2OVRB

Structure of the skp1-fbw7-cyclinedegn complex
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
444
structure length
442
Chain Sequence
b'TQVKHMMQVIEPQFQRDFISLLPKELALYVLSFLEPKDLLQAAQTCRYWRILAEDNLLWREKCKEEGIDEPLHIKRVIKPGFIHSPWKSAYIRQHRIDTNWRRGELKSPKVLKGHDDHVITCLQFCGNRIVSGSDDNTLKVWSAVTGKCLRTLVGHTGGVWSSQMRDNIIISGSTDRTLKVWNAETGECIHTLYGHTSTVRCMHLHEKRVVSGSRDATLRVWDIETGQCLHVLMGHVAAVRCVQYDGRRVVSGAYDFMVKVWDPETETCLHTLQGHTNRVYSLQFDGIHVVSGSLDTSIRVWDVETGNCIHTLTGHQSLTSGMELKDNILVSGNADSTVKIWDIKTGQCLQTLQGPNKHQSAVTCLQFNKNFVITSSDDGTVKLWDLKTGEFIRNLVTLESGGSGGVVWRIRASNTKLVCAVGSRNGTEETKLLVLDFDVDM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords S-phase kinase-associated protein 1A
publication title Structure of a Fbw7-Skp1-Cyclin E Complex: Multisite-Phosphorylated Substrate Recognition by SCF Ubiquitin Ligases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/cell cycle
total genus 132
structure length 442
sequence length 444
ec nomenclature
pdb deposition date 2007-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00400 WD40 WD domain, G-beta repeat
B PF12937 F-box-like F-box-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.50 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 2ovrB01
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2ovrB02
4FAVD 2J55H 4GM3A 5HE1B 4J87A 2H6KA 3I8CA 1MG3A 5AFU3 4OZUA 1U2VC 2HYEA 2HXCA 5FKTA 3JZGA 4ZOYA 5HE2B 4E5ZB 2HESX 1PBYB 4ZN4A 2GC7A 4I6JB 2P1MB 4ZOVA 5EAMA 4U7AA 2YNOA 4L3HD 4L9OA 2I0SA 3CIKB 3C6OB 2PBIB 3JZNA 4LG9A 5EM2A 4FA1D 2QC5A 3AL9A 1OMWB 3SVWD 2B5NA 4K3ID 5C2WB 2E31A 3SWSD 4E5ZA 3E0CA 4FAND 3EI4A 3C99A 3I89A 2B5MA 2H14A 4PXWA 5K1CC 2B5LA 1MG2A 1QNIA 2E32A 3I7OA 5I5JA 4CI2A 3MXXA 3K26A 3PE7A 4XYIA 3V7DB 3SJLD 3ODTA 3PSCB 4IA9A 2OK4A 2AH1A 4CZXA 4ES0A 4PBYA 4PC0A 2EBSA 2CN2A 3PVWB 3W15A 5H14A 3RFHA 5CXBB 3UVNA 3ZWLB 1JMZB 3F3GA 4CI3A 4UI9R 1SHYB 3GFCA 3PXSD 4PNKB 3I7LA 5IBKB 3SBPA 4GZ8A 4JSNC 3AL8A 2XL2A 2P1NB 2HKRA 4FB1D 3OGKB 4JT6C 3B7FA 3I7HA 4A08B 5CYKB 3L4MD 2G9AA 3EI3B 5CXBA 4J84A 5C2VB 3I2NA 5EMJB 3IKOA 1XKSA 1B9XA 4CY5A 4BL0A 2P1OB 3HFQA 4QRJA 5H1MA 3UKUC 3UVMA 1JJUB 3L2OB 4HDJA 5GMKn 4G56B 4O1QD 4GQ2P 3SCYA 5CXCA 2G99A 5HQGA 3JAMg 1SQJA 1XHMA 4TZ4A 2H9NA 4J77A 1U4CA 4XEIC 3V5WB 4GGDA 4A08A 3EI1A 2IWFA 2GNQA 4H5IA 2CE9A 3EMHA 2AGXA 3BG0A 3RLMD 3N0DA 3JPXA 3BG1A 2QXVA 2OIZA 2P9KC 2CO0A 5EMMB 5IGQA 3OGMB 3IJ1A 4X60B 5FQDA 4R7AB 4GGCA 1GG2B 1B9YA 1JMXB 2HJBA 3F3FA 1JOFA 3FRXA 5GSAA 4A0AA 2YBAA 2AH0A 3J80g 5C9ZB 4ERQA 2BBKH 4ESGA 2GC4A 4FHLA 4J78A 4D6VA 5THAA 3SMRA 2IAAA 3U4YA 3MKQA 4X61B 2YB8B 3UVKA 3DXKC 2H9PA 5A2Qg 4JSVC 4J8BA 4CY1A 2IUQA 4NSXA 2H68A 3OGLB 1TYQC 1RI6A 3A0FA 5SXMA 4GQ1A 5TDHB 2H6NA 3UR4A 4JD2C 3PSLA 3SXTD 3C5MA 4J0XA 4ERZA 5K19A 4I79A 3OKTA 4O3TB 4GM9A 2I3TA 4CZYA 5FKSA 4O9DA 3DM0A 4ZOXA 1LDKE 3N0EA 4A09B 3SFZA 4N14A 1PEVA 2CN3A 4J73A 3RRMC 1K32A 3FM0A 5I5IA 3MZKA 3OTTA 4L3GD 4K3JB 2IUVA 2W18A 3BWSA 3NVNA 1N6DA 1NR0A 2OVPB 5HE3B 2IWKA 3C9CA 4Y5RD 2XL3A 2CNXA 4JSPC 4A0BB 1L0QA 2Z2PA 4FA4D 4A09A 2H9MA 4KFMB 3EI2B 3C6PB 1P22A 2PM7B 4JXMA 2YNNA 4GM8A 2I3SA 3I7NA 2Z2NA 3GREA 3FGBA 3CFSB 5JWZA 2MTAH 2P9LC 4J79A 3I7PA 4A7JA 4OWRA 4A11B 1NEXB 4Y7RA 2YMUA 3KRWB 5TF2A 3UVOA 1VYHC 3PXTD 3KRXB 2CE8A 3RN1D 2P1QB 2OJYA 5HYNB 3OL2B 3SBRA 1ERJA 1K8KC 2UZYB 4CZVA 3JRPA 4O3UB 2AQ5A 3MKSB 4LGNA 1SQ9A 3AH8B 5CYKA 2AGWA 3EI3A 4A11A 1GP2B 5H17A 5FKQA 4PSWB 3JB9L 2TRCB 4LG8A 4J0WA 3UVLA 3IIWA 3P4FA 2H9LA 2Z2OA 3OL2A 4FA9D 4JSXC 4CI8A 2PM6B 3CFVA 4XYHA 4X63B 1Q47A 2OVQB 4E54B 2B4EA 5EALA 4J8GA 2CO0C 4BH6A 4AEZA 3K27A 5B4WA 3C6NB 3ORVD 3JZHA 3UKRC 3IJ0A 2H6QA 5IT9g 2XU7A 1S4UX 3NVQA 2YNPA 5EM2B 2P9SC 3C75H 1GXRA 4D0KA 1N6EA 3AFCA 3ULEC 1MDAH 2O9KA 5EMKB 3V9FA 2H47A 4AOWA 4E54A 3EI4B 4J86A 2AGLA 4L1QD 4BUJC 2J57G 1GOTB 2IURA 3SN6B 3J81g 2Q7QA 3VA6A 4PSXB 3RFGA 4QL1A 3DWLC 1PI6A 5IJ8E 1FS1A 3SHFA 4O45A 4GMBA 3OKYB 3PVUB 4QT8A 3JROA 4PBZA 4J82A 1R5MA 2HJ4A 4QQEA 5GXHA 4U1EI 1YFQA 4GGAA 4GQBB 5HE0B 3OW8A 3WSOA 5EARA 5KDOB 1A0RB 3VH0A 3AL8B 3EWEA 2P9NC 5IGOA 3OKYA 2AGYA 2P9IC 4CC9A 4JT5C 3IJCA 1OLZA 2BCJB 2PM9B 1XIPA 4CY2A 4CY3A 3SBQA 4YVDA 3IIYA 3F3PA 2OK6A 5I5MA 2H3XA 2HKMA 4A0BA 5FKRA 5FA5B 5CXCB 5FLXg 4FWWA 4H5JA 3RMZD 3EI2A 4CI1A 3EU7A 4A2MA 3L4OD 2UZXB 2OVRB 2J56H 3EG6A 1PGUA 5AMSA 3EI1B 1TBGA 3PXWD 5IC7A 3I8EA 5IJ7E 2P1PB 2PM9A 2I0RA 1N6FA 4IMMA 5EAPA 2I0TA 3MZLA 5GXIA 4EWRA 3OKWA 5EMLB 3RSEC 5TEEA 4A0AB 2H13A 5AJAA 4ZOZA 5TEFA 2P9PC 4J81A 3MMYA 3DSMA 2XYIA 3VGZA 2P9UC 4ERYA 5FXYA 3SLED 4FA5D 3DXMC 1FWXA 4X3EA 3RN0D 4Z8LA 4MK0B 4A2LA 2IUPA 2AGZA 3I7KA 3NVXA
chains in the Genus database with same CATH superfamily
4FAVD 2J55H 3IUJA 4GM3A 5HE1B 5M5UA 4J87A 1Q9YA 2H6KA 1FYZE 5E6SA 3I8CA 1MG3A 5AFU3 4OZUA 1U2VC 1H2WA 4M3TA 3DDUA 2DEBA 2LF3A 2HYEA 2HXCA 5FKTA 3QEXA 4KHNA 3JZGA 4ZOYA 5HE2B 3SUNA 4E5ZB 2HESX 3UO3A 1PBYB 1MHZG 1XMFE 4ZN4A 1O6GA 2GC7A 1XU5E 4DTJA 4I6JB 2DTUA 2P1MB 5IREA 4ZOVA 3SQ4A 5EAMA 4U7AA 4JHPC 4Z7NA 4JRQA 2YNOA 4L3HD 4L9OA 2I0SA 3CIKB 1FZHE 3C6OB 2PBIB 2VDLA 3JZNA 4LG9A 5EM2A 4FA1D 5IZ7A 3NHGA 2QC5A 3AL9A 3NDKA 4MMYA 3J27A 3IULA 1OMWB 4FJMA 3SVWD 4HCCA 2B5NA 4K3ID 2E31A 4WK2A 5C2WB 3SWSD 1GOGA 4E5ZA 3E0CA 3TL8B 4FAND 3EI4A 3MUOA 4KI6A 4IRZA 3EQ7A 4ADNA 3C99A 3L0MA 3I89A 2B5MA 2H14A 4DU4A 4PXWA 5K1CC 2B5LA 1XMGE 1XVEE 1MG2A 4JHNA 3NIGA 1QNIA 2E32A 3ZDZA 3I7OA 1FPOA 5I5JA 4CI2A 2XE4A 2JQTA 3NE6A 3QESA 3MXXA 3TABA 4L1MA 3K26A 3PE7A 4XYIA 3V7DB 3SJLD 3ODTA 3PSCB 4IA9A 2OK4A 1XVCE 2ATQA 3KCIA 2AH1A 2VDMA 4DTSA 2VZ1A 1IG9A 4CZXA 4PBYA 4PC0A 2EBSA 3ZDYA 4ES0A 2CN2A 3PVWB 3W15A 3N1BA 5H14A 3RFHA 5CXBB 3UVNA 3QEWA 1XVFE 3ZWLB 1JMZB 3F3GA 1UOPA 3V4VA 4CI3A 4UI9R 3IUQA 1SHYB 3T3MA 3RWUA 3IUNA 2JPNA 1FZIE 4AMZA 3GFCA 3RMDA 3PXSD 4PNKB 4JRPA 4FJNA 3I7LA 5IBKB 3SBPA 4GZ8A 4JSNC 4BP8A 3AL8A 3BVOA 4NENA 2XL2A 2P1NB 2HKRA 4FB1D 4DTNA 3OGKB 1QFSA 4J2AA 4JT6C 3C95A 4UM9A 3B7FA 3I7HA 4FJLA 4A08B 5CYKB 3L4MD 2G9AA 3EI3B 5CXBA 4J84A 2VZ3A 4Z7QA 5C2VB 3I2NA 3QETA 4MMXA 3IKOA 1XKSA 3HL8A 5EMJB 1B9XA 2VDNA 4CY5A 4BL0A 4AX4A 2P1OB 2P5GA 3HFQA 4QRJA 5H1MA 4HCBA 3UKUC 3UVMA 1JJUB 2QZPA 3L2OB 2WQ8A 5E6RA 3NAEA 4HDJA 5GMKn 4G56B 3EQ8A 4O1QD 4M3UA 4GQ2P 3SCYA 5CXCA 2G99A 4WJKA 2JHCA 5HQGA 3JAMg 4DTRA 1SQJA 1XHMA 4D9SA 4TZ4A 2H9NA 1WAJA 2B8IA 1U4CA 4J77A 4QNCA 4FJHA 4XEIC 3V5WB 4GGDA 2B1EA 4A08A 3EI1A 2IWFA 2GNQA 4H5IA 2CE9A 3EMHA 1XMHE 5H37A 4Z7OA 1FZ7E 2AGXA 3BG0A 3RLMD 3N0DA 3LDBA 3JPXA 3BG1A 2QXVA 2OIZA 2P9KC 2CO0A 5EMMB 5IGQA 1FZ3E 3OGMB 3SUOA 3IJ1A 4X60B 5FQDA 1VZ2A 4R7AB 4BP9A 4X5MA 2OYQA 4GGCA 4J2EA 1GG2B 3SJJA 3TAGA 4RNGA 1B9YA 1JMXB 2HJBA 3F3FA 1JOFA 3FRXA 1VE6A 5GSAA 4A0AA 3RMAA 2YBAA 4AKIA 2AH0A 3N1EA 3J80g 5C9ZB 3E4YA 4ERQA 2BBKH 4ESGA 2GC4A 1A12A 4FHLA 1O6FA 5HDBA 4ICGC 4J78A 4D6VA 5THAA 5M61A 4DTMA 3SMRA 2IAAA 3U4YA 3MKQA 4X61B 2QXFA 2YB8B 5FFOA 3UVKA 3DXKC 2H9PA 4M3YA 5A2Qg 4JSVC 4J8BA 4AN1A 4CY1A 3SVIA 2JHAA 2IUQA 4NSXA 3QEIA 3OGLB 2H68A 1H2XA 1TYQC 2EIDA 1RI6A 4FJ5A 3LDSA 3KD1E 4BCBA 3A0FA 5SXMA 4GQ1A 1UOOA 4EP9A 3SI6A 3NCIA 1GOHA 1WAFA 3V4PA 3HGLA 4FJIA 2YB5A 5TDHB 2H6NA 3UR4A 4EYWA 4JD2C 3PSLA 3SXTD 3C5MA 4J0XA 4ERZA 5M5TA 4GAMC 5K19A 4I79A 4AKHA 4FJ8A 4MMZA 3OKTA 4O3TB 4GM9A 2I3TA 4CZYA 3E4WA 5FKSA 3UIQA 4O9DA 2PFVA 1VE7A 1Q9XA 3DM0A 4QAMA 4M3RA 4ZOXA 1LDKE 2MZWB 3N0EA 2LF6A 5M5SA 4A09B 3TAFA 3SFZA 4N14A 1PEVA 2CN3A 4J73A 4DNWA 3RRMC 1K32A 3FM0A 5I5IA 3MZKA 3OTTA 4DNVA 2OZSA 4L3GD 4K3JB 4DU3A 1E8MA 2IUVA 2W18A 3BWSA 3CQ8A 3SPYA 2EIEA 1FZ1E 3TAEA 4I9QA 3NVNA 1N6DA 1NR0A 2OVPB 2K5SA 3I7KA 5HE3B 2IWKA 3C9CA 4Y5RD 1FZ8E 2XL3A 2CNXA 4JSPC 4A0BB 4B08A 1T2XA 1L0QA 2Z2PA 3ZDXA 4FA4D 2H9MA 4A09A 4KFMB 3EI2B 1P22A 3C6PB 2PM7B 4QNDA 3SNNA 2PFTA 1E5TA 4FJ9A 2BKLA 4JXMA 2H4TA 1FZ5E 2YNNA 4GM8A 2I3SA 3I7NA 2Z2NA 3GREA 3FGBA 3CFSB 3O4HA 5JWZA 3J2PA 2MTAH 2QR5A 4M3XA 2P9LC 4J79A 4AI6A 1L5GA 3I7PA 4A7JA 1MTYG 3LZJA 4OWRA 4A11B 1NEXB 4Y7RA 2YMUA 3KRWB 3O4IA 5TF2A 1IH7A 1MHYG 3L1NA 3UVOA 4X5NA 1VYHC 3PXTD 3KRXB 1TYEA 2CE8A 3O4JA 3RN1D 1FZ2E 3IUMA 2P1QB 1QFMA 2OJYA 1FZ4E 3TJYA 4M45A 4FK4A 2VDQA 3LD8A 3OL2B 5HYNB 3SBRA 1I2MB 1ERJA 1K8KC 2UZYB 2VDKA 3CFOA 3HP9A 4CZVA 3CFPA 3IURA 3CFRA 3JRPA 2HU8A 3RMCA 4O3UB 2AQ5A 3MKSB 2XZGA 2VDRA 4LGNA 1SQ9A 4FK2A 3AH8B 4NAAA 5CYKA 2AGWA 3EI3A 4RE5A 4A11A 2DY4A 1GP2B 1UOQA 4JS4A 4J2DA 5FKQA 5H17A 4RG8A 4DU1A 5FFGA 4PSWB 3QNNA 3JB9L 2TRCB 4LG8A 1YR2A 4J0WA 3UVLA 4ADOA 3IIWA 3P4FA 2H9LA 3SQ1A 2Z2OA 3K2OA 3OL2A 4JSXC 4FA9D 2PM6B 4IT5A 4CI8A 4NBMA 3CFVA 4XYHA 1FXXA 3ZE0A 4X63B 2EIBA 2XDWA 4JS5A 1Q47A 2OVQB 4E54B 2B4EA 5EALA 4J8GA 2CO0C 4BH6A 4KHYA 4AEZA 3K27A 4FJ7A 3C6NB 4FK0A 1M1XA 3EQ9A 3JZHA 3ORVD 5B4WA 3UKRC 3IJ0A 2H6QA 4WK4A 2EICA 5IT9g 2HU7A 1GOFA 2XU7A 1S4UX 3GC3B 4DTXA 5M5VA 3NVQA 2YNPA 5EM2B 2VDOA 2VJ4A 1H2ZA 3L8BA 2P9SC 3C75H 1GXRA 3FCUA 3MVDK 2JKXA 4D0KA 1N6EA 3AFCA 3ULEC 2HD0A 1JW2A 1C9LA 5M5RA 4DNUA 1MDAH 2O9KA 3IJEA 3NIDA 1FZ0E 1XL3C 4E4BA 5EMKB 3V9FA 2H47A 4M41A 3T3PA 4AOWA 4E54A 3EI4B 4J86A 2AGLA 1C9IA 3VI4A 4DTPA 4L1QD 4BUJC 1K3IA 2J57G 5C86A 1GOTB 4KI4A 2IURA 3K72A 3SQ2A 3SN6B 3J81g 4O02A 3SQ0A 2RKHA 2Q7QA 3OF7A 3VA6A 3NGIA 4PSXB 3RFGA 3QEPA 4FJJA 3ZE2A 4QL1A 3DWLC 1PI6A 1UTCA 3QEVA 5IJ8E 2VDPA 3GD1I 4WK0A 1FS1A 3SHFA 4DTUA 4RE6A 4AN0A 4KHQA 4O45A 2JH8A 2FYOA 4GMBA 3OKYB 3PVUB 4QT8A 2MW2A 1XVBE 4KHWA 1U8CA 3JROA 3K71A 4PBZA 4J82A 3QNOA 1R5MA 2HJ4A 2VC2A 4QQEA 5GXHA 3S9HA 2P5OA 1BPOA 1VZ3A 4UM8A 2JHPA 4U1EI 1JTDB 1YFQA 4GGAA 4GQBB 5HE0B 3OW8A 3WSOA 5EARA 3FCSA 5KDOB 1A0RB 3VH0A 3AL8B 3EWEA 2RCUA 2OZMA 3HGKE 3O4GA 3C94A 2P9NC 1XVGE 4E3SA 5IGOA 3OKYA 2AGYA 2P9IC 2FW3A 4RL5A 1XVDE 4CC9A 4JT5C 3IJCA 1OLZA 2BCJB 2PM9B 4DTOA 1XIPA 4CY2A 4CY3A 4AMYA 4G1EA 3SBQA 4G1MA 4YVDA 3IIYA 1JV2A 1H2YA 3F3PA 2OK6A 3MUNA 5I5MA 1FZ9E 3QERA 2H3XA 2HKMA 3NIFA 4O2WA 4A0BA 5FKRA 3QI0A 5CXCB 5FA5B 5FLXg 4FWWA 4H5JA 4KHSA 3RMZD 3EI2A 4CI1A 1N1CA 3EU7A 4A2MA 3L4OD 2MMBA 2UZXB 2OVRB 2B7MA 4NC4A 4FJXA 2J56H 1FZ6E 3EG6A 3QHYB 5E6UA 1PGUA 5AMSA 4BCCA 3EI1B 1TBGA 4EPHA 3PXWD 5IC7A 3I8EA 1MMOG 4FJKA 5IJ7E 2P1PB 2PM9A 3SUPA 2I0RA 3VI3A 2VIXA 3RMBA 1N6FA 4G55A 4J2BA 4IMMA 1E8NA 3IVMA 1XU3E 5EAPA 2I0TA 3MZLA 3SPZA 5GXIA 3KD5E 4FJGA 2HU5A 4M42A 4EWRA 3SUQA 3OKWA 5EMLB 3RSEC 5TEEA 4A0AB 2H13A 5AJAA 4AKGA 4ZOZA 3SCXA 5TEFA 2P9PC 4J81A 3MMYA 4BCDA 3DSMA 2XYIA 3VGZA 2P9UC 4ERYA 2VJ5A 5FXYA 3SLED 4FA5D 4I9LA 3DXMC 1FWXA 4X3EA 2JH9A 3LZIA 3RN0D 4Z8LA 5C92A 4MK0B 1CLQA 4A2LA 4FVMA 4M3ZA 3K6SA 4KHUA 2IUPA 3ZE1A 2AGZA 3UO2A 4M3WA 3NVXA
chains in the Genus database with same CATH topology
4FAVD 2J55H 4GM3A 5HE1B 4J87A 1Q9YA 2H6KA 1FYZE 3I8CA 1MG3A 5AFU3 4OZUA 1U2VC 2HYEA 4M3TA 2DEBA 2LF3A 2HXCA 5FKTA 3QEXA 4KHNA 3JZGA 4ZOYA 5HE2B 3SUNA 4E5ZB 2HESX 1PBYB 1MHZG 1XMFE 4ZN4A 2GC7A 1XU5E 4DTJA 4I6JB 2DTUA 2P1MB 5IREA 4ZOVA 3SQ4A 5EAMA 4U7AA 4JRQA 2YNOA 4L3HD 4L9OA 2I0SA 3CIKB 3C6OB 1FZHE 2PBIB 3JZNA 4LG9A 5EM2A 4FA1D 5IZ7A 3NHGA 2QC5A 3AL9A 3NDKA 3J27A 1OMWB 4FJMA 3SVWD 4HCCA 2B5NA 4K3ID 2E31A 5C2WB 3SWSD 4E5ZA 3E0CA 3TL8B 4FAND 3EI4A 4KI6A 4ADNA 3C99A 3L0MA 3I89A 2B5MA 2H14A 4DU4A 4PXWA 5K1CC 2B5LA 1XMGE 1XVEE 1MG2A 1QNIA 2E32A 3I7OA 5I5JA 4CI2A 3NE6A 3QESA 3MXXA 3TABA 3K26A 3PE7A 4XYIA 3V7DB 3SJLD 3ODTA 3PSCB 4IA9A 2OK4A 1XVCE 2ATQA 2AH1A 4DTSA 1IG9A 4CZXA 4PBYA 4PC0A 2EBSA 4ES0A 2CN2A 3PVWB 3W15A 3N1BA 5H14A 3RFHA 5CXBB 3UVNA 3QEWA 1XVFE 3ZWLB 1JMZB 3F3GA 4CI3A 4UI9R 1SHYB 3RWUA 2JPNA 1FZIE 3GFCA 3RMDA 3PXSD 4PNKB 4JRPA 4FJNA 3I7LA 5IBKB 3SBPA 4GZ8A 4JSNC 3AL8A 2XL2A 2P1NB 2HKRA 4FB1D 4DTNA 3OGKB 4J2AA 4JT6C 3C95A 3B7FA 3I7HA 4FJLA 4A08B 5CYKB 3L4MD 2G9AA 3EI3B 5CXBA 4J84A 5C2VB 3I2NA 3QETA 5EMJB 3IKOA 1XKSA 3HL8A 1B9XA 4CY5A 4BL0A 2P1OB 2P5GA 3HFQA 4QRJA 5H1MA 4HCBA 3UKUC 3UVMA 1JJUB 3L2OB 3NAEA 4HDJA 5GMKn 4G56B 4O1QD 4M3UA 4GQ2P 3SCYA 5CXCA 2G99A 5HQGA 2JHCA 3JAMg 4DTRA 1SQJA 1XHMA 4TZ4A 2H9NA 1WAJA 2B8IA 1U4CA 4J77A 4QNCA 4FJHA 4XEIC 3V5WB 4GGDA 2B1EA 4A08A 3EI1A 2IWFA 2GNQA 4H5IA 2CE9A 3EMHA 1XMHE 5H37A 1FZ7E 2AGXA 3BG0A 3RLMD 3N0DA 3LDBA 3JPXA 3BG1A 2QXVA 2OIZA 2P9KC 2CO0A 5EMMB 5IGQA 1FZ3E 3OGMB 3SUOA 3IJ1A 4X60B 5FQDA 4R7AB 4X5MA 2OYQA 4GGCA 4J2EA 1GG2B 3SJJA 3TAGA 4RNGA 1B9YA 1JMXB 2HJBA 3F3FA 1JOFA 3FRXA 5GSAA 4A0AA 3RMAA 2YBAA 4AKIA 2AH0A 3N1EA 3J80g 5C9ZB 3E4YA 4ERQA 2BBKH 4ESGA 2GC4A 4FHLA 4J78A 4D6VA 5THAA 4DTMA 3SMRA 2IAAA 3U4YA 3MKQA 4X61B 2QXFA 2YB8B 3UVKA 3DXKC 2H9PA 4M3YA 5A2Qg 4JSVC 4J8BA 4CY1A 3SVIA 2JHAA 2IUQA 4NSXA 3QEIA 3OGLB 2H68A 1TYQC 1RI6A 4FJ5A 3LDSA 3KD1E 3A0FA 5SXMA 4GQ1A 4EP9A 3SI6A 3NCIA 1WAFA 3HGLA 4FJIA 2YB5A 5TDHB 2H6NA 3UR4A 4EYWA 4JD2C 3PSLA 3SXTD 3C5MA 4J0XA 4ERZA 4GAMC 5K19A 4I79A 4AKHA 4FJ8A 3OKTA 4O3TB 4GM9A 2I3TA 4CZYA 3E4WA 5FKSA 3UIQA 4O9DA 2PFVA 3DM0A 1Q9XA 4ZOXA 4M3RA 1LDKE 2MZWB 3N0EA 2LF6A 4A09B 3TAFA 3SFZA 4N14A 1PEVA 2CN3A 4J73A 3RRMC 1K32A 3FM0A 5I5IA 3MZKA 3OTTA 2OZSA 4L3GD 4K3JB 4DU3A 2IUVA 2W18A 3BWSA 3CQ8A 3SPYA 1FZ1E 3TAEA 4I9QA 3NVNA 1N6DA 1NR0A 2OVPB 5HE3B 2IWKA 3C9CA 4Y5RD 1FZ8E 2XL3A 2CNXA 4JSPC 4A0BB 4B08A 1L0QA 2Z2PA 4FA4D 4A09A 2H9MA 4KFMB 3EI2B 1P22A 3C6PB 2PM7B 4QNDA 3SNNA 2PFTA 4FJ9A 4JXMA 2H4TA 1FZ5E 2YNNA 4GM8A 2I3SA 3I7NA 2Z2NA 3GREA 3FGBA 3CFSB 5JWZA 3J2PA 2MTAH 4M3XA 2P9LC 4J79A 4AI6A 3I7PA 4A7JA 1MTYG 3LZJA 4OWRA 4A11B 1NEXB 4Y7RA 2YMUA 3KRWB 5TF2A 1IH7A 1MHYG 3L1NA 3UVOA 4X5NA 1VYHC 3PXTD 3KRXB 2CE8A 3RN1D 1FZ2E 2P1QB 2OJYA 1FZ4E 3TJYA 4M45A 4FK4A 5HYNB 3LD8A 3OL2B 3SBRA 1ERJA 1K8KC 2UZYB 3CFOA 3HP9A 4CZVA 3CFPA 3CFRA 3JRPA 3RMCA 4O3UB 2AQ5A 3MKSB 4LGNA 1SQ9A 4FK2A 3AH8B 5CYKA 2AGWA 3EI3A 4A11A 2DY4A 1GP2B 4JS4A 4J2DA 5FKQA 5H17A 4RG8A 4DU1A 4PSWB 3QNNA 3JB9L 2TRCB 4LG8A 4J0WA 3UVLA 4ADOA 3IIWA 3P4FA 2H9LA 3SQ1A 2Z2OA 3K2OA 3OL2A 4JSXC 4FA9D 2PM6B 4CI8A 3CFVA 4XYHA 1FXXA 4X63B 4JS5A 1Q47A 2OVQB 4E54B 2B4EA 5EALA 4J8GA 2CO0C 4BH6A 4KHYA 4AEZA 3K27A 4FJ7A 3C6NB 4FK0A 3JZHA 3ORVD 5B4WA 3UKRC 3IJ0A 2H6QA 5IT9g 2XU7A 1S4UX 4DTXA 3NVQA 2YNPA 5EM2B 2VJ4A 3L8BA 2P9SC 3C75H 1GXRA 4D0KA 1N6EA 3AFCA 3ULEC 2HD0A 1MDAH 2O9KA 1FZ0E 1XL3C 4E4BA 5EMKB 3V9FA 2H47A 4M41A 4AOWA 4E54A 3EI4B 4J86A 2AGLA 4DTPA 4L1QD 4BUJC 2J57G 1GOTB 4KI4A 2IURA 3SQ2A 3SN6B 3J81g 3SQ0A 2Q7QA 3VA6A 3NGIA 4PSXB 3RFGA 3QEPA 4FJJA 4QL1A 3DWLC 1PI6A 3QEVA 5IJ8E 1FS1A 3SHFA 4DTUA 4KHQA 4O45A 2JH8A 2FYOA 4GMBA 3OKYB 3PVUB 4QT8A 1XVBE 4KHWA 3JROA 4PBZA 4J82A 3QNOA 1R5MA 2HJ4A 4QQEA 5GXHA 3S9HA 2P5OA 2JHPA 4U1EI 1YFQA 4GGAA 4GQBB 5HE0B 3OW8A 3WSOA 5EARA 5KDOB 1A0RB 3VH0A 3AL8B 3EWEA 2RCUA 2OZMA 3HGKE 3C94A 2P9NC 1XVGE 4E3SA 5IGOA 3OKYA 2AGYA 2P9IC 2FW3A 4RL5A 1XVDE 4CC9A 4JT5C 3IJCA 1OLZA 2BCJB 2PM9B 4DTOA 1XIPA 4CY2A 4CY3A 3SBQA 4YVDA 3IIYA 3F3PA 2OK6A 5I5MA 1FZ9E 3QERA 2H3XA 2HKMA 4A0BA 5FKRA 5FA5B 5CXCB 5FLXg 4FWWA 4H5JA 4KHSA 3RMZD 3EI2A 4CI1A 3EU7A 4A2MA 3L4OD 2MMBA 2UZXB 2OVRB 2B7MA 4FJXA 2J56H 1FZ6E 3EG6A 1PGUA 5AMSA 3EI1B 1TBGA 4EPHA 3PXWD 5IC7A 3I8EA 1MMOG 4FJKA 5IJ7E 2P1PB 2PM9A 3SUPA 2I0RA 2VIXA 3RMBA 1N6FA 4J2BA 4IMMA 1XU3E 5EAPA 2I0TA 3MZLA 3SPZA 5GXIA 3KD5E 4FJGA 4M42A 4EWRA 3SUQA 3OKWA 5EMLB 3RSEC 5TEEA 4A0AB 2H13A 5AJAA 4AKGA 4ZOZA 3SCXA 5TEFA 2P9PC 4J81A 3MMYA 3DSMA 2XYIA 3VGZA 2P9UC 4ERYA 2VJ5A 5FXYA 3SLED 4FA5D 4I9LA 3DXMC 1FWXA 4X3EA 2JH9A 3LZIA 3RN0D 4Z8LA 4MK0B 1CLQA 4A2LA 4FVMA 4M3ZA 4KHUA 2IUPA 2AGZA 3I7KA 4M3WA 3NVXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FAV D;  2J55 H;  4GM3 A;  5HE1 B;  4J87 A;  2H6K A;  3I8C A;  1MG3 A;  5AFU 3;  4OZU A;  1U2V C;  2HYE A;  2HXC A;  5FKT A;  3JZG A;  4ZOY A;  5HE2 B;  4E5Z B;  2HES X;  1PBY B;  4ZN4 A;  2GC7 A;  4I6J B;  2P1M B;  4ZOV A;  5EAM A;  4U7A A;  2YNO A;  4L3H D;  4L9O A;  2I0S A;  3CIK B;  3C6O B;  2PBI B;  3JZN A;  4LG9 A;  5EM2 A;  4FA1 D;  2QC5 A;  3AL9 A;  1OMW B;  3SVW D;  2B5N A;  4K3I D;  5C2W B;  2E31 A;  3SWS D;  4E5Z A;  3E0C A;  4FAN D;  3EI4 A;  3C99 A;  3I89 A;  2B5M A;  2H14 A;  4PXW A;  5K1C C;  2B5L A;  1MG2 A;  1QNI A;  2E32 A;  3I7O A;  5I5J A;  4CI2 A;  3MXX A;  3K26 A;  3PE7 A;  4XYI A;  3V7D B;  3SJL D;  3ODT A;  3PSC B;  4IA9 A;  2OK4 A;  2AH1 A;  4CZX A;  4ES0 A;  4PBY A;  4PC0 A;  2EBS A;  2CN2 A;  3PVW B;  3W15 A;  5H14 A;  3RFH A;  5CXB B;  3UVN A;  3ZWL B;  1JMZ B;  3F3G A;  4CI3 A;  4UI9 R;  1SHY B;  3GFC A;  3PXS D;  4PNK B;  3I7L A;  5IBK B;  3SBP A;  4GZ8 A;  4JSN C;  3AL8 A;  2XL2 A;  2P1N B;  2HKR A;  4FB1 D;  3OGK B;  4JT6 C;  3B7F A;  3I7H A;  4A08 B;  5CYK B;  3L4M D;  2G9A A;  3EI3 B;  5CXB A;  4J84 A;  5C2V B;  3I2N A;  5EMJ B;  3IKO A;  1XKS A;  1B9X A;  4CY5 A;  4BL0 A;  2P1O B;  3HFQ A;  4QRJ A;  5H1M A;  3UKU C;  3UVM A;  1JJU B;  3L2O B;  4HDJ A;  5GMK n;  4G56 B;  4O1Q D;  4GQ2 P;  3SCY A;  5CXC A;  2G99 A;  5HQG A;  3JAM g;  1SQJ A;  1XHM A;  4TZ4 A;  2H9N A;  4J77 A;  1U4C A;  4XEI C;  3V5W B;  4GGD A;  4A08 A;  3EI1 A;  2IWF A;  2GNQ A;  4H5I A;  2CE9 A;  3EMH A;  2AGX A;  3BG0 A;  3RLM D;  3N0D A;  3JPX A;  3BG1 A;  2QXV A;  2OIZ A;  2P9K C;  2CO0 A;  5EMM B;  5IGQ A;  3OGM B;  3IJ1 A;  4X60 B;  5FQD A;  4R7A B;  4GGC A;  1GG2 B;  1B9Y A;  1JMX B;  2HJB A;  3F3F A;  1JOF A;  3FRX A;  5GSA A;  4A0A A;  2YBA A;  2AH0 A;  3J80 g;  5C9Z B;  4ERQ A;  2BBK H;  4ESG A;  2GC4 A;  4FHL A;  4J78 A;  4D6V A;  5THA A;  3SMR A;  2IAA A;  3U4Y A;  3MKQ A;  4X61 B;  2YB8 B;  3UVK A;  3DXK C;  2H9P A;  5A2Q g;  4JSV C;  4J8B A;  4CY1 A;  2IUQ A;  4NSX A;  2H68 A;  3OGL B;  1TYQ C;  1RI6 A;  3A0F A;  5SXM A;  4GQ1 A;  5TDH B;  2H6N A;  3UR4 A;  4JD2 C;  3PSL A;  3SXT D;  3C5M A;  4J0X A;  4ERZ A;  5K19 A;  4I79 A;  3OKT A;  4O3T B;  4GM9 A;  2I3T A;  4CZY A;  5FKS A;  4O9D A;  3DM0 A;  4ZOX A;  1LDK E;  3N0E A;  4A09 B;  3SFZ A;  4N14 A;  1PEV A;  2CN3 A;  4J73 A;  3RRM C;  1K32 A;  3FM0 A;  5I5I A;  3MZK A;  3OTT A;  4L3G D;  4K3J B;  2IUV A;  2W18 A;  3BWS A;  3NVN A;  1N6D A;  1NR0 A;  2OVP B;  5HE3 B;  2IWK A;  3C9C A;  4Y5R D;  2XL3 A;  2CNX A;  4JSP C;  4A0B B;  1L0Q A;  2Z2P A;  4FA4 D;  4A09 A;  2H9M A;  4KFM B;  3EI2 B;  3C6P B;  1P22 A;  2PM7 B;  4JXM A;  2YNN A;  4GM8 A;  2I3S A;  3I7N A;  2Z2N A;  3GRE A;  3FGB A;  3CFS B;  5JWZ A;  2MTA H;  2P9L C;  4J79 A;  3I7P A;  4A7J A;  4OWR A;  4A11 B;  1NEX B;  4Y7R A;  2YMU A;  3KRW B;  5TF2 A;  3UVO A;  1VYH C;  3PXT D;  3KRX B;  2CE8 A;  3RN1 D;  2P1Q B;  2OJY A;  5HYN B;  3OL2 B;  3SBR A;  1ERJ A;  1K8K C;  2UZY B;  4CZV A;  3JRP A;  4O3U B;  2AQ5 A;  3MKS B;  4LGN A;  1SQ9 A;  3AH8 B;  5CYK A;  2AGW A;  3EI3 A;  4A11 A;  1GP2 B;  5H17 A;  5FKQ A;  4PSW B;  3JB9 L;  2TRC B;  4LG8 A;  4J0W A;  3UVL A;  3IIW A;  3P4F A;  2H9L A;  2Z2O A;  3OL2 A;  4FA9 D;  4JSX C;  4CI8 A;  2PM6 B;  3CFV A;  4XYH A;  4X63 B;  1Q47 A;  2OVQ B;  4E54 B;  2B4E A;  5EAL A;  4J8G A;  2CO0 C;  4BH6 A;  4AEZ A;  3K27 A;  5B4W A;  3C6N B;  3ORV D;  3JZH A;  3UKR C;  3IJ0 A;  2H6Q A;  5IT9 g;  2XU7 A;  1S4U X;  3NVQ A;  2YNP A;  5EM2 B;  2P9S C;  3C75 H;  1GXR A;  4D0K A;  1N6E A;  3AFC A;  3ULE C;  1MDA H;  2O9K A;  5EMK B;  3V9F A;  2H47 A;  4AOW A;  4E54 A;  3EI4 B;  4J86 A;  2AGL A;  4L1Q D;  4BUJ C;  2J57 G;  1GOT B;  2IUR A;  3SN6 B;  3J81 g;  2Q7Q A;  3VA6 A;  4PSX B;  3RFG A;  4QL1 A;  3DWL C;  1PI6 A;  5IJ8 E;  1FS1 A;  3SHF A;  4O45 A;  4GMB A;  3OKY B;  3PVU B;  4QT8 A;  3JRO A;  4PBZ A;  4J82 A;  1R5M A;  2HJ4 A;  4QQE A;  5GXH A;  4U1E I;  1YFQ A;  4GGA A;  4GQB B;  5HE0 B;  3OW8 A;  3WSO A;  5EAR A;  5KDO B;  1A0R B;  3VH0 A;  3AL8 B;  3EWE A;  2P9N C;  5IGO A;  3OKY A;  2AGY A;  2P9I C;  4CC9 A;  4JT5 C;  3IJC A;  1OLZ A;  2BCJ B;  2PM9 B;  1XIP A;  4CY2 A;  4CY3 A;  3SBQ A;  4YVD A;  3IIY A;  3F3P A;  2OK6 A;  5I5M A;  2H3X A;  2HKM A;  4A0B A;  5FKR A;  5FA5 B;  5CXC B;  5FLX g;  4FWW A;  4H5J A;  3RMZ D;  3EI2 A;  4CI1 A;  3EU7 A;  4A2M A;  3L4O D;  2UZX B;  2OVR B;  2J56 H;  3EG6 A;  1PGU A;  5AMS A;  3EI1 B;  1TBG A;  3PXW D;  5IC7 A;  3I8E A;  5IJ7 E;  2P1P B;  2PM9 A;  2I0R A;  1N6F A;  4IMM A;  5EAP A;  2I0T A;  3MZL A;  5GXI A;  4EWR A;  3OKW A;  5EML B;  3RSE C;  5TEE A;  4A0A B;  2H13 A;  5AJA A;  4ZOZ A;  5TEF A;  2P9P C;  4J81 A;  3MMY A;  3DSM A;  2XYI A;  3VGZ A;  2P9U C;  4ERY A;  5FXY A;  3SLE D;  4FA5 D;  3DXM C;  1FWX A;  4X3E A;  3RN0 D;  4Z8L A;  4MK0 B;  4A2L A;  2IUP A;  2AGZ A;  3I7K A;  3NVX A; 
#chains in the Genus database with same CATH topology
 4FAV D;  2J55 H;  3IUJ A;  4GM3 A;  5HE1 B;  5M5U A;  4J87 A;  1Q9Y A;  2H6K A;  1FYZ E;  5E6S A;  3I8C A;  1MG3 A;  5AFU 3;  4OZU A;  1U2V C;  1H2W A;  4M3T A;  3DDU A;  2DEB A;  2LF3 A;  2HYE A;  2HXC A;  5FKT A;  3QEX A;  4KHN A;  3JZG A;  4ZOY A;  5HE2 B;  3SUN A;  4E5Z B;  2HES X;  3UO3 A;  1PBY B;  1MHZ G;  1XMF E;  4ZN4 A;  1O6G A;  2GC7 A;  1XU5 E;  4DTJ A;  4I6J B;  2DTU A;  2P1M B;  5IRE A;  4ZOV A;  3SQ4 A;  5EAM A;  4U7A A;  4JHP C;  4Z7N A;  4JRQ A;  2YNO A;  4L3H D;  4L9O A;  2I0S A;  3CIK B;  1FZH E;  3C6O B;  2PBI B;  2VDL A;  3JZN A;  4LG9 A;  5EM2 A;  4FA1 D;  5IZ7 A;  3NHG A;  2QC5 A;  3AL9 A;  3NDK A;  4MMY A;  3J27 A;  3IUL A;  1OMW B;  4FJM A;  3SVW D;  4HCC A;  2B5N A;  4K3I D;  2E31 A;  4WK2 A;  5C2W B;  3SWS D;  1GOG A;  4E5Z A;  3E0C A;  3TL8 B;  4FAN D;  3EI4 A;  3MUO A;  4KI6 A;  4IRZ A;  3EQ7 A;  4ADN A;  3C99 A;  3L0M A;  3I89 A;  2B5M A;  2H14 A;  4DU4 A;  4PXW A;  5K1C C;  2B5L A;  1XMG E;  1XVE E;  1MG2 A;  4JHN A;  3NIG A;  1QNI A;  2E32 A;  3ZDZ A;  3I7O A;  1FPO A;  5I5J A;  4CI2 A;  2XE4 A;  2JQT A;  3NE6 A;  3QES A;  3MXX A;  3TAB A;  4L1M A;  3K26 A;  3PE7 A;  4XYI A;  3V7D B;  3SJL D;  3ODT A;  3PSC B;  4IA9 A;  2OK4 A;  1XVC E;  2ATQ A;  3KCI A;  2AH1 A;  2VDM A;  4DTS A;  2VZ1 A;  1IG9 A;  4CZX A;  4PBY A;  4PC0 A;  2EBS A;  3ZDY A;  4ES0 A;  2CN2 A;  3PVW B;  3W15 A;  3N1B A;  5H14 A;  3RFH A;  5CXB B;  3UVN A;  3QEW A;  1XVF E;  3ZWL B;  1JMZ B;  3F3G A;  1UOP A;  3V4V A;  4CI3 A;  4UI9 R;  3IUQ A;  1SHY B;  3T3M A;  3RWU A;  3IUN A;  2JPN A;  1FZI E;  4AMZ A;  3GFC A;  3RMD A;  3PXS D;  4PNK B;  4JRP A;  4FJN A;  3I7L A;  5IBK B;  3SBP A;  4GZ8 A;  4JSN C;  4BP8 A;  3AL8 A;  3BVO A;  4NEN A;  2XL2 A;  2P1N B;  2HKR A;  4FB1 D;  4DTN A;  3OGK B;  1QFS A;  4J2A A;  4JT6 C;  3C95 A;  4UM9 A;  3B7F A;  3I7H A;  4FJL A;  4A08 B;  5CYK B;  3L4M D;  2G9A A;  3EI3 B;  5CXB A;  4J84 A;  2VZ3 A;  4Z7Q A;  5C2V B;  3I2N A;  3QET A;  4MMX A;  3IKO A;  1XKS A;  3HL8 A;  5EMJ B;  1B9X A;  2VDN A;  4CY5 A;  4BL0 A;  4AX4 A;  2P1O B;  2P5G A;  3HFQ A;  4QRJ A;  5H1M A;  4HCB A;  3UKU C;  3UVM A;  1JJU B;  2QZP A;  3L2O B;  2WQ8 A;  5E6R A;  3NAE A;  4HDJ A;  5GMK n;  4G56 B;  3EQ8 A;  4O1Q D;  4M3U A;  4GQ2 P;  3SCY A;  5CXC A;  2G99 A;  4WJK A;  2JHC A;  5HQG A;  3JAM g;  4DTR A;  1SQJ A;  1XHM A;  4D9S A;  4TZ4 A;  2H9N A;  1WAJ A;  2B8I A;  1U4C A;  4J77 A;  4QNC A;  4FJH A;  4XEI C;  3V5W B;  4GGD A;  2B1E A;  4A08 A;  3EI1 A;  2IWF A;  2GNQ A;  4H5I A;  2CE9 A;  3EMH A;  1XMH E;  5H37 A;  4Z7O A;  1FZ7 E;  2AGX A;  3BG0 A;  3RLM D;  3N0D A;  3LDB A;  3JPX A;  3BG1 A;  2QXV A;  2OIZ A;  2P9K C;  2CO0 A;  5EMM B;  5IGQ A;  1FZ3 E;  3OGM B;  3SUO A;  3IJ1 A;  4X60 B;  5FQD A;  1VZ2 A;  4R7A B;  4BP9 A;  4X5M A;  2OYQ A;  4GGC A;  4J2E A;  1GG2 B;  3SJJ A;  3TAG A;  4RNG A;  1B9Y A;  1JMX B;  2HJB A;  3F3F A;  1JOF A;  3FRX A;  1VE6 A;  5GSA A;  4A0A A;  3RMA A;  2YBA A;  4AKI A;  2AH0 A;  3N1E A;  3J80 g;  5C9Z B;  3E4Y A;  4ERQ A;  2BBK H;  4ESG A;  2GC4 A;  1A12 A;  4FHL A;  1O6F A;  5HDB A;  4ICG C;  4J78 A;  4D6V A;  5THA A;  5M61 A;  4DTM A;  3SMR A;  2IAA A;  3U4Y A;  3MKQ A;  4X61 B;  2QXF A;  2YB8 B;  5FFO A;  3UVK A;  3DXK C;  2H9P A;  4M3Y A;  5A2Q g;  4JSV C;  4J8B A;  4AN1 A;  4CY1 A;  3SVI A;  2JHA A;  2IUQ A;  4NSX A;  3QEI A;  3OGL B;  2H68 A;  1H2X A;  1TYQ C;  2EID A;  1RI6 A;  4FJ5 A;  3LDS A;  3KD1 E;  4BCB A;  3A0F A;  5SXM A;  4GQ1 A;  1UOO A;  4EP9 A;  3SI6 A;  3NCI A;  1GOH A;  1WAF A;  3V4P A;  3HGL A;  4FJI A;  2YB5 A;  5TDH B;  2H6N A;  3UR4 A;  4EYW A;  4JD2 C;  3PSL A;  3SXT D;  3C5M A;  4J0X A;  4ERZ A;  5M5T A;  4GAM C;  5K19 A;  4I79 A;  4AKH A;  4FJ8 A;  4MMZ A;  3OKT A;  4O3T B;  4GM9 A;  2I3T A;  4CZY A;  3E4W A;  5FKS A;  3UIQ A;  4O9D A;  2PFV A;  1VE7 A;  1Q9X A;  3DM0 A;  4QAM A;  4M3R A;  4ZOX A;  1LDK E;  2MZW B;  3N0E A;  2LF6 A;  5M5S A;  4A09 B;  3TAF A;  3SFZ A;  4N14 A;  1PEV A;  2CN3 A;  4J73 A;  4DNW A;  3RRM C;  1K32 A;  3FM0 A;  5I5I A;  3MZK A;  3OTT A;  4DNV A;  2OZS A;  4L3G D;  4K3J B;  4DU3 A;  1E8M A;  2IUV A;  2W18 A;  3BWS A;  3CQ8 A;  3SPY A;  2EIE A;  1FZ1 E;  3TAE A;  4I9Q A;  3NVN A;  1N6D A;  1NR0 A;  2OVP B;  2K5S A;  3I7K A;  5HE3 B;  2IWK A;  3C9C A;  4Y5R D;  1FZ8 E;  2XL3 A;  2CNX A;  4JSP C;  4A0B B;  4B08 A;  1T2X A;  1L0Q A;  2Z2P A;  3ZDX A;  4FA4 D;  2H9M A;  4A09 A;  4KFM B;  3EI2 B;  1P22 A;  3C6P B;  2PM7 B;  4QND A;  3SNN A;  2PFT A;  1E5T A;  4FJ9 A;  2BKL A;  4JXM A;  2H4T A;  1FZ5 E;  2YNN A;  4GM8 A;  2I3S A;  3I7N A;  2Z2N A;  3GRE A;  3FGB A;  3CFS B;  3O4H A;  5JWZ A;  3J2P A;  2MTA H;  2QR5 A;  4M3X A;  2P9L C;  4J79 A;  4AI6 A;  1L5G A;  3I7P A;  4A7J A;  1MTY G;  3LZJ A;  4OWR A;  4A11 B;  1NEX B;  4Y7R A;  2YMU A;  3KRW B;  3O4I A;  5TF2 A;  1IH7 A;  1MHY G;  3L1N A;  3UVO A;  4X5N A;  1VYH C;  3PXT D;  3KRX B;  1TYE A;  2CE8 A;  3O4J A;  3RN1 D;  1FZ2 E;  3IUM A;  2P1Q B;  1QFM A;  2OJY A;  1FZ4 E;  3TJY A;  4M45 A;  4FK4 A;  2VDQ A;  3LD8 A;  3OL2 B;  5HYN B;  3SBR A;  1I2M B;  1ERJ A;  1K8K C;  2UZY B;  2VDK A;  3CFO A;  3HP9 A;  4CZV A;  3CFP A;  3IUR A;  3CFR A;  3JRP A;  2HU8 A;  3RMC A;  4O3U B;  2AQ5 A;  3MKS B;  2XZG A;  2VDR A;  4LGN A;  1SQ9 A;  4FK2 A;  3AH8 B;  4NAA A;  5CYK A;  2AGW A;  3EI3 A;  4RE5 A;  4A11 A;  2DY4 A;  1GP2 B;  1UOQ A;  4JS4 A;  4J2D A;  5FKQ A;  5H17 A;  4RG8 A;  4DU1 A;  5FFG A;  4PSW B;  3QNN A;  3JB9 L;  2TRC B;  4LG8 A;  1YR2 A;  4J0W A;  3UVL A;  4ADO A;  3IIW A;  3P4F A;  2H9L A;  3SQ1 A;  2Z2O A;  3K2O A;  3OL2 A;  4JSX C;  4FA9 D;  2PM6 B;  4IT5 A;  4CI8 A;  4NBM A;  3CFV A;  4XYH A;  1FXX A;  3ZE0 A;  4X63 B;  2EIB A;  2XDW A;  4JS5 A;  1Q47 A;  2OVQ B;  4E54 B;  2B4E A;  5EAL A;  4J8G A;  2CO0 C;  4BH6 A;  4KHY A;  4AEZ A;  3K27 A;  4FJ7 A;  3C6N B;  4FK0 A;  1M1X A;  3EQ9 A;  3JZH A;  3ORV D;  5B4W A;  3UKR C;  3IJ0 A;  2H6Q A;  4WK4 A;  2EIC A;  5IT9 g;  2HU7 A;  1GOF A;  2XU7 A;  1S4U X;  3GC3 B;  4DTX A;  5M5V A;  3NVQ A;  2YNP A;  5EM2 B;  2VDO A;  2VJ4 A;  1H2Z A;  3L8B A;  2P9S C;  3C75 H;  1GXR A;  3FCU A;  3MVD K;  2JKX A;  4D0K A;  1N6E A;  3AFC A;  3ULE C;  2HD0 A;  1JW2 A;  1C9L A;  5M5R A;  4DNU A;  1MDA H;  2O9K A;  3IJE A;  3NID A;  1FZ0 E;  1XL3 C;  4E4B A;  5EMK B;  3V9F A;  2H47 A;  4M41 A;  3T3P A;  4AOW A;  4E54 A;  3EI4 B;  4J86 A;  2AGL A;  1C9I A;  3VI4 A;  4DTP A;  4L1Q D;  4BUJ C;  1K3I A;  2J57 G;  5C86 A;  1GOT B;  4KI4 A;  2IUR A;  3K72 A;  3SQ2 A;  3SN6 B;  3J81 g;  4O02 A;  3SQ0 A;  2RKH A;  2Q7Q A;  3OF7 A;  3VA6 A;  3NGI A;  4PSX B;  3RFG A;  3QEP A;  4FJJ A;  3ZE2 A;  4QL1 A;  3DWL C;  1PI6 A;  1UTC A;  3QEV A;  5IJ8 E;  2VDP A;  3GD1 I;  4WK0 A;  1FS1 A;  3SHF A;  4DTU A;  4RE6 A;  4AN0 A;  4KHQ A;  4O45 A;  2JH8 A;  2FYO A;  4GMB A;  3OKY B;  3PVU B;  4QT8 A;  2MW2 A;  1XVB E;  4KHW A;  1U8C A;  3JRO A;  3K71 A;  4PBZ A;  4J82 A;  3QNO A;  1R5M A;  2HJ4 A;  2VC2 A;  4QQE A;  5GXH A;  3S9H A;  2P5O A;  1BPO A;  1VZ3 A;  4UM8 A;  2JHP A;  4U1E I;  1JTD B;  1YFQ A;  4GGA A;  4GQB B;  5HE0 B;  3OW8 A;  3WSO A;  5EAR A;  3FCS A;  5KDO B;  1A0R B;  3VH0 A;  3AL8 B;  3EWE A;  2RCU A;  2OZM A;  3HGK E;  3O4G A;  3C94 A;  2P9N C;  1XVG E;  4E3S A;  5IGO A;  3OKY A;  2AGY A;  2P9I C;  2FW3 A;  4RL5 A;  1XVD E;  4CC9 A;  4JT5 C;  3IJC A;  1OLZ A;  2BCJ B;  2PM9 B;  4DTO A;  1XIP A;  4CY2 A;  4CY3 A;  4AMY A;  4G1E A;  3SBQ A;  4G1M A;  4YVD A;  3IIY A;  1JV2 A;  1H2Y A;  3F3P A;  2OK6 A;  3MUN A;  5I5M A;  1FZ9 E;  3QER A;  2H3X A;  2HKM A;  3NIF A;  4O2W A;  4A0B A;  5FKR A;  3QI0 A;  5CXC B;  5FA5 B;  5FLX g;  4FWW A;  4H5J A;  4KHS A;  3RMZ D;  3EI2 A;  4CI1 A;  1N1C A;  3EU7 A;  4A2M A;  3L4O D;  2MMB A;  2UZX B;  2OVR B;  2B7M A;  4NC4 A;  4FJX A;  2J56 H;  1FZ6 E;  3EG6 A;  3QHY B;  5E6U A;  1PGU A;  5AMS A;  4BCC A;  3EI1 B;  1TBG A;  4EPH A;  3PXW D;  5IC7 A;  3I8E A;  1MMO G;  4FJK A;  5IJ7 E;  2P1P B;  2PM9 A;  3SUP A;  2I0R A;  3VI3 A;  2VIX A;  3RMB A;  1N6F A;  4G55 A;  4J2B A;  4IMM A;  1E8N A;  3IVM A;  1XU3 E;  5EAP A;  2I0T A;  3MZL A;  3SPZ A;  5GXI A;  3KD5 E;  4FJG A;  2HU5 A;  4M42 A;  4EWR A;  3SUQ A;  3OKW A;  5EML B;  3RSE C;  5TEE A;  4A0A B;  2H13 A;  5AJA A;  4AKG A;  4ZOZ A;  3SCX A;  5TEF A;  2P9P C;  4J81 A;  3MMY A;  4BCD A;  3DSM A;  2XYI A;  3VGZ A;  2P9U C;  4ERY A;  2VJ5 A;  5FXY A;  3SLE D;  4FA5 D;  4I9L A;  3DXM C;  1FWX A;  4X3E A;  2JH9 A;  3LZI A;  3RN0 D;  4Z8L A;  5C92 A;  4MK0 B;  1CLQ A;  4A2L A;  4FVM A;  4M3Z A;  3K6S A;  4KHU A;  2IUP A;  3ZE1 A;  2AGZ A;  3UO2 A;  4M3W A;  3NVX A; 
#chains in the Genus database with same CATH homology
 4FAV D;  2J55 H;  4GM3 A;  5HE1 B;  4J87 A;  1Q9Y A;  2H6K A;  1FYZ E;  3I8C A;  1MG3 A;  5AFU 3;  4OZU A;  1U2V C;  2HYE A;  4M3T A;  2DEB A;  2LF3 A;  2HXC A;  5FKT A;  3QEX A;  4KHN A;  3JZG A;  4ZOY A;  5HE2 B;  3SUN A;  4E5Z B;  2HES X;  1PBY B;  1MHZ G;  1XMF E;  4ZN4 A;  2GC7 A;  1XU5 E;  4DTJ A;  4I6J B;  2DTU A;  2P1M B;  5IRE A;  4ZOV A;  3SQ4 A;  5EAM A;  4U7A A;  4JRQ A;  2YNO A;  4L3H D;  4L9O A;  2I0S A;  3CIK B;  3C6O B;  1FZH E;  2PBI B;  3JZN A;  4LG9 A;  5EM2 A;  4FA1 D;  5IZ7 A;  3NHG A;  2QC5 A;  3AL9 A;  3NDK A;  3J27 A;  1OMW B;  4FJM A;  3SVW D;  4HCC A;  2B5N A;  4K3I D;  2E31 A;  5C2W B;  3SWS D;  4E5Z A;  3E0C A;  3TL8 B;  4FAN D;  3EI4 A;  4KI6 A;  4ADN A;  3C99 A;  3L0M A;  3I89 A;  2B5M A;  2H14 A;  4DU4 A;  4PXW A;  5K1C C;  2B5L A;  1XMG E;  1XVE E;  1MG2 A;  1QNI A;  2E32 A;  3I7O A;  5I5J A;  4CI2 A;  3NE6 A;  3QES A;  3MXX A;  3TAB A;  3K26 A;  3PE7 A;  4XYI A;  3V7D B;  3SJL D;  3ODT A;  3PSC B;  4IA9 A;  2OK4 A;  1XVC E;  2ATQ A;  2AH1 A;  4DTS A;  1IG9 A;  4CZX A;  4PBY A;  4PC0 A;  2EBS A;  4ES0 A;  2CN2 A;  3PVW B;  3W15 A;  3N1B A;  5H14 A;  3RFH A;  5CXB B;  3UVN A;  3QEW A;  1XVF E;  3ZWL B;  1JMZ B;  3F3G A;  4CI3 A;  4UI9 R;  1SHY B;  3RWU A;  2JPN A;  1FZI E;  3GFC A;  3RMD A;  3PXS D;  4PNK B;  4JRP A;  4FJN A;  3I7L A;  5IBK B;  3SBP A;  4GZ8 A;  4JSN C;  3AL8 A;  2XL2 A;  2P1N B;  2HKR A;  4FB1 D;  4DTN A;  3OGK B;  4J2A A;  4JT6 C;  3C95 A;  3B7F A;  3I7H A;  4FJL A;  4A08 B;  5CYK B;  3L4M D;  2G9A A;  3EI3 B;  5CXB A;  4J84 A;  5C2V B;  3I2N A;  3QET A;  5EMJ B;  3IKO A;  1XKS A;  3HL8 A;  1B9X A;  4CY5 A;  4BL0 A;  2P1O B;  2P5G A;  3HFQ A;  4QRJ A;  5H1M A;  4HCB A;  3UKU C;  3UVM A;  1JJU B;  3L2O B;  3NAE A;  4HDJ A;  5GMK n;  4G56 B;  4O1Q D;  4M3U A;  4GQ2 P;  3SCY A;  5CXC A;  2G99 A;  5HQG A;  2JHC A;  3JAM g;  4DTR A;  1SQJ A;  1XHM A;  4TZ4 A;  2H9N A;  1WAJ A;  2B8I A;  1U4C A;  4J77 A;  4QNC A;  4FJH A;  4XEI C;  3V5W B;  4GGD A;  2B1E A;  4A08 A;  3EI1 A;  2IWF A;  2GNQ A;  4H5I A;  2CE9 A;  3EMH A;  1XMH E;  5H37 A;  1FZ7 E;  2AGX A;  3BG0 A;  3RLM D;  3N0D A;  3LDB A;  3JPX A;  3BG1 A;  2QXV A;  2OIZ A;  2P9K C;  2CO0 A;  5EMM B;  5IGQ A;  1FZ3 E;  3OGM B;  3SUO A;  3IJ1 A;  4X60 B;  5FQD A;  4R7A B;  4X5M A;  2OYQ A;  4GGC A;  4J2E A;  1GG2 B;  3SJJ A;  3TAG A;  4RNG A;  1B9Y A;  1JMX B;  2HJB A;  3F3F A;  1JOF A;  3FRX A;  5GSA A;  4A0A A;  3RMA A;  2YBA A;  4AKI A;  2AH0 A;  3N1E A;  3J80 g;  5C9Z B;  3E4Y A;  4ERQ A;  2BBK H;  4ESG A;  2GC4 A;  4FHL A;  4J78 A;  4D6V A;  5THA A;  4DTM A;  3SMR A;  2IAA A;  3U4Y A;  3MKQ A;  4X61 B;  2QXF A;  2YB8 B;  3UVK A;  3DXK C;  2H9P A;  4M3Y A;  5A2Q g;  4JSV C;  4J8B A;  4CY1 A;  3SVI A;  2JHA A;  2IUQ A;  4NSX A;  3QEI A;  3OGL B;  2H68 A;  1TYQ C;  1RI6 A;  4FJ5 A;  3LDS A;  3KD1 E;  3A0F A;  5SXM A;  4GQ1 A;  4EP9 A;  3SI6 A;  3NCI A;  1WAF A;  3HGL A;  4FJI A;  2YB5 A;  5TDH B;  2H6N A;  3UR4 A;  4EYW A;  4JD2 C;  3PSL A;  3SXT D;  3C5M A;  4J0X A;  4ERZ A;  4GAM C;  5K19 A;  4I79 A;  4AKH A;  4FJ8 A;  3OKT A;  4O3T B;  4GM9 A;  2I3T A;  4CZY A;  3E4W A;  5FKS A;  3UIQ A;  4O9D A;  2PFV A;  3DM0 A;  1Q9X A;  4ZOX A;  4M3R A;  1LDK E;  2MZW B;  3N0E A;  2LF6 A;  4A09 B;  3TAF A;  3SFZ A;  4N14 A;  1PEV A;  2CN3 A;  4J73 A;  3RRM C;  1K32 A;  3FM0 A;  5I5I A;  3MZK A;  3OTT A;  2OZS A;  4L3G D;  4K3J B;  4DU3 A;  2IUV A;  2W18 A;  3BWS A;  3CQ8 A;  3SPY A;  1FZ1 E;  3TAE A;  4I9Q A;  3NVN A;  1N6D A;  1NR0 A;  2OVP B;  5HE3 B;  2IWK A;  3C9C A;  4Y5R D;  1FZ8 E;  2XL3 A;  2CNX A;  4JSP C;  4A0B B;  4B08 A;  1L0Q A;  2Z2P A;  4FA4 D;  4A09 A;  2H9M A;  4KFM B;  3EI2 B;  1P22 A;  3C6P B;  2PM7 B;  4QND A;  3SNN A;  2PFT A;  4FJ9 A;  4JXM A;  2H4T A;  1FZ5 E;  2YNN A;  4GM8 A;  2I3S A;  3I7N A;  2Z2N A;  3GRE A;  3FGB A;  3CFS B;  5JWZ A;  3J2P A;  2MTA H;  4M3X A;  2P9L C;  4J79 A;  4AI6 A;  3I7P A;  4A7J A;  1MTY G;  3LZJ A;  4OWR A;  4A11 B;  1NEX B;  4Y7R A;  2YMU A;  3KRW B;  5TF2 A;  1IH7 A;  1MHY G;  3L1N A;  3UVO A;  4X5N A;  1VYH C;  3PXT D;  3KRX B;  2CE8 A;  3RN1 D;  1FZ2 E;  2P1Q B;  2OJY A;  1FZ4 E;  3TJY A;  4M45 A;  4FK4 A;  5HYN B;  3LD8 A;  3OL2 B;  3SBR A;  1ERJ A;  1K8K C;  2UZY B;  3CFO A;  3HP9 A;  4CZV A;  3CFP A;  3CFR A;  3JRP A;  3RMC A;  4O3U B;  2AQ5 A;  3MKS B;  4LGN A;  1SQ9 A;  4FK2 A;  3AH8 B;  5CYK A;  2AGW A;  3EI3 A;  4A11 A;  2DY4 A;  1GP2 B;  4JS4 A;  4J2D A;  5FKQ A;  5H17 A;  4RG8 A;  4DU1 A;  4PSW B;  3QNN A;  3JB9 L;  2TRC B;  4LG8 A;  4J0W A;  3UVL A;  4ADO A;  3IIW A;  3P4F A;  2H9L A;  3SQ1 A;  2Z2O A;  3K2O A;  3OL2 A;  4JSX C;  4FA9 D;  2PM6 B;  4CI8 A;  3CFV A;  4XYH A;  1FXX A;  4X63 B;  4JS5 A;  1Q47 A;  2OVQ B;  4E54 B;  2B4E A;  5EAL A;  4J8G A;  2CO0 C;  4BH6 A;  4KHY A;  4AEZ A;  3K27 A;  4FJ7 A;  3C6N B;  4FK0 A;  3JZH A;  3ORV D;  5B4W A;  3UKR C;  3IJ0 A;  2H6Q A;  5IT9 g;  2XU7 A;  1S4U X;  4DTX A;  3NVQ A;  2YNP A;  5EM2 B;  2VJ4 A;  3L8B A;  2P9S C;  3C75 H;  1GXR A;  4D0K A;  1N6E A;  3AFC A;  3ULE C;  2HD0 A;  1MDA H;  2O9K A;  1FZ0 E;  1XL3 C;  4E4B A;  5EMK B;  3V9F A;  2H47 A;  4M41 A;  4AOW A;  4E54 A;  3EI4 B;  4J86 A;  2AGL A;  4DTP A;  4L1Q D;  4BUJ C;  2J57 G;  1GOT B;  4KI4 A;  2IUR A;  3SQ2 A;  3SN6 B;  3J81 g;  3SQ0 A;  2Q7Q A;  3VA6 A;  3NGI A;  4PSX B;  3RFG A;  3QEP A;  4FJJ A;  4QL1 A;  3DWL C;  1PI6 A;  3QEV A;  5IJ8 E;  1FS1 A;  3SHF A;  4DTU A;  4KHQ A;  4O45 A;  2JH8 A;  2FYO A;  4GMB A;  3OKY B;  3PVU B;  4QT8 A;  1XVB E;  4KHW A;  3JRO A;  4PBZ A;  4J82 A;  3QNO A;  1R5M A;  2HJ4 A;  4QQE A;  5GXH A;  3S9H A;  2P5O A;  2JHP A;  4U1E I;  1YFQ A;  4GGA A;  4GQB B;  5HE0 B;  3OW8 A;  3WSO A;  5EAR A;  5KDO B;  1A0R B;  3VH0 A;  3AL8 B;  3EWE A;  2RCU A;  2OZM A;  3HGK E;  3C94 A;  2P9N C;  1XVG E;  4E3S A;  5IGO A;  3OKY A;  2AGY A;  2P9I C;  2FW3 A;  4RL5 A;  1XVD E;  4CC9 A;  4JT5 C;  3IJC A;  1OLZ A;  2BCJ B;  2PM9 B;  4DTO A;  1XIP A;  4CY2 A;  4CY3 A;  3SBQ A;  4YVD A;  3IIY A;  3F3P A;  2OK6 A;  5I5M A;  1FZ9 E;  3QER A;  2H3X A;  2HKM A;  4A0B A;  5FKR A;  5FA5 B;  5CXC B;  5FLX g;  4FWW A;  4H5J A;  4KHS A;  3RMZ D;  3EI2 A;  4CI1 A;  3EU7 A;  4A2M A;  3L4O D;  2MMB A;  2UZX B;  2OVR B;  2B7M A;  4FJX A;  2J56 H;  1FZ6 E;  3EG6 A;  1PGU A;  5AMS A;  3EI1 B;  1TBG A;  4EPH A;  3PXW D;  5IC7 A;  3I8E A;  1MMO G;  4FJK A;  5IJ7 E;  2P1P B;  2PM9 A;  3SUP A;  2I0R A;  2VIX A;  3RMB A;  1N6F A;  4J2B A;  4IMM A;  1XU3 E;  5EAP A;  2I0T A;  3MZL A;  3SPZ A;  5GXI A;  3KD5 E;  4FJG A;  4M42 A;  4EWR A;  3SUQ A;  3OKW A;  5EML B;  3RSE C;  5TEE A;  4A0A B;  2H13 A;  5AJA A;  4AKG A;  4ZOZ A;  3SCX A;  5TEF A;  2P9P C;  4J81 A;  3MMY A;  3DSM A;  2XYI A;  3VGZ A;  2P9U C;  4ERY A;  2VJ5 A;  5FXY A;  3SLE D;  4FA5 D;  4I9L A;  3DXM C;  1FWX A;  4X3E A;  2JH9 A;  3LZI A;  3RN0 D;  4Z8L A;  4MK0 B;  1CLQ A;  4A2L A;  4FVM A;  4M3Z A;  4KHU A;  2IUP A;  2AGZ A;  3I7K A;  4M3W A;  3NVX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...