1N6EA 3BWSA 2H68A 3C94A 4XYHA 3NVQA 3SVWD 4WJKA 3C99A 3SFZA 1ERJA 5HDBA 4PSXB 3AL8A 2UZYB 2ATQA 3N0EA 1XKSA 2XYIA 5C9ZB 2VDQA 2P1PB 4X60B 4UM8A 2OVQB 1FZ5E 3VGZA 3L0MA 2BBKH 3RMCA 5CYKB 2GC7A 2HU5A 1XL3C 1L0QA 2VDPA 3T3PA 2FW3A 1NEXB 2CO0A 4PBZA 4J8GA 3SUNA 4DTPA 1BPOA 5TDHB 2XE4A 4NAAA 3QESA 3K6SA 1CLQA 4O02A 1FZIE 4DNUA 4E5ZA 1GOHA 3ZE1A 1MG3A 2VDRA 3ZDZA 5H37A 5GMKn 3J80g 3HGKE 2DY4A 2I3SA 4WK0A 3RMZD 4IA9A 3SHFA 3MKSB 4FJHA 3QEWA 1GXRA 3QEVA 1K8KC 4E54B 3DM0A 3ORVD 2DTUA 4GQ2P 3CFPA 4GGDA 3BG1A 2AGXA 5C2VB 5HYNB 1SHYB 4JT5C 5B4WA 1MTYG 2IUPA 1JOFA 2PM7B 3SCYA 3EQ9A 4GGCA 1FZ7E 4CZXA 1GOFA 4L1MA 1H2XA 1JW2A 4ADNA 3JZHA 3IUMA 5FFOA 4FJGA 1YR2A 5M5SA 2K5SA 4JS5A 3IIYA 4GGAA 5SXMA 4X63B 4ZOVA 4JT6C 1FZ9E 4FAND 4NSXA 1JV2A 3GD1I 5EMLB 3MKQA 4DNVA 1K32A 1PI6A 4ERYA 3CQ8A 3V4VA 4A11A 2I0TA 2B8IA 3TL8B 3LZIA 4BP9A 3TJYA 1RI6A 3DXKC 2EICA 3FM0A 4ZOXA 2B1EA 4J77A 5CXBA 5HE3B 5IC7A 4FK2A 1XMFE 4X61B 3SXTD 3E4WA 3VA6A 4I6JB 3SWSD 4E3SA 1E5TA 1YFQA 3F3FA 3QHYB 2H6KA 2P9KC 3UVMA 4GM8A 4AKHA 5IGOA 3SJJA 1IH7A 2AGLA 4JD2C 3I8CA 1WAFA 3SUQA 1UOPA 4OZUA 4RL5A 1MG2A 2CE9A 2QR5A 5FFGA 3C75H 4KHUA 1VE6A 4DTUA 1GOGA 2HESX 4FK4A 3I7NA 2B5MA 2IURA 2OK4A 4ES0A 4JRPA 4EP9A 4ERQA 5AMSA 5IT9g 3JZGA 2I0RA 2H9PA 3NIGA 4PNKB 3IJEA 4OWRA 2CN2A 1XMGE
chains in the Genus database with same CATH topology
3OGMB 2P9SC 3EWEA 1R5MA 1XVGE 4ESGA 3ZWLB 4M3XA 3IIWA 4I79A 3K26A 4JSXC 2OK6A 3OW8A 2PM9A 4FJMA 4J81A 4CZYA 3EU7A 3PVWB 1FZ4E 3UIQA 3LDBA 4FJNA 3UKUC 3OKYA 4ERZA 3TABA 1MDAH 2H47A 1VYHC 4HCCA 5EAPA 1SQJA 4XEIC 3V5WB 3SQ1A 2HXCA 3EMHA 3C6OB 3IJCA 2G99A 3E0CA 3SN6B 5AJAA 5IJ8E 1P22A 3CFSB 3SNNA 2Q7QA 3JRPA 4CI2A 3JZNA 4GM3A 3J27A 1SQ9A 2AH0A 4FJLA 4BUJC 4LG8A 5C2WB 4O3TB 4FK0A 3IKOA 4B08A 3NDKA 3TAEA 4FJ8A 4L1QD 2MTAH 1FZ1E 4J8BA 4ZN4A 3QEIA 3EI3A 3I7PA 2FYOA 3JPXA 2YNOA 4BH6A 2TRCB 3KRWB 2XL2A 1MHZG 3RMDA 3MZLA 4O45A 2BCJB 3SI6A 3SPZA 1IG9A 2JPNA 4L9OA 3UVLA 3UVNA 5THAA 4FJJA 1S4UX 2YMUA 2IWFA 2XL3A 3W15A 4A2MA 4A0BB 3BG0A 4FB1D 3EI1A 3PXTD 5I5JA 2OZMA 4E4BA 4L3HD 4M3WA 5EMMB 3L4OD 4Z8LA 4O3UB 4J82A 5CXCA 3ULEC 3N1EA 4DTNA 1OMWB 2B7MA 3SQ2A 4MK0B 1NR0A 2GNQA 3QNOA 4A7JA 4FA1D 2AH1A 4JS4A 2YB8B 2H6NA 4LG9A 3AL8B 3RMBA 1FZ8E 2H14A 4J0XA 4X5NA 2LF6A 3HL8A 4DU3A 4IMMA 5HE1B 4A09A 4AKGA 3J81g 3DWLC 4JSNC 3FRXA 2JH8A 2W18A 4AOWA 4M3UA 1Q9XA 2RCUA 1MMOG 1A0RB 3LD8A 4E5ZB 5TEFA 3OGLB 5IZ7A 4A0AA 4FJ5A 1XU3E 4X5MA 1TYQC 2GC4A 3EI2A 3RRMC 4H5JA 4M41A 2JHCA 2CE8A 2HKMA 4LGNA 4L3GD 5EALA 5HQGA 5CXCB 1XIPA 4QRJA 4AKIA 4J86A 3QEXA 3SVIA 2OYQA 1PGUA 3I7HA 5FKSA 2J55H 4GQBB 4PC0A 2HYEA 5IJ7E 4QQEA 5H1MA 3PVUB 3I7LA 2HKRA 4KHQA 3AFCA 4A08A 2P1MB 5GXHA 1XVFE 3ODTA 3JROA 3CFVA 2IWKA 1WAJA 4FJXA 3B7FA 4Y7RA 2J56H 1XMHE 2MZWB 4CZVA 2H13A 2YNPA 3CIKB 4FHLA 1JMXB 2P9PC 4CC9A 4QT8A 3OKWA 4EPHA 5H14A 3IJ1A 3L2OB 2QC5A 4FVMA 3RN0D 4QNCA 2P1QB 2P9NC 2Z2PA 1FZ2E 3OL2A 4A11B 5FKQA 4KHYA 1N6FA 2OIZA 5K1CC 4J73A 3KD1E 5CXBB 4J79A 2JHAA 4TZ4A 2B5NA 3UR4A 4M45A 2B4EA 2I0SA 2Z2OA 4J87A 4RNGA 2EBSA 2JHPA 5EM2A 2HJBA 2H9MA 3F3GA 2OVRB 3MXXA 2P5OA 4A08B 4UI9R 5FA5B 5EAMA 4GZ8A 4DU1A 2H6QA 2YNNA 1OLZA 2VJ4A 5AFU3 3SMRA 4ZOZA 4AI6A 1B9YA 3QEPA 4KHWA 3NVNA 1XU5E 1XVEE 3S9HA 2PM6B 3LDSA 3C5MA 5I5IA 1N6DA 2H3XA 4ZOYA 5CYKA 5JWZA 5EMKB 4XYIA 3V9FA 3NGIA 3EI4A 2H9LA 4ADOA 3VH0A 4X3EA 2OZSA 4FA4D 2PM9B 3OTTA 4QL1A 4H5IA 4FWWA 3RWUA 5EM2B 1JMZB 4M3TA 4I9QA 3I89A 4D6VA 2JH9A 1XVBE 4CY5A 3RMAA 1JJUB 3KRXB 2CNXA 3OKYB 1FZ6E 4M42A 3C6NB 3RFGA 3A0FA 5HE2B 1U4CA 4E54A 4GMBA 4DTSA 5EMJB 3PSLA 3CFOA 2CN3A 3E4YA 4DTMA 3OGKB 4EYWA 3GFCA 3L8BA 5I5MA 3N0DA 4YVDA 3SBRA 2AGZA 4GM9A 5H17A 3UKRC 3SQ4A 5FKTA 4AEZA 4EWRA 5TEEA 3NVXA 5GXIA 4N14A 2P9LC 3LZJA 2OVPB 5FQDA 4FA5D 3EI4B 4QNDA 4KHSA 3EI3B 1Q9YA 4CY3A 5KDOB 2E32A 4J84A 1B9XA 3SBQA 3NCIA 3L1NA 2YB5A 1XVCE 3GREA 2P9IC 3I7OA 3RN1D 3DXMC 3QNNA 3HGLA 4M3RA 5FKRA 4U1EI 3SPYA 5FXYA 5K19A 4CY1A 1FZHE 5IREA 5FLXg 1XVDE 3HP9A 4FJIA 3EI1B 3JB9L 2IAAA 4J78A 1FZ3E 3TAGA 4PXWA 1TBGA 3F3PA 3V7DB 4GQ1A 4J2BA 4FJKA 1QNIA 5HE0B 2O9KA 3NAEA 4J2AA 3N1BA 4HDJA 2YBAA 3EG6A 3C9CA 3L4MD 4K3ID 4DU4A 3SUOA 2J57G 3PXWD 4FA9D 4A2LA 5IBKB 2AGWA 2CO0C 4KI6A 3AH8B 3OKTA 4PSWB 2MMBA 1U2VC 4KHNA 3UVOA 3PXSD 2PFVA 2H4TA 2XU7A 3TAFA 4O9DA 4J2EA 4A09B 3CFRA 4GAMC 4DTOA 3IJ0A 3MMYA 4CI1A 2PFTA 3AL9A 4JRQA 3SCXA 3K2OA 2H9NA 2G9AA 2PBIB 1LDKE 3J2PA 2P5GA 3DSMA 4A0AB 2QXVA 3QETA 4O1QD 3EI2B 2UZXB 4CY2A 3RLMD 3NHGA 2OJYA 1GG2B 4JSVC 2AGYA 1FS1A 1PBYB 3WSOA 4U7AA 3RFHA 1FZ0E 4DTJA 4PBYA 3UVKA 3MZKA 3U4YA 4CI8A 3RSEC 4D0KA 3SUPA 3P4FA 3QERA 2DEBA 4J2DA 1FXXA 2IUVA 4R7AB 2HJ4A 3SQ0A 2P1OB 3FGBA 4JXMA 2IUQA 5TF2A 4FAVD 5IGQA 3I2NA 1GOTB 4DTXA 3KD5E 3PE7A 4RG8A 4DTRA 3HFQA 1PEVA 4G56B 3OL2B 4Y5RD 4HCBA 3I8EA 4KFMB 4FJ9A 5A2Qg 4KI4A 2P9UC 2VIXA 4K3JB 1GP2B 2I3TA 1XHMA 1FYZE 3PSCB 3SLED 4A0BA 2VJ5A 3SJLD 4J0WA 2AQ5A 2LF3A 4CI3A 1MHYG 3C95A 1Q47A 4M3YA 2HD0A 3C6PB 5EARA 4M3ZA 4BL0A 5GSAA 2Z2NA 2P1NB 3I7KA 4JSPC 2E31A 3K27A 2QXFA 2B5LA 3NE6A 3JAMg 3SBPA 4I9LA 4FJ7A 1FWXA 1N6EA 3BWSA 2H68A 3C94A 4XYHA 3NVQA 3SVWD 3C99A 3SFZA 1ERJA 4PSXB 3AL8A 2UZYB 2ATQA 3N0EA 1XKSA 2XYIA 5C9ZB 4X60B 2P1PB 2OVQB 1FZ5E 3VGZA 3L0MA 2BBKH 3RMCA 5CYKB 2GC7A 1XL3C 1L0QA 2FW3A 1NEXB 2CO0A 4PBZA 4J8GA 3SUNA 4DTPA 5TDHB 3QESA 1CLQA 4E5ZA 1FZIE 1MG3A 5H37A 5GMKn 3J80g 3HGKE 2DY4A 2I3SA 3RMZD 4IA9A 3SHFA 3MKSB 4FJHA 3QEWA 1GXRA 3QEVA 1K8KC 4E54B 3DM0A 3ORVD 2DTUA 4GQ2P 3CFPA 4GGDA 3BG1A 2AGXA 5C2VB 5HYNB 1SHYB 4JT5C 5B4WA 1MTYG 2IUPA 1JOFA 2PM7B 3SCYA 4GGCA 1FZ7E 4CZXA 3JZHA 4ADNA 4FJGA 4JS5A 4GGAA 3IIYA 5SXMA 4FAND 4X63B 4ZOVA 4JT6C 1FZ9E 4NSXA 5EMLB 3MKQA 1K32A 1PI6A 4ERYA 3CQ8A 4A11A 2I0TA 2B8IA 3TL8B 3LZIA 3TJYA 1RI6A 3DXKC 4ZOXA 3FM0A 2B1EA 4J77A 5CXBA 5HE3B 5IC7A 4FK2A 1XMFE 4X61B 3SXTD 3E4WA 3VA6A 4I6JB 3SWSD 4E3SA 1YFQA 3F3FA 2H6KA 2P9KC 3UVMA 4GM8A 4AKHA 5IGOA 3SJJA 1IH7A 2AGLA 4JD2C 3I8CA 1WAFA 3SUQA 4OZUA 4RL5A 1MG2A 2CE9A 3C75H 4KHUA 4DTUA 2HESX 4FK4A 3I7NA 2B5MA 2IURA 2OK4A 4ES0A 4JRPA 4EP9A 4ERQA 5AMSA 5IT9g 3JZGA 2I0RA 2H9PA 4PNKB 4OWRA 2CN2A 1XMGE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OGM B;  2P9S C;  3EWE A;  1R5M A;  4ESG A;  3ZWL B;  3IIW A;  4I79 A;  3K26 A;  4JSX C;  2OK6 A;  3OW8 A;  2PM9 A;  4J81 A;  4CZY A;  3EU7 A;  3PVW B;  3UKU C;  3OKY A;  4ERZ A;  1MDA H;  2H47 A;  1VYH C;  5EAP A;  1SQJ A;  4XEI C;  3V5W B;  2HXC A;  3EMH A;  3C6O B;  3IJC A;  2G99 A;  3E0C A;  3SN6 B;  5AJA A;  5IJ8 E;  1P22 A;  3CFS B;  2Q7Q A;  3JRP A;  4CI2 A;  3JZN A;  4GM3 A;  1SQ9 A;  2AH0 A;  4BUJ C;  4LG8 A;  5C2W B;  4O3T B;  3IKO A;  4L1Q D;  2MTA H;  4J8B A;  4ZN4 A;  3EI3 A;  3I7P A;  3JPX A;  2YNO A;  4BH6 A;  2TRC B;  3KRW B;  2XL2 A;  3MZL A;  4O45 A;  2BCJ B;  4L9O A;  3UVL A;  3UVN A;  5THA A;  2YMU A;  1S4U X;  3W15 A;  2IWF A;  2XL3 A;  4A2M A;  4A0B B;  3BG0 A;  4FB1 D;  3EI1 A;  3PXT D;  5I5J A;  4L3H D;  5EMM B;  3L4O D;  4Z8L A;  4O3U B;  4J82 A;  5CXC A;  3ULE C;  1OMW B;  4MK0 B;  1NR0 A;  2GNQ A;  4A7J A;  4FA1 D;  2AH1 A;  2YB8 B;  2H6N A;  4LG9 A;  3AL8 B;  2H14 A;  4J0X A;  4IMM A;  5HE1 B;  4A09 A;  3J81 g;  3DWL C;  4JSN C;  3FRX A;  2W18 A;  4AOW A;  1A0R B;  4E5Z B;  5TEF A;  3OGL B;  4A0A A;  1TYQ C;  2GC4 A;  3EI2 A;  3RRM C;  4H5J A;  4LGN A;  2CE8 A;  2HKM A;  5EAL A;  5HQG A;  4L3G D;  5CXC B;  1XIP A;  4QRJ A;  4J86 A;  1PGU A;  3I7H A;  5FKS A;  2J55 H;  4GQB B;  4PC0 A;  2HYE A;  5IJ7 E;  4QQE A;  5H1M A;  3PVU B;  3I7L A;  2HKR A;  3AFC A;  4A08 A;  2P1M B;  5GXH A;  3ODT A;  3JRO A;  3CFV A;  2IWK A;  3B7F A;  4Y7R A;  2J56 H;  4CZV A;  2H13 A;  2YNP A;  3CIK B;  4FHL A;  1JMX B;  2P9P C;  4CC9 A;  4QT8 A;  3OKW A;  5H14 A;  3IJ1 A;  3L2O B;  2QC5 A;  3RN0 D;  2P1Q B;  2P9N C;  2Z2P A;  3OL2 A;  4A11 B;  5FKQ A;  1N6F A;  2OIZ A;  5K1C C;  4J73 A;  5CXB B;  4J79 A;  4TZ4 A;  2B5N A;  3UR4 A;  2B4E A;  2I0S A;  2Z2O A;  4J87 A;  2EBS A;  5EM2 A;  2HJB A;  2H9M A;  3F3G A;  2OVR B;  3MXX A;  4A08 B;  4UI9 R;  5FA5 B;  5EAM A;  4GZ8 A;  5AFU 3;  2H6Q A;  1OLZ A;  3SMR A;  4ZOZ A;  1B9Y A;  3NVN A;  2PM6 B;  3C5M A;  5I5I A;  1N6D A;  2H3X A;  4ZOY A;  5CYK A;  5JWZ A;  5EMK B;  4XYI A;  3V9F A;  3EI4 A;  2H9L A;  3VH0 A;  4X3E A;  4FA4 D;  2PM9 B;  3OTT A;  4QL1 A;  4H5I A;  4FWW A;  5EM2 B;  1JMZ B;  3I89 A;  4D6V A;  4CY5 A;  3OKY B;  1JJU B;  3KRX B;  2CNX A;  3C6N B;  3RFG A;  3A0F A;  5HE2 B;  1U4C A;  4E54 A;  4GMB A;  5EMJ B;  3PSL A;  2CN3 A;  3OGK B;  3GFC A;  5I5M A;  3N0D A;  4YVD A;  3SBR A;  2AGZ A;  4GM9 A;  5H17 A;  3UKR C;  5FKT A;  4AEZ A;  4EWR A;  5TEE A;  3NVX A;  5GXI A;  4N14 A;  2P9L C;  2OVP B;  5FQD A;  4FA5 D;  3EI4 B;  3EI3 B;  4CY3 A;  5KDO B;  2E32 A;  4J84 A;  1B9X A;  3SBQ A;  3GRE A;  2P9I C;  3I7O A;  3RN1 D;  3DXM C;  5FKR A;  4U1E I;  5FXY A;  5K19 A;  4CY1 A;  3EI1 B;  5FLX g;  3JB9 L;  2IAA A;  4J78 A;  4PXW A;  1TBG A;  3F3P A;  3V7D B;  4GQ1 A;  1QNI A;  5HE0 B;  2O9K A;  4HDJ A;  2YBA A;  3EG6 A;  3C9C A;  3L4M D;  4K3I D;  2J57 G;  3PXW D;  4FA9 D;  4A2L A;  5IBK B;  2AGW A;  2CO0 C;  3AH8 B;  3OKT A;  4PSW B;  1U2V C;  3UVO A;  3PXS D;  2XU7 A;  4O9D A;  4A09 B;  3IJ0 A;  3MMY A;  4CI1 A;  3AL9 A;  2H9N A;  2G9A A;  2PBI B;  1LDK E;  3DSM A;  4A0A B;  2QXV A;  4O1Q D;  3EI2 B;  2UZX B;  4CY2 A;  3RLM D;  2OJY A;  1GG2 B;  2CN2 A;  4JSV C;  2AGY A;  1FS1 A;  1PBY B;  3WSO A;  4U7A A;  3RFH A;  4PBY A;  3UVK A;  3MZK A;  3U4Y A;  4CI8 A;  3RSE C;  4D0K A;  3P4F A;  2IUV A;  4R7A B;  2HJ4 A;  2P1O B;  3FGB A;  4JXM A;  2IUQ A;  5TF2 A;  4FAV D;  5IGQ A;  3I2N A;  1GOT B;  3PE7 A;  1PEV A;  4G56 B;  3OL2 B;  4Y5R D;  3I8E A;  4KFM B;  5A2Q g;  2P9U C;  4K3J B;  1GP2 B;  2I3T A;  1XHM A;  3SLE D;  3PSC B;  4A0B A;  3SJL D;  4J0W A;  2AQ5 A;  4CI3 A;  1Q47 A;  4BL0 A;  3C6P B;  5EAR A;  5GSA A;  2Z2N A;  2P1N B;  3I7K A;  4JSP C;  2E31 A;  3K27 A;  2B5L A;  3JAM g;  3SBP A;  1FWX A;  1N6E A;  3BWS A;  2H68 A;  4XYH A;  3NVQ A;  3SVW D;  3C99 A;  3SFZ A;  1ERJ A;  4PSX B;  3AL8 A;  2UZY B;  3N0E A;  1XKS A;  2XYI A;  5C9Z B;  4X60 B;  2P1P B;  2OVQ B;  3VGZ A;  2BBK H;  5CYK B;  2GC7 A;  1L0Q A;  1NEX B;  2CO0 A;  4PBZ A;  4J8G A;  5TDH B;  4E5Z A;  1MG3 A;  5GMK n;  3J80 g;  2I3S A;  3RMZ D;  4IA9 A;  3SHF A;  3MKS B;  1GXR A;  1K8K C;  4E54 B;  3DM0 A;  3ORV D;  4GQ2 P;  4GGD A;  3BG1 A;  2AGX A;  5C2V B;  5HYN B;  1SHY B;  4JT5 C;  5B4W A;  2IUP A;  1JOF A;  2PM7 B;  3SCY A;  4GGC A;  4CZX A;  3JZH A;  4GGA A;  3IIY A;  5SXM A;  4FAN D;  4X63 B;  4ZOV A;  4JT6 C;  4NSX A;  5EML B;  3MKQ A;  1K32 A;  1PI6 A;  4ERY A;  4A11 A;  2I0T A;  3DXK C;  1RI6 A;  4ZOX A;  3FM0 A;  4J77 A;  5CXB A;  5HE3 B;  5IC7 A;  4X61 B;  3SXT D;  3VA6 A;  4I6J B;  3SWS D;  1YFQ A;  3F3F A;  2H6K A;  2P9K C;  3UVM A;  4GM8 A;  5IGO A;  2AGL A;  4JD2 C;  3I8C A;  4OZU A;  1MG2 A;  2CE9 A;  3C75 H;  2HES X;  3I7N A;  2B5M A;  2IUR A;  2OK4 A;  4ES0 A;  4ERQ A;  5AMS A;  5IT9 g;  3JZG A;  2I0R A;  2H9P A;  4PNK B;  4OWR A;  2YNN A;  3HFQ A; 
#chains in the Genus database with same CATH topology
 2MW2 A;  3OGM B;  2P9S C;  3EWE A;  1R5M A;  1XVG E;  3NID A;  3VI3 A;  4ESG A;  3ZWL B;  4M3X A;  3IIW A;  4I79 A;  3K26 A;  4JSX C;  2OK6 A;  3OW8 A;  2PM9 A;  4FJM A;  4J81 A;  5M61 A;  4CZY A;  3OF7 A;  5E6R A;  3EU7 A;  3PVW B;  1FZ4 E;  4Z7O A;  3UIQ A;  4NBM A;  3LDB A;  4FJN A;  2WQ8 A;  3UKU C;  3OKY A;  4ERZ A;  3TAB A;  1MDA H;  2H47 A;  4BCC A;  1VYH C;  4HCC A;  5EAP A;  1SQJ A;  4XEI C;  3V5W B;  3SQ1 A;  2HXC A;  3EMH A;  3C6O B;  3IJC A;  2G99 A;  3E0C A;  3IUN A;  3SN6 B;  5AJA A;  1VZ3 A;  5IJ8 E;  1P22 A;  3CFS B;  3SNN A;  3VI4 A;  2Q7Q A;  3JRP A;  4QAM A;  4CI2 A;  3JZN A;  4GM3 A;  3J27 A;  1SQ9 A;  2AH0 A;  4FJL A;  4BUJ C;  4LG8 A;  4JHP C;  5C2W B;  4O3T B;  4FK0 A;  3IKO A;  4B08 A;  2XDW A;  3NDK A;  3TAE A;  4FJ8 A;  4L1Q D;  2MTA H;  1FZ1 E;  4J8B A;  4ZN4 A;  3QEI A;  3EI3 A;  3I7P A;  2FYO A;  3JPX A;  2YNO A;  2QZP A;  4BH6 A;  2TRC B;  3KRW B;  4BP8 A;  2XL2 A;  1MHZ G;  3RMD A;  3MZL A;  2VDK A;  4O45 A;  2BCJ B;  3SI6 A;  3SPZ A;  3GC3 B;  1IG9 A;  2JPN A;  4L9O A;  3UVL A;  3UVN A;  5THA A;  4FJJ A;  1S4U X;  2YMU A;  2IWF A;  2XL3 A;  3W15 A;  4A2M A;  4A0B B;  3BG0 A;  4FB1 D;  3EI1 A;  3PXT D;  5I5J A;  2OZM A;  4E4B A;  4L3H D;  3O4G A;  4M3W A;  4G55 A;  5EMM B;  3L4O D;  4Z8L A;  5E6U A;  4O3U B;  4J82 A;  5CXC A;  2VZ3 A;  3ULE C;  4DNW A;  3N1E A;  4DTN A;  1OMW B;  2B7M A;  3SQ2 A;  1E8M A;  4MK0 B;  1NR0 A;  2GNQ A;  3QNO A;  4A7J A;  4FA1 D;  2AH1 A;  4JS4 A;  2YB8 B;  2H6N A;  4AMZ A;  4LG9 A;  3AL8 B;  3RMB A;  1FZ8 E;  2H14 A;  4J0X A;  4X5N A;  2LF6 A;  3HL8 A;  4DU3 A;  4Z7Q A;  4IMM A;  5HE1 B;  3ZDY A;  4A09 A;  4AKG A;  3J81 g;  3DWL C;  1M1X A;  3FRX A;  2JH8 A;  2W18 A;  4JSN C;  3EQ7 A;  4AOW A;  4M3U A;  1Q9X A;  1C9L A;  2RCU A;  1MMO G;  1A0R B;  3LD8 A;  4E5Z B;  5TEF A;  4RE5 A;  3OGL B;  5IZ7 A;  4A0A A;  4FJ5 A;  1XU3 E;  4X5M A;  1TYQ C;  2GC4 A;  3EI2 A;  3RRM C;  4H5J A;  4M41 A;  2JHC A;  2CE8 A;  2HKM A;  4LGN A;  4L3G D;  5EAL A;  5HQG A;  1UOQ A;  5CXC B;  1XIP A;  4QRJ A;  4AKI A;  4J86 A;  3QEX A;  3QI0 A;  3SVI A;  2HU8 A;  2OYQ A;  1UOO A;  1PGU A;  3I7H A;  5FKS A;  2J55 H;  4GQB B;  4PC0 A;  2HYE A;  5IJ7 E;  4QQE A;  5H1M A;  3PVU B;  3IUR A;  3I7L A;  4UM9 A;  2HKR A;  4KHQ A;  3AFC A;  2JQT A;  4G1M A;  2VZ1 A;  2VDO A;  4A08 A;  1QFS A;  2P1M B;  5GXH A;  1XVF E;  3ODT A;  1H2Y A;  3JRO A;  3CFV A;  2IWK A;  4MMX A;  1WAJ A;  4FJX A;  1QFM A;  3B7F A;  4Y7R A;  2VDN A;  2J56 H;  1XMH E;  2MZW B;  4CZV A;  2H13 A;  2YNP A;  4AN1 A;  3CIK B;  4FHL A;  1JMX B;  2P9P C;  4BCB A;  4CC9 A;  4QT8 A;  1T2X A;  3OKW A;  4EPH A;  5H14 A;  3IJ1 A;  3L2O B;  2QC5 A;  4FVM A;  3RN0 D;  4QNC A;  2P1Q B;  2P9N C;  2Z2P A;  1FZ2 E;  3OL2 A;  4A11 B;  5FKQ A;  4KHY A;  1N6F A;  2OIZ A;  3ZE0 A;  5K1C C;  3T3M A;  4J73 A;  3KD1 E;  5CXB B;  1U8C A;  4J79 A;  2JHA A;  4TZ4 A;  2B5N A;  3UR4 A;  4M45 A;  2B4E A;  1H2Z A;  2I0S A;  2Z2O A;  4J87 A;  4RNG A;  2EBS A;  2JHP A;  2VDM A;  4JHN A;  5EM2 A;  2HJB A;  2H9M A;  3F3G A;  2OVR B;  3MXX A;  5C86 A;  2P5O A;  4A08 B;  4UI9 R;  5FA5 B;  4ICG C;  5EAM A;  4GZ8 A;  4DU1 A;  2H6Q A;  2YNN A;  1OLZ A;  2VJ4 A;  5AFU 3;  3EQ8 A;  3SMR A;  4ZOZ A;  4AI6 A;  1B9Y A;  3QEP A;  4KHW A;  3MUO A;  3NVN A;  1XU5 E;  1XVE E;  3S9H A;  2PM6 B;  3LDS A;  3C5M A;  3UO3 A;  5I5I A;  1N6D A;  2H3X A;  4ZOY A;  2BKL A;  5CYK A;  3IUJ A;  5JWZ A;  1JTD B;  5EMK B;  4XYI A;  3V9F A;  1N1C A;  3NGI A;  3EI4 A;  2H9L A;  4ADO A;  3VH0 A;  4X3E A;  2OZS A;  1TYE A;  2EIE A;  4FA4 D;  2PM9 B;  3OTT A;  4QL1 A;  4H5I A;  4FWW A;  3RWU A;  5EM2 B;  1JMZ B;  4M3T A;  4I9Q A;  3I89 A;  4D6V A;  2JH9 A;  1XVB E;  4CY5 A;  3RMA A;  1JJU B;  3KRX B;  2CNX A;  3OKY B;  5E6S A;  1FZ6 E;  4M42 A;  5M5T A;  3K71 A;  3C6N B;  3RFG A;  3A0F A;  5HE2 B;  1U4C A;  4AN0 A;  2JKX A;  4E54 A;  3V4P A;  4GMB A;  4DTS A;  5EMJ B;  3PSL A;  3CFO A;  2CN3 A;  3E4Y A;  4DTM A;  3OGK B;  4EYW A;  3GFC A;  3L8B A;  5I5M A;  3N0D A;  4YVD A;  3SBR A;  1I2M B;  2AGZ A;  4GM9 A;  5H17 A;  3UKR C;  4BCD A;  3SQ4 A;  4WK2 A;  5FKT A;  4O2W A;  4AEZ A;  4EWR A;  5M5U A;  3FCS A;  5TEE A;  3ZDX A;  3NVX A;  5C92 A;  4G1E A;  5GXI A;  4N14 A;  2EID A;  4WK4 A;  2P9L C;  3LZJ A;  2OVP B;  5FQD A;  4FA5 D;  3EI4 B;  4QND A;  4KHS A;  3EI3 B;  1Q9Y A;  4CY3 A;  5KDO B;  1O6F A;  2E32 A;  4J84 A;  1B9X A;  3SBQ A;  3NCI A;  1VE7 A;  3L1N A;  2YB5 A;  1XVC E;  3GRE A;  2P9I C;  3FCU A;  3I7O A;  3RN1 D;  3DXM C;  3QNN A;  3HGL A;  3ZE2 A;  4M3R A;  3BVO A;  3O4J A;  5FKR A;  4U1E I;  3SPY A;  5FXY A;  5K19 A;  4CY1 A;  1FZH E;  5IRE A;  1UTC A;  1XVD E;  3HP9 A;  4FJI A;  5FLX g;  3EI1 B;  3JB9 L;  2IAA A;  4J78 A;  1FZ3 E;  3TAG A;  4PXW A;  1TBG A;  2HU7 A;  3F3P A;  3V7D B;  4GQ1 A;  4J2B A;  4FJK A;  1QNI A;  5HE0 B;  2O9K A;  3NAE A;  4J2A A;  3N1B A;  4NEN A;  4HDJ A;  2YBA A;  3EG6 A;  3C9C A;  3L4M D;  4K3I D;  4NC4 A;  4DU4 A;  3NIF A;  4AX4 A;  3SUO A;  4D9S A;  2J57 G;  3PXW D;  1FPO A;  4FA9 D;  2EIB A;  4A2L A;  5IBK B;  2AGW A;  2CO0 C;  4KI6 A;  3AH8 B;  3OKT A;  4IT5 A;  2VDL A;  4PSW B;  2MMB A;  1L5G A;  4KHN A;  1U2V C;  3UVO A;  3PXS D;  2PFV A;  2H4T A;  3DDU A;  2XU7 A;  3TAF A;  4O9D A;  4J2E A;  4A09 B;  3CFR A;  1C9I A;  4GAM C;  4DTO A;  3IJ0 A;  3MMY A;  4CI1 A;  2PFT A;  3AL9 A;  4JRQ A;  3SCX A;  3K2O A;  2H9N A;  3IUQ A;  2G9A A;  2PBI B;  4MMZ A;  1LDK E;  3J2P A;  2P5G A;  3DSM A;  4MMY A;  3KCI A;  1E8N A;  4A0A B;  1K3I A;  2QXV A;  3QET A;  3O4H A;  4O1Q D;  3EI2 B;  2UZX B;  4CY2 A;  3RLM D;  3NHG A;  2OJY A;  5M5R A;  3IVM A;  1GG2 B;  3MVD K;  4JSV C;  2AGY A;  1FS1 A;  1PBY B;  3WSO A;  4U7A A;  3RFH A;  1FZ0 E;  2RKH A;  4DTJ A;  4PBY A;  3UVK A;  3MZK A;  3U4Y A;  3K72 A;  4CI8 A;  3RSE C;  4D0K A;  3SUP A;  3P4F A;  3QER A;  2DEB A;  4J2D A;  1FXX A;  2IUV A;  4R7A B;  5M5V A;  2HJ4 A;  4AMY A;  3SQ0 A;  2P1O B;  2VC2 A;  4RE6 A;  3FGB A;  4JXM A;  3UO2 A;  2IUQ A;  5TF2 A;  4FAV D;  1H2W A;  5IGQ A;  3I2N A;  1GOT B;  4Z7N A;  4DTX A;  3O4I A;  3KD5 E;  3PE7 A;  4RG8 A;  4DTR A;  3HFQ A;  1PEV A;  4G56 B;  3OL2 B;  1VZ2 A;  4Y5R D;  4HCB A;  3I8E A;  4KFM B;  4FJ9 A;  5A2Q g;  4KI4 A;  2P9U C;  2VIX A;  4K3J B;  1GP2 B;  3MUN A;  2I3T A;  1XHM A;  1FYZ E;  3PSC B;  3SLE D;  4A0B A;  2VJ5 A;  3SJL D;  4J0W A;  2AQ5 A;  2LF3 A;  4CI3 A;  1MHY G;  3C95 A;  4IRZ A;  1Q47 A;  4M3Y A;  1A12 A;  1O6G A;  3C6P B;  2HD0 A;  4M3Z A;  2XZG A;  3IUL A;  2Z2N A;  5EAR A;  4BL0 A;  5GSA A;  2P1N B;  3I7K A;  4JSP C;  2E31 A;  3K27 A;  2QXF A;  2B5L A;  3NE6 A;  3JAM g;  3SBP A;  4I9L A;  4FJ7 A;  1FWX A;  1N6E A;  3BWS A;  2H68 A;  3C94 A;  4XYH A;  3NVQ A;  3SVW D;  4WJK A;  3C99 A;  3SFZ A;  1ERJ A;  5HDB A;  4PSX B;  3AL8 A;  2UZY B;  2ATQ A;  3N0E A;  1XKS A;  2XYI A;  5C9Z B;  2VDQ A;  2P1P B;  4X60 B;  4UM8 A;  2OVQ B;  1FZ5 E;  3VGZ A;  3L0M A;  2BBK H;  3RMC A;  5CYK B;  2GC7 A;  2HU5 A;  1XL3 C;  1L0Q A;  2VDP A;  3T3P A;  2FW3 A;  1NEX B;  2CO0 A;  4PBZ A;  4J8G A;  3SUN A;  4DTP A;  1BPO A;  5TDH B;  2XE4 A;  4NAA A;  3QES A;  3K6S A;  1CLQ A;  4O02 A;  1FZI E;  4DNU A;  4E5Z A;  1GOH A;  3ZE1 A;  1MG3 A;  2VDR A;  3ZDZ A;  5H37 A;  5GMK n;  3J80 g;  3HGK E;  2DY4 A;  2I3S A;  4WK0 A;  3RMZ D;  4IA9 A;  3SHF A;  3MKS B;  4FJH A;  3QEW A;  1GXR A;  3QEV A;  1K8K C;  4E54 B;  3DM0 A;  3ORV D;  2DTU A;  4GQ2 P;  3CFP A;  4GGD A;  3BG1 A;  2AGX A;  5C2V B;  5HYN B;  1SHY B;  4JT5 C;  5B4W A;  1MTY G;  2IUP A;  1JOF A;  2PM7 B;  3SCY A;  3EQ9 A;  4GGC A;  1FZ7 E;  4CZX A;  1GOF A;  4L1M A;  1H2X A;  1JW2 A;  4ADN A;  3JZH A;  3IUM A;  5FFO A;  4FJG A;  1YR2 A;  5M5S A;  2K5S A;  4JS5 A;  3IIY A;  4GGA A;  5SXM A;  4X63 B;  4ZOV A;  4JT6 C;  1FZ9 E;  4FAN D;  4NSX A;  1JV2 A;  3GD1 I;  5EML B;  3MKQ A;  4DNV A;  1K32 A;  1PI6 A;  4ERY A;  3CQ8 A;  3V4V A;  4A11 A;  2I0T A;  2B8I A;  3TL8 B;  3LZI A;  4BP9 A;  3TJY A;  1RI6 A;  3DXK C;  2EIC A;  3FM0 A;  4ZOX A;  2B1E A;  4J77 A;  5CXB A;  5HE3 B;  5IC7 A;  4FK2 A;  1XMF E;  4X61 B;  3SXT D;  3E4W A;  3VA6 A;  4I6J B;  3SWS D;  4E3S A;  1E5T A;  1YFQ A;  3F3F A;  3QHY B;  2H6K A;  2P9K C;  3UVM A;  4GM8 A;  4AKH A;  5IGO A;  3SJJ A;  1IH7 A;  2AGL A;  4JD2 C;  3I8C A;  1WAF A;  3SUQ A;  1UOP A;  4OZU A;  4RL5 A;  1MG2 A;  2CE9 A;  2QR5 A;  5FFG A;  3C75 H;  4KHU A;  1VE6 A;  4DTU A;  1GOG A;  2HES X;  4FK4 A;  3I7N A;  2B5M A;  2IUR A;  2OK4 A;  4ES0 A;  4JRP A;  4EP9 A;  4ERQ A;  5AMS A;  5IT9 g;  3JZG A;  2I0R A;  2H9P A;  3NIG A;  4PNK B;  3IJE A;  4OWR A;  2CN2 A;  1XMG E; 
#chains in the Genus database with same CATH homology
 3OGM B;  2P9S C;  3EWE A;  1R5M A;  1XVG E;  4ESG A;  3ZWL B;  4M3X A;  3IIW A;  4I79 A;  3K26 A;  4JSX C;  2OK6 A;  3OW8 A;  2PM9 A;  4FJM A;  4J81 A;  4CZY A;  3EU7 A;  3PVW B;  1FZ4 E;  3UIQ A;  3LDB A;  4FJN A;  3UKU C;  3OKY A;  4ERZ A;  3TAB A;  1MDA H;  2H47 A;  1VYH C;  4HCC A;  5EAP A;  1SQJ A;  4XEI C;  3V5W B;  3SQ1 A;  2HXC A;  3EMH A;  3C6O B;  3IJC A;  2G99 A;  3E0C A;  3SN6 B;  5AJA A;  5IJ8 E;  1P22 A;  3CFS B;  3SNN A;  2Q7Q A;  3JRP A;  4CI2 A;  3JZN A;  4GM3 A;  3J27 A;  1SQ9 A;  2AH0 A;  4FJL A;  4BUJ C;  4LG8 A;  5C2W B;  4O3T B;  4FK0 A;  3IKO A;  4B08 A;  3NDK A;  3TAE A;  4FJ8 A;  4L1Q D;  2MTA H;  1FZ1 E;  4J8B A;  4ZN4 A;  3QEI A;  3EI3 A;  3I7P A;  2FYO A;  3JPX A;  2YNO A;  4BH6 A;  2TRC B;  3KRW B;  2XL2 A;  1MHZ G;  3RMD A;  3MZL A;  4O45 A;  2BCJ B;  3SI6 A;  3SPZ A;  1IG9 A;  2JPN A;  4L9O A;  3UVL A;  3UVN A;  5THA A;  4FJJ A;  1S4U X;  2YMU A;  2IWF A;  2XL3 A;  3W15 A;  4A2M A;  4A0B B;  3BG0 A;  4FB1 D;  3EI1 A;  3PXT D;  5I5J A;  2OZM A;  4E4B A;  4L3H D;  4M3W A;  5EMM B;  3L4O D;  4Z8L A;  4O3U B;  4J82 A;  5CXC A;  3ULE C;  3N1E A;  4DTN A;  1OMW B;  2B7M A;  3SQ2 A;  4MK0 B;  1NR0 A;  2GNQ A;  3QNO A;  4A7J A;  4FA1 D;  2AH1 A;  4JS4 A;  2YB8 B;  2H6N A;  4LG9 A;  3AL8 B;  3RMB A;  1FZ8 E;  2H14 A;  4J0X A;  4X5N A;  2LF6 A;  3HL8 A;  4DU3 A;  4IMM A;  5HE1 B;  4A09 A;  4AKG A;  3J81 g;  3DWL C;  4JSN C;  3FRX A;  2JH8 A;  2W18 A;  4AOW A;  4M3U A;  1Q9X A;  2RCU A;  1MMO G;  1A0R B;  3LD8 A;  4E5Z B;  5TEF A;  3OGL B;  5IZ7 A;  4A0A A;  4FJ5 A;  1XU3 E;  4X5M A;  1TYQ C;  2GC4 A;  3EI2 A;  3RRM C;  4H5J A;  4M41 A;  2JHC A;  2CE8 A;  2HKM A;  4LGN A;  4L3G D;  5EAL A;  5HQG A;  5CXC B;  1XIP A;  4QRJ A;  4AKI A;  4J86 A;  3QEX A;  3SVI A;  2OYQ A;  1PGU A;  3I7H A;  5FKS A;  2J55 H;  4GQB B;  4PC0 A;  2HYE A;  5IJ7 E;  4QQE A;  5H1M A;  3PVU B;  3I7L A;  2HKR A;  4KHQ A;  3AFC A;  4A08 A;  2P1M B;  5GXH A;  1XVF E;  3ODT A;  3JRO A;  3CFV A;  2IWK A;  1WAJ A;  4FJX A;  3B7F A;  4Y7R A;  2J56 H;  1XMH E;  2MZW B;  4CZV A;  2H13 A;  2YNP A;  3CIK B;  4FHL A;  1JMX B;  2P9P C;  4CC9 A;  4QT8 A;  3OKW A;  4EPH A;  5H14 A;  3IJ1 A;  3L2O B;  2QC5 A;  4FVM A;  3RN0 D;  4QNC A;  2P1Q B;  2P9N C;  2Z2P A;  1FZ2 E;  3OL2 A;  4A11 B;  5FKQ A;  4KHY A;  1N6F A;  2OIZ A;  5K1C C;  4J73 A;  3KD1 E;  5CXB B;  4J79 A;  2JHA A;  4TZ4 A;  2B5N A;  3UR4 A;  4M45 A;  2B4E A;  2I0S A;  2Z2O A;  4J87 A;  4RNG A;  2EBS A;  2JHP A;  5EM2 A;  2HJB A;  2H9M A;  3F3G A;  2OVR B;  3MXX A;  2P5O A;  4A08 B;  4UI9 R;  5FA5 B;  5EAM A;  4GZ8 A;  4DU1 A;  2H6Q A;  2YNN A;  1OLZ A;  2VJ4 A;  5AFU 3;  3SMR A;  4ZOZ A;  4AI6 A;  1B9Y A;  3QEP A;  4KHW A;  3NVN A;  1XU5 E;  1XVE E;  3S9H A;  2PM6 B;  3LDS A;  3C5M A;  5I5I A;  1N6D A;  2H3X A;  4ZOY A;  5CYK A;  5JWZ A;  5EMK B;  4XYI A;  3V9F A;  3NGI A;  3EI4 A;  2H9L A;  4ADO A;  3VH0 A;  4X3E A;  2OZS A;  4FA4 D;  2PM9 B;  3OTT A;  4QL1 A;  4H5I A;  4FWW A;  3RWU A;  5EM2 B;  1JMZ B;  4M3T A;  4I9Q A;  3I89 A;  4D6V A;  2JH9 A;  1XVB E;  4CY5 A;  3RMA A;  1JJU B;  3KRX B;  2CNX A;  3OKY B;  1FZ6 E;  4M42 A;  3C6N B;  3RFG A;  3A0F A;  5HE2 B;  1U4C A;  4E54 A;  4GMB A;  4DTS A;  5EMJ B;  3PSL A;  3CFO A;  2CN3 A;  3E4Y A;  4DTM A;  3OGK B;  4EYW A;  3GFC A;  3L8B A;  5I5M A;  3N0D A;  4YVD A;  3SBR A;  2AGZ A;  4GM9 A;  5H17 A;  3UKR C;  3SQ4 A;  5FKT A;  4AEZ A;  4EWR A;  5TEE A;  3NVX A;  5GXI A;  4N14 A;  2P9L C;  3LZJ A;  2OVP B;  5FQD A;  4FA5 D;  3EI4 B;  4QND A;  4KHS A;  3EI3 B;  1Q9Y A;  4CY3 A;  5KDO B;  2E32 A;  4J84 A;  1B9X A;  3SBQ A;  3NCI A;  3L1N A;  2YB5 A;  1XVC E;  3GRE A;  2P9I C;  3I7O A;  3RN1 D;  3DXM C;  3QNN A;  3HGL A;  4M3R A;  5FKR A;  4U1E I;  3SPY A;  5FXY A;  5K19 A;  4CY1 A;  1FZH E;  5IRE A;  5FLX g;  1XVD E;  3HP9 A;  4FJI A;  3EI1 B;  3JB9 L;  2IAA A;  4J78 A;  1FZ3 E;  3TAG A;  4PXW A;  1TBG A;  3F3P A;  3V7D B;  4GQ1 A;  4J2B A;  4FJK A;  1QNI A;  5HE0 B;  2O9K A;  3NAE A;  4J2A A;  3N1B A;  4HDJ A;  2YBA A;  3EG6 A;  3C9C A;  3L4M D;  4K3I D;  4DU4 A;  3SUO A;  2J57 G;  3PXW D;  4FA9 D;  4A2L A;  5IBK B;  2AGW A;  2CO0 C;  4KI6 A;  3AH8 B;  3OKT A;  4PSW B;  2MMB A;  1U2V C;  4KHN A;  3UVO A;  3PXS D;  2PFV A;  2H4T A;  2XU7 A;  3TAF A;  4O9D A;  4J2E A;  4A09 B;  3CFR A;  4GAM C;  4DTO A;  3IJ0 A;  3MMY A;  4CI1 A;  2PFT A;  3AL9 A;  4JRQ A;  3SCX A;  3K2O A;  2H9N A;  2G9A A;  2PBI B;  1LDK E;  3J2P A;  2P5G A;  3DSM A;  4A0A B;  2QXV A;  3QET A;  4O1Q D;  3EI2 B;  2UZX B;  4CY2 A;  3RLM D;  3NHG A;  2OJY A;  1GG2 B;  4JSV C;  2AGY A;  1FS1 A;  1PBY B;  3WSO A;  4U7A A;  3RFH A;  1FZ0 E;  4DTJ A;  4PBY A;  3UVK A;  3MZK A;  3U4Y A;  4CI8 A;  3RSE C;  4D0K A;  3SUP A;  3P4F A;  3QER A;  2DEB A;  4J2D A;  1FXX A;  2IUV A;  4R7A B;  2HJ4 A;  3SQ0 A;  2P1O B;  3FGB A;  4JXM A;  2IUQ A;  5TF2 A;  4FAV D;  5IGQ A;  3I2N A;  1GOT B;  4DTX A;  3KD5 E;  3PE7 A;  4RG8 A;  4DTR A;  3HFQ A;  1PEV A;  4G56 B;  3OL2 B;  4Y5R D;  4HCB A;  3I8E A;  4KFM B;  4FJ9 A;  5A2Q g;  4KI4 A;  2P9U C;  2VIX A;  4K3J B;  1GP2 B;  2I3T A;  1XHM A;  1FYZ E;  3PSC B;  3SLE D;  4A0B A;  2VJ5 A;  3SJL D;  4J0W A;  2AQ5 A;  2LF3 A;  4CI3 A;  1MHY G;  3C95 A;  1Q47 A;  4M3Y A;  2HD0 A;  3C6P B;  5EAR A;  4M3Z A;  4BL0 A;  5GSA A;  2Z2N A;  2P1N B;  3I7K A;  4JSP C;  2E31 A;  3K27 A;  2QXF A;  2B5L A;  3NE6 A;  3JAM g;  3SBP A;  4I9L A;  4FJ7 A;  1FWX A;  1N6E A;  3BWS A;  2H68 A;  3C94 A;  4XYH A;  3NVQ A;  3SVW D;  3C99 A;  3SFZ A;  1ERJ A;  4PSX B;  3AL8 A;  2UZY B;  2ATQ A;  3N0E A;  1XKS A;  2XYI A;  5C9Z B;  4X60 B;  2P1P B;  2OVQ B;  1FZ5 E;  3VGZ A;  3L0M A;  2BBK H;  3RMC A;  5CYK B;  2GC7 A;  1XL3 C;  1L0Q A;  2FW3 A;  1NEX B;  2CO0 A;  4PBZ A;  4J8G A;  3SUN A;  4DTP A;  5TDH B;  3QES A;  1CLQ A;  4E5Z A;  1FZI E;  1MG3 A;  5H37 A;  5GMK n;  3J80 g;  3HGK E;  2DY4 A;  2I3S A;  3RMZ D;  4IA9 A;  3SHF A;  3MKS B;  4FJH A;  3QEW A;  1GXR A;  3QEV A;  1K8K C;  4E54 B;  3DM0 A;  3ORV D;  2DTU A;  4GQ2 P;  3CFP A;  4GGD A;  3BG1 A;  2AGX A;  5C2V B;  5HYN B;  1SHY B;  4JT5 C;  5B4W A;  1MTY G;  2IUP A;  1JOF A;  2PM7 B;  3SCY A;  4GGC A;  1FZ7 E;  4CZX A;  3JZH A;  4ADN A;  4FJG A;  4JS5 A;  4GGA A;  3IIY A;  5SXM A;  4FAN D;  4X63 B;  4ZOV A;  4JT6 C;  1FZ9 E;  4NSX A;  5EML B;  3MKQ A;  1K32 A;  1PI6 A;  4ERY A;  3CQ8 A;  4A11 A;  2I0T A;  2B8I A;  3TL8 B;  3LZI A;  3TJY A;  1RI6 A;  3DXK C;  4ZOX A;  3FM0 A;  2B1E A;  4J77 A;  5CXB A;  5HE3 B;  5IC7 A;  4FK2 A;  1XMF E;  4X61 B;  3SXT D;  3E4W A;  3VA6 A;  4I6J B;  3SWS D;  4E3S A;  1YFQ A;  3F3F A;  2H6K A;  2P9K C;  3UVM A;  4GM8 A;  4AKH A;  5IGO A;  3SJJ A;  1IH7 A;  2AGL A;  4JD2 C;  3I8C A;  1WAF A;  3SUQ A;  4OZU A;  4RL5 A;  1MG2 A;  2CE9 A;  3C75 H;  4KHU A;  4DTU A;  2HES X;  4FK4 A;  3I7N A;  2B5M A;  2IUR A;  2OK4 A;  4ES0 A;  4JRP A;  4EP9 A;  4ERQ A;  5AMS A;  5IT9 g;  3JZG A;  2I0R A;  2H9P A;  4PNK B;  4OWR A;  2CN2 A;  1XMG E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...