2OW0A

Mmp-9 active site mutant with iodine-labeled carboxylate inhibitor
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
159
structure length
159
Chain Sequence
b'FEGDLKWHHHNITYWIQNYSEDLPRAVIDDAFARAFALWSAVTPLTFTRVYSRDADIVIQFGVAEHGDGYPFDGKDGLLAHAFPPGPGIQGDAHFDDDELWSLGKGQGYSLFLVAAHQFGHALGLDHSSVPEALMYPMYRFTEGPPLHKDDVNGIRHLY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Matrix metalloproteinase-9 (MMP-9) (92 kDa type IV collagena
publication title Crystal Structures of MMP-9 Complexes with Five Inhibitors: Contribution of the Flexible Arg424 Side-chain to Selectivity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 41
structure length 159
sequence length 159
chains with identical sequence B
ec nomenclature ec 3.4.24.35: Gelatinase B.
pdb deposition date 2007-02-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 2ow0A00
2J0TA 1QJJA 2TCLA 3GBOA 4JPAA 2FV9A 3EDGA 3K7NA 3HY9A 1KUIA 4QKZA 1JIWP 3HDBA 4XBHA 1ZXVA 3HBUP 4GWMA 4HMAA 1JJ9A 4I35A 4A7BA 4J4MA 2ERPA 4GF1A 1D8MA 4DV8A 3WV2A 2DW2A 4HX3A 2YB9A 4GQLA 1GKCA 2POJA 1PWQA 2MZIA 1CGLA 4FU4A 1O0TA 2W13A 2QPJA 3BA0A 2USNA 3F17A 4FXYP 3LEAA 1GE5A 1SLMA 2W14A 2XS4A 4AXQA 1KAPP 1B3DA 1IACA 4JIJA 3WV1A 1ZP5A 3RTSA 1XFXA 1R1JA 5LABA 5D1SA 3F19A 3DWBA 1MMPA 3EDZA 1GO7P 5L7FA 1PWVA 4G9LA 1D5JA 1IABA 5CZMA 3VTGA 1XFZA 3U1RA 1BKCA 1G12A 3DPEA 4EFSA 3TSKA 4DF9A 4FVLA 5I4OA 2OXWA 1IAGA 3KMEA 4WF6A 3LJGA 1Q3AA 2DW0A 2OW0A 5I43A 5D1UA 1I1IP 1A86A 3P24A 1MNCA 3LQBA 1MMQA 1FBLA 2O3EA 1IAEA 5I2ZA 3P1VA 1XUDA 3USNA 1YCMA 2JT6A 3AIGA 2WO8A 2A8HA 2Y6CA 1Y0VA 3N2UA 1JH1A 1OM8A 1RM8A 1UTZA 3KEKA 1QJIA 2MLSA 1JAOA 3EDHA 3N2VA 1QIBA 1G05A 2W0DA 2MZHA 2W15A 1GKDA 1PWWA 3KWVC 4PKVA 1HTDA 1HFSA 1OS2A 1ND1A 2AIGP 1BKCE 1KBCA 3E8RA 1JAPA 2WO9A 2YIGA 1BZSA 2OXZA 3KHIA 1I73A 1C3IA 3EWJA 1KUFA 1MMRA 4GR3A 2HU6A 2OW2A 1D8FA 4H3XA 3F1AA 4PKSA 3HDAP 3LJTA 5I12A 1UMSA 1EAKA 4JP4A 3VI1A 1MMBA 2JSDA 2XS3A 1DMTA 4PKRA 1GE7A 1D7XA 2X3AA 4L63A 1ZVXA 1YP1A 3DNGA 5BPAA 1H71P 1SU3A 2WOAA 3SHIA 1BQQM 2JT5A 1EUBA 3KECA 1BUVM 3AYUA 3B2ZA 3ZVSA 1QICA 1UMTA 1ROSA 4WZVA 5CUHA 4PKWA 1C7KA 1KUGA 1YOUA 5BOTA 1HFCA 3G42A 1XFVA 1CK7A 1UEAA 2ERQA 3WV3A 4XM8A 1ZS0A 2D1OA 3LILA 2DW1A 1GE6A 1OM6A 4G0DA 2O36A 4PKUA 1JAQA 2OI0A 1JK3A 4FXQA 4XCTA 5D2BA 3KMCA 4H49A 3LGPA 3DPFA 3LQ0A 4AUOA 1IADA 1R54A 3EHXA 3EHYA 3I7IA 2DDYA 3DL1A 2OY4A 3F15A 4AIGA 2L0RA 4H1QA 3LE9A 4XM6A 3TS4A 1JKYA 1Y93A 1ZXCA 4JA1A 2OY2A 5L79A 3LUMA 3I7GA 5D7WA 4H84A 1BSWA 1R1HA 1ATLA 3F18A 2OW1A 4XM7A 1BQOA 4ON1A 1OMJA 456CA 1WNIA 4H76A 3B8ZA 3UVCA 1G49A 3HY7A 3HB2P 1RMZA 2I47A 4ILWD 2CKIA 2X7MA 3B92A 1HV5A 1CAQA 1FLSA 1UTTA 5H8XA 1I76A 1BM6A 2EROA 1K7GA 1CXVA 1PWUA 4H30A 1USNA 2SRTA 3F16A 4GUYA 3Q2GA 3O64A 4WKIA 1XUCA 2FV5A 1OM7A 2PJTA 4PKQA 5BOYA 3CKIA 966CA 3ELMA 3LJZA 2D1NA 1G4KA 2MLRA 5JMYA 3L0TA 1AF0A 4DD8A 2JNPA 1KUHA 2Z2DA 1AYKA 4IN9A 3HBVP 1QUAA 3KRYA 4AYKA 1SLNA 1XFWA 3KEJA 4GR0A 2JIHA 1HY7A 4DPEA 3Q2HA 4ZR5A 1K7QA 3O2XA 3LKAA 1KUKA 4L6TA 2K2GA 1SRPA 2X3BA 3ZUKA 1JIZA 4H82A 1IAAA 1K7IA 1L6JA 1BKCI 2E2DA 5I3MA 2CLTA 1Y8JA 1R1IA 1R55A 5B5PA 4PKTA 3V96B 4A3WA 3LMCA 4Q1LA 1XFYA 2N8RA 1CGEA 4GWNA 1CQRA 3LUNA 4IJOA 2V4BA 2J83A 5D3CA 1GO8P 2OW9A 4JQGA 2X3CA 4R3VA 3OHLA 3K7LA 5I0LA 830CA 4CTHA 1ZTQA 1FM1A 1QIAA 4IUWA 1JANA 1XURA 3RTTA 3EDIA 3DSLA 3G5CA 5D1TA 4WKEA 2AYKA 4L19A 2MZEA 3MA2A 1CGFA 3AYKA 4I03A 2Y6DA 1O0QA 1OO9A 1DTHA 1OS9A 3NX7A 4GR8A 1ASTA 1EB6A 2OVXA 3HYGA 1A85A 1J7NA 2OZRA 1AKLA 1BIWA 1S4BP 1YQYA 3OHOA 1PWPA 1G9KA 2RJPA 4H2EA 3LIRA 2KRJA 1SMPA 3ZXHA 3L0VA 2E3XA 1XFUA 3LK8A 1BUDA 2OXUA 1B8YA 1SATA 3TT4A 5B5OA 1Z3JA 2DDFA 1CIZA 4WK7A 1HOVA 2W12A 1C8TA 5CXAA 3TVCA 2K9CA 1GXDA 2RJQA 2OVZA 3LIKA
chains in the Genus database with same CATH superfamily
2J0TA 4L7AA 1QJJA 2TCLA 3GBOA 4JPAA 2FV9A 3EDGA 3K7NA 3HY9A 1KUIA 4QKZA 1JIWP 3HDBA 4XBHA 1ZXVA 3HBUP 4GWMA 4HMAA 1JJ9A 4I35A 4A7BA 4J4MA 2ERPA 4GF1A 1D8MA 4DV8A 3WV2A 2DW2A 4HX3A 2YB9A 4GQLA 1GKCA 2POJA 1PWQA 2MZIA 1CGLA 4FU4A 1O0TA 2W13A 2QPJA 3BA0A 2USNA 3F17A 4FXYP 3LEAA 1GE5A 1SLMA 2W14A 2XS4A 4AXQA 1KAPP 1B3DA 1IACA 4JIJA 3WV1A 1ZP5A 3RTSA 1XFXA 1R1JA 5LABA 5D1SA 3F19A 1OZ9A 3DWBA 1MMPA 3EDZA 1GO7P 5L7FA 1PWVA 4G9LA 1D5JA 1IABA 5CZMA 3VTGA 1XFZA 3U1RA 1BKCA 1G12A 3DPEA 4EFSA 3TSKA 4DF9A 4FVLA 5I4OA 2OXWA 1IAGA 3KMEA 4WF6A 3LJGA 1Q3AA 2DW0A 2OW0A 5I43A 5D1UA 1I1IP 1A86A 3P24A 1MNCA 3LQBA 1MMQA 3DTEA 1FBLA 2O3EA 1IAEA 5I2ZA 3P1VA 1XUDA 3USNA 1YCMA 2JT6A 3AIGA 2WO8A 2A8HA 2Y6CA 1Y0VA 3N2UA 1JH1A 1OM8A 1RM8A 1UTZA 3KEKA 1TVIA 1QJIA 2MLSA 1JAOA 3EDHA 3N2VA 1QIBA 1G05A 2W0DA 2MZHA 2W15A 1GKDA 1PWWA 3KWVC 4PKVA 1HTDA 1HFSA 1OS2A 1ND1A 2AIGP 1BKCE 1KBCA 3E8RA 1JAPA 2WO9A 2YIGA 1BZSA 2OXZA 3KHIA 1I73A 1C3IA 3EWJA 1KUFA 1MMRA 4GR3A 2HU6A 2OW2A 1D8FA 4H3XA 3F1AA 4PKSA 3HDAP 3LJTA 5I12A 1UMSA 1EAKA 4JP4A 3VI1A 1MMBA 2JSDA 2YUFA 2XS3A 1DMTA 4PKRA 1GE7A 1D7XA 1XM5A 2X3AA 4L63A 1ZVXA 1YP1A 3DNGA 5BPAA 1H71P 1SU3A 2WOAA 3SHIA 1BQQM 2JT5A 1EUBA 3KECA 1BUVM 3AYUA 3B2ZA 3ZVSA 1QICA 1UMTA 1ROSA 4WZVA 5CUHA 4PKWA 1C7KA 1KUGA 1YOUA 5BOTA 1HFCA 3G42A 3DTIA 1XFVA 1CK7A 1UEAA 2ERQA 3WV3A 4XM8A 1ZS0A 2D1OA 3LILA 2DW1A 1GE6A 1OM6A 4G0DA 2O36A 4PKUA 1JAQA 2OI0A 1JK3A 4FXQA 4XCTA 5D2BA 3KMCA 4H49A 3LGPA 3DPFA 3LQ0A 4AUOA 1IADA 1R54A 3EHXA 3DTKA 3EHYA 3I7IA 2DDYA 3DL1A 2OY4A 3F15A 4AIGA 2L0RA 4H1QA 3LE9A 4XM6A 3TS4A 1JKYA 1Y93A 1ZXCA 4JA1A 2OY2A 5L79A 3LUMA 3I7GA 5D7WA 4H84A 1BSWA 1R1HA 1ATLA 3F18A 2OW1A 4XM7A 1BQOA 4ON1A 1OMJA 456CA 1WNIA 4H76A 3B8ZA 3UVCA 1G49A 3HY7A 3HB2P 1RMZA 2I47A 4ILWD 2CKIA 2X7MA 3B92A 1HV5A 1CAQA 1FLSA 1UTTA 5H8XA 1I76A 1BM6A 2EROA 1K7GA 1CXVA 1PWUA 4H30A 1USNA 2SRTA 3F16A 4GUYA 3Q2GA 3O64A 4WKIA 1XAXA 1XUCA 2FV5A 1OM7A 2PJTA 4PKQA 5BOYA 3CKIA 966CA 3ELMA 3LJZA 2D1NA 1G4KA 2MLRA 5JMYA 3L0TA 1AF0A 4DD8A 2JNPA 1KUHA 2Z2DA 1AYKA 4IN9A 3HBVP 1QUAA 3KRYA 4AYKA 1SLNA 1XFWA 3KEJA 4GR0A 2JIHA 1HY7A 4DPEA 3Q2HA 4ZR5A 1K7QA 3O2XA 3LKAA 1KUKA 4L6TA 2K2GA 1SRPA 2X3BA 3ZUKA 1JIZA 4H82A 1IAAA 1K7IA 1L6JA 1BKCI 2E2DA 5I3MA 2CLTA 1Y8JA 1R1IA 1R55A 5B5PA 4PKTA 3V96B 4A3WA 3LMCA 4Q1LA 1XFYA 2N8RA 1CGEA 4GWNA 1CQRA 3LUNA 4IJOA 2V4BA 2J83A 5D3CA 1GO8P 2OW9A 4JQGA 2X3CA 4R3VA 3OHLA 3K7LA 5I0LA 830CA 4CTHA 1ZTQA 1FM1A 1QIAA 4IUWA 1JANA 1XURA 3RTTA 3EDIA 3DSLA 3G5CA 5D1TA 4WKEA 2AYKA 4L19A 2MZEA 3MA2A 1CGFA 3AYKA 4I03A 2Y6DA 1O0QA 1OO9A 1DTHA 1OS9A 3NX7A 4GR8A 1ASTA 1EB6A 2OVXA 3HYGA 1A85A 1J7NA 2OZRA 1AKLA 1BIWA 1S4BP 1YQYA 3OHOA 1PWPA 1G9KA 2RJPA 4H2EA 3LIRA 2KRJA 1SMPA 3ZXHA 3L0VA 2E3XA 1XFUA 3LK8A 1BUDA 2OXUA 1B8YA 1SATA 3TT4A 5B5OA 1Z3JA 2DDFA 1CIZA 4WK7A 1HOVA 2W12A 1C8TA 5CXAA 3TVCA 2K9CA 1GXDA 2RJQA 2OVZA 3LIKA
chains in the Genus database with same CATH topology
2J0TA 4L7AA 1QJJA 2TCLA 3GBOA 4JPAA 2FV9A 3EDGA 3K7NA 3HY9A 1KUIA 4QKZA 1JIWP 3HDBA 4XBHA 1ZXVA 3HBUP 4GWMA 4HMAA 1JJ9A 4I35A 4A7BA 4J4MA 2ERPA 4GF1A 1D8MA 4DV8A 3WV2A 2DW2A 4HX3A 2YB9A 4GQLA 1GKCA 2POJA 1PWQA 2MZIA 1CGLA 4FU4A 1O0TA 2W13A 2QPJA 3BA0A 2USNA 3F17A 4FXYP 3LEAA 1GE5A 1SLMA 2W14A 2XS4A 4AXQA 1KAPP 1B3DA 1IACA 4JIJA 3WV1A 1ZP5A 3RTSA 1XFXA 1R1JA 5LABA 5D1SA 3F19A 3DWBA 1MMPA 3EDZA 1GO7P 5L7FA 1PWVA 4G9LA 1D5JA 1IABA 5CZMA 3VTGA 1XFZA 3U1RA 1BKCA 1G12A 3DPEA 4EFSA 3TSKA 4DF9A 4FVLA 5I4OA 2OXWA 1IAGA 3KMEA 4WF6A 3LJGA 1Q3AA 2DW0A 2OW0A 5I43A 5D1UA 1I1IP 1A86A 3P24A 1MNCA 3LQBA 1MMQA 3DTEA 1FBLA 2O3EA 1IAEA 5I2ZA 3P1VA 1XUDA 3USNA 1YCMA 2JT6A 3AIGA 2WO8A 2A8HA 2Y6CA 1Y0VA 3N2UA 1JH1A 1OM8A 1RM8A 1UTZA 3KEKA 1QJIA 2MLSA 1JAOA 3EDHA 3N2VA 1QIBA 1G05A 2W0DA 2MZHA 2W15A 1GKDA 1PWWA 3KWVC 4PKVA 1HTDA 1HFSA 1OS2A 1ND1A 2AIGP 1BKCE 1KBCA 3E8RA 1JAPA 2WO9A 2YIGA 1BZSA 2OXZA 3KHIA 1I73A 1C3IA 3EWJA 1KUFA 1MMRA 4GR3A 2HU6A 2OW2A 1D8FA 4H3XA 3F1AA 4PKSA 3HDAP 3LJTA 5I12A 1UMSA 1EAKA 4JP4A 3VI1A 1MMBA 2JSDA 2YUFA 2XS3A 1DMTA 4PKRA 1GE7A 1D7XA 2X3AA 4L63A 1ZVXA 1YP1A 3DNGA 5BPAA 1H71P 1SU3A 2WOAA 3SHIA 1BQQM 2JT5A 1EUBA 3KECA 1BUVM 3AYUA 3B2ZA 3ZVSA 1QICA 1UMTA 1ROSA 4WZVA 5CUHA 4PKWA 1C7KA 1KUGA 1YOUA 5BOTA 1HFCA 3G42A 3DTIA 1XFVA 1CK7A 1UEAA 2ERQA 3WV3A 4XM8A 1ZS0A 2D1OA 3LILA 2DW1A 1GE6A 1OM6A 4G0DA 2O36A 4PKUA 1JAQA 2OI0A 1JK3A 4FXQA 4XCTA 5D2BA 3KMCA 4H49A 3LGPA 3DPFA 3LQ0A 4AUOA 1IADA 1R54A 3EHXA 3DTKA 3EHYA 3I7IA 2DDYA 3DL1A 2OY4A 3F15A 4AIGA 2L0RA 4H1QA 3LE9A 4XM6A 3TS4A 1JKYA 1Y93A 1ZXCA 4JA1A 2OY2A 5L79A 3LUMA 3I7GA 5D7WA 4H84A 1BSWA 1R1HA 1ATLA 3F18A 2OW1A 4XM7A 1BQOA 4ON1A 1OMJA 456CA 1WNIA 4H76A 3B8ZA 3UVCA 1G49A 3HY7A 3HB2P 1RMZA 2I47A 4ILWD 2CKIA 2X7MA 3B92A 1HV5A 1CAQA 1FLSA 1UTTA 5H8XA 1I76A 1BM6A 2EROA 1K7GA 1CXVA 1PWUA 4H30A 1USNA 2SRTA 3F16A 4GUYA 3Q2GA 3O64A 4WKIA 1XUCA 2FV5A 1OM7A 2PJTA 4PKQA 5BOYA 3CKIA 966CA 3ELMA 3LJZA 2D1NA 1G4KA 2MLRA 5JMYA 3L0TA 1AF0A 4DD8A 2JNPA 1KUHA 2Z2DA 1AYKA 4IN9A 3HBVP 1QUAA 3KRYA 4AYKA 1SLNA 1XFWA 3KEJA 4GR0A 2JIHA 1HY7A 4DPEA 3Q2HA 4ZR5A 1K7QA 3O2XA 3LKAA 1KUKA 4L6TA 2K2GA 1SRPA 2X3BA 3ZUKA 1JIZA 4H82A 1IAAA 1K7IA 1L6JA 1BKCI 2E2DA 5I3MA 2CLTA 1Y8JA 1R1IA 1R55A 5B5PA 4PKTA 3V96B 4A3WA 3LMCA 4Q1LA 1XFYA 2N8RA 1CGEA 4GWNA 1CQRA 3LUNA 4IJOA 2V4BA 2J83A 5D3CA 1GO8P 2OW9A 4JQGA 2X3CA 4R3VA 3OHLA 3K7LA 5I0LA 830CA 4CTHA 1ZTQA 1FM1A 1QIAA 4IUWA 1JANA 1XURA 3RTTA 3EDIA 3DSLA 3G5CA 5D1TA 4WKEA 2AYKA 4L19A 2MZEA 3MA2A 1CGFA 3AYKA 4I03A 2Y6DA 1O0QA 1OO9A 1DTHA 1OS9A 3NX7A 4GR8A 1ASTA 1EB6A 2OVXA 3HYGA 1A85A 1J7NA 2OZRA 1AKLA 1BIWA 1S4BP 1YQYA 3OHOA 1PWPA 1G9KA 2RJPA 4H2EA 3LIRA 2KRJA 1SMPA 3ZXHA 3L0VA 2E3XA 1XFUA 3LK8A 1BUDA 2OXUA 1B8YA 1SATA 3TT4A 5B5OA 1Z3JA 2DDFA 1CIZA 4WK7A 1HOVA 2W12A 1C8TA 5CXAA 3TVCA 2K9CA 1GXDA 2RJQA 2OVZA 3LIKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J0T A;  1QJJ A;  2TCL A;  3GBO A;  4JPA A;  2FV9 A;  3EDG A;  3K7N A;  3HY9 A;  1KUI A;  4QKZ A;  1JIW P;  3HDB A;  4XBH A;  1ZXV A;  3HBU P;  4GWM A;  4HMA A;  1JJ9 A;  4I35 A;  4A7B A;  4J4M A;  2ERP A;  4GF1 A;  1D8M A;  4DV8 A;  3WV2 A;  2DW2 A;  4HX3 A;  2YB9 A;  4GQL A;  1GKC A;  2POJ A;  1PWQ A;  2MZI A;  1CGL A;  4FU4 A;  1O0T A;  2W13 A;  2QPJ A;  3BA0 A;  2USN A;  3F17 A;  4FXY P;  3LEA A;  1GE5 A;  1SLM A;  2W14 A;  2XS4 A;  4AXQ A;  1KAP P;  1B3D A;  1IAC A;  4JIJ A;  3WV1 A;  1ZP5 A;  3RTS A;  1XFX A;  1R1J A;  5LAB A;  5D1S A;  3F19 A;  3DWB A;  1MMP A;  3EDZ A;  1GO7 P;  5L7F A;  1PWV A;  4G9L A;  1D5J A;  1IAB A;  5CZM A;  3VTG A;  1XFZ A;  3U1R A;  1BKC A;  1G12 A;  3DPE A;  4EFS A;  3TSK A;  4DF9 A;  4FVL A;  5I4O A;  2OXW A;  1IAG A;  3KME A;  4WF6 A;  3LJG A;  1Q3A A;  2DW0 A;  2OW0 A;  5I43 A;  5D1U A;  1I1I P;  1A86 A;  3P24 A;  1MNC A;  3LQB A;  1MMQ A;  1FBL A;  2O3E A;  1IAE A;  5I2Z A;  3P1V A;  1XUD A;  3USN A;  1YCM A;  2JT6 A;  3AIG A;  2WO8 A;  2A8H A;  2Y6C A;  1Y0V A;  3N2U A;  1JH1 A;  1OM8 A;  1RM8 A;  1UTZ A;  3KEK A;  1QJI A;  2MLS A;  1JAO A;  3EDH A;  3N2V A;  1QIB A;  1G05 A;  2W0D A;  2MZH A;  2W15 A;  1GKD A;  1PWW A;  3KWV C;  4PKV A;  1HTD A;  1HFS A;  1OS2 A;  1ND1 A;  2AIG P;  1BKC E;  1KBC A;  3E8R A;  1JAP A;  2WO9 A;  2YIG A;  1BZS A;  2OXZ A;  3KHI A;  1I73 A;  1C3I A;  3EWJ A;  1KUF A;  1MMR A;  4GR3 A;  2HU6 A;  2OW2 A;  1D8F A;  4H3X A;  3F1A A;  4PKS A;  3HDA P;  3LJT A;  5I12 A;  1UMS A;  1EAK A;  4JP4 A;  3VI1 A;  1MMB A;  2JSD A;  2XS3 A;  1DMT A;  4PKR A;  1GE7 A;  1D7X A;  2X3A A;  4L63 A;  1ZVX A;  1YP1 A;  3DNG A;  5BPA A;  1H71 P;  1SU3 A;  2WOA A;  3SHI A;  1BQQ M;  2JT5 A;  1EUB A;  3KEC A;  1BUV M;  3AYU A;  3B2Z A;  3ZVS A;  1QIC A;  1UMT A;  1ROS A;  4WZV A;  5CUH A;  4PKW A;  1C7K A;  1KUG A;  1YOU A;  5BOT A;  1HFC A;  3G42 A;  1XFV A;  1CK7 A;  1UEA A;  2ERQ A;  3WV3 A;  4XM8 A;  1ZS0 A;  2D1O A;  3LIL A;  2DW1 A;  1GE6 A;  1OM6 A;  4G0D A;  2O36 A;  4PKU A;  1JAQ A;  2OI0 A;  1JK3 A;  4FXQ A;  4XCT A;  5D2B A;  3KMC A;  4H49 A;  3LGP A;  3DPF A;  3LQ0 A;  4AUO A;  1IAD A;  1R54 A;  3EHX A;  3EHY A;  3I7I A;  2DDY A;  3DL1 A;  2OY4 A;  3F15 A;  4AIG A;  2L0R A;  4H1Q A;  3LE9 A;  4XM6 A;  3TS4 A;  1JKY A;  1Y93 A;  1ZXC A;  4JA1 A;  2OY2 A;  5L79 A;  3LUM A;  3I7G A;  5D7W A;  4H84 A;  1BSW A;  1R1H A;  1ATL A;  3F18 A;  2OW1 A;  4XM7 A;  1BQO A;  4ON1 A;  1OMJ A;  456C A;  1WNI A;  4H76 A;  3B8Z A;  3UVC A;  1G49 A;  3HY7 A;  3HB2 P;  1RMZ A;  2I47 A;  4ILW D;  2CKI A;  2X7M A;  3B92 A;  1HV5 A;  1CAQ A;  1FLS A;  1UTT A;  5H8X A;  1I76 A;  1BM6 A;  2ERO A;  1K7G A;  1CXV A;  1PWU A;  4H30 A;  1USN A;  2SRT A;  3F16 A;  4GUY A;  3Q2G A;  3O64 A;  4WKI A;  1XUC A;  2FV5 A;  1OM7 A;  2PJT A;  4PKQ A;  5BOY A;  3CKI A;  966C A;  3ELM A;  3LJZ A;  2D1N A;  1G4K A;  2MLR A;  5JMY A;  3L0T A;  1AF0 A;  4DD8 A;  2JNP A;  1KUH A;  2Z2D A;  1AYK A;  4IN9 A;  3HBV P;  1QUA A;  3KRY A;  4AYK A;  1SLN A;  1XFW A;  3KEJ A;  4GR0 A;  2JIH A;  1HY7 A;  4DPE A;  3Q2H A;  4ZR5 A;  1K7Q A;  3O2X A;  3LKA A;  1KUK A;  4L6T A;  2K2G A;  1SRP A;  2X3B A;  3ZUK A;  1JIZ A;  4H82 A;  1IAA A;  1K7I A;  1L6J A;  1BKC I;  2E2D A;  5I3M A;  2CLT A;  1Y8J A;  1R1I A;  1R55 A;  5B5P A;  4PKT A;  3V96 B;  4A3W A;  3LMC A;  4Q1L A;  1XFY A;  2N8R A;  1CGE A;  4GWN A;  1CQR A;  3LUN A;  4IJO A;  2V4B A;  2J83 A;  5D3C A;  1GO8 P;  2OW9 A;  4JQG A;  2X3C A;  4R3V A;  3OHL A;  3K7L A;  5I0L A;  830C A;  4CTH A;  1ZTQ A;  1FM1 A;  1QIA A;  4IUW A;  1JAN A;  1XUR A;  3RTT A;  3EDI A;  3DSL A;  3G5C A;  5D1T A;  4WKE A;  2AYK A;  4L19 A;  2MZE A;  3MA2 A;  1CGF A;  3AYK A;  4I03 A;  2Y6D A;  1O0Q A;  1OO9 A;  1DTH A;  1OS9 A;  3NX7 A;  4GR8 A;  1AST A;  1EB6 A;  2OVX A;  3HYG A;  1A85 A;  1J7N A;  2OZR A;  1AKL A;  1BIW A;  1S4B P;  1YQY A;  3OHO A;  1PWP A;  1G9K A;  2RJP A;  4H2E A;  3LIR A;  2KRJ A;  1SMP A;  3ZXH A;  3L0V A;  2E3X A;  1XFU A;  3LK8 A;  1BUD A;  2OXU A;  1B8Y A;  1SAT A;  3TT4 A;  5B5O A;  1Z3J A;  2DDF A;  1CIZ A;  4WK7 A;  1HOV A;  2W12 A;  1C8T A;  5CXA A;  3TVC A;  2K9C A;  1GXD A;  2RJQ A;  2OVZ A;  3LIK A; 
#chains in the Genus database with same CATH topology
 2J0T A;  4L7A A;  1QJJ A;  2TCL A;  3GBO A;  4JPA A;  2FV9 A;  3EDG A;  3K7N A;  3HY9 A;  1KUI A;  4QKZ A;  1JIW P;  3HDB A;  4XBH A;  1ZXV A;  3HBU P;  4GWM A;  4HMA A;  1JJ9 A;  4I35 A;  4A7B A;  4J4M A;  2ERP A;  4GF1 A;  1D8M A;  4DV8 A;  3WV2 A;  2DW2 A;  4HX3 A;  2YB9 A;  4GQL A;  1GKC A;  2POJ A;  1PWQ A;  2MZI A;  1CGL A;  4FU4 A;  1O0T A;  2W13 A;  2QPJ A;  3BA0 A;  2USN A;  3F17 A;  4FXY P;  3LEA A;  1GE5 A;  1SLM A;  2W14 A;  2XS4 A;  4AXQ A;  1KAP P;  1B3D A;  1IAC A;  4JIJ A;  3WV1 A;  1ZP5 A;  3RTS A;  1XFX A;  1R1J A;  5LAB A;  5D1S A;  3F19 A;  1OZ9 A;  3DWB A;  1MMP A;  3EDZ A;  1GO7 P;  5L7F A;  1PWV A;  4G9L A;  1D5J A;  1IAB A;  5CZM A;  3VTG A;  1XFZ A;  3U1R A;  1BKC A;  1G12 A;  3DPE A;  4EFS A;  3TSK A;  4DF9 A;  4FVL A;  5I4O A;  2OXW A;  1IAG A;  3KME A;  4WF6 A;  3LJG A;  1Q3A A;  2DW0 A;  2OW0 A;  5I43 A;  5D1U A;  1I1I P;  1A86 A;  3P24 A;  1MNC A;  3LQB A;  1MMQ A;  3DTE A;  1FBL A;  2O3E A;  1IAE A;  5I2Z A;  3P1V A;  1XUD A;  3USN A;  1YCM A;  2JT6 A;  3AIG A;  2WO8 A;  2A8H A;  2Y6C A;  1Y0V A;  3N2U A;  1JH1 A;  1OM8 A;  1RM8 A;  1UTZ A;  3KEK A;  1TVI A;  1QJI A;  2MLS A;  1JAO A;  3EDH A;  3N2V A;  1QIB A;  1G05 A;  2W0D A;  2MZH A;  2W15 A;  1GKD A;  1PWW A;  3KWV C;  4PKV A;  1HTD A;  1HFS A;  1OS2 A;  1ND1 A;  2AIG P;  1BKC E;  1KBC A;  3E8R A;  1JAP A;  2WO9 A;  2YIG A;  1BZS A;  2OXZ A;  3KHI A;  1I73 A;  1C3I A;  3EWJ A;  1KUF A;  1MMR A;  4GR3 A;  2HU6 A;  2OW2 A;  1D8F A;  4H3X A;  3F1A A;  4PKS A;  3HDA P;  3LJT A;  5I12 A;  1UMS A;  1EAK A;  4JP4 A;  3VI1 A;  1MMB A;  2JSD A;  2YUF A;  2XS3 A;  1DMT A;  4PKR A;  1GE7 A;  1D7X A;  1XM5 A;  2X3A A;  4L63 A;  1ZVX A;  1YP1 A;  3DNG A;  5BPA A;  1H71 P;  1SU3 A;  2WOA A;  3SHI A;  1BQQ M;  2JT5 A;  1EUB A;  3KEC A;  1BUV M;  3AYU A;  3B2Z A;  3ZVS A;  1QIC A;  1UMT A;  1ROS A;  4WZV A;  5CUH A;  4PKW A;  1C7K A;  1KUG A;  1YOU A;  5BOT A;  1HFC A;  3G42 A;  3DTI A;  1XFV A;  1CK7 A;  1UEA A;  2ERQ A;  3WV3 A;  4XM8 A;  1ZS0 A;  2D1O A;  3LIL A;  2DW1 A;  1GE6 A;  1OM6 A;  4G0D A;  2O36 A;  4PKU A;  1JAQ A;  2OI0 A;  1JK3 A;  4FXQ A;  4XCT A;  5D2B A;  3KMC A;  4H49 A;  3LGP A;  3DPF A;  3LQ0 A;  4AUO A;  1IAD A;  1R54 A;  3EHX A;  3DTK A;  3EHY A;  3I7I A;  2DDY A;  3DL1 A;  2OY4 A;  3F15 A;  4AIG A;  2L0R A;  4H1Q A;  3LE9 A;  4XM6 A;  3TS4 A;  1JKY A;  1Y93 A;  1ZXC A;  4JA1 A;  2OY2 A;  5L79 A;  3LUM A;  3I7G A;  5D7W A;  4H84 A;  1BSW A;  1R1H A;  1ATL A;  3F18 A;  2OW1 A;  4XM7 A;  1BQO A;  4ON1 A;  1OMJ A;  456C A;  1WNI A;  4H76 A;  3B8Z A;  3UVC A;  1G49 A;  3HY7 A;  3HB2 P;  1RMZ A;  2I47 A;  4ILW D;  2CKI A;  2X7M A;  3B92 A;  1HV5 A;  1CAQ A;  1FLS A;  1UTT A;  5H8X A;  1I76 A;  1BM6 A;  2ERO A;  1K7G A;  1CXV A;  1PWU A;  4H30 A;  1USN A;  2SRT A;  3F16 A;  4GUY A;  3Q2G A;  3O64 A;  4WKI A;  1XAX A;  1XUC A;  2FV5 A;  1OM7 A;  2PJT A;  4PKQ A;  5BOY A;  3CKI A;  966C A;  3ELM A;  3LJZ A;  2D1N A;  1G4K A;  2MLR A;  5JMY A;  3L0T A;  1AF0 A;  4DD8 A;  2JNP A;  1KUH A;  2Z2D A;  1AYK A;  4IN9 A;  3HBV P;  1QUA A;  3KRY A;  4AYK A;  1SLN A;  1XFW A;  3KEJ A;  4GR0 A;  2JIH A;  1HY7 A;  4DPE A;  3Q2H A;  4ZR5 A;  1K7Q A;  3O2X A;  3LKA A;  1KUK A;  4L6T A;  2K2G A;  1SRP A;  2X3B A;  3ZUK A;  1JIZ A;  4H82 A;  1IAA A;  1K7I A;  1L6J A;  1BKC I;  2E2D A;  5I3M A;  2CLT A;  1Y8J A;  1R1I A;  1R55 A;  5B5P A;  4PKT A;  3V96 B;  4A3W A;  3LMC A;  4Q1L A;  1XFY A;  2N8R A;  1CGE A;  4GWN A;  1CQR A;  3LUN A;  4IJO A;  2V4B A;  2J83 A;  5D3C A;  1GO8 P;  2OW9 A;  4JQG A;  2X3C A;  4R3V A;  3OHL A;  3K7L A;  5I0L A;  830C A;  4CTH A;  1ZTQ A;  1FM1 A;  1QIA A;  4IUW A;  1JAN A;  1XUR A;  3RTT A;  3EDI A;  3DSL A;  3G5C A;  5D1T A;  4WKE A;  2AYK A;  4L19 A;  2MZE A;  3MA2 A;  1CGF A;  3AYK A;  4I03 A;  2Y6D A;  1O0Q A;  1OO9 A;  1DTH A;  1OS9 A;  3NX7 A;  4GR8 A;  1AST A;  1EB6 A;  2OVX A;  3HYG A;  1A85 A;  1J7N A;  2OZR A;  1AKL A;  1BIW A;  1S4B P;  1YQY A;  3OHO A;  1PWP A;  1G9K A;  2RJP A;  4H2E A;  3LIR A;  2KRJ A;  1SMP A;  3ZXH A;  3L0V A;  2E3X A;  1XFU A;  3LK8 A;  1BUD A;  2OXU A;  1B8Y A;  1SAT A;  3TT4 A;  5B5O A;  1Z3J A;  2DDF A;  1CIZ A;  4WK7 A;  1HOV A;  2W12 A;  1C8T A;  5CXA A;  3TVC A;  2K9C A;  1GXD A;  2RJQ A;  2OVZ A;  3LIK A; 
#chains in the Genus database with same CATH homology
 2J0T A;  4L7A A;  1QJJ A;  2TCL A;  3GBO A;  4JPA A;  2FV9 A;  3EDG A;  3K7N A;  3HY9 A;  1KUI A;  4QKZ A;  1JIW P;  3HDB A;  4XBH A;  1ZXV A;  3HBU P;  4GWM A;  4HMA A;  1JJ9 A;  4I35 A;  4A7B A;  4J4M A;  2ERP A;  4GF1 A;  1D8M A;  4DV8 A;  3WV2 A;  2DW2 A;  4HX3 A;  2YB9 A;  4GQL A;  1GKC A;  2POJ A;  1PWQ A;  2MZI A;  1CGL A;  4FU4 A;  1O0T A;  2W13 A;  2QPJ A;  3BA0 A;  2USN A;  3F17 A;  4FXY P;  3LEA A;  1GE5 A;  1SLM A;  2W14 A;  2XS4 A;  4AXQ A;  1KAP P;  1B3D A;  1IAC A;  4JIJ A;  3WV1 A;  1ZP5 A;  3RTS A;  1XFX A;  1R1J A;  5LAB A;  5D1S A;  3F19 A;  3DWB A;  1MMP A;  3EDZ A;  1GO7 P;  5L7F A;  1PWV A;  4G9L A;  1D5J A;  1IAB A;  5CZM A;  3VTG A;  1XFZ A;  3U1R A;  1BKC A;  1G12 A;  3DPE A;  4EFS A;  3TSK A;  4DF9 A;  4FVL A;  5I4O A;  2OXW A;  1IAG A;  3KME A;  4WF6 A;  3LJG A;  1Q3A A;  2DW0 A;  2OW0 A;  5I43 A;  5D1U A;  1I1I P;  1A86 A;  3P24 A;  1MNC A;  3LQB A;  1MMQ A;  3DTE A;  1FBL A;  2O3E A;  1IAE A;  5I2Z A;  3P1V A;  1XUD A;  3USN A;  1YCM A;  2JT6 A;  3AIG A;  2WO8 A;  2A8H A;  2Y6C A;  1Y0V A;  3N2U A;  1JH1 A;  1OM8 A;  1RM8 A;  1UTZ A;  3KEK A;  1QJI A;  2MLS A;  1JAO A;  3EDH A;  3N2V A;  1QIB A;  1G05 A;  2W0D A;  2MZH A;  2W15 A;  1GKD A;  1PWW A;  3KWV C;  4PKV A;  1HTD A;  1HFS A;  1OS2 A;  1ND1 A;  2AIG P;  1BKC E;  1KBC A;  3E8R A;  1JAP A;  2WO9 A;  2YIG A;  1BZS A;  2OXZ A;  3KHI A;  1I73 A;  1C3I A;  3EWJ A;  1KUF A;  1MMR A;  4GR3 A;  2HU6 A;  2OW2 A;  1D8F A;  4H3X A;  3F1A A;  4PKS A;  3HDA P;  3LJT A;  5I12 A;  1UMS A;  1EAK A;  4JP4 A;  3VI1 A;  1MMB A;  2JSD A;  2YUF A;  2XS3 A;  1DMT A;  4PKR A;  1GE7 A;  1D7X A;  2X3A A;  4L63 A;  1ZVX A;  1YP1 A;  3DNG A;  5BPA A;  1H71 P;  1SU3 A;  2WOA A;  3SHI A;  1BQQ M;  2JT5 A;  1EUB A;  3KEC A;  1BUV M;  3AYU A;  3B2Z A;  3ZVS A;  1QIC A;  1UMT A;  1ROS A;  4WZV A;  5CUH A;  4PKW A;  1C7K A;  1KUG A;  1YOU A;  5BOT A;  1HFC A;  3G42 A;  3DTI A;  1XFV A;  1CK7 A;  1UEA A;  2ERQ A;  3WV3 A;  4XM8 A;  1ZS0 A;  2D1O A;  3LIL A;  2DW1 A;  1GE6 A;  1OM6 A;  4G0D A;  2O36 A;  4PKU A;  1JAQ A;  2OI0 A;  1JK3 A;  4FXQ A;  4XCT A;  5D2B A;  3KMC A;  4H49 A;  3LGP A;  3DPF A;  3LQ0 A;  4AUO A;  1IAD A;  1R54 A;  3EHX A;  3DTK A;  3EHY A;  3I7I A;  2DDY A;  3DL1 A;  2OY4 A;  3F15 A;  4AIG A;  2L0R A;  4H1Q A;  3LE9 A;  4XM6 A;  3TS4 A;  1JKY A;  1Y93 A;  1ZXC A;  4JA1 A;  2OY2 A;  5L79 A;  3LUM A;  3I7G A;  5D7W A;  4H84 A;  1BSW A;  1R1H A;  1ATL A;  3F18 A;  2OW1 A;  4XM7 A;  1BQO A;  4ON1 A;  1OMJ A;  456C A;  1WNI A;  4H76 A;  3B8Z A;  3UVC A;  1G49 A;  3HY7 A;  3HB2 P;  1RMZ A;  2I47 A;  4ILW D;  2CKI A;  2X7M A;  3B92 A;  1HV5 A;  1CAQ A;  1FLS A;  1UTT A;  5H8X A;  1I76 A;  1BM6 A;  2ERO A;  1K7G A;  1CXV A;  1PWU A;  4H30 A;  1USN A;  2SRT A;  3F16 A;  4GUY A;  3Q2G A;  3O64 A;  4WKI A;  1XUC A;  2FV5 A;  1OM7 A;  2PJT A;  4PKQ A;  5BOY A;  3CKI A;  966C A;  3ELM A;  3LJZ A;  2D1N A;  1G4K A;  2MLR A;  5JMY A;  3L0T A;  1AF0 A;  4DD8 A;  2JNP A;  1KUH A;  2Z2D A;  1AYK A;  4IN9 A;  3HBV P;  1QUA A;  3KRY A;  4AYK A;  1SLN A;  1XFW A;  3KEJ A;  4GR0 A;  2JIH A;  1HY7 A;  4DPE A;  3Q2H A;  4ZR5 A;  1K7Q A;  3O2X A;  3LKA A;  1KUK A;  4L6T A;  2K2G A;  1SRP A;  2X3B A;  3ZUK A;  1JIZ A;  4H82 A;  1IAA A;  1K7I A;  1L6J A;  1BKC I;  2E2D A;  5I3M A;  2CLT A;  1Y8J A;  1R1I A;  1R55 A;  5B5P A;  4PKT A;  3V96 B;  4A3W A;  3LMC A;  4Q1L A;  1XFY A;  2N8R A;  1CGE A;  4GWN A;  1CQR A;  3LUN A;  4IJO A;  2V4B A;  2J83 A;  5D3C A;  1GO8 P;  2OW9 A;  4JQG A;  2X3C A;  4R3V A;  3OHL A;  3K7L A;  5I0L A;  830C A;  4CTH A;  1ZTQ A;  1FM1 A;  1QIA A;  4IUW A;  1JAN A;  1XUR A;  3RTT A;  3EDI A;  3DSL A;  3G5C A;  5D1T A;  4WKE A;  2AYK A;  4L19 A;  2MZE A;  3MA2 A;  1CGF A;  3AYK A;  4I03 A;  2Y6D A;  1O0Q A;  1OO9 A;  1DTH A;  1OS9 A;  3NX7 A;  4GR8 A;  1AST A;  1EB6 A;  2OVX A;  3HYG A;  1A85 A;  1J7N A;  2OZR A;  1AKL A;  1BIW A;  1S4B P;  1YQY A;  3OHO A;  1PWP A;  1G9K A;  2RJP A;  4H2E A;  3LIR A;  2KRJ A;  1SMP A;  3ZXH A;  3L0V A;  2E3X A;  1XFU A;  3LK8 A;  1BUD A;  2OXU A;  1B8Y A;  1SAT A;  3TT4 A;  5B5O A;  1Z3J A;  2DDF A;  1CIZ A;  4WK7 A;  1HOV A;  2W12 A;  1C8T A;  5CXA A;  3TVC A;  2K9C A;  1GXD A;  2RJQ A;  2OVZ A;  3LIK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...