2OW1A

Mmp-9 active site mutant with trifluoromethyl hydroxamate inhibitor
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
159
structure length
159
Chain Sequence
FEGDLKWHHHNITYWIQNYSEDLPRAVIDDAFARAFALWSAVTPLTFTRVYSRDADIVIQFGVAEHGDGYPFDGKDGLLAHAFPPGPGIQGDAHFDDDELWSLGKGQGYSLFLVAAHQFGHALGLDHSSVPEALMYPMYRFTEGPPLHKDDVNGIRHLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Matrix metalloproteinase-9 (MMP-9) (92 kDa type IV collagena
publication title Crystal Structures of MMP-9 Complexes with Five Inhibitors: Contribution of the Flexible Arg424 Side-chain to Selectivity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 44
structure length 159
sequence length 159
chains with identical sequence B
ec nomenclature ec 3.4.24.35: Gelatinase B.
pdb deposition date 2007-02-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 2ow1A00
3NX7A 3K7LA 1XFXA 1PWWA 4XBHA 1KUFA 1JJ9A 2RJQA 2OZRA 2FV9A 2W0DA 3USNA 3F15A 2AIGP 1XFUA 4GR3A 1J7NA 5CXAA 3ZVSA 1UMTA 3EDIA 1GO8P 3N2VA 4GR0A 4H82A 1XUCA 1UTZA 2OW1A 4AUOA 4ON1A 4GR8A 1JAPA 4A3WA 3HBUP 4ILWD 4WK7A 5B5PA 2X3AA 3LE9A 1JAOA 2AYKA 3EWJA 1BQQM 3AIGA 2USNA 1FLSA 1QICA 1XFWA 3DNGA 3O2XA 3G42A 4AYKA 2OVZA 1BZSA 4I03A 2PJTA 3LIKA 3OHLA 1QJIA 3TT4A 1QIAA 3WV3A 2RJPA 1JKYA 3KWVC 4GF1A 4PKTA 1HV5A 2K2GA 1IAGA 4DV8A 2JIHA 2WO8A 3Q2HA 1Z3JA 1K7GA 3DSLA 1SU3A 2YB9A 4PKRA 3I7IA 456CA 2I47A 1O0TA 3I7GA 1SRPA 3TSKA 1KUGA 3MA2A 2MZEA 1UEAA 1RM8A 4A7BA 1IACA 1OM6A 2OW2A 1D5JA 1OM7A 3GBOA 1MNCA 1BSWA 1HFCA 5B5OA 4JPAA 1UMSA 2O3EA 5I0LA 2OW9A 1XFZA 5L7FA 2OXZA 2A8HA 4AXQA 4DF9A 1BUDA 1CGLA 3G5CA 1GXDA 2ERQA 2DDYA 2O36A 1KBCA 1G9KA 2QPJA 1D7XA 3F18A 1CK7A 3AYKA 1DMTA 3LUNA 1PWQA 2CLTA 4H3XA 1S4BP 3P24A 1ASTA 2EROA 1A86A 1SATA 2MZHA 2OI0A 1Y8JA 1G05A 1I73A 2TCLA 1K7IA 830CA 3KHIA 3ZXHA 3WV1A 4ZR5A 1PWPA 4GWNA 1RMZA 1SLNA 3KMEA 3RTSA 1GKCA 1KUIA 5CUHA 2W12A 4JIJA 4PKUA 2DW0A 3LGPA 5BOTA 4XCTA 3DL1A 5I12A 5D1UA 4L19A 1FM1A 2WO9A 2DW1A 1FBLA 2K9CA 3LJTA 1ZP5A 5BPAA 3DPFA 1XURA 1CGEA 1R1IA 1OO9A 1BQOA 2MLSA 5D3CA 966CA 1G4KA 3HDBA 4JA1A 1IAEA 1CAQA 1AKLA 4J4MA 3LQ0A 5D1TA 1ATLA 3EDZA 3O64A 3ELMA 3B92A 4PKQA 1ZXVA 2DDFA 4PKWA 1EB6A 4WKEA 4H76A 1YP1A 2MLRA 1JIZA 4H84A 5I43A 1I76A 3LQBA 1MMBA 2XS3A 2Y6DA 3HB2P 2D1NA 4IN9A 5D7WA 3LILA 1R55A 3HYGA 1R54A 1R1JA 3K7NA 3U1RA 2OY2A 1JH1A 1Q3AA 2CKIA 3EDGA 5I4OA 1ZXCA 2OXWA 2J83A 1K7QA 1MMPA 1XFVA 1YQYA 1EAKA 1ZS0A 3HY9A 3KRYA 1HFSA 5D1SA 2E3XA 3RTTA 2HU6A 4R3VA 1JANA 1OM8A 1HOVA 2WOAA 3VTGA 1DTHA 3LJZA 3HDAP 4XM7A 1AF0A 1JK3A 1L6JA 4FVLA 3KMCA 1GO7P 1OMJA 1C7KA 2J0TA 3F17A 1CQRA 2OY4A 4FXQA 2W13A 3DWBA 3KECA 1C3IA 1KAPP 2ERPA 1IAAA 2POJA 3B8ZA 5CZMA 3VI1A 5LABA 3TVCA 1HTDA 1Y93A 3CKIA 1PWUA 2N8RA 3LK8A 1PWVA 5JMYA 3L0VA 4HX3A 2JT6A 3WV2A 1UTTA 1O0QA 1KUHA 1IADA 2W15A 4WKIA 1BM6A 1B3DA 4JP4A 4GQLA 2JT5A 1YOUA 4CTHA 3HBVP 4FXYP 2V4BA 3E8RA 1Y0VA 4EFSA 3LMCA 1G12A 1ZTQA 3LIRA 1XUDA 5I3MA 4Q1LA 1GKDA 3P1VA 3LUMA 4FU4A 2OVXA 3DPEA 1BUVM 4DD8A 1AYKA 5L79A 3KEKA 1MMQA 4QKZA 1JAQA 4G9LA 4IJOA 3SHIA 4H2EA 1BKCE 1WNIA 4I35A 5BOYA 3EHYA 1MMRA 3BA0A 4XM6A 1SLMA 3LKAA 4L63A 2D1OA 1D8MA 3B2ZA 2X3CA 3LJGA 3KEJA 1GE5A 1GE6A 1EUBA 2L0RA 1CGFA 1B8YA 1BIWA 4PKSA 2OW0A 3TS4A 2X3BA 3V96B 3UVCA 4H49A 2KRJA 2FV5A 1SMPA 5I2ZA 1A85A 1USNA 2W14A 1G49A 1JIWP 4G0DA 2SRTA 2X7MA 4H1QA 2MZIA 3Q2GA 3N2UA 4H30A 1IABA 4L6TA 4XM8A 1BKCI 1CIZA 1R1HA 5D2BA 1D8FA 1HY7A 3F19A 5H8XA 4IUWA 1QIBA 1CXVA 3HY7A 1ZVXA 3ZUKA 2OXUA 4JQGA 1QUAA 1GE7A 4HMAA 1OS2A 2JNPA 1H71P 1QJJA 1ND1A 3EHXA 3EDHA 1KUKA 3F16A 4DPEA 2E2DA 1BKCA 4PKVA 2JSDA 3F1AA 4WZVA 4GWMA 2DW2A 1I1IP 4GUYA 2Y6CA 2YIGA 3OHOA 1YCMA 2Z2DA 4WF6A 2XS4A 3L0TA 1C8TA 1XFYA 3AYUA 1ROSA 4AIGA 3LEAA 1OS9A
chains in the Genus database with same CATH superfamily
3NX7A 3K7LA 1XFXA 1PWWA 4XBHA 1KUFA 1JJ9A 2RJQA 2OZRA 2FV9A 2W0DA 3USNA 3F15A 2AIGP 1XFUA 4GR3A 1J7NA 5CXAA 3ZVSA 1UMTA 3EDIA 1GO8P 3N2VA 4GR0A 4H82A 1XUCA 1UTZA 2OW1A 4AUOA 4ON1A 4GR8A 1JAPA 4A3WA 3HBUP 4ILWD 4WK7A 5B5PA 2X3AA 3LE9A 1JAOA 2AYKA 3EWJA 1BQQM 3AIGA 2USNA 1FLSA 1QICA 1XFWA 3DNGA 3O2XA 3G42A 4AYKA 2OVZA 1BZSA 4I03A 2PJTA 3LIKA 3OHLA 1QJIA 3TT4A 1QIAA 3WV3A 2RJPA 1JKYA 3KWVC 4GF1A 4PKTA 1HV5A 2K2GA 1IAGA 4DV8A 2JIHA 2WO8A 3Q2HA 1Z3JA 1K7GA 3DSLA 1SU3A 2YB9A 4PKRA 3I7IA 456CA 2I47A 1O0TA 3I7GA 1SRPA 3TSKA 1KUGA 3MA2A 2MZEA 1UEAA 1RM8A 4A7BA 1IACA 1OM6A 2OW2A 1D5JA 1OM7A 3GBOA 1MNCA 1BSWA 1HFCA 5B5OA 4JPAA 1UMSA 2O3EA 5I0LA 2OW9A 1XFZA 5L7FA 2OXZA 2A8HA 4AXQA 4DF9A 1BUDA 1CGLA 3G5CA 1GXDA 2ERQA 2DDYA 2O36A 1KBCA 1G9KA 2QPJA 1D7XA 3F18A 1CK7A 3AYKA 1DMTA 3LUNA 1PWQA 2CLTA 4H3XA 1S4BP 3P24A 1ASTA 4L7AA 3DTKA 2EROA 1A86A 1SATA 2MZHA 2OI0A 1Y8JA 1G05A 1XAXA 1I73A 2TCLA 1K7IA 1OZ9A 830CA 3KHIA 3ZXHA 3WV1A 4ZR5A 1PWPA 4GWNA 1RMZA 1SLNA 3KMEA 3RTSA 1GKCA 1KUIA 5CUHA 2W12A 4JIJA 4PKUA 2DW0A 3LGPA 5BOTA 4XCTA 3DL1A 5I12A 5D1UA 4L19A 1FM1A 2WO9A 2DW1A 1FBLA 2K9CA 3LJTA 1ZP5A 5BPAA 3DPFA 1XURA 1CGEA 1R1IA 1OO9A 1BQOA 2MLSA 5D3CA 966CA 1G4KA 3HDBA 4JA1A 1IAEA 1CAQA 1AKLA 4J4MA 3LQ0A 5D1TA 1ATLA 3EDZA 3O64A 3ELMA 3B92A 4PKQA 1ZXVA 2DDFA 4PKWA 1EB6A 4WKEA 4H76A 1YP1A 2MLRA 1JIZA 4H84A 5I43A 1I76A 3LQBA 1MMBA 2XS3A 2Y6DA 3HB2P 2D1NA 4IN9A 5D7WA 3LILA 1R55A 3HYGA 1R54A 1R1JA 3K7NA 3U1RA 2OY2A 1JH1A 1Q3AA 2CKIA 3EDGA 5I4OA 1ZXCA 2OXWA 2J83A 1K7QA 1MMPA 1XFVA 1YQYA 1EAKA 1XM5A 1ZS0A 3HY9A 3KRYA 1HFSA 5D1SA 2E3XA 3RTTA 2HU6A 4R3VA 1JANA 1OM8A 1HOVA 2WOAA 3VTGA 1DTHA 3LJZA 3HDAP 4XM7A 1AF0A 1JK3A 1L6JA 4FVLA 3KMCA 1GO7P 1OMJA 1C7KA 2J0TA 3F17A 1CQRA 3DTIA 2OY4A 4FXQA 2W13A 3DWBA 3KECA 1C3IA 1KAPP 2ERPA 1IAAA 2POJA 3B8ZA 5CZMA 3VI1A 5LABA 3TVCA 1HTDA 1Y93A 3CKIA 1PWUA 2N8RA 3LK8A 1PWVA 5JMYA 3L0VA 4HX3A 2JT6A 3WV2A 1UTTA 1O0QA 1KUHA 1IADA 2W15A 4WKIA 1BM6A 1B3DA 4JP4A 4GQLA 2JT5A 1YOUA 4CTHA 3HBVP 4FXYP 2V4BA 3E8RA 1Y0VA 4EFSA 3LMCA 1G12A 1ZTQA 3LIRA 1XUDA 5I3MA 4Q1LA 1GKDA 3P1VA 3LUMA 4FU4A 2OVXA 3DPEA 1BUVM 4DD8A 1AYKA 5L79A 3KEKA 1MMQA 4QKZA 1JAQA 4G9LA 4IJOA 3SHIA 4H2EA 1BKCE 1WNIA 4I35A 5BOYA 3EHYA 1MMRA 3BA0A 4XM6A 1SLMA 3LKAA 4L63A 2D1OA 1D8MA 3B2ZA 2X3CA 3LJGA 3KEJA 1GE5A 1GE6A 1EUBA 2L0RA 1CGFA 3DTEA 1B8YA 1BIWA 4PKSA 2OW0A 3TS4A 2X3BA 3V96B 3UVCA 4H49A 2KRJA 2FV5A 1SMPA 5I2ZA 1A85A 1USNA 2W14A 1G49A 1JIWP 1TVIA 4G0DA 2SRTA 2X7MA 4H1QA 2MZIA 3Q2GA 3N2UA 4H30A 1IABA 4L6TA 4XM8A 1BKCI 1CIZA 1R1HA 5D2BA 1D8FA 1HY7A 3F19A 5H8XA 4IUWA 1QIBA 1CXVA 3HY7A 1ZVXA 3ZUKA 2OXUA 4JQGA 1QUAA 1GE7A 4HMAA 1OS2A 2JNPA 1H71P 1QJJA 1ND1A 3EHXA 3EDHA 1KUKA 3F16A 4DPEA 2E2DA 1BKCA 4PKVA 2JSDA 3F1AA 4WZVA 4GWMA 2DW2A 1I1IP 4GUYA 2Y6CA 2YIGA 2YUFA 3OHOA 1YCMA 2Z2DA 4WF6A 2XS4A 3L0TA 1C8TA 1XFYA 3AYUA 1ROSA 4AIGA 3LEAA 1OS9A
chains in the Genus database with same CATH topology
3NX7A 3K7LA 1XFXA 1PWWA 4XBHA 1KUFA 1JJ9A 2RJQA 2OZRA 2FV9A 2W0DA 3USNA 3F15A 2AIGP 1XFUA 4GR3A 1J7NA 5CXAA 3ZVSA 1UMTA 3EDIA 1GO8P 3N2VA 4GR0A 4H82A 1XUCA 1UTZA 2OW1A 4AUOA 4ON1A 4GR8A 1JAPA 4A3WA 3HBUP 4ILWD 4WK7A 5B5PA 2X3AA 3LE9A 1JAOA 2AYKA 3EWJA 1BQQM 3AIGA 2USNA 1FLSA 1QICA 1XFWA 3DNGA 3O2XA 3G42A 4AYKA 2OVZA 1BZSA 4I03A 2PJTA 3LIKA 3OHLA 1QJIA 3TT4A 1QIAA 3WV3A 2RJPA 1JKYA 3KWVC 4GF1A 4PKTA 1HV5A 2K2GA 1IAGA 4DV8A 2JIHA 2WO8A 3Q2HA 1Z3JA 1K7GA 3DSLA 1SU3A 2YB9A 4PKRA 3I7IA 456CA 2I47A 1O0TA 3I7GA 1SRPA 3TSKA 1KUGA 3MA2A 2MZEA 1UEAA 1RM8A 4A7BA 1IACA 1OM6A 2OW2A 1D5JA 1OM7A 3GBOA 1MNCA 1BSWA 1HFCA 5B5OA 4JPAA 1UMSA 2O3EA 5I0LA 2OW9A 1XFZA 5L7FA 2OXZA 2A8HA 4AXQA 4DF9A 1BUDA 1CGLA 3G5CA 1GXDA 2ERQA 2DDYA 2O36A 1KBCA 1G9KA 2QPJA 1D7XA 3F18A 1CK7A 3AYKA 1DMTA 3LUNA 1PWQA 2CLTA 4H3XA 1S4BP 3P24A 1ASTA 4L7AA 3DTKA 2EROA 1A86A 1SATA 2MZHA 2OI0A 1Y8JA 1G05A 1I73A 2TCLA 1K7IA 830CA 3KHIA 3ZXHA 3WV1A 4ZR5A 1PWPA 4GWNA 1RMZA 1SLNA 3KMEA 3RTSA 1GKCA 1KUIA 5CUHA 2W12A 4JIJA 4PKUA 2DW0A 3LGPA 5BOTA 4XCTA 3DL1A 5I12A 5D1UA 4L19A 1FM1A 2WO9A 2DW1A 1FBLA 2K9CA 3LJTA 1ZP5A 5BPAA 3DPFA 1XURA 1CGEA 1R1IA 1OO9A 1BQOA 2MLSA 5D3CA 966CA 1G4KA 3HDBA 4JA1A 1IAEA 1CAQA 1AKLA 4J4MA 3LQ0A 5D1TA 1ATLA 3EDZA 3O64A 3ELMA 3B92A 4PKQA 1ZXVA 2DDFA 4PKWA 1EB6A 4WKEA 4H76A 1YP1A 2MLRA 1JIZA 4H84A 5I43A 1I76A 3LQBA 1MMBA 2XS3A 2Y6DA 3HB2P 2D1NA 4IN9A 5D7WA 3LILA 1R55A 3HYGA 1R54A 1R1JA 3K7NA 3U1RA 2OY2A 1JH1A 1Q3AA 2CKIA 3EDGA 5I4OA 1ZXCA 2OXWA 2J83A 1K7QA 1MMPA 1XFVA 1YQYA 1EAKA 1ZS0A 3HY9A 3KRYA 1HFSA 5D1SA 2E3XA 3RTTA 2HU6A 4R3VA 1JANA 1OM8A 1HOVA 2WOAA 3VTGA 1DTHA 3LJZA 3HDAP 4XM7A 1AF0A 1JK3A 1L6JA 4FVLA 3KMCA 1GO7P 1OMJA 1C7KA 2J0TA 3F17A 1CQRA 3DTIA 2OY4A 4FXQA 2W13A 3DWBA 3KECA 1C3IA 1KAPP 2ERPA 1IAAA 2POJA 3B8ZA 5CZMA 3VI1A 5LABA 3TVCA 1HTDA 1Y93A 3CKIA 1PWUA 2N8RA 3LK8A 1PWVA 5JMYA 3L0VA 4HX3A 2JT6A 3WV2A 1UTTA 1O0QA 1KUHA 1IADA 2W15A 4WKIA 1BM6A 1B3DA 4JP4A 4GQLA 2JT5A 1YOUA 4CTHA 3HBVP 4FXYP 2V4BA 3E8RA 1Y0VA 4EFSA 3LMCA 1G12A 1ZTQA 3LIRA 1XUDA 5I3MA 4Q1LA 1GKDA 3P1VA 3LUMA 4FU4A 2OVXA 3DPEA 1BUVM 4DD8A 1AYKA 5L79A 3KEKA 1MMQA 4QKZA 1JAQA 4G9LA 4IJOA 3SHIA 4H2EA 1BKCE 1WNIA 4I35A 5BOYA 3EHYA 1MMRA 3BA0A 4XM6A 1SLMA 3LKAA 4L63A 2D1OA 1D8MA 3B2ZA 2X3CA 3LJGA 3KEJA 1GE5A 1GE6A 1EUBA 2L0RA 1CGFA 3DTEA 1B8YA 1BIWA 4PKSA 2OW0A 3TS4A 2X3BA 3V96B 3UVCA 4H49A 2KRJA 2FV5A 1SMPA 5I2ZA 1A85A 1USNA 2W14A 1G49A 1JIWP 4G0DA 2SRTA 2X7MA 4H1QA 2MZIA 3Q2GA 3N2UA 4H30A 1IABA 4L6TA 4XM8A 1BKCI 1CIZA 1R1HA 5D2BA 1D8FA 1HY7A 3F19A 5H8XA 4IUWA 1QIBA 1CXVA 3HY7A 1ZVXA 3ZUKA 2OXUA 4JQGA 1QUAA 1GE7A 4HMAA 1OS2A 2JNPA 1H71P 1QJJA 1ND1A 3EHXA 3EDHA 1KUKA 3F16A 4DPEA 2E2DA 1BKCA 4PKVA 2JSDA 3F1AA 4WZVA 4GWMA 2DW2A 1I1IP 4GUYA 2Y6CA 2YIGA 2YUFA 3OHOA 1YCMA 2Z2DA 4WF6A 2XS4A 3L0TA 1C8TA 1XFYA 3AYUA 1ROSA 4AIGA 3LEAA 1OS9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NX7 A;  3K7L A;  1XFX A;  1PWW A;  4XBH A;  1KUF A;  1JJ9 A;  2RJQ A;  2OZR A;  2FV9 A;  2W0D A;  3USN A;  3F15 A;  2AIG P;  1XFU A;  4GR3 A;  1J7N A;  5CXA A;  3ZVS A;  1UMT A;  3EDI A;  1GO8 P;  3N2V A;  4GR0 A;  4H82 A;  1XUC A;  1UTZ A;  2OW1 A;  4AUO A;  4ON1 A;  4GR8 A;  1JAP A;  4A3W A;  3HBU P;  4ILW D;  4WK7 A;  5B5P A;  2X3A A;  3LE9 A;  1JAO A;  2AYK A;  3EWJ A;  1BQQ M;  3AIG A;  2USN A;  1FLS A;  1QIC A;  1XFW A;  3DNG A;  3O2X A;  3G42 A;  4AYK A;  2OVZ A;  1BZS A;  4I03 A;  2PJT A;  3LIK A;  3OHL A;  1QJI A;  3TT4 A;  1QIA A;  3WV3 A;  2RJP A;  1JKY A;  3KWV C;  4GF1 A;  4PKT A;  1HV5 A;  2K2G A;  1IAG A;  4DV8 A;  2JIH A;  2WO8 A;  3Q2H A;  1Z3J A;  1K7G A;  3DSL A;  1SU3 A;  2YB9 A;  4PKR A;  3I7I A;  456C A;  2I47 A;  1O0T A;  3I7G A;  1SRP A;  3TSK A;  1KUG A;  3MA2 A;  2MZE A;  1UEA A;  1RM8 A;  4A7B A;  1IAC A;  1OM6 A;  2OW2 A;  1D5J A;  1OM7 A;  3GBO A;  1MNC A;  1BSW A;  1HFC A;  5B5O A;  4JPA A;  1UMS A;  2O3E A;  5I0L A;  2OW9 A;  1XFZ A;  5L7F A;  2OXZ A;  2A8H A;  4AXQ A;  4DF9 A;  1BUD A;  1CGL A;  3G5C A;  1GXD A;  2ERQ A;  2DDY A;  2O36 A;  1KBC A;  1G9K A;  2QPJ A;  1D7X A;  3F18 A;  1CK7 A;  3AYK A;  1DMT A;  3LUN A;  1PWQ A;  2CLT A;  4H3X A;  1S4B P;  3P24 A;  1AST A;  2ERO A;  1A86 A;  1SAT A;  2MZH A;  2OI0 A;  1Y8J A;  1G05 A;  1I73 A;  2TCL A;  1K7I A;  830C A;  3KHI A;  3ZXH A;  3WV1 A;  4ZR5 A;  1PWP A;  4GWN A;  1RMZ A;  1SLN A;  3KME A;  3RTS A;  1GKC A;  1KUI A;  5CUH A;  2W12 A;  4JIJ A;  4PKU A;  2DW0 A;  3LGP A;  5BOT A;  4XCT A;  3DL1 A;  5I12 A;  5D1U A;  4L19 A;  1FM1 A;  2WO9 A;  2DW1 A;  1FBL A;  2K9C A;  3LJT A;  1ZP5 A;  5BPA A;  3DPF A;  1XUR A;  1CGE A;  1R1I A;  1OO9 A;  1BQO A;  2MLS A;  5D3C A;  966C A;  1G4K A;  3HDB A;  4JA1 A;  1IAE A;  1CAQ A;  1AKL A;  4J4M A;  3LQ0 A;  5D1T A;  1ATL A;  3EDZ A;  3O64 A;  3ELM A;  3B92 A;  4PKQ A;  1ZXV A;  2DDF A;  4PKW A;  1EB6 A;  4WKE A;  4H76 A;  1YP1 A;  2MLR A;  1JIZ A;  4H84 A;  5I43 A;  1I76 A;  3LQB A;  1MMB A;  2XS3 A;  2Y6D A;  3HB2 P;  2D1N A;  4IN9 A;  5D7W A;  3LIL A;  1R55 A;  3HYG A;  1R54 A;  1R1J A;  3K7N A;  3U1R A;  2OY2 A;  1JH1 A;  1Q3A A;  2CKI A;  3EDG A;  5I4O A;  1ZXC A;  2OXW A;  2J83 A;  1K7Q A;  1MMP A;  1XFV A;  1YQY A;  1EAK A;  1ZS0 A;  3HY9 A;  3KRY A;  1HFS A;  5D1S A;  2E3X A;  3RTT A;  2HU6 A;  4R3V A;  1JAN A;  1OM8 A;  1HOV A;  2WOA A;  3VTG A;  1DTH A;  3LJZ A;  3HDA P;  4XM7 A;  1AF0 A;  1JK3 A;  1L6J A;  4FVL A;  3KMC A;  1GO7 P;  1OMJ A;  1C7K A;  2J0T A;  3F17 A;  1CQR A;  2OY4 A;  4FXQ A;  2W13 A;  3DWB A;  3KEC A;  1C3I A;  1KAP P;  2ERP A;  1IAA A;  2POJ A;  3B8Z A;  5CZM A;  3VI1 A;  5LAB A;  3TVC A;  1HTD A;  1Y93 A;  3CKI A;  1PWU A;  2N8R A;  3LK8 A;  1PWV A;  5JMY A;  3L0V A;  4HX3 A;  2JT6 A;  3WV2 A;  1UTT A;  1O0Q A;  1KUH A;  1IAD A;  2W15 A;  4WKI A;  1BM6 A;  1B3D A;  4JP4 A;  4GQL A;  2JT5 A;  1YOU A;  4CTH A;  3HBV P;  4FXY P;  2V4B A;  3E8R A;  1Y0V A;  4EFS A;  3LMC A;  1G12 A;  1ZTQ A;  3LIR A;  1XUD A;  5I3M A;  4Q1L A;  1GKD A;  3P1V A;  3LUM A;  4FU4 A;  2OVX A;  3DPE A;  1BUV M;  4DD8 A;  1AYK A;  5L79 A;  3KEK A;  1MMQ A;  4QKZ A;  1JAQ A;  4G9L A;  4IJO A;  3SHI A;  4H2E A;  1BKC E;  1WNI A;  4I35 A;  5BOY A;  3EHY A;  1MMR A;  3BA0 A;  4XM6 A;  1SLM A;  3LKA A;  4L63 A;  2D1O A;  1D8M A;  3B2Z A;  2X3C A;  3LJG A;  3KEJ A;  1GE5 A;  1GE6 A;  1EUB A;  2L0R A;  1CGF A;  1B8Y A;  1BIW A;  4PKS A;  2OW0 A;  3TS4 A;  2X3B A;  3V96 B;  3UVC A;  4H49 A;  2KRJ A;  2FV5 A;  1SMP A;  5I2Z A;  1A85 A;  1USN A;  2W14 A;  1G49 A;  1JIW P;  4G0D A;  2SRT A;  2X7M A;  4H1Q A;  2MZI A;  3Q2G A;  3N2U A;  4H30 A;  1IAB A;  4L6T A;  4XM8 A;  1BKC I;  1CIZ A;  1R1H A;  5D2B A;  1D8F A;  1HY7 A;  3F19 A;  5H8X A;  4IUW A;  1QIB A;  1CXV A;  3HY7 A;  1ZVX A;  3ZUK A;  2OXU A;  4JQG A;  1QUA A;  1GE7 A;  4HMA A;  1OS2 A;  2JNP A;  1H71 P;  1QJJ A;  1ND1 A;  3EHX A;  3EDH A;  1KUK A;  3F16 A;  4DPE A;  2E2D A;  1BKC A;  4PKV A;  2JSD A;  3F1A A;  4WZV A;  4GWM A;  2DW2 A;  1I1I P;  4GUY A;  2Y6C A;  2YIG A;  3OHO A;  1YCM A;  2Z2D A;  4WF6 A;  2XS4 A;  3L0T A;  1C8T A;  1XFY A;  3AYU A;  1ROS A;  4AIG A;  3LEA A;  1OS9 A; 
#chains in the Genus database with same CATH topology
 3NX7 A;  3K7L A;  1XFX A;  1PWW A;  4XBH A;  1KUF A;  1JJ9 A;  2RJQ A;  2OZR A;  2FV9 A;  2W0D A;  3USN A;  3F15 A;  2AIG P;  1XFU A;  4GR3 A;  1J7N A;  5CXA A;  3ZVS A;  1UMT A;  3EDI A;  1GO8 P;  3N2V A;  4GR0 A;  4H82 A;  1XUC A;  1UTZ A;  2OW1 A;  4AUO A;  4ON1 A;  4GR8 A;  1JAP A;  4A3W A;  3HBU P;  4ILW D;  4WK7 A;  5B5P A;  2X3A A;  3LE9 A;  1JAO A;  2AYK A;  3EWJ A;  1BQQ M;  3AIG A;  2USN A;  1FLS A;  1QIC A;  1XFW A;  3DNG A;  3O2X A;  3G42 A;  4AYK A;  2OVZ A;  1BZS A;  4I03 A;  2PJT A;  3LIK A;  3OHL A;  1QJI A;  3TT4 A;  1QIA A;  3WV3 A;  2RJP A;  1JKY A;  3KWV C;  4GF1 A;  4PKT A;  1HV5 A;  2K2G A;  1IAG A;  4DV8 A;  2JIH A;  2WO8 A;  3Q2H A;  1Z3J A;  1K7G A;  3DSL A;  1SU3 A;  2YB9 A;  4PKR A;  3I7I A;  456C A;  2I47 A;  1O0T A;  3I7G A;  1SRP A;  3TSK A;  1KUG A;  3MA2 A;  2MZE A;  1UEA A;  1RM8 A;  4A7B A;  1IAC A;  1OM6 A;  2OW2 A;  1D5J A;  1OM7 A;  3GBO A;  1MNC A;  1BSW A;  1HFC A;  5B5O A;  4JPA A;  1UMS A;  2O3E A;  5I0L A;  2OW9 A;  1XFZ A;  5L7F A;  2OXZ A;  2A8H A;  4AXQ A;  4DF9 A;  1BUD A;  1CGL A;  3G5C A;  1GXD A;  2ERQ A;  2DDY A;  2O36 A;  1KBC A;  1G9K A;  2QPJ A;  1D7X A;  3F18 A;  1CK7 A;  3AYK A;  1DMT A;  3LUN A;  1PWQ A;  2CLT A;  4H3X A;  1S4B P;  3P24 A;  1AST A;  4L7A A;  3DTK A;  2ERO A;  1A86 A;  1SAT A;  2MZH A;  2OI0 A;  1Y8J A;  1G05 A;  1XAX A;  1I73 A;  2TCL A;  1K7I A;  1OZ9 A;  830C A;  3KHI A;  3ZXH A;  3WV1 A;  4ZR5 A;  1PWP A;  4GWN A;  1RMZ A;  1SLN A;  3KME A;  3RTS A;  1GKC A;  1KUI A;  5CUH A;  2W12 A;  4JIJ A;  4PKU A;  2DW0 A;  3LGP A;  5BOT A;  4XCT A;  3DL1 A;  5I12 A;  5D1U A;  4L19 A;  1FM1 A;  2WO9 A;  2DW1 A;  1FBL A;  2K9C A;  3LJT A;  1ZP5 A;  5BPA A;  3DPF A;  1XUR A;  1CGE A;  1R1I A;  1OO9 A;  1BQO A;  2MLS A;  5D3C A;  966C A;  1G4K A;  3HDB A;  4JA1 A;  1IAE A;  1CAQ A;  1AKL A;  4J4M A;  3LQ0 A;  5D1T A;  1ATL A;  3EDZ A;  3O64 A;  3ELM A;  3B92 A;  4PKQ A;  1ZXV A;  2DDF A;  4PKW A;  1EB6 A;  4WKE A;  4H76 A;  1YP1 A;  2MLR A;  1JIZ A;  4H84 A;  5I43 A;  1I76 A;  3LQB A;  1MMB A;  2XS3 A;  2Y6D A;  3HB2 P;  2D1N A;  4IN9 A;  5D7W A;  3LIL A;  1R55 A;  3HYG A;  1R54 A;  1R1J A;  3K7N A;  3U1R A;  2OY2 A;  1JH1 A;  1Q3A A;  2CKI A;  3EDG A;  5I4O A;  1ZXC A;  2OXW A;  2J83 A;  1K7Q A;  1MMP A;  1XFV A;  1YQY A;  1EAK A;  1XM5 A;  1ZS0 A;  3HY9 A;  3KRY A;  1HFS A;  5D1S A;  2E3X A;  3RTT A;  2HU6 A;  4R3V A;  1JAN A;  1OM8 A;  1HOV A;  2WOA A;  3VTG A;  1DTH A;  3LJZ A;  3HDA P;  4XM7 A;  1AF0 A;  1JK3 A;  1L6J A;  4FVL A;  3KMC A;  1GO7 P;  1OMJ A;  1C7K A;  2J0T A;  3F17 A;  1CQR A;  3DTI A;  2OY4 A;  4FXQ A;  2W13 A;  3DWB A;  3KEC A;  1C3I A;  1KAP P;  2ERP A;  1IAA A;  2POJ A;  3B8Z A;  5CZM A;  3VI1 A;  5LAB A;  3TVC A;  1HTD A;  1Y93 A;  3CKI A;  1PWU A;  2N8R A;  3LK8 A;  1PWV A;  5JMY A;  3L0V A;  4HX3 A;  2JT6 A;  3WV2 A;  1UTT A;  1O0Q A;  1KUH A;  1IAD A;  2W15 A;  4WKI A;  1BM6 A;  1B3D A;  4JP4 A;  4GQL A;  2JT5 A;  1YOU A;  4CTH A;  3HBV P;  4FXY P;  2V4B A;  3E8R A;  1Y0V A;  4EFS A;  3LMC A;  1G12 A;  1ZTQ A;  3LIR A;  1XUD A;  5I3M A;  4Q1L A;  1GKD A;  3P1V A;  3LUM A;  4FU4 A;  2OVX A;  3DPE A;  1BUV M;  4DD8 A;  1AYK A;  5L79 A;  3KEK A;  1MMQ A;  4QKZ A;  1JAQ A;  4G9L A;  4IJO A;  3SHI A;  4H2E A;  1BKC E;  1WNI A;  4I35 A;  5BOY A;  3EHY A;  1MMR A;  3BA0 A;  4XM6 A;  1SLM A;  3LKA A;  4L63 A;  2D1O A;  1D8M A;  3B2Z A;  2X3C A;  3LJG A;  3KEJ A;  1GE5 A;  1GE6 A;  1EUB A;  2L0R A;  1CGF A;  3DTE A;  1B8Y A;  1BIW A;  4PKS A;  2OW0 A;  3TS4 A;  2X3B A;  3V96 B;  3UVC A;  4H49 A;  2KRJ A;  2FV5 A;  1SMP A;  5I2Z A;  1A85 A;  1USN A;  2W14 A;  1G49 A;  1JIW P;  1TVI A;  4G0D A;  2SRT A;  2X7M A;  4H1Q A;  2MZI A;  3Q2G A;  3N2U A;  4H30 A;  1IAB A;  4L6T A;  4XM8 A;  1BKC I;  1CIZ A;  1R1H A;  5D2B A;  1D8F A;  1HY7 A;  3F19 A;  5H8X A;  4IUW A;  1QIB A;  1CXV A;  3HY7 A;  1ZVX A;  3ZUK A;  2OXU A;  4JQG A;  1QUA A;  1GE7 A;  4HMA A;  1OS2 A;  2JNP A;  1H71 P;  1QJJ A;  1ND1 A;  3EHX A;  3EDH A;  1KUK A;  3F16 A;  4DPE A;  2E2D A;  1BKC A;  4PKV A;  2JSD A;  3F1A A;  4WZV A;  4GWM A;  2DW2 A;  1I1I P;  4GUY A;  2Y6C A;  2YIG A;  2YUF A;  3OHO A;  1YCM A;  2Z2D A;  4WF6 A;  2XS4 A;  3L0T A;  1C8T A;  1XFY A;  3AYU A;  1ROS A;  4AIG A;  3LEA A;  1OS9 A; 
#chains in the Genus database with same CATH homology
 3NX7 A;  3K7L A;  1XFX A;  1PWW A;  4XBH A;  1KUF A;  1JJ9 A;  2RJQ A;  2OZR A;  2FV9 A;  2W0D A;  3USN A;  3F15 A;  2AIG P;  1XFU A;  4GR3 A;  1J7N A;  5CXA A;  3ZVS A;  1UMT A;  3EDI A;  1GO8 P;  3N2V A;  4GR0 A;  4H82 A;  1XUC A;  1UTZ A;  2OW1 A;  4AUO A;  4ON1 A;  4GR8 A;  1JAP A;  4A3W A;  3HBU P;  4ILW D;  4WK7 A;  5B5P A;  2X3A A;  3LE9 A;  1JAO A;  2AYK A;  3EWJ A;  1BQQ M;  3AIG A;  2USN A;  1FLS A;  1QIC A;  1XFW A;  3DNG A;  3O2X A;  3G42 A;  4AYK A;  2OVZ A;  1BZS A;  4I03 A;  2PJT A;  3LIK A;  3OHL A;  1QJI A;  3TT4 A;  1QIA A;  3WV3 A;  2RJP A;  1JKY A;  3KWV C;  4GF1 A;  4PKT A;  1HV5 A;  2K2G A;  1IAG A;  4DV8 A;  2JIH A;  2WO8 A;  3Q2H A;  1Z3J A;  1K7G A;  3DSL A;  1SU3 A;  2YB9 A;  4PKR A;  3I7I A;  456C A;  2I47 A;  1O0T A;  3I7G A;  1SRP A;  3TSK A;  1KUG A;  3MA2 A;  2MZE A;  1UEA A;  1RM8 A;  4A7B A;  1IAC A;  1OM6 A;  2OW2 A;  1D5J A;  1OM7 A;  3GBO A;  1MNC A;  1BSW A;  1HFC A;  5B5O A;  4JPA A;  1UMS A;  2O3E A;  5I0L A;  2OW9 A;  1XFZ A;  5L7F A;  2OXZ A;  2A8H A;  4AXQ A;  4DF9 A;  1BUD A;  1CGL A;  3G5C A;  1GXD A;  2ERQ A;  2DDY A;  2O36 A;  1KBC A;  1G9K A;  2QPJ A;  1D7X A;  3F18 A;  1CK7 A;  3AYK A;  1DMT A;  3LUN A;  1PWQ A;  2CLT A;  4H3X A;  1S4B P;  3P24 A;  1AST A;  4L7A A;  3DTK A;  2ERO A;  1A86 A;  1SAT A;  2MZH A;  2OI0 A;  1Y8J A;  1G05 A;  1I73 A;  2TCL A;  1K7I A;  830C A;  3KHI A;  3ZXH A;  3WV1 A;  4ZR5 A;  1PWP A;  4GWN A;  1RMZ A;  1SLN A;  3KME A;  3RTS A;  1GKC A;  1KUI A;  5CUH A;  2W12 A;  4JIJ A;  4PKU A;  2DW0 A;  3LGP A;  5BOT A;  4XCT A;  3DL1 A;  5I12 A;  5D1U A;  4L19 A;  1FM1 A;  2WO9 A;  2DW1 A;  1FBL A;  2K9C A;  3LJT A;  1ZP5 A;  5BPA A;  3DPF A;  1XUR A;  1CGE A;  1R1I A;  1OO9 A;  1BQO A;  2MLS A;  5D3C A;  966C A;  1G4K A;  3HDB A;  4JA1 A;  1IAE A;  1CAQ A;  1AKL A;  4J4M A;  3LQ0 A;  5D1T A;  1ATL A;  3EDZ A;  3O64 A;  3ELM A;  3B92 A;  4PKQ A;  1ZXV A;  2DDF A;  4PKW A;  1EB6 A;  4WKE A;  4H76 A;  1YP1 A;  2MLR A;  1JIZ A;  4H84 A;  5I43 A;  1I76 A;  3LQB A;  1MMB A;  2XS3 A;  2Y6D A;  3HB2 P;  2D1N A;  4IN9 A;  5D7W A;  3LIL A;  1R55 A;  3HYG A;  1R54 A;  1R1J A;  3K7N A;  3U1R A;  2OY2 A;  1JH1 A;  1Q3A A;  2CKI A;  3EDG A;  5I4O A;  1ZXC A;  2OXW A;  2J83 A;  1K7Q A;  1MMP A;  1XFV A;  1YQY A;  1EAK A;  1ZS0 A;  3HY9 A;  3KRY A;  1HFS A;  5D1S A;  2E3X A;  3RTT A;  2HU6 A;  4R3V A;  1JAN A;  1OM8 A;  1HOV A;  2WOA A;  3VTG A;  1DTH A;  3LJZ A;  3HDA P;  4XM7 A;  1AF0 A;  1JK3 A;  1L6J A;  4FVL A;  3KMC A;  1GO7 P;  1OMJ A;  1C7K A;  2J0T A;  3F17 A;  1CQR A;  3DTI A;  2OY4 A;  4FXQ A;  2W13 A;  3DWB A;  3KEC A;  1C3I A;  1KAP P;  2ERP A;  1IAA A;  2POJ A;  3B8Z A;  5CZM A;  3VI1 A;  5LAB A;  3TVC A;  1HTD A;  1Y93 A;  3CKI A;  1PWU A;  2N8R A;  3LK8 A;  1PWV A;  5JMY A;  3L0V A;  4HX3 A;  2JT6 A;  3WV2 A;  1UTT A;  1O0Q A;  1KUH A;  1IAD A;  2W15 A;  4WKI A;  1BM6 A;  1B3D A;  4JP4 A;  4GQL A;  2JT5 A;  1YOU A;  4CTH A;  3HBV P;  4FXY P;  2V4B A;  3E8R A;  1Y0V A;  4EFS A;  3LMC A;  1G12 A;  1ZTQ A;  3LIR A;  1XUD A;  5I3M A;  4Q1L A;  1GKD A;  3P1V A;  3LUM A;  4FU4 A;  2OVX A;  3DPE A;  1BUV M;  4DD8 A;  1AYK A;  5L79 A;  3KEK A;  1MMQ A;  4QKZ A;  1JAQ A;  4G9L A;  4IJO A;  3SHI A;  4H2E A;  1BKC E;  1WNI A;  4I35 A;  5BOY A;  3EHY A;  1MMR A;  3BA0 A;  4XM6 A;  1SLM A;  3LKA A;  4L63 A;  2D1O A;  1D8M A;  3B2Z A;  2X3C A;  3LJG A;  3KEJ A;  1GE5 A;  1GE6 A;  1EUB A;  2L0R A;  1CGF A;  3DTE A;  1B8Y A;  1BIW A;  4PKS A;  2OW0 A;  3TS4 A;  2X3B A;  3V96 B;  3UVC A;  4H49 A;  2KRJ A;  2FV5 A;  1SMP A;  5I2Z A;  1A85 A;  1USN A;  2W14 A;  1G49 A;  1JIW P;  4G0D A;  2SRT A;  2X7M A;  4H1Q A;  2MZI A;  3Q2G A;  3N2U A;  4H30 A;  1IAB A;  4L6T A;  4XM8 A;  1BKC I;  1CIZ A;  1R1H A;  5D2B A;  1D8F A;  1HY7 A;  3F19 A;  5H8X A;  4IUW A;  1QIB A;  1CXV A;  3HY7 A;  1ZVX A;  3ZUK A;  2OXU A;  4JQG A;  1QUA A;  1GE7 A;  4HMA A;  1OS2 A;  2JNP A;  1H71 P;  1QJJ A;  1ND1 A;  3EHX A;  3EDH A;  1KUK A;  3F16 A;  4DPE A;  2E2D A;  1BKC A;  4PKV A;  2JSD A;  3F1A A;  4WZV A;  4GWM A;  2DW2 A;  1I1I P;  4GUY A;  2Y6C A;  2YIG A;  2YUF A;  3OHO A;  1YCM A;  2Z2D A;  4WF6 A;  2XS4 A;  3L0T A;  1C8T A;  1XFY A;  3AYU A;  1ROS A;  4AIG A;  3LEA A;  1OS9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...