2OW0A

Mmp-9 active site mutant with iodine-labeled carboxylate inhibitor
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
159
structure length
159
Chain Sequence
FEGDLKWHHHNITYWIQNYSEDLPRAVIDDAFARAFALWSAVTPLTFTRVYSRDADIVIQFGVAEHGDGYPFDGKDGLLAHAFPPGPGIQGDAHFDDDELWSLGKGQGYSLFLVAAHQFGHALGLDHSSVPEALMYPMYRFTEGPPLHKDDVNGIRHLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Matrix metalloproteinase-9 (MMP-9) (92 kDa type IV collagena
publication title Crystal Structures of MMP-9 Complexes with Five Inhibitors: Contribution of the Flexible Arg424 Side-chain to Selectivity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 41
structure length 159
sequence length 159
chains with identical sequence B
ec nomenclature ec 3.4.24.35: Gelatinase B.
pdb deposition date 2007-02-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 2ow0A00
1D8MA 2W13A 4H84A 1IAGA 1HY7A 5L7FA 3WV3A 4GQLA 4H76A 2JIHA 2OY4A 4PKSA 3VTGA 2POJA 3DSLA 1YQYA 3KMEA 1PWQA 3U1RA 5I12A 2QPJA 3O64A 1PWVA 2MLRA 1IADA 1QIBA 1GO8P 3EDIA 3LQ0A 3EDGA 1Z3JA 3V96B 3KEJA 1PWPA 1HFCA 1CGFA 4L6TA 830CA 5I43A 3F17A 3HY7A 1MMRA 1HV5A 2YIGA 3HDAP 1G49A 1UTTA 1SMPA 4WK7A 1IAAA 3EWJA 4JA1A 3ZXHA 3AIGA 2XS4A 3DWBA 3EHXA 1OS2A 4DF9A 3HBVP 1EAKA 1GE5A 3ZVSA 5D2BA 1XFVA 1XFXA 4G9LA 3LQBA 2W15A 1G9KA 1UEAA 3GBOA 1AKLA 3KHIA 1GKDA 5D1UA 1GKCA 4J4MA 4G0DA 3HDBA 3TS4A 1R54A 1O0QA 5BPAA 1SLMA 2MZHA 1K7QA 2Y6CA 2ERPA 5D7WA 1BZSA 2I47A 3G42A 5I0LA 1A85A 3HBUP 3G5CA 1AYKA 1HFSA 1XFUA 2N8RA 3RTTA 2D1NA 1JJ9A 1DMTA 1C7KA 1RM8A 2D1OA 3LUNA 2A8HA 2JT6A 3DL1A 4AYKA 1FBLA 2OY2A 5BOYA 1G12A 1MMBA 4GWMA 3N2UA 3Q2HA 3WV1A 4GR3A 2OW2A 1CXVA 4JP4A 3ELMA 1MNCA 4IUWA 2OXUA 5L79A 1BQQM 2DDYA 4CTHA 4WKIA 3F16A 1DTHA 1B8YA 1K7IA 1XUDA 1EB6A 1I73A 3LKAA 1KUKA 3LGPA 1BUDA 1MMQA 1G4KA 1GE6A 1L6JA 1UTZA 4XCTA 1QUAA 1HOVA 2DW1A 3LK8A 3LJGA 3DNGA 3K7LA 4FXQA 1G05A 4L19A 2YB9A 3LE9A 1CAQA 1BKCE 5CUHA 2L0RA 2X3BA 1WNIA 966CA 4GUYA 1A86A 2EROA 1IAEA 3L0TA 2OW1A 3TSKA 4PKWA 1GXDA 1KBCA 4XBHA 4GF1A 4H49A 1OM8A 4H1QA 3WV2A 1KUHA 1SU3A 1BSWA 3HY9A 1R55A 4ILWD 2JSDA 4L63A 2W0DA 1XUCA 3TT4A 4PKRA 1XFYA 1PWUA 4A7BA 1CQRA 4FVLA 2W12A 1I1IP 3P24A 3KWVC 1AF0A 1JAOA 2J0TA 4JQGA 3KEKA 1BM6A 3LILA 2OVZA 4WZVA 3KRYA 2W14A 4PKVA 5I2ZA 1B3DA 3N2VA 2OVXA 1CIZA 4FXYP 4ZR5A 2USNA 3AYKA 2MZEA 1XFZA 3UVCA 2X3AA 1UMSA 1SRPA 1Y93A 2OXWA 3KECA 5CZMA 1D7XA 3Q2GA 4AUOA 3LJZA 4ON1A 1ND1A 4DPEA 4XM6A 1C8TA 3P1VA 5H8XA 1FLSA 1ROSA 3B2ZA 5CXAA 1CGEA 3CKIA 1J7NA 1BKCA 1O0TA 4H2EA 3E8RA 3LIRA 4I03A 3EHYA 1ASTA 1BKCI 1R1IA 1QICA 2WOAA 4H3XA 3LJTA 4WF6A 4FU4A 1ATLA 2E3XA 1UMTA 2ERQA 2WO8A 5B5OA 2OXZA 1MMPA 3I7IA 3HYGA 1KUGA 1OM7A 1R1HA 3LEAA 3F15A 4GWNA 2MZIA 3F19A 1ZXCA 2OW9A 2J83A 3ZUKA 1BIWA 3B8ZA 1ZS0A 3HB2P 5JMYA 2X7MA 1OM6A 2SRTA 3EDZA 1JIWP 1ZVXA 2OI0A 1GO7P 1USNA 1XFWA 1QJJA 3EDHA 2DW2A 1D8FA 1D5JA 3DPFA 2HU6A 4HMAA 456CA 1JANA 1BQOA 1JAPA 2CKIA 4XM8A 1PWWA 1QJIA 5D1TA 1I76A 1JK3A 3SHIA 2V4BA 1Q3AA 5D1SA 4AXQA 2MLSA 3USNA 1Y8JA 2Y6DA 2AYKA 1BUVM 3OHLA 3TVCA 4AIGA 3LUMA 1ZTQA 2X3CA 4IJOA 1IACA 3K7NA 2DW0A 3L0VA 1HTDA 2OZRA 2K2GA 3O2XA 1OO9A 1OS9A 1XURA 1S4BP 1QIAA 4I35A 2DDFA 3RTSA 4DV8A 5I3MA 1JKYA 4PKUA 1IABA 2RJPA 4JIJA 2WO9A 4GR8A 2AIGP 3KMCA 2KRJA 1SLNA 1H71P 1KUIA 1K7GA 3VI1A 1JAQA 3AYUA 4PKTA 1CGLA 1KUFA 4EFSA 2Z2DA 1SATA 4GR0A 4H82A 4PKQA 2K9CA 5I4OA 4H30A 1FM1A 1ZXVA 5BOTA 1R1JA 4WKEA 1YCMA 3F18A 3DPEA 5LABA 1RMZA 3I7GA 2JT5A 1OMJA 2O36A 3OHOA 4Q1LA 2RJQA 1GE7A 1JIZA 4A3WA 1EUBA 4R3VA 3MA2A 2E2DA 2TCLA 5B5PA 2O3EA 1YP1A 2OW0A 1ZP5A 2PJTA 4HX3A 4IN9A 3NX7A 3LIKA 2CLTA 2JNPA 1C3IA 2FV5A 3LMCA 4JPAA 5D3CA 4QKZA 2FV9A 1YOUA 1KAPP 1JH1A 3BA0A 4XM7A 4DD8A 2XS3A 3B92A 1CK7A 3F1AA 1Y0VA
chains in the Genus database with same CATH superfamily
1D8MA 2W13A 4H84A 1IAGA 1HY7A 5L7FA 3WV3A 4GQLA 4H76A 2JIHA 2OY4A 4PKSA 3VTGA 2POJA 3DSLA 1YQYA 3KMEA 1PWQA 3U1RA 5I12A 2QPJA 3O64A 4L7AA 1PWVA 2MLRA 1IADA 1QIBA 1GO8P 3EDIA 3LQ0A 3EDGA 1Z3JA 3V96B 3KEJA 1PWPA 1HFCA 1CGFA 4L6TA 830CA 5I43A 3F17A 3HY7A 1MMRA 1HV5A 2YIGA 3HDAP 1G49A 1UTTA 1SMPA 4WK7A 1IAAA 3EWJA 4JA1A 3ZXHA 3AIGA 2XS4A 3DWBA 3EHXA 1OS2A 4DF9A 3HBVP 1EAKA 1GE5A 3ZVSA 5D2BA 1XFVA 1XFXA 4G9LA 3LQBA 2W15A 1G9KA 1UEAA 3GBOA 1AKLA 3KHIA 1OZ9A 1GKDA 5D1UA 1GKCA 4J4MA 4G0DA 3HDBA 3TS4A 1R54A 1O0QA 5BPAA 1SLMA 2MZHA 1K7QA 2Y6CA 2ERPA 5D7WA 1BZSA 2I47A 3G42A 5I0LA 1A85A 3DTKA 3HBUP 3G5CA 1AYKA 1HFSA 1XFUA 3DTIA 2N8RA 3RTTA 2D1NA 1JJ9A 1DMTA 1C7KA 1RM8A 2D1OA 3LUNA 2A8HA 2JT6A 3DL1A 4AYKA 1FBLA 2OY2A 5BOYA 1G12A 1MMBA 4GWMA 3N2UA 3Q2HA 3WV1A 4GR3A 2OW2A 1CXVA 4JP4A 3ELMA 1MNCA 4IUWA 2OXUA 5L79A 1BQQM 2DDYA 4CTHA 4WKIA 3F16A 1DTHA 1B8YA 1K7IA 1XUDA 2YUFA 1EB6A 1I73A 1KUKA 3LGPA 3LKAA 1BUDA 1MMQA 1G4KA 1GE6A 1L6JA 1UTZA 4XCTA 1QUAA 3DTEA 1HOVA 2DW1A 3LK8A 3LJGA 3DNGA 3K7LA 4FXQA 1G05A 4L19A 2YB9A 3LE9A 1CAQA 1BKCE 5CUHA 2L0RA 2X3BA 1WNIA 966CA 4GUYA 1A86A 2EROA 1IAEA 3L0TA 2OW1A 3TSKA 4PKWA 1GXDA 1KBCA 4XBHA 4GF1A 4H49A 1OM8A 4H1QA 3WV2A 1KUHA 1SU3A 1BSWA 3HY9A 1R55A 4ILWD 2JSDA 4L63A 2W0DA 1XUCA 3TT4A 4PKRA 1XFYA 1PWUA 4A7BA 1CQRA 4FVLA 2W12A 1I1IP 3P24A 3KWVC 1AF0A 1JAOA 2J0TA 4JQGA 3KEKA 1BM6A 3LILA 2OVZA 4WZVA 3KRYA 2W14A 4PKVA 5I2ZA 1B3DA 3N2VA 2OVXA 1CIZA 4FXYP 4ZR5A 2USNA 3AYKA 2MZEA 1XFZA 3UVCA 2X3AA 1UMSA 1SRPA 1Y93A 2OXWA 3KECA 5CZMA 1D7XA 3Q2GA 4AUOA 3LJZA 4ON1A 1ND1A 4DPEA 4XM6A 1C8TA 3P1VA 5H8XA 1FLSA 1ROSA 3B2ZA 5CXAA 1CGEA 3CKIA 1J7NA 1BKCA 1O0TA 4H2EA 3E8RA 3LIRA 4I03A 3EHYA 1ASTA 1BKCI 1R1IA 1QICA 2WOAA 4H3XA 3LJTA 4WF6A 4FU4A 1ATLA 2E3XA 1UMTA 2ERQA 2WO8A 5B5OA 2OXZA 1MMPA 3I7IA 3HYGA 1KUGA 1OM7A 1R1HA 3LEAA 3F15A 4GWNA 2MZIA 3F19A 1ZXCA 2OW9A 2J83A 3ZUKA 1BIWA 3B8ZA 1ZS0A 3HB2P 5JMYA 2X7MA 1OM6A 2SRTA 3EDZA 1JIWP 1ZVXA 2OI0A 1GO7P 1USNA 1XFWA 1QJJA 3EDHA 2DW2A 1D8FA 1D5JA 3DPFA 2HU6A 4HMAA 456CA 1JANA 1BQOA 1JAPA 2CKIA 4XM8A 1PWWA 1QJIA 5D1TA 1I76A 1JK3A 3SHIA 2V4BA 1Q3AA 5D1SA 4AXQA 2MLSA 3USNA 1Y8JA 2Y6DA 2AYKA 1BUVM 3OHLA 3TVCA 4AIGA 3LUMA 1ZTQA 2X3CA 4IJOA 1IACA 3K7NA 2DW0A 3L0VA 1HTDA 2OZRA 2K2GA 3O2XA 1OO9A 1OS9A 1XURA 1S4BP 1QIAA 4I35A 2DDFA 3RTSA 4DV8A 5I3MA 1JKYA 4PKUA 1IABA 2RJPA 4JIJA 2WO9A 4GR8A 1TVIA 2AIGP 3KMCA 2KRJA 1SLNA 1H71P 1KUIA 1K7GA 3VI1A 1JAQA 3AYUA 4PKTA 1CGLA 1KUFA 4EFSA 2Z2DA 1SATA 4GR0A 4H82A 4PKQA 2K9CA 5I4OA 4H30A 1FM1A 1ZXVA 5BOTA 1R1JA 4WKEA 1YCMA 3F18A 3DPEA 5LABA 1RMZA 3I7GA 2JT5A 1OMJA 1XAXA 2O36A 3OHOA 4Q1LA 2RJQA 1GE7A 1JIZA 4A3WA 1EUBA 4R3VA 3MA2A 2E2DA 2TCLA 5B5PA 2O3EA 1YP1A 2OW0A 1ZP5A 2PJTA 4HX3A 4IN9A 3NX7A 3LIKA 2CLTA 1XM5A 2JNPA 1C3IA 2FV5A 3LMCA 4JPAA 5D3CA 4QKZA 2FV9A 1YOUA 1KAPP 1JH1A 3BA0A 4XM7A 4DD8A 2XS3A 3B92A 1CK7A 3F1AA 1Y0VA
chains in the Genus database with same CATH topology
1D8MA 2W13A 4H84A 1IAGA 1HY7A 5L7FA 3WV3A 4GQLA 4H76A 2JIHA 2OY4A 4PKSA 3VTGA 2POJA 3DSLA 1YQYA 3KMEA 1PWQA 3U1RA 5I12A 2QPJA 3O64A 4L7AA 1PWVA 2MLRA 1IADA 1QIBA 1GO8P 3EDIA 3LQ0A 3EDGA 1Z3JA 3V96B 3KEJA 1PWPA 1HFCA 1CGFA 4L6TA 830CA 5I43A 3F17A 3HY7A 1MMRA 1HV5A 2YIGA 3HDAP 1G49A 1UTTA 1SMPA 4WK7A 1IAAA 3EWJA 4JA1A 3ZXHA 3AIGA 2XS4A 3DWBA 3EHXA 1OS2A 4DF9A 3HBVP 1EAKA 1GE5A 3ZVSA 5D2BA 1XFVA 1XFXA 4G9LA 3LQBA 2W15A 1G9KA 1UEAA 3GBOA 1AKLA 3KHIA 1GKDA 5D1UA 1GKCA 4J4MA 4G0DA 3HDBA 3TS4A 1R54A 1O0QA 5BPAA 1SLMA 2MZHA 1K7QA 2Y6CA 2ERPA 5D7WA 1BZSA 2I47A 3G42A 5I0LA 1A85A 3DTKA 3HBUP 3G5CA 1AYKA 1HFSA 1XFUA 3DTIA 2N8RA 3RTTA 2D1NA 1JJ9A 1DMTA 1C7KA 1RM8A 2D1OA 3LUNA 2A8HA 2JT6A 3DL1A 4AYKA 1FBLA 2OY2A 5BOYA 1G12A 1MMBA 4GWMA 3N2UA 3Q2HA 3WV1A 4GR3A 2OW2A 1CXVA 4JP4A 3ELMA 1MNCA 4IUWA 2OXUA 5L79A 1BQQM 2DDYA 4CTHA 4WKIA 3F16A 1DTHA 1B8YA 1K7IA 1XUDA 2YUFA 1EB6A 1I73A 1KUKA 3LGPA 3LKAA 1BUDA 1MMQA 1G4KA 1GE6A 1L6JA 1UTZA 4XCTA 1QUAA 3DTEA 1HOVA 2DW1A 3LK8A 3LJGA 3DNGA 3K7LA 4FXQA 1G05A 4L19A 2YB9A 3LE9A 1CAQA 1BKCE 5CUHA 2L0RA 2X3BA 1WNIA 966CA 4GUYA 1A86A 2EROA 1IAEA 3L0TA 2OW1A 3TSKA 4PKWA 1GXDA 1KBCA 4XBHA 4GF1A 4H49A 1OM8A 4H1QA 3WV2A 1KUHA 1SU3A 1BSWA 3HY9A 1R55A 4ILWD 2JSDA 4L63A 2W0DA 1XUCA 3TT4A 4PKRA 1XFYA 1PWUA 4A7BA 1CQRA 4FVLA 2W12A 1I1IP 3P24A 3KWVC 1AF0A 1JAOA 2J0TA 4JQGA 3KEKA 1BM6A 3LILA 2OVZA 4WZVA 3KRYA 2W14A 4PKVA 5I2ZA 1B3DA 3N2VA 2OVXA 1CIZA 4FXYP 4ZR5A 2USNA 3AYKA 2MZEA 1XFZA 3UVCA 2X3AA 1UMSA 1SRPA 1Y93A 2OXWA 3KECA 5CZMA 1D7XA 3Q2GA 4AUOA 3LJZA 4ON1A 1ND1A 4DPEA 4XM6A 1C8TA 3P1VA 5H8XA 1FLSA 1ROSA 3B2ZA 5CXAA 1CGEA 3CKIA 1J7NA 1BKCA 1O0TA 4H2EA 3E8RA 3LIRA 4I03A 3EHYA 1ASTA 1BKCI 1R1IA 1QICA 2WOAA 4H3XA 3LJTA 4WF6A 4FU4A 1ATLA 2E3XA 1UMTA 2ERQA 2WO8A 5B5OA 2OXZA 1MMPA 3I7IA 3HYGA 1KUGA 1OM7A 1R1HA 3LEAA 3F15A 4GWNA 2MZIA 3F19A 1ZXCA 2OW9A 2J83A 3ZUKA 1BIWA 3B8ZA 1ZS0A 3HB2P 5JMYA 2X7MA 1OM6A 2SRTA 3EDZA 1JIWP 1ZVXA 2OI0A 1GO7P 1USNA 1XFWA 1QJJA 3EDHA 2DW2A 1D8FA 1D5JA 3DPFA 2HU6A 4HMAA 456CA 1JANA 1BQOA 1JAPA 2CKIA 4XM8A 1PWWA 1QJIA 5D1TA 1I76A 1JK3A 3SHIA 2V4BA 1Q3AA 5D1SA 4AXQA 2MLSA 3USNA 1Y8JA 2Y6DA 2AYKA 1BUVM 3OHLA 3TVCA 4AIGA 3LUMA 1ZTQA 2X3CA 4IJOA 1IACA 3K7NA 2DW0A 3L0VA 1HTDA 2OZRA 2K2GA 3O2XA 1OO9A 1OS9A 1XURA 1S4BP 1QIAA 4I35A 2DDFA 3RTSA 4DV8A 5I3MA 1JKYA 4PKUA 1IABA 2RJPA 4JIJA 2WO9A 4GR8A 2AIGP 3KMCA 2KRJA 1SLNA 1H71P 1KUIA 1K7GA 3VI1A 1JAQA 3AYUA 4PKTA 1CGLA 1KUFA 4EFSA 2Z2DA 1SATA 4GR0A 4H82A 4PKQA 2K9CA 5I4OA 4H30A 1FM1A 1ZXVA 5BOTA 1R1JA 4WKEA 1YCMA 3F18A 3DPEA 5LABA 1RMZA 3I7GA 2JT5A 1OMJA 2O36A 3OHOA 4Q1LA 2RJQA 1GE7A 1JIZA 4A3WA 1EUBA 4R3VA 3MA2A 2E2DA 2TCLA 5B5PA 2O3EA 1YP1A 2OW0A 1ZP5A 2PJTA 4HX3A 4IN9A 3NX7A 3LIKA 2CLTA 2JNPA 1C3IA 2FV5A 3LMCA 4JPAA 5D3CA 4QKZA 2FV9A 1YOUA 1KAPP 1JH1A 3BA0A 4XM7A 4DD8A 2XS3A 3B92A 1CK7A 3F1AA 1Y0VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1D8M A;  2W13 A;  4H84 A;  1IAG A;  1HY7 A;  5L7F A;  3WV3 A;  4GQL A;  4H76 A;  2JIH A;  2OY4 A;  4PKS A;  3VTG A;  2POJ A;  3DSL A;  1YQY A;  3KME A;  1PWQ A;  3U1R A;  5I12 A;  2QPJ A;  3O64 A;  1PWV A;  2MLR A;  1IAD A;  1QIB A;  1GO8 P;  3EDI A;  3LQ0 A;  3EDG A;  1Z3J A;  3V96 B;  3KEJ A;  1PWP A;  1HFC A;  1CGF A;  4L6T A;  830C A;  5I43 A;  3F17 A;  3HY7 A;  1MMR A;  1HV5 A;  2YIG A;  3HDA P;  1G49 A;  1UTT A;  1SMP A;  4WK7 A;  1IAA A;  3EWJ A;  4JA1 A;  3ZXH A;  3AIG A;  2XS4 A;  3DWB A;  3EHX A;  1OS2 A;  4DF9 A;  3HBV P;  1EAK A;  1GE5 A;  3ZVS A;  5D2B A;  1XFV A;  1XFX A;  4G9L A;  3LQB A;  2W15 A;  1G9K A;  1UEA A;  3GBO A;  1AKL A;  3KHI A;  1GKD A;  5D1U A;  1GKC A;  4J4M A;  4G0D A;  3HDB A;  3TS4 A;  1R54 A;  1O0Q A;  5BPA A;  1SLM A;  2MZH A;  1K7Q A;  2Y6C A;  2ERP A;  5D7W A;  1BZS A;  2I47 A;  3G42 A;  5I0L A;  1A85 A;  3HBU P;  3G5C A;  1AYK A;  1HFS A;  1XFU A;  2N8R A;  3RTT A;  2D1N A;  1JJ9 A;  1DMT A;  1C7K A;  1RM8 A;  2D1O A;  3LUN A;  2A8H A;  2JT6 A;  3DL1 A;  4AYK A;  1FBL A;  2OY2 A;  5BOY A;  1G12 A;  1MMB A;  4GWM A;  3N2U A;  3Q2H A;  3WV1 A;  4GR3 A;  2OW2 A;  1CXV A;  4JP4 A;  3ELM A;  1MNC A;  4IUW A;  2OXU A;  5L79 A;  1BQQ M;  2DDY A;  4CTH A;  4WKI A;  3F16 A;  1DTH A;  1B8Y A;  1K7I A;  1XUD A;  1EB6 A;  1I73 A;  3LKA A;  1KUK A;  3LGP A;  1BUD A;  1MMQ A;  1G4K A;  1GE6 A;  1L6J A;  1UTZ A;  4XCT A;  1QUA A;  1HOV A;  2DW1 A;  3LK8 A;  3LJG A;  3DNG A;  3K7L A;  4FXQ A;  1G05 A;  4L19 A;  2YB9 A;  3LE9 A;  1CAQ A;  1BKC E;  5CUH A;  2L0R A;  2X3B A;  1WNI A;  966C A;  4GUY A;  1A86 A;  2ERO A;  1IAE A;  3L0T A;  2OW1 A;  3TSK A;  4PKW A;  1GXD A;  1KBC A;  4XBH A;  4GF1 A;  4H49 A;  1OM8 A;  4H1Q A;  3WV2 A;  1KUH A;  1SU3 A;  1BSW A;  3HY9 A;  1R55 A;  4ILW D;  2JSD A;  4L63 A;  2W0D A;  1XUC A;  3TT4 A;  4PKR A;  1XFY A;  1PWU A;  4A7B A;  1CQR A;  4FVL A;  2W12 A;  1I1I P;  3P24 A;  3KWV C;  1AF0 A;  1JAO A;  2J0T A;  4JQG A;  3KEK A;  1BM6 A;  3LIL A;  2OVZ A;  4WZV A;  3KRY A;  2W14 A;  4PKV A;  5I2Z A;  1B3D A;  3N2V A;  2OVX A;  1CIZ A;  4FXY P;  4ZR5 A;  2USN A;  3AYK A;  2MZE A;  1XFZ A;  3UVC A;  2X3A A;  1UMS A;  1SRP A;  1Y93 A;  2OXW A;  3KEC A;  5CZM A;  1D7X A;  3Q2G A;  4AUO A;  3LJZ A;  4ON1 A;  1ND1 A;  4DPE A;  4XM6 A;  1C8T A;  3P1V A;  5H8X A;  1FLS A;  1ROS A;  3B2Z A;  5CXA A;  1CGE A;  3CKI A;  1J7N A;  1BKC A;  1O0T A;  4H2E A;  3E8R A;  3LIR A;  4I03 A;  3EHY A;  1AST A;  1BKC I;  1R1I A;  1QIC A;  2WOA A;  4H3X A;  3LJT A;  4WF6 A;  4FU4 A;  1ATL A;  2E3X A;  1UMT A;  2ERQ A;  2WO8 A;  5B5O A;  2OXZ A;  1MMP A;  3I7I A;  3HYG A;  1KUG A;  1OM7 A;  1R1H A;  3LEA A;  3F15 A;  4GWN A;  2MZI A;  3F19 A;  1ZXC A;  2OW9 A;  2J83 A;  3ZUK A;  1BIW A;  3B8Z A;  1ZS0 A;  3HB2 P;  5JMY A;  2X7M A;  1OM6 A;  2SRT A;  3EDZ A;  1JIW P;  1ZVX A;  2OI0 A;  1GO7 P;  1USN A;  1XFW A;  1QJJ A;  3EDH A;  2DW2 A;  1D8F A;  1D5J A;  3DPF A;  2HU6 A;  4HMA A;  456C A;  1JAN A;  1BQO A;  1JAP A;  2CKI A;  4XM8 A;  1PWW A;  1QJI A;  5D1T A;  1I76 A;  1JK3 A;  3SHI A;  2V4B A;  1Q3A A;  5D1S A;  4AXQ A;  2MLS A;  3USN A;  1Y8J A;  2Y6D A;  2AYK A;  1BUV M;  3OHL A;  3TVC A;  4AIG A;  3LUM A;  1ZTQ A;  2X3C A;  4IJO A;  1IAC A;  3K7N A;  2DW0 A;  3L0V A;  1HTD A;  2OZR A;  2K2G A;  3O2X A;  1OO9 A;  1OS9 A;  1XUR A;  1S4B P;  1QIA A;  4I35 A;  2DDF A;  3RTS A;  4DV8 A;  5I3M A;  1JKY A;  4PKU A;  1IAB A;  2RJP A;  4JIJ A;  2WO9 A;  4GR8 A;  2AIG P;  3KMC A;  2KRJ A;  1SLN A;  1H71 P;  1KUI A;  1K7G A;  3VI1 A;  1JAQ A;  3AYU A;  4PKT A;  1CGL A;  1KUF A;  4EFS A;  2Z2D A;  1SAT A;  4GR0 A;  4H82 A;  4PKQ A;  2K9C A;  5I4O A;  4H30 A;  1FM1 A;  1ZXV A;  5BOT A;  1R1J A;  4WKE A;  1YCM A;  3F18 A;  3DPE A;  5LAB A;  1RMZ A;  3I7G A;  2JT5 A;  1OMJ A;  2O36 A;  3OHO A;  4Q1L A;  2RJQ A;  1GE7 A;  1JIZ A;  4A3W A;  1EUB A;  4R3V A;  3MA2 A;  2E2D A;  2TCL A;  5B5P A;  2O3E A;  1YP1 A;  2OW0 A;  1ZP5 A;  2PJT A;  4HX3 A;  4IN9 A;  3NX7 A;  3LIK A;  2CLT A;  2JNP A;  1C3I A;  2FV5 A;  3LMC A;  4JPA A;  5D3C A;  4QKZ A;  2FV9 A;  1YOU A;  1KAP P;  1JH1 A;  3BA0 A;  4XM7 A;  4DD8 A;  2XS3 A;  3B92 A;  1CK7 A;  3F1A A;  1Y0V A; 
#chains in the Genus database with same CATH topology
 1D8M A;  2W13 A;  4H84 A;  1IAG A;  1HY7 A;  5L7F A;  3WV3 A;  4GQL A;  4H76 A;  2JIH A;  2OY4 A;  4PKS A;  3VTG A;  2POJ A;  3DSL A;  1YQY A;  3KME A;  1PWQ A;  3U1R A;  5I12 A;  2QPJ A;  3O64 A;  4L7A A;  1PWV A;  2MLR A;  1IAD A;  1QIB A;  1GO8 P;  3EDI A;  3LQ0 A;  3EDG A;  1Z3J A;  3V96 B;  3KEJ A;  1PWP A;  1HFC A;  1CGF A;  4L6T A;  830C A;  5I43 A;  3F17 A;  3HY7 A;  1MMR A;  1HV5 A;  2YIG A;  3HDA P;  1G49 A;  1UTT A;  1SMP A;  4WK7 A;  1IAA A;  3EWJ A;  4JA1 A;  3ZXH A;  3AIG A;  2XS4 A;  3DWB A;  3EHX A;  1OS2 A;  4DF9 A;  3HBV P;  1EAK A;  1GE5 A;  3ZVS A;  5D2B A;  1XFV A;  1XFX A;  4G9L A;  3LQB A;  2W15 A;  1G9K A;  1UEA A;  3GBO A;  1AKL A;  3KHI A;  1OZ9 A;  1GKD A;  5D1U A;  1GKC A;  4J4M A;  4G0D A;  3HDB A;  3TS4 A;  1R54 A;  1O0Q A;  5BPA A;  1SLM A;  2MZH A;  1K7Q A;  2Y6C A;  2ERP A;  5D7W A;  1BZS A;  2I47 A;  3G42 A;  5I0L A;  1A85 A;  3DTK A;  3HBU P;  3G5C A;  1AYK A;  1HFS A;  1XFU A;  3DTI A;  2N8R A;  3RTT A;  2D1N A;  1JJ9 A;  1DMT A;  1C7K A;  1RM8 A;  2D1O A;  3LUN A;  2A8H A;  2JT6 A;  3DL1 A;  4AYK A;  1FBL A;  2OY2 A;  5BOY A;  1G12 A;  1MMB A;  4GWM A;  3N2U A;  3Q2H A;  3WV1 A;  4GR3 A;  2OW2 A;  1CXV A;  4JP4 A;  3ELM A;  1MNC A;  4IUW A;  2OXU A;  5L79 A;  1BQQ M;  2DDY A;  4CTH A;  4WKI A;  3F16 A;  1DTH A;  1B8Y A;  1K7I A;  1XUD A;  2YUF A;  1EB6 A;  1I73 A;  1KUK A;  3LGP A;  3LKA A;  1BUD A;  1MMQ A;  1G4K A;  1GE6 A;  1L6J A;  1UTZ A;  4XCT A;  1QUA A;  3DTE A;  1HOV A;  2DW1 A;  3LK8 A;  3LJG A;  3DNG A;  3K7L A;  4FXQ A;  1G05 A;  4L19 A;  2YB9 A;  3LE9 A;  1CAQ A;  1BKC E;  5CUH A;  2L0R A;  2X3B A;  1WNI A;  966C A;  4GUY A;  1A86 A;  2ERO A;  1IAE A;  3L0T A;  2OW1 A;  3TSK A;  4PKW A;  1GXD A;  1KBC A;  4XBH A;  4GF1 A;  4H49 A;  1OM8 A;  4H1Q A;  3WV2 A;  1KUH A;  1SU3 A;  1BSW A;  3HY9 A;  1R55 A;  4ILW D;  2JSD A;  4L63 A;  2W0D A;  1XUC A;  3TT4 A;  4PKR A;  1XFY A;  1PWU A;  4A7B A;  1CQR A;  4FVL A;  2W12 A;  1I1I P;  3P24 A;  3KWV C;  1AF0 A;  1JAO A;  2J0T A;  4JQG A;  3KEK A;  1BM6 A;  3LIL A;  2OVZ A;  4WZV A;  3KRY A;  2W14 A;  4PKV A;  5I2Z A;  1B3D A;  3N2V A;  2OVX A;  1CIZ A;  4FXY P;  4ZR5 A;  2USN A;  3AYK A;  2MZE A;  1XFZ A;  3UVC A;  2X3A A;  1UMS A;  1SRP A;  1Y93 A;  2OXW A;  3KEC A;  5CZM A;  1D7X A;  3Q2G A;  4AUO A;  3LJZ A;  4ON1 A;  1ND1 A;  4DPE A;  4XM6 A;  1C8T A;  3P1V A;  5H8X A;  1FLS A;  1ROS A;  3B2Z A;  5CXA A;  1CGE A;  3CKI A;  1J7N A;  1BKC A;  1O0T A;  4H2E A;  3E8R A;  3LIR A;  4I03 A;  3EHY A;  1AST A;  1BKC I;  1R1I A;  1QIC A;  2WOA A;  4H3X A;  3LJT A;  4WF6 A;  4FU4 A;  1ATL A;  2E3X A;  1UMT A;  2ERQ A;  2WO8 A;  5B5O A;  2OXZ A;  1MMP A;  3I7I A;  3HYG A;  1KUG A;  1OM7 A;  1R1H A;  3LEA A;  3F15 A;  4GWN A;  2MZI A;  3F19 A;  1ZXC A;  2OW9 A;  2J83 A;  3ZUK A;  1BIW A;  3B8Z A;  1ZS0 A;  3HB2 P;  5JMY A;  2X7M A;  1OM6 A;  2SRT A;  3EDZ A;  1JIW P;  1ZVX A;  2OI0 A;  1GO7 P;  1USN A;  1XFW A;  1QJJ A;  3EDH A;  2DW2 A;  1D8F A;  1D5J A;  3DPF A;  2HU6 A;  4HMA A;  456C A;  1JAN A;  1BQO A;  1JAP A;  2CKI A;  4XM8 A;  1PWW A;  1QJI A;  5D1T A;  1I76 A;  1JK3 A;  3SHI A;  2V4B A;  1Q3A A;  5D1S A;  4AXQ A;  2MLS A;  3USN A;  1Y8J A;  2Y6D A;  2AYK A;  1BUV M;  3OHL A;  3TVC A;  4AIG A;  3LUM A;  1ZTQ A;  2X3C A;  4IJO A;  1IAC A;  3K7N A;  2DW0 A;  3L0V A;  1HTD A;  2OZR A;  2K2G A;  3O2X A;  1OO9 A;  1OS9 A;  1XUR A;  1S4B P;  1QIA A;  4I35 A;  2DDF A;  3RTS A;  4DV8 A;  5I3M A;  1JKY A;  4PKU A;  1IAB A;  2RJP A;  4JIJ A;  2WO9 A;  4GR8 A;  1TVI A;  2AIG P;  3KMC A;  2KRJ A;  1SLN A;  1H71 P;  1KUI A;  1K7G A;  3VI1 A;  1JAQ A;  3AYU A;  4PKT A;  1CGL A;  1KUF A;  4EFS A;  2Z2D A;  1SAT A;  4GR0 A;  4H82 A;  4PKQ A;  2K9C A;  5I4O A;  4H30 A;  1FM1 A;  1ZXV A;  5BOT A;  1R1J A;  4WKE A;  1YCM A;  3F18 A;  3DPE A;  5LAB A;  1RMZ A;  3I7G A;  2JT5 A;  1OMJ A;  1XAX A;  2O36 A;  3OHO A;  4Q1L A;  2RJQ A;  1GE7 A;  1JIZ A;  4A3W A;  1EUB A;  4R3V A;  3MA2 A;  2E2D A;  2TCL A;  5B5P A;  2O3E A;  1YP1 A;  2OW0 A;  1ZP5 A;  2PJT A;  4HX3 A;  4IN9 A;  3NX7 A;  3LIK A;  2CLT A;  1XM5 A;  2JNP A;  1C3I A;  2FV5 A;  3LMC A;  4JPA A;  5D3C A;  4QKZ A;  2FV9 A;  1YOU A;  1KAP P;  1JH1 A;  3BA0 A;  4XM7 A;  4DD8 A;  2XS3 A;  3B92 A;  1CK7 A;  3F1A A;  1Y0V A; 
#chains in the Genus database with same CATH homology
 1D8M A;  2W13 A;  4H84 A;  1IAG A;  1HY7 A;  5L7F A;  3WV3 A;  4GQL A;  4H76 A;  2JIH A;  2OY4 A;  4PKS A;  3VTG A;  2POJ A;  3DSL A;  1YQY A;  3KME A;  1PWQ A;  3U1R A;  5I12 A;  2QPJ A;  3O64 A;  4L7A A;  1PWV A;  2MLR A;  1IAD A;  1QIB A;  1GO8 P;  3EDI A;  3LQ0 A;  3EDG A;  1Z3J A;  3V96 B;  3KEJ A;  1PWP A;  1HFC A;  1CGF A;  4L6T A;  830C A;  5I43 A;  3F17 A;  3HY7 A;  1MMR A;  1HV5 A;  2YIG A;  3HDA P;  1G49 A;  1UTT A;  1SMP A;  4WK7 A;  1IAA A;  3EWJ A;  4JA1 A;  3ZXH A;  3AIG A;  2XS4 A;  3DWB A;  3EHX A;  1OS2 A;  4DF9 A;  3HBV P;  1EAK A;  1GE5 A;  3ZVS A;  5D2B A;  1XFV A;  1XFX A;  4G9L A;  3LQB A;  2W15 A;  1G9K A;  1UEA A;  3GBO A;  1AKL A;  3KHI A;  1GKD A;  5D1U A;  1GKC A;  4J4M A;  4G0D A;  3HDB A;  3TS4 A;  1R54 A;  1O0Q A;  5BPA A;  1SLM A;  2MZH A;  1K7Q A;  2Y6C A;  2ERP A;  5D7W A;  1BZS A;  2I47 A;  3G42 A;  5I0L A;  1A85 A;  3DTK A;  3HBU P;  3G5C A;  1AYK A;  1HFS A;  1XFU A;  3DTI A;  2N8R A;  3RTT A;  2D1N A;  1JJ9 A;  1DMT A;  1C7K A;  1RM8 A;  2D1O A;  3LUN A;  2A8H A;  2JT6 A;  3DL1 A;  4AYK A;  1FBL A;  2OY2 A;  5BOY A;  1G12 A;  1MMB A;  4GWM A;  3N2U A;  3Q2H A;  3WV1 A;  4GR3 A;  2OW2 A;  1CXV A;  4JP4 A;  3ELM A;  1MNC A;  4IUW A;  2OXU A;  5L79 A;  1BQQ M;  2DDY A;  4CTH A;  4WKI A;  3F16 A;  1DTH A;  1B8Y A;  1K7I A;  1XUD A;  2YUF A;  1EB6 A;  1I73 A;  1KUK A;  3LGP A;  3LKA A;  1BUD A;  1MMQ A;  1G4K A;  1GE6 A;  1L6J A;  1UTZ A;  4XCT A;  1QUA A;  3DTE A;  1HOV A;  2DW1 A;  3LK8 A;  3LJG A;  3DNG A;  3K7L A;  4FXQ A;  1G05 A;  4L19 A;  2YB9 A;  3LE9 A;  1CAQ A;  1BKC E;  5CUH A;  2L0R A;  2X3B A;  1WNI A;  966C A;  4GUY A;  1A86 A;  2ERO A;  1IAE A;  3L0T A;  2OW1 A;  3TSK A;  4PKW A;  1GXD A;  1KBC A;  4XBH A;  4GF1 A;  4H49 A;  1OM8 A;  4H1Q A;  3WV2 A;  1KUH A;  1SU3 A;  1BSW A;  3HY9 A;  1R55 A;  4ILW D;  2JSD A;  4L63 A;  2W0D A;  1XUC A;  3TT4 A;  4PKR A;  1XFY A;  1PWU A;  4A7B A;  1CQR A;  4FVL A;  2W12 A;  1I1I P;  3P24 A;  3KWV C;  1AF0 A;  1JAO A;  2J0T A;  4JQG A;  3KEK A;  1BM6 A;  3LIL A;  2OVZ A;  4WZV A;  3KRY A;  2W14 A;  4PKV A;  5I2Z A;  1B3D A;  3N2V A;  2OVX A;  1CIZ A;  4FXY P;  4ZR5 A;  2USN A;  3AYK A;  2MZE A;  1XFZ A;  3UVC A;  2X3A A;  1UMS A;  1SRP A;  1Y93 A;  2OXW A;  3KEC A;  5CZM A;  1D7X A;  3Q2G A;  4AUO A;  3LJZ A;  4ON1 A;  1ND1 A;  4DPE A;  4XM6 A;  1C8T A;  3P1V A;  5H8X A;  1FLS A;  1ROS A;  3B2Z A;  5CXA A;  1CGE A;  3CKI A;  1J7N A;  1BKC A;  1O0T A;  4H2E A;  3E8R A;  3LIR A;  4I03 A;  3EHY A;  1AST A;  1BKC I;  1R1I A;  1QIC A;  2WOA A;  4H3X A;  3LJT A;  4WF6 A;  4FU4 A;  1ATL A;  2E3X A;  1UMT A;  2ERQ A;  2WO8 A;  5B5O A;  2OXZ A;  1MMP A;  3I7I A;  3HYG A;  1KUG A;  1OM7 A;  1R1H A;  3LEA A;  3F15 A;  4GWN A;  2MZI A;  3F19 A;  1ZXC A;  2OW9 A;  2J83 A;  3ZUK A;  1BIW A;  3B8Z A;  1ZS0 A;  3HB2 P;  5JMY A;  2X7M A;  1OM6 A;  2SRT A;  3EDZ A;  1JIW P;  1ZVX A;  2OI0 A;  1GO7 P;  1USN A;  1XFW A;  1QJJ A;  3EDH A;  2DW2 A;  1D8F A;  1D5J A;  3DPF A;  2HU6 A;  4HMA A;  456C A;  1JAN A;  1BQO A;  1JAP A;  2CKI A;  4XM8 A;  1PWW A;  1QJI A;  5D1T A;  1I76 A;  1JK3 A;  3SHI A;  2V4B A;  1Q3A A;  5D1S A;  4AXQ A;  2MLS A;  3USN A;  1Y8J A;  2Y6D A;  2AYK A;  1BUV M;  3OHL A;  3TVC A;  4AIG A;  3LUM A;  1ZTQ A;  2X3C A;  4IJO A;  1IAC A;  3K7N A;  2DW0 A;  3L0V A;  1HTD A;  2OZR A;  2K2G A;  3O2X A;  1OO9 A;  1OS9 A;  1XUR A;  1S4B P;  1QIA A;  4I35 A;  2DDF A;  3RTS A;  4DV8 A;  5I3M A;  1JKY A;  4PKU A;  1IAB A;  2RJP A;  4JIJ A;  2WO9 A;  4GR8 A;  2AIG P;  3KMC A;  2KRJ A;  1SLN A;  1H71 P;  1KUI A;  1K7G A;  3VI1 A;  1JAQ A;  3AYU A;  4PKT A;  1CGL A;  1KUF A;  4EFS A;  2Z2D A;  1SAT A;  4GR0 A;  4H82 A;  4PKQ A;  2K9C A;  5I4O A;  4H30 A;  1FM1 A;  1ZXV A;  5BOT A;  1R1J A;  4WKE A;  1YCM A;  3F18 A;  3DPE A;  5LAB A;  1RMZ A;  3I7G A;  2JT5 A;  1OMJ A;  2O36 A;  3OHO A;  4Q1L A;  2RJQ A;  1GE7 A;  1JIZ A;  4A3W A;  1EUB A;  4R3V A;  3MA2 A;  2E2D A;  2TCL A;  5B5P A;  2O3E A;  1YP1 A;  2OW0 A;  1ZP5 A;  2PJT A;  4HX3 A;  4IN9 A;  3NX7 A;  3LIK A;  2CLT A;  2JNP A;  1C3I A;  2FV5 A;  3LMC A;  4JPA A;  5D3C A;  4QKZ A;  2FV9 A;  1YOU A;  1KAP P;  1JH1 A;  3BA0 A;  4XM7 A;  4DD8 A;  2XS3 A;  3B92 A;  1CK7 A;  3F1A A;  1Y0V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...