2OW1A

Mmp-9 active site mutant with trifluoromethyl hydroxamate inhibitor
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
159
structure length
159
Chain Sequence
b'FEGDLKWHHHNITYWIQNYSEDLPRAVIDDAFARAFALWSAVTPLTFTRVYSRDADIVIQFGVAEHGDGYPFDGKDGLLAHAFPPGPGIQGDAHFDDDELWSLGKGQGYSLFLVAAHQFGHALGLDHSSVPEALMYPMYRFTEGPPLHKDDVNGIRHLY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Matrix metalloproteinase-9 (MMP-9) (92 kDa type IV collagena
publication title Crystal Structures of MMP-9 Complexes with Five Inhibitors: Contribution of the Flexible Arg424 Side-chain to Selectivity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 44
structure length 159
sequence length 159
chains with identical sequence B
ec nomenclature ec 3.4.24.35: Gelatinase B.
pdb deposition date 2007-02-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 2ow1A00
5H8XA 3LUMA 2FV5A 3EHYA 2XS3A 4IN9A 4XCTA 1BUDA 1CAQA 1BQQM 1OS9A 2DW2A 3P24A 4ILWD 1KUIA 4PKWA 4H82A 1WNIA 4Q1LA 4H30A 2MZIA 4I03A 2OY2A 2OW0A 1ASTA 3TT4A 4QKZA 3KHIA 4AXQA 2MLRA 3K7LA 1BSWA 2OXWA 3V96B 1H71P 3DNGA 3WV1A 2AIGP 2D1NA 1KUHA 1RMZA 2OW9A 3UVCA 3KRYA 3LIKA 1ATLA 3EDZA 1XFVA 1XURA 1G9KA 1KUKA 1XFZA 3TVCA 4H3XA 1ZXVA 4XBHA 1R1IA 2MZHA 4AIGA 2POJA 2O36A 1GKDA 3LILA 4H84A 1QJJA 1YOUA 1ZTQA 3N2UA 1MMBA 2FV9A 3OHOA 2W0DA 4WF6A 1GO7P 3KWVC 4DPEA 1JKYA 1OM6A 1KUFA 5BOYA 4L19A 2X7MA 1JAOA 2DDYA 3HY9A 1O0TA 3KEKA 830CA 1IADA 5B5PA 4AYKA 1HFSA 1XFUA 4FVLA 3F19A 1GE6A 966CA 3Q2GA 1HOVA 1K7GA 1GE5A 1C8TA 4J4MA 4IUWA 3SHIA 1AF0A 1UMTA 4DF9A 1O0QA 1PWUA 1USNA 4FU4A 4JA1A 3F1AA 3B8ZA 3DSLA 2W12A 2SRTA 3O2XA 1UEAA 1IAAA 1SMPA 3EDIA 4PKSA 5BPAA 1Y0VA 1BIWA 3GBOA 2V4BA 2CLTA 4HX3A 1XFWA 2MZEA 2RJPA 4A7BA 4ON1A 4H76A 3G5CA 1Y8JA 1IAGA 4PKUA 1R54A 1HV5A 1CGLA 1JJ9A 4XM8A 1QJIA 1MMQA 2OI0A 1D8MA 4PKQA 3HDAP 2AYKA 1L6JA 5L7FA 4GWNA 1I1IP 2X3AA 2JSDA 1MNCA 4IJOA 2DW1A 2OW2A 3F18A 1GXDA 3RTTA 1DMTA 3HYGA 3LKAA 5D1UA 4H2EA 5I4OA 3O64A 4JP4A 4JPAA 1SU3A 4JIJA 4GQLA 3LQ0A 1XUCA 3F17A 3ZVSA 5BOTA 2DDFA 1SLMA 5D2BA 1SRPA 2O3EA 2X3CA 5D1SA 3DPEA 5D1TA 2CKIA 4PKVA 2K9CA 2ERQA 5LABA 3Q2HA 4WKEA 4EFSA 4GR8A 3EHXA 4GR0A 1G4KA 2W14A 3KMEA 1SATA 1K7IA 1I76A 1CXVA 5I0LA 3B2ZA 2USNA 4WKIA 1BKCA 1OMJA 4G9LA 1PWPA 3G42A 3KECA 1K7QA 3LIRA 1EUBA 4R3VA 1YP1A 1JK3A 1CIZA 1IABA 3LJZA 1JAQA 3F16A 4AUOA 3HBUP 1QIBA 4GUYA 4GWMA 5B5OA 1BKCE 3AIGA 1XFYA 1A85A 1HTDA 1CQRA 1JAPA 3DPFA 2Y6DA 4WZVA 1ROSA 3I7IA 1A86A 1HFCA 4G0DA 4L6TA 3RTSA 1BUVM 3OHLA 3LGPA 4DD8A 2Y6CA 1YQYA 2ERPA 4HMAA 1C3IA 1PWVA 3KMCA 2JT5A 2L0RA 4FXYP 1IACA 1GE7A 1JANA 1CGFA 3MA2A 2KRJA 2X3BA 3U1RA 3EDGA 1C7KA 3ELMA 3LK8A 1KAPP 2OZRA 4ZR5A 1PWQA 1ZP5A 3L0VA 4L63A 5D7WA 3HY7A 1GKCA 2RJQA 3AYUA 2OVXA 3LEAA 3TSKA 3LUNA 2HU6A 3KEJA 1PWWA 1B3DA 4JQGA 1OS2A 1XUDA 1SLNA 2YB9A 3B92A 1D5JA 1R1HA 1EAKA 3DL1A 3USNA 1FM1A 1JIZA 2PJTA 1JH1A 3P1VA 3NX7A 3CKIA 4H1QA 5L79A 1BM6A 1G12A 3TS4A 3VTGA 1HY7A 3F15A 2OY4A 5JMYA 1R1JA 3LJGA 5I2ZA 1ZVXA 3WV3A 2K2GA 1BKCI 5CUHA 1QICA 2J83A 2WO9A 5D3CA 3BA0A 1RM8A 3N2VA 2QPJA 5I43A 1G05A 4A3WA 5I3MA 2MLSA 1ND1A 1Y93A 1XFXA 3K7NA 2TCLA 4WK7A 1ZXCA 1G49A 3LJTA 3E8RA 1KUGA 3DWBA 1B8YA 1OO9A 3LE9A 2J0TA 3LQBA 2OW1A 2E3XA 2I47A 2EROA 2OXZA 4PKTA 1DTHA 456CA 1BZSA 4PKRA 1FBLA 2DW0A 3L0TA 3HBVP 1YCMA 4XM6A 3AYKA 4CTHA 2W15A 5CZMA 2JIHA 1UMSA 4H49A 1EB6A 4GR3A 2JNPA 2E2DA 2WOAA 1J7NA 2A8HA 2Z2DA 3VI1A 2W13A 1MMRA 1R55A 2XS4A 5CXAA 1UTTA 1OM8A 1IAEA 2JT6A 2OXUA 1MMPA 1OM7A 1D8FA 1KBCA 1CK7A 2D1OA 1AYKA 1Z3JA 1UTZA 5I12A 3HB2P 3WV2A 1AKLA 3EDHA 3HDBA 1BQOA 1Q3AA 1JIWP 4GF1A 1GO8P 3I7GA 4DV8A 1S4BP 2N8RA 2YIGA 3ZXHA 3LMCA 1I73A 1D7XA 4I35A 1FLSA 1ZS0A 1CGEA 1QIAA 2OVZA 3EWJA 4XM7A 3ZUKA 4FXQA 2WO8A 1QUAA
chains in the Genus database with same CATH superfamily
5H8XA 3LUMA 2FV5A 3DTIA 3EHYA 2XS3A 4IN9A 4XCTA 1BUDA 1CAQA 1BQQM 1OS9A 2DW2A 3P24A 4ILWD 1KUIA 4PKWA 4H82A 1WNIA 4Q1LA 4H30A 2MZIA 4I03A 2OY2A 2OW0A 1ASTA 3TT4A 4QKZA 3KHIA 4AXQA 2MLRA 3K7LA 1BSWA 2OXWA 3V96B 1H71P 3DNGA 3WV1A 2AIGP 2D1NA 1KUHA 1RMZA 2OW9A 3UVCA 3KRYA 3LIKA 1ATLA 3EDZA 1XFVA 1XURA 1G9KA 1KUKA 1XFZA 3TVCA 4H3XA 1ZXVA 4XBHA 1R1IA 2MZHA 4AIGA 2POJA 2O36A 1GKDA 3LILA 4H84A 1QJJA 1YOUA 1ZTQA 1XM5A 3N2UA 1MMBA 2FV9A 3OHOA 2W0DA 4WF6A 1GO7P 3KWVC 4DPEA 1JKYA 1OM6A 1KUFA 5BOYA 4L19A 2X7MA 1JAOA 2DDYA 3HY9A 1O0TA 3KEKA 830CA 1IADA 5B5PA 4AYKA 1HFSA 1XFUA 4FVLA 3F19A 1GE6A 966CA 3Q2GA 1HOVA 1K7GA 1GE5A 1C8TA 4J4MA 4IUWA 3SHIA 1AF0A 1UMTA 4DF9A 1O0QA 1PWUA 1USNA 4FU4A 4JA1A 3F1AA 3B8ZA 3DSLA 2W12A 2SRTA 3O2XA 1UEAA 1IAAA 1SMPA 3EDIA 4PKSA 5BPAA 1Y0VA 1BIWA 3GBOA 2V4BA 2CLTA 4HX3A 1XFWA 2MZEA 2RJPA 4A7BA 4ON1A 4H76A 3G5CA 1Y8JA 1IAGA 4PKUA 1R54A 1HV5A 1CGLA 1JJ9A 4XM8A 1QJIA 1MMQA 2OI0A 1D8MA 4PKQA 3HDAP 2AYKA 1L6JA 5L7FA 4GWNA 1I1IP 2X3AA 2JSDA 1MNCA 4IJOA 2DW1A 2OW2A 3F18A 1GXDA 3RTTA 1DMTA 3HYGA 3LKAA 5D1UA 4H2EA 5I4OA 3O64A 4JP4A 4JPAA 1SU3A 4JIJA 4GQLA 3LQ0A 1XUCA 3F17A 3ZVSA 5BOTA 2DDFA 1SLMA 5D2BA 1SRPA 2O3EA 2X3CA 5D1SA 3DPEA 5D1TA 2CKIA 3DTKA 4PKVA 2K9CA 2ERQA 1XAXA 5LABA 3Q2HA 4WKEA 4EFSA 4GR8A 3EHXA 4GR0A 1G4KA 2W14A 3KMEA 1SATA 1K7IA 1I76A 1CXVA 5I0LA 3B2ZA 2USNA 4WKIA 1BKCA 1OZ9A 1OMJA 4G9LA 1PWPA 4L7AA 3G42A 3KECA 1K7QA 3LIRA 1EUBA 2YUFA 4R3VA 1YP1A 1JK3A 1CIZA 1IABA 3LJZA 1JAQA 3F16A 4AUOA 3HBUP 1QIBA 4GUYA 4GWMA 5B5OA 1BKCE 3AIGA 1XFYA 1A85A 1HTDA 1CQRA 1JAPA 3DPFA 2Y6DA 4WZVA 1ROSA 3I7IA 1A86A 1HFCA 4G0DA 4L6TA 3RTSA 1BUVM 3OHLA 3LGPA 4DD8A 2Y6CA 1YQYA 2ERPA 4HMAA 1C3IA 1PWVA 3KMCA 2JT5A 2L0RA 4FXYP 1IACA 1GE7A 1JANA 1CGFA 3MA2A 2KRJA 2X3BA 3U1RA 3EDGA 1C7KA 3ELMA 3LK8A 1KAPP 2OZRA 4ZR5A 1PWQA 1ZP5A 3L0VA 4L63A 5D7WA 3HY7A 1GKCA 2RJQA 3AYUA 2OVXA 3LEAA 3TSKA 3LUNA 2HU6A 3KEJA 1PWWA 1B3DA 4JQGA 1OS2A 1XUDA 1SLNA 2YB9A 3B92A 1D5JA 1R1HA 1EAKA 3DL1A 3USNA 1FM1A 1JIZA 2PJTA 1JH1A 3P1VA 3NX7A 3CKIA 4H1QA 5L79A 1BM6A 1G12A 3TS4A 3VTGA 1HY7A 3F15A 2OY4A 5JMYA 1R1JA 3LJGA 5I2ZA 1ZVXA 3WV3A 2K2GA 1BKCI 5CUHA 1QICA 2J83A 2WO9A 5D3CA 3BA0A 1RM8A 3N2VA 2QPJA 5I43A 1G05A 4A3WA 5I3MA 2MLSA 1ND1A 1Y93A 1XFXA 3K7NA 2TCLA 4WK7A 1ZXCA 1G49A 3LJTA 3E8RA 1KUGA 3DWBA 1B8YA 1OO9A 3LE9A 2J0TA 3LQBA 2OW1A 2E3XA 2I47A 2EROA 2OXZA 4PKTA 1DTHA 456CA 1BZSA 4PKRA 1FBLA 2DW0A 3L0TA 3HBVP 1YCMA 4XM6A 3AYKA 4CTHA 3DTEA 2W15A 5CZMA 2JIHA 1UMSA 4H49A 1EB6A 4GR3A 2JNPA 2E2DA 2WOAA 1J7NA 2A8HA 2Z2DA 3VI1A 2W13A 1MMRA 1R55A 2XS4A 5CXAA 1UTTA 1OM8A 1IAEA 2JT6A 2OXUA 1MMPA 1OM7A 1D8FA 1KBCA 1CK7A 2D1OA 1AYKA 1Z3JA 1UTZA 5I12A 3HB2P 3WV2A 1AKLA 3EDHA 3HDBA 1BQOA 1Q3AA 1JIWP 4GF1A 1GO8P 3I7GA 4DV8A 1S4BP 2N8RA 2YIGA 3ZXHA 3LMCA 1I73A 1D7XA 4I35A 1FLSA 1ZS0A 1CGEA 1QIAA 2OVZA 3EWJA 4XM7A 3ZUKA 1TVIA 4FXQA 2WO8A 1QUAA
chains in the Genus database with same CATH topology
5H8XA 3LUMA 2FV5A 3DTIA 3EHYA 2XS3A 4IN9A 4XCTA 1BUDA 1CAQA 1BQQM 1OS9A 2DW2A 3P24A 4ILWD 1KUIA 4PKWA 4H82A 1WNIA 4Q1LA 4H30A 2MZIA 4I03A 2OY2A 2OW0A 1ASTA 3TT4A 4QKZA 3KHIA 4AXQA 2MLRA 3K7LA 1BSWA 2OXWA 3V96B 1H71P 3DNGA 3WV1A 2AIGP 2D1NA 1KUHA 1RMZA 2OW9A 3UVCA 3KRYA 3LIKA 1ATLA 3EDZA 1XFVA 1XURA 1G9KA 1KUKA 1XFZA 3TVCA 4H3XA 1ZXVA 4XBHA 1R1IA 2MZHA 4AIGA 2POJA 2O36A 1GKDA 3LILA 4H84A 1QJJA 1YOUA 1ZTQA 3N2UA 1MMBA 2FV9A 3OHOA 2W0DA 4WF6A 1GO7P 3KWVC 4DPEA 1JKYA 1OM6A 1KUFA 5BOYA 4L19A 2X7MA 1JAOA 2DDYA 3HY9A 1O0TA 3KEKA 830CA 1IADA 5B5PA 4AYKA 1HFSA 1XFUA 4FVLA 3F19A 1GE6A 966CA 3Q2GA 1HOVA 1K7GA 1GE5A 1C8TA 4J4MA 4IUWA 3SHIA 1AF0A 1UMTA 4DF9A 1O0QA 1PWUA 1USNA 4FU4A 4JA1A 3F1AA 3B8ZA 3DSLA 2W12A 2SRTA 3O2XA 1UEAA 1IAAA 1SMPA 3EDIA 4PKSA 5BPAA 1Y0VA 1BIWA 3GBOA 2V4BA 2CLTA 4HX3A 1XFWA 2MZEA 2RJPA 4A7BA 4ON1A 4H76A 3G5CA 1Y8JA 1IAGA 4PKUA 1R54A 1HV5A 1CGLA 1JJ9A 4XM8A 1QJIA 1MMQA 2OI0A 1D8MA 4PKQA 3HDAP 2AYKA 1L6JA 5L7FA 4GWNA 1I1IP 2X3AA 2JSDA 1MNCA 4IJOA 2DW1A 2OW2A 3F18A 1GXDA 3RTTA 1DMTA 3HYGA 3LKAA 5D1UA 4H2EA 5I4OA 3O64A 4JP4A 4JPAA 1SU3A 4JIJA 4GQLA 3LQ0A 1XUCA 3F17A 3ZVSA 5BOTA 2DDFA 1SLMA 5D2BA 1SRPA 2O3EA 2X3CA 5D1SA 3DPEA 5D1TA 2CKIA 3DTKA 4PKVA 2K9CA 2ERQA 5LABA 3Q2HA 4WKEA 4EFSA 4GR8A 3EHXA 4GR0A 1G4KA 2W14A 3KMEA 1SATA 1K7IA 1I76A 1CXVA 5I0LA 3B2ZA 2USNA 4WKIA 1BKCA 1OMJA 4G9LA 1PWPA 4L7AA 3G42A 3KECA 1K7QA 3LIRA 1EUBA 2YUFA 4R3VA 1YP1A 1JK3A 1CIZA 1IABA 3LJZA 1JAQA 3F16A 4AUOA 3HBUP 1QIBA 4GUYA 4GWMA 5B5OA 1BKCE 3AIGA 1XFYA 1A85A 1HTDA 1CQRA 1JAPA 3DPFA 2Y6DA 4WZVA 1ROSA 3I7IA 1A86A 1HFCA 4G0DA 4L6TA 3RTSA 1BUVM 3OHLA 3LGPA 4DD8A 2Y6CA 1YQYA 2ERPA 4HMAA 1C3IA 1PWVA 3KMCA 2JT5A 2L0RA 4FXYP 1IACA 1GE7A 1JANA 1CGFA 3MA2A 2KRJA 2X3BA 3U1RA 3EDGA 1C7KA 3ELMA 3LK8A 1KAPP 2OZRA 4ZR5A 1PWQA 1ZP5A 3L0VA 4L63A 5D7WA 3HY7A 1GKCA 2RJQA 3AYUA 2OVXA 3LEAA 3TSKA 3LUNA 2HU6A 3KEJA 1PWWA 1B3DA 4JQGA 1OS2A 1XUDA 1SLNA 2YB9A 3B92A 1D5JA 1R1HA 1EAKA 3DL1A 3USNA 1FM1A 1JIZA 2PJTA 1JH1A 3P1VA 3NX7A 3CKIA 4H1QA 5L79A 1BM6A 1G12A 3TS4A 3VTGA 1HY7A 3F15A 2OY4A 5JMYA 1R1JA 3LJGA 5I2ZA 1ZVXA 3WV3A 2K2GA 1BKCI 5CUHA 1QICA 2J83A 2WO9A 5D3CA 3BA0A 1RM8A 3N2VA 2QPJA 5I43A 1G05A 4A3WA 5I3MA 2MLSA 1ND1A 1Y93A 1XFXA 3K7NA 2TCLA 4WK7A 1ZXCA 1G49A 3LJTA 3E8RA 1KUGA 3DWBA 1B8YA 1OO9A 3LE9A 2J0TA 3LQBA 2OW1A 2E3XA 2I47A 2EROA 2OXZA 4PKTA 1DTHA 456CA 1BZSA 4PKRA 1FBLA 2DW0A 3L0TA 3HBVP 1YCMA 4XM6A 3AYKA 4CTHA 3DTEA 2W15A 5CZMA 2JIHA 1UMSA 4H49A 1EB6A 4GR3A 2JNPA 2E2DA 2WOAA 1J7NA 2A8HA 2Z2DA 3VI1A 2W13A 1MMRA 1R55A 2XS4A 5CXAA 1UTTA 1OM8A 1IAEA 2JT6A 2OXUA 1MMPA 1OM7A 1D8FA 1KBCA 1CK7A 2D1OA 1AYKA 1Z3JA 1UTZA 5I12A 3HB2P 3WV2A 1AKLA 3EDHA 3HDBA 1BQOA 1Q3AA 1JIWP 4GF1A 1GO8P 3I7GA 4DV8A 1S4BP 2N8RA 2YIGA 3ZXHA 3LMCA 1I73A 1D7XA 4I35A 1FLSA 1ZS0A 1CGEA 1QIAA 2OVZA 3EWJA 4XM7A 3ZUKA 4FXQA 2WO8A 1QUAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5H8X A;  3LUM A;  2FV5 A;  3EHY A;  2XS3 A;  4IN9 A;  4XCT A;  1BUD A;  1CAQ A;  1BQQ M;  1OS9 A;  2DW2 A;  3P24 A;  4ILW D;  1KUI A;  4PKW A;  4H82 A;  1WNI A;  4Q1L A;  4H30 A;  2MZI A;  4I03 A;  2OY2 A;  2OW0 A;  1AST A;  3TT4 A;  4QKZ A;  3KHI A;  4AXQ A;  2MLR A;  3K7L A;  1BSW A;  2OXW A;  3V96 B;  1H71 P;  3DNG A;  3WV1 A;  2AIG P;  2D1N A;  1KUH A;  1RMZ A;  2OW9 A;  3UVC A;  3KRY A;  3LIK A;  1ATL A;  3EDZ A;  1XFV A;  1XUR A;  1G9K A;  1KUK A;  1XFZ A;  3TVC A;  4H3X A;  1ZXV A;  4XBH A;  1R1I A;  2MZH A;  4AIG A;  2POJ A;  2O36 A;  1GKD A;  3LIL A;  4H84 A;  1QJJ A;  1YOU A;  1ZTQ A;  3N2U A;  1MMB A;  2FV9 A;  3OHO A;  2W0D A;  4WF6 A;  1GO7 P;  3KWV C;  4DPE A;  1JKY A;  1OM6 A;  1KUF A;  5BOY A;  4L19 A;  2X7M A;  1JAO A;  2DDY A;  3HY9 A;  1O0T A;  3KEK A;  830C A;  1IAD A;  5B5P A;  4AYK A;  1HFS A;  1XFU A;  4FVL A;  3F19 A;  1GE6 A;  966C A;  3Q2G A;  1HOV A;  1K7G A;  1GE5 A;  1C8T A;  4J4M A;  4IUW A;  3SHI A;  1AF0 A;  1UMT A;  4DF9 A;  1O0Q A;  1PWU A;  1USN A;  4FU4 A;  4JA1 A;  3F1A A;  3B8Z A;  3DSL A;  2W12 A;  2SRT A;  3O2X A;  1UEA A;  1IAA A;  1SMP A;  3EDI A;  4PKS A;  5BPA A;  1Y0V A;  1BIW A;  3GBO A;  2V4B A;  2CLT A;  4HX3 A;  1XFW A;  2MZE A;  2RJP A;  4A7B A;  4ON1 A;  4H76 A;  3G5C A;  1Y8J A;  1IAG A;  4PKU A;  1R54 A;  1HV5 A;  1CGL A;  1JJ9 A;  4XM8 A;  1QJI A;  1MMQ A;  2OI0 A;  1D8M A;  4PKQ A;  3HDA P;  2AYK A;  1L6J A;  5L7F A;  4GWN A;  1I1I P;  2X3A A;  2JSD A;  1MNC A;  4IJO A;  2DW1 A;  2OW2 A;  3F18 A;  1GXD A;  3RTT A;  1DMT A;  3HYG A;  3LKA A;  5D1U A;  4H2E A;  5I4O A;  3O64 A;  4JP4 A;  4JPA A;  1SU3 A;  4JIJ A;  4GQL A;  3LQ0 A;  1XUC A;  3F17 A;  3ZVS A;  5BOT A;  2DDF A;  1SLM A;  5D2B A;  1SRP A;  2O3E A;  2X3C A;  5D1S A;  3DPE A;  5D1T A;  2CKI A;  4PKV A;  2K9C A;  2ERQ A;  5LAB A;  3Q2H A;  4WKE A;  4EFS A;  4GR8 A;  3EHX A;  4GR0 A;  1G4K A;  2W14 A;  3KME A;  1SAT A;  1K7I A;  1I76 A;  1CXV A;  5I0L A;  3B2Z A;  2USN A;  4WKI A;  1BKC A;  1OMJ A;  4G9L A;  1PWP A;  3G42 A;  3KEC A;  1K7Q A;  3LIR A;  1EUB A;  4R3V A;  1YP1 A;  1JK3 A;  1CIZ A;  1IAB A;  3LJZ A;  1JAQ A;  3F16 A;  4AUO A;  3HBU P;  1QIB A;  4GUY A;  4GWM A;  5B5O A;  1BKC E;  3AIG A;  1XFY A;  1A85 A;  1HTD A;  1CQR A;  1JAP A;  3DPF A;  2Y6D A;  4WZV A;  1ROS A;  3I7I A;  1A86 A;  1HFC A;  4G0D A;  4L6T A;  3RTS A;  1BUV M;  3OHL A;  3LGP A;  4DD8 A;  2Y6C A;  1YQY A;  2ERP A;  4HMA A;  1C3I A;  1PWV A;  3KMC A;  2JT5 A;  2L0R A;  4FXY P;  1IAC A;  1GE7 A;  1JAN A;  1CGF A;  3MA2 A;  2KRJ A;  2X3B A;  3U1R A;  3EDG A;  1C7K A;  3ELM A;  3LK8 A;  1KAP P;  2OZR A;  4ZR5 A;  1PWQ A;  1ZP5 A;  3L0V A;  4L63 A;  5D7W A;  3HY7 A;  1GKC A;  2RJQ A;  3AYU A;  2OVX A;  3LEA A;  3TSK A;  3LUN A;  2HU6 A;  3KEJ A;  1PWW A;  1B3D A;  4JQG A;  1OS2 A;  1XUD A;  1SLN A;  2YB9 A;  3B92 A;  1D5J A;  1R1H A;  1EAK A;  3DL1 A;  3USN A;  1FM1 A;  1JIZ A;  2PJT A;  1JH1 A;  3P1V A;  3NX7 A;  3CKI A;  4H1Q A;  5L79 A;  1BM6 A;  1G12 A;  3TS4 A;  3VTG A;  1HY7 A;  3F15 A;  2OY4 A;  5JMY A;  1R1J A;  3LJG A;  5I2Z A;  1ZVX A;  3WV3 A;  2K2G A;  1BKC I;  5CUH A;  1QIC A;  2J83 A;  2WO9 A;  5D3C A;  3BA0 A;  1RM8 A;  3N2V A;  2QPJ A;  5I43 A;  1G05 A;  4A3W A;  5I3M A;  2MLS A;  1ND1 A;  1Y93 A;  1XFX A;  3K7N A;  2TCL A;  4WK7 A;  1ZXC A;  1G49 A;  3LJT A;  3E8R A;  1KUG A;  3DWB A;  1B8Y A;  1OO9 A;  3LE9 A;  2J0T A;  3LQB A;  2OW1 A;  2E3X A;  2I47 A;  2ERO A;  2OXZ A;  4PKT A;  1DTH A;  456C A;  1BZS A;  4PKR A;  1FBL A;  2DW0 A;  3L0T A;  3HBV P;  1YCM A;  4XM6 A;  3AYK A;  4CTH A;  2W15 A;  5CZM A;  2JIH A;  1UMS A;  4H49 A;  1EB6 A;  4GR3 A;  2JNP A;  2E2D A;  2WOA A;  1J7N A;  2A8H A;  2Z2D A;  3VI1 A;  2W13 A;  1MMR A;  1R55 A;  2XS4 A;  5CXA A;  1UTT A;  1OM8 A;  1IAE A;  2JT6 A;  2OXU A;  1MMP A;  1OM7 A;  1D8F A;  1KBC A;  1CK7 A;  2D1O A;  1AYK A;  1Z3J A;  1UTZ A;  5I12 A;  3HB2 P;  3WV2 A;  1AKL A;  3EDH A;  3HDB A;  1BQO A;  1Q3A A;  1JIW P;  4GF1 A;  1GO8 P;  3I7G A;  4DV8 A;  1S4B P;  2N8R A;  2YIG A;  3ZXH A;  3LMC A;  1I73 A;  1D7X A;  4I35 A;  1FLS A;  1ZS0 A;  1CGE A;  1QIA A;  2OVZ A;  3EWJ A;  4XM7 A;  3ZUK A;  4FXQ A;  2WO8 A;  1QUA A; 
#chains in the Genus database with same CATH topology
 5H8X A;  3LUM A;  2FV5 A;  3DTI A;  3EHY A;  2XS3 A;  4IN9 A;  4XCT A;  1BUD A;  1CAQ A;  1BQQ M;  1OS9 A;  2DW2 A;  3P24 A;  4ILW D;  1KUI A;  4PKW A;  4H82 A;  1WNI A;  4Q1L A;  4H30 A;  2MZI A;  4I03 A;  2OY2 A;  2OW0 A;  1AST A;  3TT4 A;  4QKZ A;  3KHI A;  4AXQ A;  2MLR A;  3K7L A;  1BSW A;  2OXW A;  3V96 B;  1H71 P;  3DNG A;  3WV1 A;  2AIG P;  2D1N A;  1KUH A;  1RMZ A;  2OW9 A;  3UVC A;  3KRY A;  3LIK A;  1ATL A;  3EDZ A;  1XFV A;  1XUR A;  1G9K A;  1KUK A;  1XFZ A;  3TVC A;  4H3X A;  1ZXV A;  4XBH A;  1R1I A;  2MZH A;  4AIG A;  2POJ A;  2O36 A;  1GKD A;  3LIL A;  4H84 A;  1QJJ A;  1YOU A;  1ZTQ A;  1XM5 A;  3N2U A;  1MMB A;  2FV9 A;  3OHO A;  2W0D A;  4WF6 A;  1GO7 P;  3KWV C;  4DPE A;  1JKY A;  1OM6 A;  1KUF A;  5BOY A;  4L19 A;  2X7M A;  1JAO A;  2DDY A;  3HY9 A;  1O0T A;  3KEK A;  830C A;  1IAD A;  5B5P A;  4AYK A;  1HFS A;  1XFU A;  4FVL A;  3F19 A;  1GE6 A;  966C A;  3Q2G A;  1HOV A;  1K7G A;  1GE5 A;  1C8T A;  4J4M A;  4IUW A;  3SHI A;  1AF0 A;  1UMT A;  4DF9 A;  1O0Q A;  1PWU A;  1USN A;  4FU4 A;  4JA1 A;  3F1A A;  3B8Z A;  3DSL A;  2W12 A;  2SRT A;  3O2X A;  1UEA A;  1IAA A;  1SMP A;  3EDI A;  4PKS A;  5BPA A;  1Y0V A;  1BIW A;  3GBO A;  2V4B A;  2CLT A;  4HX3 A;  1XFW A;  2MZE A;  2RJP A;  4A7B A;  4ON1 A;  4H76 A;  3G5C A;  1Y8J A;  1IAG A;  4PKU A;  1R54 A;  1HV5 A;  1CGL A;  1JJ9 A;  4XM8 A;  1QJI A;  1MMQ A;  2OI0 A;  1D8M A;  4PKQ A;  3HDA P;  2AYK A;  1L6J A;  5L7F A;  4GWN A;  1I1I P;  2X3A A;  2JSD A;  1MNC A;  4IJO A;  2DW1 A;  2OW2 A;  3F18 A;  1GXD A;  3RTT A;  1DMT A;  3HYG A;  3LKA A;  5D1U A;  4H2E A;  5I4O A;  3O64 A;  4JP4 A;  4JPA A;  1SU3 A;  4JIJ A;  4GQL A;  3LQ0 A;  1XUC A;  3F17 A;  3ZVS A;  5BOT A;  2DDF A;  1SLM A;  5D2B A;  1SRP A;  2O3E A;  2X3C A;  5D1S A;  3DPE A;  5D1T A;  2CKI A;  3DTK A;  4PKV A;  2K9C A;  2ERQ A;  1XAX A;  5LAB A;  3Q2H A;  4WKE A;  4EFS A;  4GR8 A;  3EHX A;  4GR0 A;  1G4K A;  2W14 A;  3KME A;  1SAT A;  1K7I A;  1I76 A;  1CXV A;  5I0L A;  3B2Z A;  2USN A;  4WKI A;  1BKC A;  1OZ9 A;  1OMJ A;  4G9L A;  1PWP A;  4L7A A;  3G42 A;  3KEC A;  1K7Q A;  3LIR A;  1EUB A;  2YUF A;  4R3V A;  1YP1 A;  1JK3 A;  1CIZ A;  1IAB A;  3LJZ A;  1JAQ A;  3F16 A;  4AUO A;  3HBU P;  1QIB A;  4GUY A;  4GWM A;  5B5O A;  1BKC E;  3AIG A;  1XFY A;  1A85 A;  1HTD A;  1CQR A;  1JAP A;  3DPF A;  2Y6D A;  4WZV A;  1ROS A;  3I7I A;  1A86 A;  1HFC A;  4G0D A;  4L6T A;  3RTS A;  1BUV M;  3OHL A;  3LGP A;  4DD8 A;  2Y6C A;  1YQY A;  2ERP A;  4HMA A;  1C3I A;  1PWV A;  3KMC A;  2JT5 A;  2L0R A;  4FXY P;  1IAC A;  1GE7 A;  1JAN A;  1CGF A;  3MA2 A;  2KRJ A;  2X3B A;  3U1R A;  3EDG A;  1C7K A;  3ELM A;  3LK8 A;  1KAP P;  2OZR A;  4ZR5 A;  1PWQ A;  1ZP5 A;  3L0V A;  4L63 A;  5D7W A;  3HY7 A;  1GKC A;  2RJQ A;  3AYU A;  2OVX A;  3LEA A;  3TSK A;  3LUN A;  2HU6 A;  3KEJ A;  1PWW A;  1B3D A;  4JQG A;  1OS2 A;  1XUD A;  1SLN A;  2YB9 A;  3B92 A;  1D5J A;  1R1H A;  1EAK A;  3DL1 A;  3USN A;  1FM1 A;  1JIZ A;  2PJT A;  1JH1 A;  3P1V A;  3NX7 A;  3CKI A;  4H1Q A;  5L79 A;  1BM6 A;  1G12 A;  3TS4 A;  3VTG A;  1HY7 A;  3F15 A;  2OY4 A;  5JMY A;  1R1J A;  3LJG A;  5I2Z A;  1ZVX A;  3WV3 A;  2K2G A;  1BKC I;  5CUH A;  1QIC A;  2J83 A;  2WO9 A;  5D3C A;  3BA0 A;  1RM8 A;  3N2V A;  2QPJ A;  5I43 A;  1G05 A;  4A3W A;  5I3M A;  2MLS A;  1ND1 A;  1Y93 A;  1XFX A;  3K7N A;  2TCL A;  4WK7 A;  1ZXC A;  1G49 A;  3LJT A;  3E8R A;  1KUG A;  3DWB A;  1B8Y A;  1OO9 A;  3LE9 A;  2J0T A;  3LQB A;  2OW1 A;  2E3X A;  2I47 A;  2ERO A;  2OXZ A;  4PKT A;  1DTH A;  456C A;  1BZS A;  4PKR A;  1FBL A;  2DW0 A;  3L0T A;  3HBV P;  1YCM A;  4XM6 A;  3AYK A;  4CTH A;  3DTE A;  2W15 A;  5CZM A;  2JIH A;  1UMS A;  4H49 A;  1EB6 A;  4GR3 A;  2JNP A;  2E2D A;  2WOA A;  1J7N A;  2A8H A;  2Z2D A;  3VI1 A;  2W13 A;  1MMR A;  1R55 A;  2XS4 A;  5CXA A;  1UTT A;  1OM8 A;  1IAE A;  2JT6 A;  2OXU A;  1MMP A;  1OM7 A;  1D8F A;  1KBC A;  1CK7 A;  2D1O A;  1AYK A;  1Z3J A;  1UTZ A;  5I12 A;  3HB2 P;  3WV2 A;  1AKL A;  3EDH A;  3HDB A;  1BQO A;  1Q3A A;  1JIW P;  4GF1 A;  1GO8 P;  3I7G A;  4DV8 A;  1S4B P;  2N8R A;  2YIG A;  3ZXH A;  3LMC A;  1I73 A;  1D7X A;  4I35 A;  1FLS A;  1ZS0 A;  1CGE A;  1QIA A;  2OVZ A;  3EWJ A;  4XM7 A;  3ZUK A;  1TVI A;  4FXQ A;  2WO8 A;  1QUA A; 
#chains in the Genus database with same CATH homology
 5H8X A;  3LUM A;  2FV5 A;  3DTI A;  3EHY A;  2XS3 A;  4IN9 A;  4XCT A;  1BUD A;  1CAQ A;  1BQQ M;  1OS9 A;  2DW2 A;  3P24 A;  4ILW D;  1KUI A;  4PKW A;  4H82 A;  1WNI A;  4Q1L A;  4H30 A;  2MZI A;  4I03 A;  2OY2 A;  2OW0 A;  1AST A;  3TT4 A;  4QKZ A;  3KHI A;  4AXQ A;  2MLR A;  3K7L A;  1BSW A;  2OXW A;  3V96 B;  1H71 P;  3DNG A;  3WV1 A;  2AIG P;  2D1N A;  1KUH A;  1RMZ A;  2OW9 A;  3UVC A;  3KRY A;  3LIK A;  1ATL A;  3EDZ A;  1XFV A;  1XUR A;  1G9K A;  1KUK A;  1XFZ A;  3TVC A;  4H3X A;  1ZXV A;  4XBH A;  1R1I A;  2MZH A;  4AIG A;  2POJ A;  2O36 A;  1GKD A;  3LIL A;  4H84 A;  1QJJ A;  1YOU A;  1ZTQ A;  3N2U A;  1MMB A;  2FV9 A;  3OHO A;  2W0D A;  4WF6 A;  1GO7 P;  3KWV C;  4DPE A;  1JKY A;  1OM6 A;  1KUF A;  5BOY A;  4L19 A;  2X7M A;  1JAO A;  2DDY A;  3HY9 A;  1O0T A;  3KEK A;  830C A;  1IAD A;  5B5P A;  4AYK A;  1HFS A;  1XFU A;  4FVL A;  3F19 A;  1GE6 A;  966C A;  3Q2G A;  1HOV A;  1K7G A;  1GE5 A;  1C8T A;  4J4M A;  4IUW A;  3SHI A;  1AF0 A;  1UMT A;  4DF9 A;  1O0Q A;  1PWU A;  1USN A;  4FU4 A;  4JA1 A;  3F1A A;  3B8Z A;  3DSL A;  2W12 A;  2SRT A;  3O2X A;  1UEA A;  1IAA A;  1SMP A;  3EDI A;  4PKS A;  5BPA A;  1Y0V A;  1BIW A;  3GBO A;  2V4B A;  2CLT A;  4HX3 A;  1XFW A;  2MZE A;  2RJP A;  4A7B A;  4ON1 A;  4H76 A;  3G5C A;  1Y8J A;  1IAG A;  4PKU A;  1R54 A;  1HV5 A;  1CGL A;  1JJ9 A;  4XM8 A;  1QJI A;  1MMQ A;  2OI0 A;  1D8M A;  4PKQ A;  3HDA P;  2AYK A;  1L6J A;  5L7F A;  4GWN A;  1I1I P;  2X3A A;  2JSD A;  1MNC A;  4IJO A;  2DW1 A;  2OW2 A;  3F18 A;  1GXD A;  3RTT A;  1DMT A;  3HYG A;  3LKA A;  5D1U A;  4H2E A;  5I4O A;  3O64 A;  4JP4 A;  4JPA A;  1SU3 A;  4JIJ A;  4GQL A;  3LQ0 A;  1XUC A;  3F17 A;  3ZVS A;  5BOT A;  2DDF A;  1SLM A;  5D2B A;  1SRP A;  2O3E A;  2X3C A;  5D1S A;  3DPE A;  5D1T A;  2CKI A;  3DTK A;  4PKV A;  2K9C A;  2ERQ A;  5LAB A;  3Q2H A;  4WKE A;  4EFS A;  4GR8 A;  3EHX A;  4GR0 A;  1G4K A;  2W14 A;  3KME A;  1SAT A;  1K7I A;  1I76 A;  1CXV A;  5I0L A;  3B2Z A;  2USN A;  4WKI A;  1BKC A;  1OMJ A;  4G9L A;  1PWP A;  4L7A A;  3G42 A;  3KEC A;  1K7Q A;  3LIR A;  1EUB A;  2YUF A;  4R3V A;  1YP1 A;  1JK3 A;  1CIZ A;  1IAB A;  3LJZ A;  1JAQ A;  3F16 A;  4AUO A;  3HBU P;  1QIB A;  4GUY A;  4GWM A;  5B5O A;  1BKC E;  3AIG A;  1XFY A;  1A85 A;  1HTD A;  1CQR A;  1JAP A;  3DPF A;  2Y6D A;  4WZV A;  1ROS A;  3I7I A;  1A86 A;  1HFC A;  4G0D A;  4L6T A;  3RTS A;  1BUV M;  3OHL A;  3LGP A;  4DD8 A;  2Y6C A;  1YQY A;  2ERP A;  4HMA A;  1C3I A;  1PWV A;  3KMC A;  2JT5 A;  2L0R A;  4FXY P;  1IAC A;  1GE7 A;  1JAN A;  1CGF A;  3MA2 A;  2KRJ A;  2X3B A;  3U1R A;  3EDG A;  1C7K A;  3ELM A;  3LK8 A;  1KAP P;  2OZR A;  4ZR5 A;  1PWQ A;  1ZP5 A;  3L0V A;  4L63 A;  5D7W A;  3HY7 A;  1GKC A;  2RJQ A;  3AYU A;  2OVX A;  3LEA A;  3TSK A;  3LUN A;  2HU6 A;  3KEJ A;  1PWW A;  1B3D A;  4JQG A;  1OS2 A;  1XUD A;  1SLN A;  2YB9 A;  3B92 A;  1D5J A;  1R1H A;  1EAK A;  3DL1 A;  3USN A;  1FM1 A;  1JIZ A;  2PJT A;  1JH1 A;  3P1V A;  3NX7 A;  3CKI A;  4H1Q A;  5L79 A;  1BM6 A;  1G12 A;  3TS4 A;  3VTG A;  1HY7 A;  3F15 A;  2OY4 A;  5JMY A;  1R1J A;  3LJG A;  5I2Z A;  1ZVX A;  3WV3 A;  2K2G A;  1BKC I;  5CUH A;  1QIC A;  2J83 A;  2WO9 A;  5D3C A;  3BA0 A;  1RM8 A;  3N2V A;  2QPJ A;  5I43 A;  1G05 A;  4A3W A;  5I3M A;  2MLS A;  1ND1 A;  1Y93 A;  1XFX A;  3K7N A;  2TCL A;  4WK7 A;  1ZXC A;  1G49 A;  3LJT A;  3E8R A;  1KUG A;  3DWB A;  1B8Y A;  1OO9 A;  3LE9 A;  2J0T A;  3LQB A;  2OW1 A;  2E3X A;  2I47 A;  2ERO A;  2OXZ A;  4PKT A;  1DTH A;  456C A;  1BZS A;  4PKR A;  1FBL A;  2DW0 A;  3L0T A;  3HBV P;  1YCM A;  4XM6 A;  3AYK A;  4CTH A;  3DTE A;  2W15 A;  5CZM A;  2JIH A;  1UMS A;  4H49 A;  1EB6 A;  4GR3 A;  2JNP A;  2E2D A;  2WOA A;  1J7N A;  2A8H A;  2Z2D A;  3VI1 A;  2W13 A;  1MMR A;  1R55 A;  2XS4 A;  5CXA A;  1UTT A;  1OM8 A;  1IAE A;  2JT6 A;  2OXU A;  1MMP A;  1OM7 A;  1D8F A;  1KBC A;  1CK7 A;  2D1O A;  1AYK A;  1Z3J A;  1UTZ A;  5I12 A;  3HB2 P;  3WV2 A;  1AKL A;  3EDH A;  3HDB A;  1BQO A;  1Q3A A;  1JIW P;  4GF1 A;  1GO8 P;  3I7G A;  4DV8 A;  1S4B P;  2N8R A;  2YIG A;  3ZXH A;  3LMC A;  1I73 A;  1D7X A;  4I35 A;  1FLS A;  1ZS0 A;  1CGE A;  1QIA A;  2OVZ A;  3EWJ A;  4XM7 A;  3ZUK A;  4FXQ A;  2WO8 A;  1QUA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...