2OVSA

Crystal strcuture of a type three secretion system protein
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
118
structure length
118
Chain Sequence
b'GLVPRGSMIMKDGIYSIIFISNEDSCGEGILIKNGNMITGGDIASVYQGVLSEDEDIILHVHRYNYEIPSVLNIEQDYQLVIPKKVLSNDNNLTLHCHVRGNEKLFVDVYAKFIEPLV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L0044
publication title Structure of GrlR and the implication of its EDED motif in mediating the regulation of type III secretion system in EHEC.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Gene regulation, ligand binding protein
total genus 20
structure length 118
sequence length 118
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16518 GrlR T3SS negative regulator,GrlR
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.380 Mainly Beta Beta Barrel Lipocalin Lipocalin 2ovsA00
3E3CA 2OVSA 4KT5A
chains in the Genus database with same CATH superfamily
4IMNA 2RQ0A 3B2IA 2BS6A 4MIRA 3HK1A 3O2YA 4I95A 4QRLA 3D9WA 3EW2A 4XMCA 4GDAA 3ZW0B 5L8OA 3EC5A 4TKJA 1NQMA 2JMBA 2A2UA 1SWKA 4GKCA 1HXLA 2Y3FA 3KFHA 5FQ6E 2FLJA 3RBYA 4ZH9A 1RSUB 4NNSA 5HA1A 1HN2A 3WJDA 4ZHHA 4XMHA 4O4OA 3TGBA 3HOLA 1SY3A 2LA7A 3SLOA 1JJJA 1I05A 1JV4A 3JS1A 1IIUA 3FW5A 4I3BA 1LCWA 2CZUA 2ZAGA 3S60A 4ZFXA 2NNQA 4YGGA 3APWA 4EFGA 3CWKA 4GNYA 3ZW2A 4GGRA 1VWKB 2EU7X 5B29A 1KT7A 3ZUIA 3AKNA 1FE3A 5HTEA 3BLGA 4LKTA 3RDUA 3FA9A 2IZIA 4MEEA 3WOVA 3OE3A 5F1EA 3VG5A 3HOEA 3VHMA 4ORWA 4BGFA 4QZTA 4ZGFA 4CDFA 2OF8A 1KFFA 3LTWA 5JD2A 3SLJA 3ZZVA 4YDAA 4YMYA 2AT6X 3JQOA 3BY0A 1Y0GA 3STNA 1YWCA 1SREA 2FS6A 1CBSA 1IFCA 2Q4NA 5DG4A 2G7BA 4IBAA 4ALBA 2CAMA 5IO5A 4O9SA 1LIFA 1MM9A 4YGZA 2BC3A 2FTBA 4OS0A 2G5LA 1CBIA 3IFBA 1YUPA 4BX5B 2I5ZO 3OJYC 1KGLA 4DCBA 4OS3A 3P24A 4HPDA 1VWEB 2OZQA 2AT8X 2VFBA 3BS2A 4NW4A 2WQAE 4O4UA 4RUNA 3UEWA 1B4MA 3VG6A 1GKAA 5B5FA 2DJFA 2HNXA 3BU1A 1VWOB 2X4MA 4GGZA 1FJ1E 1X8OA 2W2AA 2ZAIA 5EEEA 1S2PA 1E5PA 1VYGA 2AT0X 1DZMA 2X8SA 4GJVA 1LCVA 3KZAA 2OL7A 2A5BA 4AZRA 2X8TA 4WFUA 4TKBA 1SXXA 1DC9A 1VWMB 2LKKA 1LPJA 5FQ7E 3PQSA 3VHHA 4IMOA 1X8NA 3HTYA 5KIDA 1JYDA 4QAEA 1OSPO 4WBKA 2W2FA 3FDCA 4BCSA 1MDCA 3KFIA 1MK5A 5F2BA 4FBRA 2HMBA 2Q2PA 4N7CA 1X8PA 2L68A 1HQQA 3P02A 2G8CO 3DSZA 2DM5A 3GAQA 1KT3A 3T2WA 3WJBA 3MM0A 1ICNA 4ZGUA 4ZHDA 3B2LA 1A18A 2G78A 1AB0A 2RA6A 4IRWA 5LJEA 2RCQA 3FEPA 3RDSA 4ZHFA 1N4JA 1FELA 1NDJA 4ZHCA 1AVEA 2VDFA 3FR2A 5KICA 1SXWA 5BVTA 4GU8A 5HZ5A 3F9DA 3FENA 2BSZA 3FIQA 4IAXA 2A2GA 4PJ2A 4JHQA 3UEVA 3C76X 1AELA 5HCDC 2WQ9A 1SWNA 1BRPA 3AEHA 1FTPA 1LFOA 1QWDA 1Y52X 3PQUA 4GGTA 4ARHA 5IRWA 2CZTA 1ZNHA 3SZHA 5IRAA 5H8TA 5C0NA 1OBQA 3NX2A 3Q34A 4U3QA 1IKEA 3CBCA 4GZVA 1BWYA 2Q39A 5D48A 2QOMA 3NQ3A 3CMPA 1TXLA 2OVEA 1EPBA 2FR2A 3FA7A 1VYOA 1YP7A 2AT3X 3D95A 3FR4A 4IABA 3D96A 1GX9A 1GM6A 2AH7X 3P6HA 1GT3A 2OVDA 1OBUA 1S7DA 3D97A 2QMIA 4WFVA 4Y59A 3CBSA 1G74A 4BX6A 2GTLM 3PH6A 4BJ8A 3VG4A 3E3CA 4DNEA 2FHLA 2IZGB 4ID2A 2R74A 3LV4A 4LZUA 1K24A 1LDQA 3B2JA 1RSTB 4O3ZA 3VE2A 2NP1A 3BSZE 5CHKA 2GTLO 3UEUA 1MEPA 3PECA 4CV7A 4LKPA 2X8FA 4O3YA 2A0AA 1CJ5A 2IZJA 2HZRA 2POAA 3I0AA 5JR8A 1UYNX 3T6LA 3ZI8A 5F6ZA 1U17A 2VFCA 5AQ6A 5HTDA 2MWHA 1X8UA 2BHVA 3HWDA 4L1NA 4L3RA 4ZH6A 4QGXA 2QOSC 1DF8A 2AMMX 3WJCA 2OL8O 1GKAB 3PP6A 1R0UA 2BT9A 3GE2A 5H9NA 5F58A 1ZNLA 3KQ0A 4OS8A 4FQBB 4D6AA 1X8QA 1EQDA 2RN4A 1SY0A 4I60A 5IXGA 3U9PC 1KOIA 4GJSA 4AZMA 1U0XA 1T68X 2WWPA 4YKOA 2DJGA 1ZRYA 1E06A 4BQUA 4ML7B 2X32A 3P6GA 3WJEA 1KXOA 4QZUA 4BBOA 1G5WA 1MX7A 2K62A 2XKLA 2FKGA 2GTLN 1NP4A 3D4RA 1ZNKA 4I3DA 5EDCA 5FFHA 4ORUA 4A60A 4AW8A 4CDDA 4EXZA 1BLRA 4GNWA 5IO7A 2IZDB 3KFFA 2BLGA 2GTFX 4NNTA 5AJCA 3NQKA 1BSQA 1LIDA 4KIIA 3RE6A 4Z6JA 1W6FA 2AT5X 3VE1A 1MX8A 2OFAA 1JZUA 3BX8A 4MVIA 4CPEA 1EXSA 1VWQB 3ZUOA 1HBQA 1BJ7A 1UZ2X 3WZNA 1GX3A 4Y5DA 3VGWA 2RTNB 2WUTA 2C1SA 2OFRX 2RTLA 1GX8A 1STPA 4O49A 4TKHA 4ZCBA 1SXYA 1Y9TA 1LNMA 1AVGI 4FBVA 4IAWA 3FA6A 2N93A 3K3LA 4OELA 1EW3A 3BX7A 1SLEB 1SY1A 2OVSA 5D45A 3ZQ3A 5LJHA 1UYOX 4A1HA 4CPFA 2JU7A 3HWFA 1VYFA 2Q2MA 3RE5A 5CSEA 4HFOA 1AVDA 1KL5A 1STRB 2OY1O 2A3FX 1LUQA 1LICA 1VWFB 5D4AA 4KC8A 2L67A 1EPAA 3U03A 1A57A 1MUPA 1DF3A 3PEDA 1KT4A 3FA8A 1DFVA 1SWAA 1PBOA 1HBPA 1SWJA 4ORRA 1B56A 4A8ZA 4DQ3A 1ML7A 5HZ6A 1E00A 5BVQA 3MVFA 3QKGA 4AZPA 2RTGB 3FIDA 3OBLA 1N9YA 2GH7A 1BM5A 1HQPA 4OKAA 1VPRA 1G7NA 3O19A 4IB9A 3SOTA 4BX6B 1IW2A 1SWLA 1RXKA 1ZNDA 5CE4A 1IFBA 3WJFA 4IB7A 4QYPA 2IZHB 1KZWA 4Z28A 3H3IA 1AQBA 5LJGA 3RDQA 4ZHGA 1SWCA 4EEJA 2LBVA 1MOYA 2PI3O 2QM9A 4YGHA 1NBXA 1BEBA 2A13A 1PMPA 3EYCA 4IB8A 5B27A 4AZNA 4M7MA 1KL4A 3MG5A 4BVMA 4YFQA 1OEJA 2C4IA 3MBTA 4JO6A 2I5VO 1KT5A 2RTRB 1RLBE 5IRUA 4LQZA 1SWHA 3IA8A 2FRSA 4GRJA 4C5PA 2OY7A 1Y55X 3RWXA 1KT6A 4YFPA 4ORYA 1PTSA 5KHPA 3P6CA 1O1VA 3STKA 3BRNA 1LIEA 2RTMA 1LDOA 5LKFA 4XMEA 4TQ2A 1SA8A 2OF9A 2QCBA 4MISA 2QO4A 1EIOA 1NGLA 4NYRA 3B2HA 1RXJA 4M6SA 1HMSA 2HKDA 3V8UA 4BX7A 1SXUA 4QGWA 3TGCA 5L3YA 3WBGA 4KH8A 5FQ8E 3WZQA 1JIWI 2GC9A 5FENA 2CM9A 4GD9A 1CBRA 5B10O 1X89A 1PEEA 4N7DA 2FS7A 4YVBA 4HWMA 5D8JA 4KT5A 4HPAA 2A8GA 5HCCC 5LJBA 5H9KA 2YMSA 4GETA 3U0DA 1OEEA 4YCHA 1VWNB 2UZ2A 3NADA 5LJKA 5FAZA 5H9LA 2HZQA 3EM0A 5K68A 3ZW1A 3WVMA 3WXQA 3B2KA 3L4RA 2RTDB 1SWDA 3S26A 2RCTA 2OY5O 1DZPA 1QQSA 2CBSA 1GT5A 3PK2A 5HZ9A 1SRFA 2CBRA 1VWAB 1TOUA 3APXA 1GT1A 1RBPA 2RTQB 2ZSCA 3FEKA 2HYSA 3TGAA 3O22A 1YWDA 3PPTA 4NLIA 4YCEA 4EQAC 5LKEA 2XSTA 4O4SA 5L8IA 2FKJA 1SMPI 1SRHA 1JYJA 5CYBA 4GDZA 1YIVA 4AZQA 2WSJA 3C77X 1VWBB 2FHNX 5L8NA 1PBYA 1TOWA 1BBPA 1JMZA 1MVGA 2FT9A 2GJ5A 3CQRA 1GT4A 3KFGA 1STSB 1SWSA 2WEXA 4O3WA 1VWHB 1ADLA 1LF7A 2KD2A 3HWEA 3LHNA 4Y0PA 3NP1A 4CSBA 1KZXA 1KL3A 3FW4A 1B8EA 1NP1A 1XCAA 1W4TA 1SWOA 2ASNX 3EW1A 3F6ZB 3FELA 4ORSA 4Y0QA 1SLFB 1JMXA 2OL6O 1SY2A 4ES7A 5HA0A 3SLTA 4I9RA 1BSOA 3CQNA 4AYHA 5BVSA 1HMTA 3S5XA 3TZSA 2CM4A 2RTCB 1QY0A 1SWTA 3P6DA 3CKFA 2FWVA 3ELXA 4NYQA 1VWIB 5D47A 1O1UA 1GXAA 1CBQA 4I6SA 4KC7A 3PH5A 2FR3A 3C78X 3BU9A 2IZFB 5K06A 5BYPA 2AVIA 1HXZA 1FDQA 2IZKA 2IZLB 2JU8A 3F8AA 4TJZA 1I78A 1WBIA 2F73A 4QQ1A 1U18A 1N43A 2Y32A 3EBKA 4MVEA 4ORXA 1EUOA 4CPHA 1EI5A 1LELA 1YP6A 3SAOA 3WYQA 4B55A 1OPAA 3NX1A 4FGIB 3RKGA 1SWPA 2HLVA 1L6MA 4IB6A 5HZQA 4MVKA 2E4JA 1KQXA 4O4XA 1WUBA 3I17A 3RDOA 2P8GA 4QNIA 4ZJ0A 1E02A 2RTOB 1Y9LA 1PM1X 2AKQA 4GE1A 3VPJE 4KCAA 4OMWA 5EZ2A 4BX7B 1ZNGA 5F6BA 4A1YA 4XMDA 4CDEA 2OFBA 4I3CA 1ICMA 3SZJA 3TF6A 2UYWA 1Z24A 3EBWA 5K67A 5AEOA 5EEDA 2KTDA 2X55A 4YBUA 4QGVA 4CPIA 1NQNA 1SRJA 2QO6A 4CDCA 2X56A 3WZOA 1LIBA 3PDFA 3G7XA 1ACDA 3NR3A 4GUZA 4NV7A 4U8UM 1N7YA 2FGSA 4CK4A 4NP1A 4YBPA 4I9SA 1SWGA 1K3BA 1UREA 3UAQA 3ZW1B 1RXHA 1DZJA 2K23A 4ON1A 1JBHA 3VHIA 2R73A 1FENA 5HBSA 3VU1A 4U8UO 4Z2OA 4GH7A 1OEKA 3RZYA 2F01A 1KQWA 2RTBB 4FBOA 1I4UA 1QY2A 1D2UA 4JNJA 5HZ8A 4DQ4A 3RSWA 3FYFA 1JJUA 3T2XA 3VG3A 2ANSA 3EMMA 3NBXX 4Y0SA 3AUMO 4XMFA 2L5PA 3NPOA 4MVLA 5H9AA 3ZW0A 3N91A 4K19A 1SWEA 5LJCA 1EALA 2L9CA 3FR5A 1BSYA 4Z2VA 3FMZA 1SWFA 1Y53X 4UU3A 2RTJA 5EDBA 1QY1A 2M4LA 1ERXA 2ACPX 2BS5A 2X34A 4O3XB 5B2AO 1N0SA 2C1QA 3RDMA 1TW4A 3ZWEA 5B3MO 1IJ8A 2KW1A 3T6FA 2MJIA 2X46A 4HPBA 2OYBO 2AF5A 3HWGA 1FEMA 3Q6LA 1VWJB 4YDBA 4RUUA 2Z4IA 4INNA 3T1DA 4R0BA 3FLLA 3UEXA 4EKVA 1DZKA 1DV9A 3HPEA 1SRGA 3X00A 4AZOA 1I9HA 1YWBA 4U8UN 2LBAA 2MM3A 1ALBA 5AJBA 5B5GA 3RY1A 1VWPB 1SLDB 2G79A 2RTIB 1SLGB 4Z2PA 3JSQA 1BRQA 1XKIA 1QFVA 5HCEC 1QFTA 4LZVA 3AKMA 2OY8A 3BDRA 3DTQA 2KTSA 4ODDA 4OEMA 4YKMA 1N9MA 2LB6A 2MO5A 2RTPB 4Z27A 2ACOA 2LFOA 4WHIA 1HY2A 2W2BA 1ZNEA 4HPCA 1CRBA 2RTHB 2AL0X 1VWCB 1T8VA 5LJDA 1H91A 1TVQA 3WZPA 3KVNA 3APUA 2NNDA 1D3SA 2RTFB 1JQPA 3P6EA 3WYPA 2WPUA 1W5RA 4ALOA 1I06A 4GK9A 4CPHB 5EPQA 2NNEA 2JN3A 1QABE 2OFMX 4XMGA 1NC9A 5B11O 4BX5A 2PY1A 4NLJA 4YFRA 1VWGB 2IFBA 1A2DA 2O62A 3ELZA 1OBPA 1S44A 4TLJA 4YH0A 1ERBA 1QG5A 3CKGA 3SZIA 1LCZA 2KT4B 3VG7A 2Z4HA 3STMX 1IKJA 4TNNA 3VG2A 1P6PA 3APVA 4QYNA 1VWDB 2F09A 4Y0RA 2IZEB 1RAVA 2WR6A 1SWBA 2WEWA 3CR6A 1HMRA 2Q9SA 1I04A 4OMXA 3MX7A 1YWAA 1X71A 1A3YA 2JW1A 4PSQA 2QO5A 2JOZA 4UU2A 3NQ9A 4ZR2A 1B0OA 1LKEA 3WJGA 4COTA 1SRIA 1SWUA 2IZBA 2A5CA 2RTKA 2MF6A 2RTAA 1SWQA 5DPQA 1OPBA 3QQ2A 2X45A 4NV8A 1T0VA 5IO6A 1G85A 1VWLB 2RTEB 1JJXA 3OD9A 1EIIA 1E2TA 3P6FA 4JGLA 2OVAA 2YG2A 4U46A 1GGLA 5F7GA 5HAEA 1VWRB 2ALLX 2IZCB 2JGSA 2RD7C 3RDXA 2JU3A 2IZAA 4U9CA 3RY2A 4EDEA 5HWZA 2Y3EA 1O8VA 1SWRA 2MHDA 2R56A 4BOEA 3S5VA 4D6BA
chains in the Genus database with same CATH topology
4IMNA 2RQ0A 3B2IA 2BS6A 4MIRA 3HK1A 3O2YA 4I95A 4QRLA 4XMCA 3ZW0B 5L8OA 4TKJA 2JMBA 2A2UA 4GKCA 3KFHA 5FQ6E 2FLJA 3RBYA 4NNSA 5HA1A 1HN2A 3WJDA 4ZHHA 4XMHA 4O4OA 3TGBA 3HOLA 1SY3A 2LA7A 1JJJA 1I05A 1JV4A 3JS1A 1IIUA 3FW5A 4I3BA 2CZUA 3S60A 2ZAGA 4ZFXA 2NNQA 4YGGA 3APWA 4EFGA 3CWKA 4GNYA 3ZW2A 2EU7X 5B29A 1KT7A 3AKNA 1FE3A 5HTEA 3BLGA 4LKTA 3FA9A 3WOVA 3OE3A 5F1EA 3VG5A 3HOEA 4ORWA 4QZTA 4ZGFA 3ZZVA 4YDAA 4YMYA 2AT6X 3JQOA 3BY0A 3STNA 1YWCA 2FS6A 2Q4NA 1CBSA 1IFCA 5DG4A 2G7BA 4IBAA 4ALBA 5IO5A 4O9SA 1LIFA 4YGZA 2FTBA 4OS0A 3IFBA 1CBIA 1YUPA 1KGLA 3OJYC 4OS3A 3P24A 4HPDA 3ZUIA 2OZQA 2AT8X 3BS2A 4O4UA 4NW4A 2WQAE 4RUNA 3UEWA 1B4MA 3VG6A 1GKAA 2HNXA 3BU1A 1X8OA 2W2AA 2ZAIA 5EEEA 1S2PA 1E5PA 1VYGA 2AT0X 1DZMA 2X8SA 3KZAA 4AZRA 2X8TA 4WFUA 1SXXA 1DC9A 2LKKA 5FQ7E 1LPJA 3PQSA 4IMOA 1X8NA 3HTYA 5KIDA 1JYDA 4QAEA 4WBKA 2W2FA 1MDCA 3KFIA 4FBRA 2HMBA 2Q2PA 4N7CA 1X8PA 2L68A 3P02A 3DSZA 2DM5A 3GAQA 1KT3A 3WJBA 4ZGUA 1ICNA 4ZHDA 3B2LA 1A18A 2G78A 1AB0A 2RA6A 5LJEA 2RCQA 3FEPA 4ZHFA 1FELA 4ZHCA 3FR2A 5KICA 1SXWA 5BVTA 4GU8A 5HZ5A 3F9DA 3FENA 3FIQA 4IAXA 2A2GA 4PJ2A 3UEVA 3C76X 1AELA 5HCDC 2WQ9A 1BRPA 1FTPA 1LFOA 1QWDA 3PQUA 4ARHA 2CZTA 1ZNHA 5H8TA 5C0NA 1OBQA 3NX2A 4U3QA 1IKEA 3CBCA 4GZVA 2Q39A 5D48A 3NQ3A 3CMPA 1TXLA 2OVEA 1EPBA 2FR2A 3FA7A 1YP7A 2AT3X 3D95A 3FR4A 4IABA 3D96A 1GX9A 1GM6A 2AH7X 3P6HA 1GT3A 2OVDA 1OBUA 1S7DA 3D97A 2QMIA 4WFVA 3CBSA 1G74A 2GTLM 3PH6A 3VG4A 3E3CA 4ID2A 2R74A 3LV4A 4LZUA 3B2JA 4O3ZA 3VE2A 2NP1A 3BSZE 3UEUA 2GTLO 3PECA 4CV7A 4LKPA 2X8FA 4O3YA 2A0AA 1CJ5A 2HZRA 2POAA 3I0AA 5JR8A 3ZI8A 5F6ZA 1U17A 5AQ6A 5HTDA 2MWHA 1X8UA 2BHVA 3HWDA 4L1NA 4L3RA 4ZH6A 4QGXA 2QOSC 2AMMX 3WJCA 1GKAB 3PP6A 1R0UA 2BT9A 3GE2A 5H9NA 5F58A 1ZNLA 3KQ0A 4OS8A 4FQBB 4D6AA 1X8QA 1EQDA 2RN4A 1SY0A 3U9PC 1KOIA 4AZMA 1U0XA 1T68X 2WWPA 4YKOA 1ZRYA 1E06A 4BQUA 4ML7B 3P6GA 3WJEA 1KXOA 4QZUA 1G5WA 1MX7A 2K62A 2XKLA 2GTLN 3D4RA 1NP4A 4I3DA 1ZNKA 5EDCA 5FFHA 4ORUA 4A60A 4AW8A 4EXZA 1BLRA 4GNWA 5IO7A 3KFFA 2BLGA 2GTFX 4NNTA 5AJCA 3NQKA 1BSQA 1LIDA 4KIIA 2AT5X 3VE1A 1MX8A 1JZUA 3BX8A 4MVIA 1EXSA 3ZUOA 1HBQA 1BJ7A 1UZ2X 2WUTA 2OFRX 1GX8A 4O49A 4TKHA 4ZCBA 1SXYA 1Y9TA 1LNMA 1AVGI 4FBVA 4IAWA 3FA6A 2N93A 3K3LA 1EW3A 3BX7A 1SY1A 2OVSA 5D45A 3ZQ3A 5LJHA 4A1HA 2JU7A 3HWFA 1VYFA 2Q2MA 4HFOA 2A3FX 1LICA 5D4AA 4KC8A 2L67A 1EPAA 3U03A 1A57A 1MUPA 1KT4A 3FA8A 1DFVA 1PBOA 1HBPA 4A8ZA 4ORRA 1B56A 4DQ3A 5HZ6A 1ML7A 1E00A 5BVQA 3MVFA 3QKGA 4AZPA 3OBLA 1BM5A 1HQPA 1VPRA 1G7NA 3O19A 4IB9A 3SOTA 1IW2A 1ZNDA 5CE4A 1IFBA 3WJFA 4IB7A 4QYPA 1KZWA 3H3IA 1AQBA 5LJGA 4ZHGA 4EEJA 2LBVA 2QM9A 4YGHA 1BEBA 2A13A 1PMPA 3EYCA 4IB8A 4AZNA 4M7MA 4BVMA 4YFQA 1OEJA 3MBTA 1KT5A 1RLBE 4LQZA 3IA8A 2FRSA 4GRJA 3RWXA 1KT6A 4YFPA 4ORYA 5KHPA 3P6CA 1O1VA 3STKA 3BRNA 1LIEA 5LKFA 4XMEA 4TQ2A 1SA8A 4MISA 2QO4A 1EIOA 1NGLA 4NYRA 3B2HA 4M6SA 1HMSA 3V8UA 3TGCA 1SXUA 4QGWA 3WBGA 4KH8A 5FQ8E 1JIWI 2GC9A 5FENA 2CM9A 1CBRA 1X89A 1PEEA 4N7DA 2FS7A 4HWMA 5D8JA 4KT5A 4HPAA 5HCCC 5LJBA 5H9KA 2YMSA 4GETA 3U0DA 1OEEA 4YCHA 3NADA 5LJKA 5FAZA 5H9LA 2HZQA 3EM0A 3ZW1A 3WVMA 3WXQA 3B2KA 3L4RA 3S26A 2RCTA 1DZPA 1QQSA 2CBSA 1GT5A 5HZ9A 2CBRA 1TOUA 3APXA 1GT1A 1RBPA 3FEKA 2HYSA 3TGAA 3O22A 1YWDA 3PPTA 4NLIA 4YCEA 4EQAC 5LKEA 2XSTA 4O4SA 5L8IA 1SMPI 1JYJA 5CYBA 4GDZA 1YIVA 4AZQA 2WSJA 3C77X 5L8NA 1TOWA 1BBPA 1MVGA 2FT9A 2GJ5A 3CQRA 3KFGA 1GT4A 4O3WA 5HBSA 5B27A 2WEXA 4CSBA 3HWEA 1ADLA 1LF7A 2KD2A 3LHNA 4Y0PA 3NP1A 3FW4A 3PEDA 1B8EA 1NP1A 1XCAA 3F6ZB 4ORSA 2ASNX 4Y0QA 3FELA 1SY2A 4ES7A 5HA0A 4I9RA 1BSOA 3CQNA 4AYHA 5BVSA 1HMTA 3S5XA 2CM4A 1QY0A 3P6DA 4NYQA 2FWVA 3ELXA 5D47A 1O1UA 1GXAA 1CBQA 4I6SA 4KC7A 3PH5A 2FR3A 3C78X 3BU9A 5K06A 5BYPA 1FDQA 2JU8A 3F8AA 4TJZA 2F73A 4QQ1A 1U18A 3EBKA 4MVEA 4ORXA 1EUOA 1EI5A 1YP6A 3SAOA 1OPAA 3NX1A 4FGIB 3RKGA 2HLVA 1L6MA 4IB6A 5HZQA 4MVKA 2E4JA 1KQXA 4O4XA 3I17A 2P8GA 4QNIA 4ZJ0A 1E02A 1Y9LA 1PM1X 2AKQA 4GE1A 3VPJE 4KCAA 4OMWA 5EZ2A 1ZNGA 5F6BA 4A1YA 4XMDA 4I3CA 1ICMA 3TF6A 1Z24A 3EBWA 5AEOA 5EEDA 2KTDA 4YBUA 4QGVA 2QO6A 1LIBA 3G7XA 1ACDA 3NR3A 4U8UM 4CK4A 4YBPA 4NP1A 4I9SA 1UREA 3UAQA 3ZW1B 2K23A 1DZJA 4ON1A 1JBHA 2R73A 1FENA 3VU1A 4U8UO 4GH7A 1OEKA 3RZYA 1KQWA 4FBOA 1I4UA 1QY2A 1D2UA 5HZ8A 4DQ4A 3RSWA 3FYFA 3VG3A 2ANSA 3EMMA 3NBXX 4Y0SA 4XMFA 2L5PA 3NPOA 4MVLA 5H9AA 3ZW0A 3N91A 4K19A 1EALA 5LJCA 2L9CA 3FR5A 1BSYA 3FMZA 4UU3A 5EDBA 1QY1A 2M4LA 1ERXA 2ACPX 2BS5A 4O3XB 1DF3A 1N0SA 3ZWEA 1TW4A 2KW1A 2MJIA 2X46A 4HPBA 3HWGA 1FEMA 3Q6LA 4YDBA 4RUUA 2Z4IA 4INNA 3T1DA 4R0BA 3FLLA 3UEXA 1DV9A 1DZKA 1KZXA 4AZOA 1YWBA 4U8UN 2LBAA 2MM3A 1ALBA 5AJBA 2G79A 3JSQA 1BRQA 1XKIA 1QFVA 5HCEC 1QFTA 4LZVA 3AKMA 3DTQA 3BDRA 4ODDA 2KTSA 4YKMA 4ZH9A 3TZSA 2LB6A 2MO5A 2ACOA 2LFOA 4WHIA 2W2BA 1ZNEA 4HPCA 1CRBA 2AL0X 1T8VA 5LJDA 1H91A 1TVQA 3APUA 2NNDA 1D3SA 3P6EA 4ALOA 1I06A 4GK9A 5EPQA 2NNEA 2JN3A 1QABE 2OFMX 4XMGA 2PY1A 4NLJA 4YFRA 2O62A 2IFBA 1A2DA 3ELZA 1OBPA 1S44A 4TLJA 4YH0A 1ERBA 1QG5A 2KT4B 3VG7A 2Z4HA 3STMX 1IKJA 4TNNA 3VG2A 1P6PA 3APVA 4QYNA 2F09A 4Y0RA 2WR6A 2WEWA 3CR6A 1HMRA 2Q9SA 1I04A 4OMXA 3MX7A 1YWAA 1X71A 1A3YA 2JW1A 4PSQA 2QO5A 2JOZA 4UU2A 3NQ9A 4ZR2A 1B0OA 1LKEA 3WJGA 4COTA 4TKBA 5DPQA 1OPBA 2X45A 1T0VA 5IO6A 1G85A 1JJXA 3OD9A 1EIIA 1BWYA 3P6FA 4JGLA 2OVAA 2YG2A 5F7GA 1GGLA 5HAEA 2ALLX 2RD7C 2JU3A 4U9CA 4EDEA 5HWZA 1O8VA 2MHDA 4BOEA 2R56A 3S5VA 4D6BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3E3C A;  2OVS A;  4KT5 A; 
#chains in the Genus database with same CATH topology
 4IMN A;  2RQ0 A;  3B2I A;  2BS6 A;  4MIR A;  3HK1 A;  3O2Y A;  4I95 A;  4QRL A;  3D9W A;  3EW2 A;  4XMC A;  4GDA A;  3ZW0 B;  5L8O A;  3EC5 A;  4TKJ A;  1NQM A;  2JMB A;  2A2U A;  1SWK A;  4GKC A;  1HXL A;  2Y3F A;  3KFH A;  5FQ6 E;  2FLJ A;  3RBY A;  4ZH9 A;  1RSU B;  4NNS A;  5HA1 A;  1HN2 A;  3WJD A;  4ZHH A;  4XMH A;  4O4O A;  3TGB A;  3HOL A;  1SY3 A;  2LA7 A;  3SLO A;  1JJJ A;  1I05 A;  1JV4 A;  3JS1 A;  1IIU A;  3FW5 A;  4I3B A;  1LCW A;  2CZU A;  2ZAG A;  3S60 A;  4ZFX A;  2NNQ A;  4YGG A;  3APW A;  4EFG A;  3CWK A;  4GNY A;  3ZW2 A;  4GGR A;  1VWK B;  2EU7 X;  5B29 A;  1KT7 A;  3ZUI A;  3AKN A;  1FE3 A;  5HTE A;  3BLG A;  4LKT A;  3RDU A;  3FA9 A;  2IZI A;  4MEE A;  3WOV A;  3OE3 A;  5F1E A;  3VG5 A;  3HOE A;  3VHM A;  4ORW A;  4BGF A;  4QZT A;  4ZGF A;  4CDF A;  2OF8 A;  1KFF A;  3LTW A;  5JD2 A;  3SLJ A;  3ZZV A;  4YDA A;  4YMY A;  2AT6 X;  3JQO A;  3BY0 A;  1Y0G A;  3STN A;  1YWC A;  1SRE A;  2FS6 A;  1CBS A;  1IFC A;  2Q4N A;  5DG4 A;  2G7B A;  4IBA A;  4ALB A;  2CAM A;  5IO5 A;  4O9S A;  1LIF A;  1MM9 A;  4YGZ A;  2BC3 A;  2FTB A;  4OS0 A;  2G5L A;  1CBI A;  3IFB A;  1YUP A;  4BX5 B;  2I5Z O;  3OJY C;  1KGL A;  4DCB A;  4OS3 A;  3P24 A;  4HPD A;  1VWE B;  2OZQ A;  2AT8 X;  2VFB A;  3BS2 A;  4NW4 A;  2WQA E;  4O4U A;  4RUN A;  3UEW A;  1B4M A;  3VG6 A;  1GKA A;  5B5F A;  2DJF A;  2HNX A;  3BU1 A;  1VWO B;  2X4M A;  4GGZ A;  1FJ1 E;  1X8O A;  2W2A A;  2ZAI A;  5EEE A;  1S2P A;  1E5P A;  1VYG A;  2AT0 X;  1DZM A;  2X8S A;  4GJV A;  1LCV A;  3KZA A;  2OL7 A;  2A5B A;  4AZR A;  2X8T A;  4WFU A;  4TKB A;  1SXX A;  1DC9 A;  1VWM B;  2LKK A;  1LPJ A;  5FQ7 E;  3PQS A;  3VHH A;  4IMO A;  1X8N A;  3HTY A;  5KID A;  1JYD A;  4QAE A;  1OSP O;  4WBK A;  2W2F A;  3FDC A;  4BCS A;  1MDC A;  3KFI A;  1MK5 A;  5F2B A;  4FBR A;  2HMB A;  2Q2P A;  4N7C A;  1X8P A;  2L68 A;  1HQQ A;  3P02 A;  2G8C O;  3DSZ A;  2DM5 A;  3GAQ A;  1KT3 A;  3T2W A;  3WJB A;  3MM0 A;  1ICN A;  4ZGU A;  4ZHD A;  3B2L A;  1A18 A;  2G78 A;  1AB0 A;  2RA6 A;  4IRW A;  5LJE A;  2RCQ A;  3FEP A;  3RDS A;  4ZHF A;  1N4J A;  1FEL A;  1NDJ A;  4ZHC A;  1AVE A;  2VDF A;  3FR2 A;  5KIC A;  1SXW A;  5BVT A;  4GU8 A;  5HZ5 A;  3F9D A;  3FEN A;  2BSZ A;  3FIQ A;  4IAX A;  2A2G A;  4PJ2 A;  4JHQ A;  3UEV A;  3C76 X;  1AEL A;  5HCD C;  2WQ9 A;  1SWN A;  1BRP A;  3AEH A;  1FTP A;  1LFO A;  1QWD A;  1Y52 X;  3PQU A;  4GGT A;  4ARH A;  5IRW A;  2CZT A;  1ZNH A;  3SZH A;  5IRA A;  5H8T A;  5C0N A;  1OBQ A;  3NX2 A;  3Q34 A;  4U3Q A;  1IKE A;  3CBC A;  4GZV A;  1BWY A;  2Q39 A;  5D48 A;  2QOM A;  3NQ3 A;  3CMP A;  1TXL A;  2OVE A;  1EPB A;  2FR2 A;  3FA7 A;  1VYO A;  1YP7 A;  2AT3 X;  3D95 A;  3FR4 A;  4IAB A;  3D96 A;  1GX9 A;  1GM6 A;  2AH7 X;  3P6H A;  1GT3 A;  2OVD A;  1OBU A;  1S7D A;  3D97 A;  2QMI A;  4WFV A;  4Y59 A;  3CBS A;  1G74 A;  4BX6 A;  2GTL M;  3PH6 A;  4BJ8 A;  3VG4 A;  3E3C A;  4DNE A;  2FHL A;  2IZG B;  4ID2 A;  2R74 A;  3LV4 A;  4LZU A;  1K24 A;  1LDQ A;  3B2J A;  1RST B;  4O3Z A;  3VE2 A;  2NP1 A;  3BSZ E;  5CHK A;  2GTL O;  3UEU A;  1MEP A;  3PEC A;  4CV7 A;  4LKP A;  2X8F A;  4O3Y A;  2A0A A;  1CJ5 A;  2IZJ A;  2HZR A;  2POA A;  3I0A A;  5JR8 A;  1UYN X;  3T6L A;  3ZI8 A;  5F6Z A;  1U17 A;  2VFC A;  5AQ6 A;  5HTD A;  2MWH A;  1X8U A;  2BHV A;  3HWD A;  4L1N A;  4L3R A;  4ZH6 A;  4QGX A;  2QOS C;  1DF8 A;  2AMM X;  3WJC A;  2OL8 O;  1GKA B;  3PP6 A;  1R0U A;  2BT9 A;  3GE2 A;  5H9N A;  5F58 A;  1ZNL A;  3KQ0 A;  4OS8 A;  4FQB B;  4D6A A;  1X8Q A;  1EQD A;  2RN4 A;  1SY0 A;  4I60 A;  5IXG A;  3U9P C;  1KOI A;  4GJS A;  4AZM A;  1U0X A;  1T68 X;  2WWP A;  4YKO A;  2DJG A;  1ZRY A;  1E06 A;  4BQU A;  4ML7 B;  2X32 A;  3P6G A;  3WJE A;  1KXO A;  4QZU A;  4BBO A;  1G5W A;  1MX7 A;  2K62 A;  2XKL A;  2FKG A;  2GTL N;  1NP4 A;  3D4R A;  1ZNK A;  4I3D A;  5EDC A;  5FFH A;  4ORU A;  4A60 A;  4AW8 A;  4CDD A;  4EXZ A;  1BLR A;  4GNW A;  5IO7 A;  2IZD B;  3KFF A;  2BLG A;  2GTF X;  4NNT A;  5AJC A;  3NQK A;  1BSQ A;  1LID A;  4KII A;  3RE6 A;  4Z6J A;  1W6F A;  2AT5 X;  3VE1 A;  1MX8 A;  2OFA A;  1JZU A;  3BX8 A;  4MVI A;  4CPE A;  1EXS A;  1VWQ B;  3ZUO A;  1HBQ A;  1BJ7 A;  1UZ2 X;  3WZN A;  1GX3 A;  4Y5D A;  3VGW A;  2RTN B;  2WUT A;  2C1S A;  2OFR X;  2RTL A;  1GX8 A;  1STP A;  4O49 A;  4TKH A;  4ZCB A;  1SXY A;  1Y9T A;  1LNM A;  1AVG I;  4FBV A;  4IAW A;  3FA6 A;  2N93 A;  3K3L A;  4OEL A;  1EW3 A;  3BX7 A;  1SLE B;  1SY1 A;  2OVS A;  5D45 A;  3ZQ3 A;  5LJH A;  1UYO X;  4A1H A;  4CPF A;  2JU7 A;  3HWF A;  1VYF A;  2Q2M A;  3RE5 A;  5CSE A;  4HFO A;  1AVD A;  1KL5 A;  1STR B;  2OY1 O;  2A3F X;  1LUQ A;  1LIC A;  1VWF B;  5D4A A;  4KC8 A;  2L67 A;  1EPA A;  3U03 A;  1A57 A;  1MUP A;  1DF3 A;  3PED A;  1KT4 A;  3FA8 A;  1DFV A;  1SWA A;  1PBO A;  1HBP A;  1SWJ A;  4ORR A;  1B56 A;  4A8Z A;  4DQ3 A;  1ML7 A;  5HZ6 A;  1E00 A;  5BVQ A;  3MVF A;  3QKG A;  4AZP A;  2RTG B;  3FID A;  3OBL A;  1N9Y A;  2GH7 A;  1BM5 A;  1HQP A;  4OKA A;  1VPR A;  1G7N A;  3O19 A;  4IB9 A;  3SOT A;  4BX6 B;  1IW2 A;  1SWL A;  1RXK A;  1ZND A;  5CE4 A;  1IFB A;  3WJF A;  4IB7 A;  4QYP A;  2IZH B;  1KZW A;  4Z28 A;  3H3I A;  1AQB A;  5LJG A;  3RDQ A;  4ZHG A;  1SWC A;  4EEJ A;  2LBV A;  1MOY A;  2PI3 O;  2QM9 A;  4YGH A;  1NBX A;  1BEB A;  2A13 A;  1PMP A;  3EYC A;  4IB8 A;  5B27 A;  4AZN A;  4M7M A;  1KL4 A;  3MG5 A;  4BVM A;  4YFQ A;  1OEJ A;  2C4I A;  3MBT A;  4JO6 A;  2I5V O;  1KT5 A;  2RTR B;  1RLB E;  5IRU A;  4LQZ A;  1SWH A;  3IA8 A;  2FRS A;  4GRJ A;  4C5P A;  2OY7 A;  1Y55 X;  3RWX A;  1KT6 A;  4YFP A;  4ORY A;  1PTS A;  5KHP A;  3P6C A;  1O1V A;  3STK A;  3BRN A;  1LIE A;  2RTM A;  1LDO A;  5LKF A;  4XME A;  4TQ2 A;  1SA8 A;  2OF9 A;  2QCB A;  4MIS A;  2QO4 A;  1EIO A;  1NGL A;  4NYR A;  3B2H A;  1RXJ A;  4M6S A;  1HMS A;  2HKD A;  3V8U A;  4BX7 A;  1SXU A;  4QGW A;  3TGC A;  5L3Y A;  3WBG A;  4KH8 A;  5FQ8 E;  3WZQ A;  1JIW I;  2GC9 A;  5FEN A;  2CM9 A;  4GD9 A;  1CBR A;  5B10 O;  1X89 A;  1PEE A;  4N7D A;  2FS7 A;  4YVB A;  4HWM A;  5D8J A;  4KT5 A;  4HPA A;  2A8G A;  5HCC C;  5LJB A;  5H9K A;  2YMS A;  4GET A;  3U0D A;  1OEE A;  4YCH A;  1VWN B;  2UZ2 A;  3NAD A;  5LJK A;  5FAZ A;  5H9L A;  2HZQ A;  3EM0 A;  5K68 A;  3ZW1 A;  3WVM A;  3WXQ A;  3B2K A;  3L4R A;  2RTD B;  1SWD A;  3S26 A;  2RCT A;  2OY5 O;  1DZP A;  1QQS A;  2CBS A;  1GT5 A;  3PK2 A;  5HZ9 A;  1SRF A;  2CBR A;  1VWA B;  1TOU A;  3APX A;  1GT1 A;  1RBP A;  2RTQ B;  2ZSC A;  3FEK A;  2HYS A;  3TGA A;  3O22 A;  1YWD A;  3PPT A;  4NLI A;  4YCE A;  4EQA C;  5LKE A;  2XST A;  4O4S A;  5L8I A;  2FKJ A;  1SMP I;  1SRH A;  1JYJ A;  5CYB A;  4GDZ A;  1YIV A;  4AZQ A;  2WSJ A;  3C77 X;  1VWB B;  2FHN X;  5L8N A;  1PBY A;  1TOW A;  1BBP A;  1JMZ A;  1MVG A;  2FT9 A;  2GJ5 A;  3CQR A;  1GT4 A;  3KFG A;  1STS B;  1SWS A;  2WEX A;  4O3W A;  1VWH B;  1ADL A;  1LF7 A;  2KD2 A;  3HWE A;  3LHN A;  4Y0P A;  3NP1 A;  4CSB A;  1KZX A;  1KL3 A;  3FW4 A;  1B8E A;  1NP1 A;  1XCA A;  1W4T A;  1SWO A;  2ASN X;  3EW1 A;  3F6Z B;  3FEL A;  4ORS A;  4Y0Q A;  1SLF B;  1JMX A;  2OL6 O;  1SY2 A;  4ES7 A;  5HA0 A;  3SLT A;  4I9R A;  1BSO A;  3CQN A;  4AYH A;  5BVS A;  1HMT A;  3S5X A;  3TZS A;  2CM4 A;  2RTC B;  1QY0 A;  1SWT A;  3P6D A;  3CKF A;  2FWV A;  3ELX A;  4NYQ A;  1VWI B;  5D47 A;  1O1U A;  1GXA A;  1CBQ A;  4I6S A;  4KC7 A;  3PH5 A;  2FR3 A;  3C78 X;  3BU9 A;  2IZF B;  5K06 A;  5BYP A;  2AVI A;  1HXZ A;  1FDQ A;  2IZK A;  2IZL B;  2JU8 A;  3F8A A;  4TJZ A;  1I78 A;  1WBI A;  2F73 A;  4QQ1 A;  1U18 A;  1N43 A;  2Y32 A;  3EBK A;  4MVE A;  4ORX A;  1EUO A;  4CPH A;  1EI5 A;  1LEL A;  1YP6 A;  3SAO A;  3WYQ A;  4B55 A;  1OPA A;  3NX1 A;  4FGI B;  3RKG A;  1SWP A;  2HLV A;  1L6M A;  4IB6 A;  5HZQ A;  4MVK A;  2E4J A;  1KQX A;  4O4X A;  1WUB A;  3I17 A;  3RDO A;  2P8G A;  4QNI A;  4ZJ0 A;  1E02 A;  2RTO B;  1Y9L A;  1PM1 X;  2AKQ A;  4GE1 A;  3VPJ E;  4KCA A;  4OMW A;  5EZ2 A;  4BX7 B;  1ZNG A;  5F6B A;  4A1Y A;  4XMD A;  4CDE A;  2OFB A;  4I3C A;  1ICM A;  3SZJ A;  3TF6 A;  2UYW A;  1Z24 A;  3EBW A;  5K67 A;  5AEO A;  5EED A;  2KTD A;  2X55 A;  4YBU A;  4QGV A;  4CPI A;  1NQN A;  1SRJ A;  2QO6 A;  4CDC A;  2X56 A;  3WZO A;  1LIB A;  3PDF A;  3G7X A;  1ACD A;  3NR3 A;  4GUZ A;  4NV7 A;  4U8U M;  1N7Y A;  2FGS A;  4CK4 A;  4NP1 A;  4YBP A;  4I9S A;  1SWG A;  1K3B A;  1URE A;  3UAQ A;  3ZW1 B;  1RXH A;  1DZJ A;  2K23 A;  4ON1 A;  1JBH A;  3VHI A;  2R73 A;  1FEN A;  5HBS A;  3VU1 A;  4U8U O;  4Z2O A;  4GH7 A;  1OEK A;  3RZY A;  2F01 A;  1KQW A;  2RTB B;  4FBO A;  1I4U A;  1QY2 A;  1D2U A;  4JNJ A;  5HZ8 A;  4DQ4 A;  3RSW A;  3FYF A;  1JJU A;  3T2X A;  3VG3 A;  2ANS A;  3EMM A;  3NBX X;  4Y0S A;  3AUM O;  4XMF A;  2L5P A;  3NPO A;  4MVL A;  5H9A A;  3ZW0 A;  3N91 A;  4K19 A;  1SWE A;  5LJC A;  1EAL A;  2L9C A;  3FR5 A;  1BSY A;  4Z2V A;  3FMZ A;  1SWF A;  1Y53 X;  4UU3 A;  2RTJ A;  5EDB A;  1QY1 A;  2M4L A;  1ERX A;  2ACP X;  2BS5 A;  2X34 A;  4O3X B;  5B2A O;  1N0S A;  2C1Q A;  3RDM A;  1TW4 A;  3ZWE A;  5B3M O;  1IJ8 A;  2KW1 A;  3T6F A;  2MJI A;  2X46 A;  4HPB A;  2OYB O;  2AF5 A;  3HWG A;  1FEM A;  3Q6L A;  1VWJ B;  4YDB A;  4RUU A;  2Z4I A;  4INN A;  3T1D A;  4R0B A;  3FLL A;  3UEX A;  4EKV A;  1DZK A;  1DV9 A;  3HPE A;  1SRG A;  3X00 A;  4AZO A;  1I9H A;  1YWB A;  4U8U N;  2LBA A;  2MM3 A;  1ALB A;  5AJB A;  5B5G A;  3RY1 A;  1VWP B;  1SLD B;  2G79 A;  2RTI B;  1SLG B;  4Z2P A;  3JSQ A;  1BRQ A;  1XKI A;  1QFV A;  5HCE C;  1QFT A;  4LZV A;  3AKM A;  2OY8 A;  3BDR A;  3DTQ A;  2KTS A;  4ODD A;  4OEM A;  4YKM A;  1N9M A;  2LB6 A;  2MO5 A;  2RTP B;  4Z27 A;  2ACO A;  2LFO A;  4WHI A;  1HY2 A;  2W2B A;  1ZNE A;  4HPC A;  1CRB A;  2RTH B;  2AL0 X;  1VWC B;  1T8V A;  5LJD A;  1H91 A;  1TVQ A;  3WZP A;  3KVN A;  3APU A;  2NND A;  1D3S A;  2RTF B;  1JQP A;  3P6E A;  3WYP A;  2WPU A;  1W5R A;  4ALO A;  1I06 A;  4GK9 A;  4CPH B;  5EPQ A;  2NNE A;  2JN3 A;  1QAB E;  2OFM X;  4XMG A;  1NC9 A;  5B11 O;  4BX5 A;  2PY1 A;  4NLJ A;  4YFR A;  1VWG B;  2IFB A;  1A2D A;  2O62 A;  3ELZ A;  1OBP A;  1S44 A;  4TLJ A;  4YH0 A;  1ERB A;  1QG5 A;  3CKG A;  3SZI A;  1LCZ A;  2KT4 B;  3VG7 A;  2Z4H A;  3STM X;  1IKJ A;  4TNN A;  3VG2 A;  1P6P A;  3APV A;  4QYN A;  1VWD B;  2F09 A;  4Y0R A;  2IZE B;  1RAV A;  2WR6 A;  1SWB A;  2WEW A;  3CR6 A;  1HMR A;  2Q9S A;  1I04 A;  4OMX A;  3MX7 A;  1YWA A;  1X71 A;  1A3Y A;  2JW1 A;  4PSQ A;  2QO5 A;  2JOZ A;  4UU2 A;  3NQ9 A;  4ZR2 A;  1B0O A;  1LKE A;  3WJG A;  4COT A;  1SRI A;  1SWU A;  2IZB A;  2A5C A;  2RTK A;  2MF6 A;  2RTA A;  1SWQ A;  5DPQ A;  1OPB A;  3QQ2 A;  2X45 A;  4NV8 A;  1T0V A;  5IO6 A;  1G85 A;  1VWL B;  2RTE B;  1JJX A;  3OD9 A;  1EII A;  1E2T A;  3P6F A;  4JGL A;  2OVA A;  2YG2 A;  4U46 A;  1GGL A;  5F7G A;  5HAE A;  1VWR B;  2ALL X;  2IZC B;  2JGS A;  2RD7 C;  3RDX A;  2JU3 A;  2IZA A;  4U9C A;  3RY2 A;  4EDE A;  5HWZ A;  2Y3E A;  1O8V A;  1SWR A;  2MHD A;  2R56 A;  4BOE A;  3S5V A;  4D6B A; 
#chains in the Genus database with same CATH homology
 4IMN A;  2RQ0 A;  3B2I A;  2BS6 A;  4MIR A;  3HK1 A;  3O2Y A;  4I95 A;  4QRL A;  4XMC A;  3ZW0 B;  5L8O A;  4TKJ A;  2JMB A;  2A2U A;  4GKC A;  3KFH A;  5FQ6 E;  2FLJ A;  3RBY A;  4NNS A;  5HA1 A;  1HN2 A;  3WJD A;  4ZHH A;  4XMH A;  4O4O A;  3TGB A;  3HOL A;  1SY3 A;  2LA7 A;  1JJJ A;  1I05 A;  1JV4 A;  3JS1 A;  1IIU A;  3FW5 A;  4I3B A;  2CZU A;  3S60 A;  2ZAG A;  4ZFX A;  2NNQ A;  4YGG A;  3APW A;  4EFG A;  3CWK A;  4GNY A;  3ZW2 A;  2EU7 X;  5B29 A;  1KT7 A;  3AKN A;  1FE3 A;  5HTE A;  3BLG A;  4LKT A;  3FA9 A;  3WOV A;  3OE3 A;  5F1E A;  3VG5 A;  3HOE A;  4ORW A;  4QZT A;  4ZGF A;  3ZZV A;  4YDA A;  4YMY A;  2AT6 X;  3JQO A;  3BY0 A;  3STN A;  1YWC A;  2FS6 A;  2Q4N A;  1CBS A;  1IFC A;  5DG4 A;  2G7B A;  4IBA A;  4ALB A;  5IO5 A;  4O9S A;  1LIF A;  4YGZ A;  2FTB A;  4OS0 A;  3IFB A;  1CBI A;  1YUP A;  1KGL A;  3OJY C;  4OS3 A;  3P24 A;  4HPD A;  3ZUI A;  2OZQ A;  2AT8 X;  3BS2 A;  4O4U A;  4NW4 A;  2WQA E;  4RUN A;  3UEW A;  1B4M A;  3VG6 A;  1GKA A;  2HNX A;  3BU1 A;  1X8O A;  2W2A A;  2ZAI A;  5EEE A;  1S2P A;  1E5P A;  1VYG A;  2AT0 X;  1DZM A;  2X8S A;  3KZA A;  4AZR A;  2X8T A;  4WFU A;  1SXX A;  1DC9 A;  2LKK A;  5FQ7 E;  1LPJ A;  3PQS A;  4IMO A;  1X8N A;  3HTY A;  5KID A;  1JYD A;  4QAE A;  4WBK A;  2W2F A;  1MDC A;  3KFI A;  4FBR A;  2HMB A;  2Q2P A;  4N7C A;  1X8P A;  2L68 A;  3P02 A;  3DSZ A;  2DM5 A;  3GAQ A;  1KT3 A;  3WJB A;  4ZGU A;  1ICN A;  4ZHD A;  3B2L A;  1A18 A;  2G78 A;  1AB0 A;  2RA6 A;  5LJE A;  2RCQ A;  3FEP A;  4ZHF A;  1FEL A;  4ZHC A;  3FR2 A;  5KIC A;  1SXW A;  5BVT A;  4GU8 A;  5HZ5 A;  3F9D A;  3FEN A;  3FIQ A;  4IAX A;  2A2G A;  4PJ2 A;  3UEV A;  3C76 X;  1AEL A;  5HCD C;  2WQ9 A;  1BRP A;  1FTP A;  1LFO A;  1QWD A;  3PQU A;  4ARH A;  2CZT A;  1ZNH A;  5H8T A;  5C0N A;  1OBQ A;  3NX2 A;  4U3Q A;  1IKE A;  3CBC A;  4GZV A;  2Q39 A;  5D48 A;  3NQ3 A;  3CMP A;  1TXL A;  2OVE A;  1EPB A;  2FR2 A;  3FA7 A;  1YP7 A;  2AT3 X;  3D95 A;  3FR4 A;  4IAB A;  3D96 A;  1GX9 A;  1GM6 A;  2AH7 X;  3P6H A;  1GT3 A;  2OVD A;  1OBU A;  1S7D A;  3D97 A;  2QMI A;  4WFV A;  3CBS A;  1G74 A;  2GTL M;  3PH6 A;  3VG4 A;  3E3C A;  4ID2 A;  2R74 A;  3LV4 A;  4LZU A;  3B2J A;  4O3Z A;  3VE2 A;  2NP1 A;  3BSZ E;  3UEU A;  2GTL O;  3PEC A;  4CV7 A;  4LKP A;  2X8F A;  4O3Y A;  2A0A A;  1CJ5 A;  2HZR A;  2POA A;  3I0A A;  5JR8 A;  3ZI8 A;  5F6Z A;  1U17 A;  5AQ6 A;  5HTD A;  2MWH A;  1X8U A;  2BHV A;  3HWD A;  4L1N A;  4L3R A;  4ZH6 A;  4QGX A;  2QOS C;  2AMM X;  3WJC A;  1GKA B;  3PP6 A;  1R0U A;  2BT9 A;  3GE2 A;  5H9N A;  5F58 A;  1ZNL A;  3KQ0 A;  4OS8 A;  4FQB B;  4D6A A;  1X8Q A;  1EQD A;  2RN4 A;  1SY0 A;  3U9P C;  1KOI A;  4AZM A;  1U0X A;  1T68 X;  2WWP A;  4YKO A;  1ZRY A;  1E06 A;  4BQU A;  4ML7 B;  3P6G A;  3WJE A;  1KXO A;  4QZU A;  1G5W A;  1MX7 A;  2K62 A;  2XKL A;  2GTL N;  3D4R A;  1NP4 A;  4I3D A;  1ZNK A;  5EDC A;  5FFH A;  4ORU A;  4A60 A;  4AW8 A;  4EXZ A;  1BLR A;  4GNW A;  5IO7 A;  3KFF A;  2BLG A;  2GTF X;  4NNT A;  5AJC A;  3NQK A;  1BSQ A;  1LID A;  4KII A;  2AT5 X;  3VE1 A;  1MX8 A;  1JZU A;  3BX8 A;  4MVI A;  1EXS A;  3ZUO A;  1HBQ A;  1BJ7 A;  1UZ2 X;  2WUT A;  2OFR X;  1GX8 A;  4O49 A;  4TKH A;  4ZCB A;  1SXY A;  1Y9T A;  1LNM A;  1AVG I;  4FBV A;  4IAW A;  3FA6 A;  2N93 A;  3K3L A;  1EW3 A;  3BX7 A;  1SY1 A;  2OVS A;  5D45 A;  3ZQ3 A;  5LJH A;  4A1H A;  2JU7 A;  3HWF A;  1VYF A;  2Q2M A;  4HFO A;  2A3F X;  1LIC A;  5D4A A;  4KC8 A;  2L67 A;  1EPA A;  3U03 A;  1A57 A;  1MUP A;  1KT4 A;  3FA8 A;  1DFV A;  1PBO A;  1HBP A;  4A8Z A;  4ORR A;  1B56 A;  4DQ3 A;  5HZ6 A;  1ML7 A;  1E00 A;  5BVQ A;  3MVF A;  3QKG A;  4AZP A;  3OBL A;  1BM5 A;  1HQP A;  1VPR A;  1G7N A;  3O19 A;  4IB9 A;  3SOT A;  1IW2 A;  1ZND A;  5CE4 A;  1IFB A;  3WJF A;  4IB7 A;  4QYP A;  1KZW A;  3H3I A;  1AQB A;  5LJG A;  4ZHG A;  4EEJ A;  2LBV A;  2QM9 A;  4YGH A;  1BEB A;  2A13 A;  1PMP A;  3EYC A;  4IB8 A;  4AZN A;  4M7M A;  4BVM A;  4YFQ A;  1OEJ A;  3MBT A;  1KT5 A;  1RLB E;  4LQZ A;  3IA8 A;  2FRS A;  4GRJ A;  3RWX A;  1KT6 A;  4YFP A;  4ORY A;  5KHP A;  3P6C A;  1O1V A;  3STK A;  3BRN A;  1LIE A;  5LKF A;  4XME A;  4TQ2 A;  1SA8 A;  4MIS A;  2QO4 A;  1EIO A;  1NGL A;  4NYR A;  3B2H A;  4M6S A;  1HMS A;  3V8U A;  3TGC A;  1SXU A;  4QGW A;  3WBG A;  4KH8 A;  5FQ8 E;  1JIW I;  2GC9 A;  5FEN A;  2CM9 A;  1CBR A;  1X89 A;  1PEE A;  4N7D A;  2FS7 A;  4HWM A;  5D8J A;  4KT5 A;  4HPA A;  5HCC C;  5LJB A;  5H9K A;  2YMS A;  4GET A;  3U0D A;  1OEE A;  4YCH A;  3NAD A;  5LJK A;  5FAZ A;  5H9L A;  2HZQ A;  3EM0 A;  3ZW1 A;  3WVM A;  3WXQ A;  3B2K A;  3L4R A;  3S26 A;  2RCT A;  1DZP A;  1QQS A;  2CBS A;  1GT5 A;  5HZ9 A;  2CBR A;  1TOU A;  3APX A;  1GT1 A;  1RBP A;  3FEK A;  2HYS A;  3TGA A;  3O22 A;  1YWD A;  3PPT A;  4NLI A;  4YCE A;  4EQA C;  5LKE A;  2XST A;  4O4S A;  5L8I A;  1SMP I;  1JYJ A;  5CYB A;  4GDZ A;  1YIV A;  4AZQ A;  2WSJ A;  3C77 X;  5L8N A;  1TOW A;  1BBP A;  1MVG A;  2FT9 A;  2GJ5 A;  3CQR A;  3KFG A;  1GT4 A;  4O3W A;  5HBS A;  5B27 A;  2WEX A;  4CSB A;  3HWE A;  1ADL A;  1LF7 A;  2KD2 A;  3LHN A;  4Y0P A;  3NP1 A;  3FW4 A;  3PED A;  1B8E A;  1NP1 A;  1XCA A;  3F6Z B;  4ORS A;  2ASN X;  4Y0Q A;  3FEL A;  1SY2 A;  4ES7 A;  5HA0 A;  4I9R A;  1BSO A;  3CQN A;  4AYH A;  5BVS A;  1HMT A;  3S5X A;  2CM4 A;  1QY0 A;  3P6D A;  4NYQ A;  2FWV A;  3ELX A;  5D47 A;  1O1U A;  1GXA A;  1CBQ A;  4I6S A;  4KC7 A;  3PH5 A;  2FR3 A;  3C78 X;  3BU9 A;  5K06 A;  5BYP A;  1FDQ A;  2JU8 A;  3F8A A;  4TJZ A;  2F73 A;  4QQ1 A;  1U18 A;  3EBK A;  4MVE A;  4ORX A;  1EUO A;  1EI5 A;  1YP6 A;  3SAO A;  1OPA A;  3NX1 A;  4FGI B;  3RKG A;  2HLV A;  1L6M A;  4IB6 A;  5HZQ A;  4MVK A;  2E4J A;  1KQX A;  4O4X A;  3I17 A;  2P8G A;  4QNI A;  4ZJ0 A;  1E02 A;  1Y9L A;  1PM1 X;  2AKQ A;  4GE1 A;  3VPJ E;  4KCA A;  4OMW A;  5EZ2 A;  1ZNG A;  5F6B A;  4A1Y A;  4XMD A;  4I3C A;  1ICM A;  3TF6 A;  1Z24 A;  3EBW A;  5AEO A;  5EED A;  2KTD A;  4YBU A;  4QGV A;  2QO6 A;  1LIB A;  3G7X A;  1ACD A;  3NR3 A;  4U8U M;  4CK4 A;  4YBP A;  4NP1 A;  4I9S A;  1URE A;  3UAQ A;  3ZW1 B;  2K23 A;  1DZJ A;  4ON1 A;  1JBH A;  2R73 A;  1FEN A;  3VU1 A;  4U8U O;  4GH7 A;  1OEK A;  3RZY A;  1KQW A;  4FBO A;  1I4U A;  1QY2 A;  1D2U A;  5HZ8 A;  4DQ4 A;  3RSW A;  3FYF A;  3VG3 A;  2ANS A;  3EMM A;  3NBX X;  4Y0S A;  4XMF A;  2L5P A;  3NPO A;  4MVL A;  5H9A A;  3ZW0 A;  3N91 A;  4K19 A;  1EAL A;  5LJC A;  2L9C A;  3FR5 A;  1BSY A;  3FMZ A;  4UU3 A;  5EDB A;  1QY1 A;  2M4L A;  1ERX A;  2ACP X;  2BS5 A;  4O3X B;  1DF3 A;  1N0S A;  3ZWE A;  1TW4 A;  2KW1 A;  2MJI A;  2X46 A;  4HPB A;  3HWG A;  1FEM A;  3Q6L A;  4YDB A;  4RUU A;  2Z4I A;  4INN A;  3T1D A;  4R0B A;  3FLL A;  3UEX A;  1DV9 A;  1DZK A;  1KZX A;  4AZO A;  1YWB A;  4U8U N;  2LBA A;  2MM3 A;  1ALB A;  5AJB A;  2G79 A;  3JSQ A;  1BRQ A;  1XKI A;  1QFV A;  5HCE C;  1QFT A;  4LZV A;  3AKM A;  3DTQ A;  3BDR A;  4ODD A;  2KTS A;  4YKM A;  4ZH9 A;  3TZS A;  2LB6 A;  2MO5 A;  2ACO A;  2LFO A;  4WHI A;  2W2B A;  1ZNE A;  4HPC A;  1CRB A;  2AL0 X;  1T8V A;  5LJD A;  1H91 A;  1TVQ A;  3APU A;  2NND A;  1D3S A;  3P6E A;  4ALO A;  1I06 A;  4GK9 A;  5EPQ A;  2NNE A;  2JN3 A;  1QAB E;  2OFM X;  4XMG A;  2PY1 A;  4NLJ A;  4YFR A;  2O62 A;  2IFB A;  1A2D A;  3ELZ A;  1OBP A;  1S44 A;  4TLJ A;  4YH0 A;  1ERB A;  1QG5 A;  2KT4 B;  3VG7 A;  2Z4H A;  3STM X;  1IKJ A;  4TNN A;  3VG2 A;  1P6P A;  3APV A;  4QYN A;  2F09 A;  4Y0R A;  2WR6 A;  2WEW A;  3CR6 A;  1HMR A;  2Q9S A;  1I04 A;  4OMX A;  3MX7 A;  1YWA A;  1X71 A;  1A3Y A;  2JW1 A;  4PSQ A;  2QO5 A;  2JOZ A;  4UU2 A;  3NQ9 A;  4ZR2 A;  1B0O A;  1LKE A;  3WJG A;  4COT A;  4TKB A;  5DPQ A;  1OPB A;  2X45 A;  1T0V A;  5IO6 A;  1G85 A;  1JJX A;  3OD9 A;  1EII A;  1BWY A;  3P6F A;  4JGL A;  2OVA A;  2YG2 A;  5F7G A;  1GGL A;  5HAE A;  2ALL X;  2RD7 C;  2JU3 A;  4U9C A;  4EDE A;  5HWZ A;  1O8V A;  2MHD A;  4BOE A;  2R56 A;  3S5V A;  4D6B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...