2OWSA

Crystal structure of bordetella pertussis holo ferric binding protein bound with two synergistic oxalate anions
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
318
structure length
314
Chain Sequence
DEVSLYTTREPKLIQPLLDAFAKDSGIKVNTVFVKDGLLERVRAEGDKSPADVLMTVDIGNLIDLVNGGVTQKIQSQTLDSVVPANLRGAEGSWYALSLRDRVLYVEKDLKLDSFRYGDLADPKWKGKVCIRSGQHPYNTALVAAMIAHDGAEATEKWLRGVKANLARKAAGGDRDVARDILGGICDIGLANAYYVGHMKNAEPGTDARKWGDAIKVVRPTFAGGTHVNISGAAVAAHAPNKANAVKLLEYLVSEPAQTLYAQANYEYPVRAGVKLDAVVASFGPLKVDTLPVAEIAKYRKQASELVDKVGFDN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Anion-dependent hinge motion in ferric binding proteins
rcsb
source organism Bordetella pertussis tohama i
molecule tags Metal binding protein
molecule keywords Putative iron binding protein
total genus 110
structure length 314
sequence length 318
ec nomenclature
pdb deposition date 2007-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13343 SBP_bac_6 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2owsA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2owsA02
4MF3A 2OLBA 5TU0A 2XD2A 4P0GA 1LAGE 3UORA 3CIJA 3SDFA 3WAFA 2XXRA 3FJMA 3K4UA 2OZZA 2F78A 1POTA 2QS2A 3HHFA 3PMWA 4GWOA 1MDP1 4RY1A 3TODA 1B51A 1Y1ZA 3OO9A 5DYHA 4KR5A 3S4UA 5A5XA 4THIA 2O51A 4RYAA 2HQ0A 5CRYA 2H9BA 5KCJB 4QFLA 1MY2A 3OD7A 3FVGA 1Y9UA 1B7UA 1I6AA 2QPQA 3C31A 4L17A 2UVGA 4JSDA 2ZYKA 4R2FA 4FJPA 3C35A 1ZJLA 1RKMA 3C33A 2XX8A 3O6IA 3O6GA 2DVZA 3CFXA 1FTMA 4HW8A 4GL8A 2GRVA 1B52A 4EDPA 1BLFA 2UVJA 3T9VA 5H8HB 1IXGA 1JVXA 3CVGA 4X48A 1RYXA 4JB7A 4H65A 1AL3A 1QW0A 4UACA 5I56B 1N0TA 1B3HA 2ZNUA 4H5GA 4JWYA 2OWTA 4R9GA 4RK2A 4YU0A 1ELJA 1POY1 2O69A 4N13A 5I2NB 2ESNA 3SKPA 3W15C 4RJZA 2D5WA 2O6AA 4PFYA 4Q5TA 2I4BA 1UTBA 3MP8A 4IY6A 3K1PA 1S9TA 3SEVA 3TQWA 1NH8A 1URDA 3S9LC 1ZKBA 1N04A 1P99A 5FTIA 2RC7A 3LC8A 4F3BA 4MH5A 3TYHA 2ZNSA 3OO7A 5L9MA 4DCYA 5CBSA 4H8JA 3UA8A 3TTMA 5IAIA 1SDXA 1SYHA 1URGA 4Q30B 3C32A 1PBPA 5DTBA 5AA4A 3MAMA 3CG3A 4HCYA 4F18A 3DP4A 1N84A 4GIZA 1TFAA 1Y20A 3TDJA 2AL5A 3T9HB 2Q88A 1ZLQA 3T93B 3EHSA 3KOSA 4IO6A 1JQFA 2XXVA 1LLSA 4I62A 4MLQA 4NF4A 4R2BA 4YB6A 3U92A 3V89B 1SW1A 5I84A 3HV1A 2Y84A 3MVXA 2PX1A 3H6TA 2Q2CA 3OELA 2XXHA 3QYTA 4H1XA 4KD5A 5JTYB 3FXRA 1S50A 2ALUA 1I69A 3PPNA 5TPAA 1M5DA 3BFUA 4DZ1A 1NNFA 4RXLA 2D3IA 3V8XB 1R1NA 3GXAA 4HTGA 5H8FB 4QRZA 1M5CA 4P0IA 5CI5A 1LCFA 1A40A 1XVXA 2QJEA 5H8QB 3RT8A 3EQ1A 2FYIA 3PD9A 4QSDA 3O66A 3WAEA 5KZTA 4F3GA 1LCTA 3FV2A 3K6UA 4X9TA 4H5FA 4BDMA 2NWJA 3I5OA 2HZKA 5J1DA 5F7VA 4DLDA 3TCGA 3FVOA 1UTHB 2FNCA 4IO3A 3SEXA 2DS9A 2HAVA 4JWOA 4ND9A 1FTKA 1URSA 2Z8FA 2OJTA 3MPKA 4EXLA 4PE5B 3MC2A 4EQ7A 3N6UA 1N3WA 3IJOB 1XOCA 1IXHA 3TTRA 3VV5A 3KSXA 4QHQA 1T0KA 4OETA 4G68C 3U94A 4LVQA 1LFHA 3D4GA 1VE4A 4YB5A 4YICA 3S9NC 4YKJA 2RCBA 1GV8A 1LAXA 3USDA 2BJJX 2UVHA 3KZGA 1B0LA 1MY4A 3LSFB 4FE8A 3SEYA 4LATA 2D21A 4ZS9A 4EXKA 3QXMA 1ZU0A 2Y7KA 3Q26A 3PPRA 4X1BA 1B3LA 3U8QA 2RINA 1PBQA 4FIMA 3EHTA 5TP9A 4DE8A 3P7IA 5AA2A 3TPAA 4U1ZA 2UVIA 2X7PA 4BDOA 1USYE 2Z8DA 4XKQA 2QS3A 3OXNA 3TTNA 1USYH 4NF8B 4QFOA 1Z7ME 5HBCA 4NMYA 3A09A 2I49A 3N5LA 1TXFA 2Y7RA 3QUJA 5FHMA 1MQIA 5H8QA 4O3AA 1NL5A 4QF9A 4H8IA 1P1OA 1N76A 3A3UA 3FXUA 4XKRA 2XX7A 3MP1A 3H3GA 3IOTA 1A54A 2YPNA 1Z7NE 3KGCA 1XT8A 4GOTA 4JXIA 2HZLA 4QFNA 4LQ5A 5K2XA 3KFMA 5AA2B 2PT1A 5H8NB 3Q25A 5I59B 2QS4A 1JETA 1PEBA 1YAEA 3MVZA 4ZEBA 4XKNA 4KPTA 4PFWA 3VE1B 1EZOA 5CMCA 3S2VA 3TQLA 1M5BA 2NUVA 3IO6A 4ZEIA 3MVYA 1TFDA 4IO4A 4U2RA 1B1XA 2ZYOA 3MP6A 3N94A 4LQ2A 4OEUA 4NEDA 2A5TA 4XXUA 3RN8A 3FD3A 3VDFA 3FV1A 3TTKA 4FORA 5I58A 4IB2A 1NKXA 2QL3A 4JSOA 4R73A 1OLAA 3VXBA 3PD8A 4I8CA 5L9OA 5ITOA 2P2AA 2V25A 1A55A 3TCHA 2THIA 2E0SA 3MBPA 3OO8A 5AE4A 1IITA 1JNFA 4GLIA 4NF8A 3FVKA 5BWJA 2O1MA 4G8MA 1MXZA 1B5IA 4LUBA 3IOUA 1JEVA 1PB8A 4YZZA 1FTOA 4IO7A 4DXCA 3A3CA 4PQJA 4TLLB 1HSLA 3U72A 4F22A 2Q2AA 1ZBMA 3IJXB 5I57B 4ELQA 2M8CA 3M8UA 1NNKA 3PV0E 4MBPA 1OIBA 1MM7A 2Z22A 3CRBA 4KCDA 4F19A 1EZ9A 3MQ9A 5FHNA 3O29A 3FZVA 4BDRA 2OBGA 1H43A 3PUWE 5I2KB 3VXCA 1O7TA 3KG2A 4H6DA 5H8NA 2F7AA 2HXWA 3FJGA 5DVIA 3IB0A 1UIUA 3ONMA 2OK2A 3B6WA 4FEBA 3EHUA 2HFBA 5TPAB 5I2KA 2DOJA 2HAUA 1Y4TA 2XD3A 3PPOA 2Q8JA 3ZKLA 4KYDA 1Y3NA 4R6KA 3MJNA 2B3FA 4YAHX 3T9UA 2H98A 4KYSA 4KYEA 3S9MC 2VOZA 5KDTB 5M2VA 4NF4B 1XHYA 5I57A 4G77A 3SESA 4EF2A 3IK6B 3L6HA 5CBRA 1AIVA 3TMGA 4O3CA 4F3PA 2DP8A 2F6PA 2H4IA 2I3WA 3MWBA 1RYOA 4G8NA 3R26A 2Z8EA 4N6PA 3GZGA 1AMFA 3G3JA 3OEMA 4OTEA 4RNSA 3TAJA 5KDTA 1D9YA 4OMBA 1LGBC 4H67A 1FQAA 1XVYA 1QULA 3KN7A 4G4PA 4U4XA 4ZZAA 2RF1A 2DWHA 3G3GA 1FQDA 5CMKA 1QJMA 1VFEA 1P1NA 4AB5A 1QUIA 3FGSA 5HM4B 3G3IA 1JVYA 2HEUA 1ATGA 2A5SA 5JK4A 3VLWA 1FQBA 1MXUA 3VFJA 4PETA 3V83A 4HCWA 1TWYA 4AB6A 3LUYA 5ICQA 1B3FA 2A5TB 2ONKE 5EYFA 3RT6B 1HSEA 1DPPA 1II5A 3C36A 3KEIA 3Q29A 3TELA 4BDLA 1MDQA 1DMBA 4C0RA 1MQDA 1SI1A 1MXXA 2O7UA 1N7XA 1M5FA 1Y3PA 2QMWA 4R72A 5H8SA 3UN6A 3K00A 4DDDA 4ESXA 3R6UA 2Y7IA 5AA4B 1MPCA 2ANJA 4GVOA 3KJTA 4P11A 3GLBA 1B46A 2REGA 4R6YA 3K0VA 2F7CA 2I0CA 2P1SA 3DP6A 1XC1A 3G7WA 3CSGA 2I0BA 3KOTA 4GD5A 5LOMA 2YJPA 3GBBA 2VD3A 1IXIA 3B6QA 3PPPA 1B7HA 1SBPA 1D9VA 4I1DA 3VLVA 5H8FA 2F34A 3K2DA 4MFIA 3HSTA 4OENA 5A5XB 4YB7A 2LAOA 4XIGQ 1WODA 4GFRA 4E0XA 4QSEA 1MY3A 2IEEA 3T9XB 1Y3QA 4TOZA 2F97A 2H25A 4POXA 2DQVA 1B5JA 2V3TA 3KSJA 4U23A 3UIFA 2ZXTA 1PB7A 4KFQA 2E1SA 5ICTA 4GXAA 3OEKA 2GFEA 4OXVA 1IEJA 2CMOA 1UQWA 2ONSA 1B4HA 2DXYA 3FIRA 4WKMA 4PFUA 5AA2D 2I4CA 1OQGA 3N26A 5B7DA 4K3FA 2V93A 1D4NA 1S7YA 4HS7A 1QVSA 2GHAA 1H3DA 5JEIA 4DXBA 2DSFA 1N3XA 1OVTA 4GL0A 1B4ZA 1P1WA 2F8DA 3OOAA 1R6ZA 2DXRA 1MH4A 1R9QA 5AA1A 3K01A 4R74A 3RGYA 3SEWA 3OENA 4YMBA 3KBRA 3VLUA 1LB9A 1DSNA 3DM0A 1QUJA 1BP5A 4XKPA 1A8FA 4NE4A 1I6BA 2KLFA 2I6EA 2I48A 2XX9A 3OO6A 2F36A 4R75A 1GVCA 5TP9B 2IA4A 1QKBA 4OWDA 1IIWA 3FASA 1YPNA 3L6GA 3M3LA 4GF8A 1BIYA 1B3EA 3G3KA 2F5XA 2R71A 3R7XA 3TUSA 1MY1A 2R6GE 3VVDA 3IOVA 4QSCA 3H06B 4YKKA 4TQUQ 3IL1B 3QUFA 3H6VA 1BKAA 2RC8A 3FUZA 2XXIA 3I6VA 4POWA 3C4MA 5I58B 5F1QA 2DVCA 3CI8A 1I6QA 2OCUA 4OYVA 2B65A 2O68A 4ECFA 2XXTA 3ODBA 5I2NA 1H45A 1IZ1A 2DYXA 1LSTA 2F35A 4Z0IA 5JTYA 1VSOA 4IGTA 1LAHE 3RUMA 3TZAA 5I59A 5CMBA 4R9FA 1US5A 4JWXA 4KHZE 3TEPA 2GHBA 1ZIUA 3TFLA 4FEDA 2UYEA 4Q8RA 4OZ9A 2QS1A 2G93A 3D4CA 1B1HA 2XXWA 2ZNTA 3B6TA 4RPOA 2Q89A 4F1YA 1AOVA 5B70A 3RTFB 2ZMBA 1CB6A 1FTJA 1SW4A 3KN3A 5DVFA 1M5EA 2QMXA 2QRYA 3IB2A 4F3SA 3QIMA 3KN8A 1MRPA 1WVJA 3IORA 2V3QA 3HHGA 4RK9A 4NWDA 1B6HA 1SI0A 4LA9A 4Z7EA 1A99A 4YKPA 4F39A 3U1OA 4LZ7A 3HCQA 3M3FA 1B3GA 4M4GA 5DT6A 4ELRA 4YMAA 1Y1MA 1SQYA 2XXPA 5I56A 3ECRA 3PGFA 4OFJA 1TT1A 3FXQA 3PUYE 4NF5B 3C9HA 3FATA 3W9VA 1IQ7A 3IAZA 1MXYA 4IY5A 4ELOA 1A8EA 3VVEA 2OWSA 5ISUA 1B40A 3EN3A 3K6XA 3MZ1A 4WXJA 4QFPA 5FHOA 3T96B 4Q0CA 2REJA 3HPIA 1YCJA 4X1DA 3UP9A 1PC3A 2I58A 2O84X 4F1UA 2Y7WA 3MW0A 4RPNA 1MQJA 3MUQA 1KWHA 1UTHA 2PT2A 3E4RA 3PMXA 4ZEFA 4GRKA 3V5AA 1Y4CA 2NOOA 4E0WA 1SW2A 3FVNA 4F2QA 4DIGA 3DP8A 4OVJA 3H4ZA 1D3KA 1MY0A 3JZJA 4U21A 5ITPA 4BLAA 4AQ4A 2I3VA 3Q27A 4WEPA 4F29A 1IUDA 5AA3A 3ZS6A 5KCJA 2AIXA 5EHMA 3F11A 4ZECA 3FJ7A 2VHAA 4DCXA 4TLMB 4ZEDA 3EPEA 5HPQA 2RCAA 3G3FA 4F31B 1WDNA 1P1UA 4U22A 1O63A 4IO2A 1B2HA 1OQHA 1NH7A 3QSLA 1O64A 2CZLA 1CE2A 4U1OA 4KCCA 5K2YA 1N7WA 1US4A 2P0SA 3CFLA 5EHSA 3MZBA 1ANFA 4GXSB 1B5HA 2F6GA 4KQPA 1QUKA 1ZTYA 3VVFA 2FA7A 2O1LA 4EQBA 2UYFA 3KJ7A 1NFTA 1Q1KA 3PUZE 2X7QA 1OMPA 2QSXA 4EF1A 1B7ZA 1Q35A 3N6TA 3IB1A 4C1UA 4G8HA 3OMBA 4EUOA 5L9SA 1MXWA 1ZMGA 4ZE9A 1J1NA 3PPQA 4OHNA 3Q28A 1AH5A 2DWIA 2XXYA 3MVWA 2WKYA 2DE2A 4WEDA 1DTZA 3T22A 4G2ZA 4OQOA 3AXFA 3E13X 4YKIA 1GGGA 3H6UA 4DXUA 4LP2B 2Y7PA 1GTKA 4C1TA 3DELB 1FQEA 3IOWA 4ZZEA 3PUVE 4M1VA 3JV9A 3EF7A 3O28A 4I9DA 4ONYA 2O7IA 5BUUA 2GH9A 3OSQA 2ZYMA 2NXOA 2X26A 3K6WA 3PU5A 3HO7A 1UTBB 2DE3A 3H03A 4OFOA 4OFLA 3TTLA 1LFIA 3H7MA 1F9BA 1JW4A 2ZYNA 5ELVA 5DEXA 3K1NA 2W7YA 4MLVA 4ZDMA 3JYRA 1SYIA 3LSWA 1B0HA 1BTJA 1UIVA 4NF6A 3H6WA 3I3VA 2UXAA 4RA1A 5H8HA 1MQHA 2H99A 2HCAA 4F2OA 3ZKKA 1SD3A 3GBAA 1MPDA 2XXUA 4GQOA 3LSLA 3G3HA 3OSRA 3S9EA 2PBWA 2Q9TA 3IO4A 2AYSA 4G68B 4ELPA 2Z23A 1IXCA 3E9XA 2B3BA 3DLNA 2ABHA 3RY3A 3THIA 4NWCA 1MG1A 4IO5A 1B9JA 5DVJA 1FCKA 3CR9A 1A7LA 3MPLA 1R9LA 1OLCA 1DOTA 3IX1A 4N07A 4QFKA 1PDAA 1FQCA 1NMUA 1YTVA 3W9WA 4PP0A 2VD2A 3MZ9A 3QK6A 1VFDA 1P1QA 4JDFA 1B58A 4LONB 1FW0A 3U93A 4ISUA 2F7BA 1PB9A 3CG1A 1LFGA 3O9PA 2XHDA 4UA8A 4G68A 2V84A 1MH3A 1MQGA 3LBSA 4NF5A 5IKBA 1NNPA 2PVUA 3IR1A 3HN0A 4KI0E 4O3BA 2VGQA 3LSXA 2YLNA 5FTHA 3SERA 2ONRA 2XXQA 2AL4A 4LZ8A 3PMVA 1LAFE 1H76A 2VP1A 2RKMA 3O97A 1GR2A 4BDQA 4BDNA 3C34A 3BKIB 1XS5A 3SETA 2R9JA 1EZPA 3PUXE 1LBBA 1EU8A 1DTGA 3BFTA 3BBRA 1OVBA 1SVXB 1MXVA 3LR1A 4FECA 1MM6A 4LZ5A 3K1MA 3K6VA 5L8DA 3RNNA 4NTLA 3SEUA 2V3UA 1HSJA 4ZE8A 1FTLA 2RC9A 3K02A 3RLFE 1JW1A 1LB8A 4FAJA 3RTWB 3B7DA 1EH3A 3CSBA 4ZEKA 3UGWA 4U4SA 4IGRA 4F1VA 4OESA 5CM6A 2PMSA 1B32A 4EQ9A 3O2AA 3ILUB 4OEVA 1B05A 4FATA 1L5TA 1VR5A 3UK4A 2XXXA 4PFTA 3CFZA 4R6HA 1JEUA 1H44A 4OERA 3RQTA 1DPEA 3RPWA 1QKAA 2DE4A 2DWAA 3E3KA 4NF6B 3O6HA 4JBZA 1SW5A 1FQFA 2DWJA 3M3KA 1LBCA 2NVUB 3TCFA 3TKDA 3QAXA 5DEXB 1NNTA 3T66A 3ZSFA 1MS7A 4H0WA 2H5YA 2PYYA 5CMMA 2G29A 4ESWA 4XTCQ 1JW5A 1MPBA 5CC2A 3ILTB
chains in the Genus database with same CATH superfamily
4MF3A 2OLBA 2XD2A 3WAFA 4RY1A 1LBZA 5DYHA 5A5XA 5CRYA 1D9QA 3OD7A 2QPQA 3C31A 3RPLA 2ZYKA 4R2FA 3C35A 4JVCA 2QVVA 1QW0A 5I56B 1B3HA 4JWYA 4R9GA 5I2NB 1POY1 2O69A 3W15C 2D5WA 4PFYA 4Q5TA 2I4BA 1DBZA 1YXIA 5IGAA 5FTIA 3LC8A 3OO7A 5L9MA 5CBSA 4Q30B 3C32A 1PBPA 5AA4A 3TDJA 2AL5A 1ZLQA 4YB6A 4NF4A 2PX1A 1EYIA 3H6TA 4NQ8A 5JTYB 4KD5A 3FXRA 2ALUA 3PPNA 4HE1A 3BFUA 2XWVA 1EYKA 1LCFA 1XVXA 1LEVA 3EQ1A 3PD9A 3WAEA 1FPKA 1NV7A 3K6UA 2NWJA 3TCGA 3SEXA 2QFLA 3MPKA 4EXLA 3IJOB 3TTRA 4QHQA 1T0KA 3D4GA 3USDA 1LAXA 3KZGA 3PPRA 1B3LA 1PBQA 4FIMA 3TPAA 4U1ZA 2QS3A 1Z7ME 3A09A 3PTYA 3ROJA 1NL5A 4H8IA 1N76A 3H3GA 3KGCA 1XT8A 5H8NB 1JETA 3E79A 3MVYA 4MIJA 4IO4A 4U2RA 1B1XA 3MP6A 4LQ2A 4OEUA 4GWWA 3FV1A 3TTKA 4IB2A 3VXBA 1A55A 2E0SA 2WBDA 4GLIA 2O1MA 4N6KA 1JP4A 1NV4A 1FTOA 2FIEA 3A3CA 1HSLA 4F22A 2Q2AA 1ZBMA 4P8BA 2WBBA 2M8CA 4ELQA 3M8UA 1NNKA 1OIBA 4KCDA 5FHNA 4BDRA 1H43A 1O7TA 2XXKA 2HXWA 1UIUA 3ONMA 3B6WA 2Q8JA 3PPOA 2XD3A 5ET7A 3ZKLA 4PTKA 1Y3NA 2H98A 2L5VA 3IK6B 5CBRA 1AIVA 5IZ3B 3R26A 2FIXA 3OEMA 4RNSA 3G3JA 5IZ1A 5KDTA 4OMBA 1XVYA 3G3GA 1FJ6A 1P1NA 2OX3A 1RDXA 1ATGA 2A5SA 4PETA 3V83A 5ICQA 1B3FA 1CNQA 3KEIA 4BDLA 2XA5A 1N7XA 1M5FA 1Y3PA 5H8SA 3UN6A 5AA4B 1MPCA 1NUZA 1FPBA 2REGA 3K0VA 2P1SA 1NUYA 1XC1A 4GD5A 3CSGA 2YJPA 4PAKA 3GBBA 4I1DA 5H8FA 4YB7A 4GX3A 4TOZA 1B5JA 3KSJA 3OEKA 1B4HA 4O7IA 1RDZA 2PFYA 2I4CA 3N26A 5B7DA 4K3FA 2Y5LA 1LBXA 1H3DA 4DXBA 2DSFA 4IO6A 2F8DA 5AA1A 1AOVA 3OENA 4N91A 3KBRA 1LB9A 1DSNA 3DM0A 4P47A 4NE4A 2I48A 4HXVA 1NI9A 1QKBA 3FASA 4GF8A 3TUSA 4QSCA 3H6VA 1BKAA 1FRPA 3C4MA 5F1QA 3CI8A 1I6QA 3ODBA 1INPA 2R8TA 1IZ1A 5LDZA 3SZPA 1LSTA 4Z0IA 5JTYA 3TZAA 4JWXA 2GHBA 2ZNTA 4OVRA 1NUXA 3KN3A 2QMXA 3QMFA 3KN8A 3IORA 4RK9A 4FBPA 4YKPA 4LZ7A 3HCQA 5DT6A 4ELRA 5I56A 1SQYA 2XXPA 1TT1A 3C9HA 3W9VA 1MXYA 4PDDA 4HE2A 5FHOA 2REJA 2CZKA 3HPIA 2I58A 2O84X 4RPNA 1IMDA 2PT2A 3V5AA 4F2QA 3DP8A 3H4ZA 1D3KA 5ITPA 5AA3A 1IUDA 2VHAA 4DCXA 4PFBA 1WDNA 1P1UA 1B2HA 1O64A 4U1OA 1N7WA 1B5HA 4EQBA 1ZTYA 2UYFA 4PGNA 1OMPA 5I3SA 4XEQA 5L9SA 1MXWA 4ZE9A 5I7IA 1AH5A 2DWIA 4OANA 3T22A 1DTZA 4G2ZA 3AXFA 3E13X 1GGGA 4I9DA 4GX6A 2HHMA 2X26A 3K6WA 3TTLA 4OFOA 5ELVA 1JW4A 3K1NA 1SYIA 3LSWA 3H6WA 4MX6A 4QXDA 4NHBA 5H8HA 1MQHA 2H99A 1SD3A 2PBWA 4G68B 3E9XA 4IO5A 2WYKA 3MPLA 5ESYA 3IX1A 1FQCA 4PP0A 2VD2A 3MZ9A 1P1QA 4JDFA 4NG7A 1B58A 4LONB 2XHDA 2V84A 1MH3A 1MQGA 5EQ9A 1NV1A 2YLNA 5FTHA 2ONRA 3FXBA 1LAFE 1H76A 4N8GA 4BDNA 4PE3A 3BKIB 3PUXE 3RNNA 3K6VA 3SEUA 4ZE8A 1FPLA 4FAJA 3CSBA 1EH3A 3UGWA 4F1VA 3D1RA 4OESA 1B32A 5FBPA 2XXXA 3LUZA 4P1EA 3RPWA 4MCOA 1SW5A 4P1LA 5DEXB 3T66A 5TU0A 1FBPA 3SDFA 3FJMA 2F78A 3PMWA 4GWOA 1MDP1 1Y1ZA 4RYAA 2HQ0A 2H9BA 4N17A 4GBVA 2UVGA 1YZ0A 4JSDA 4FJPA 3O6IA 4HW8A 3CFXA 1FTMA 4GL8A 2GRVA 1B52A 1BLFA 3T9VA 5H8HB 1IXGA 4X48A 4UACA 4YU0A 4RK2A 1FPGA 2ESNA 3TQWA 3S9LC 1NH8A 3ISPA 1ZKBA 3FBPA 1IMBA 2ZNSA 4DCYA 5IAIA 3CG3A 1TFAA 1Y20A 4G61A 3EHSA 2XXVA 1LLSA 3U92A 1SW1A 2Y84A 2Q2CA 5TPAA 4DZ1A 4RXLA 3V8XB 1R1NA 3GXAA 5H8FB 4QRZA 1M5CA 3RT8A 2QJEA 5H8QB 5A5LA 5ET5A 4F3GA 5T3JA 3FV2A 5IZZA 3BIHA 4X9TA 5J1DA 5F7VA 4DLDA 2FNCA 4IO3A 4ND9A 4EQ7A 1N3WA 3VV5A 1FTAA 4G68C 4LVQA 1LFHA 3S9NC 4YKJA 1FPEA 4FE8A 3LSFB 4X04A 1ZU0A 1G0HA 5AA2A 5TP9A 2X7PA 4BDOA 2Z8DA 1USYH 2DDKA 2I49A 3N5LA 1TXFA 5FHMA 1P1OA 3A3UA 3MP1A 4GOTA 4IR8A 2HZLA 4GBWA 5K2XA 3KFMA 4AS4A 3Q25A 2QS4A 4ZEBA 3VE1B 4KPTA 2NUVA 1TFDA 2ZYOA 4FORA 4JSOA 4PF8A 4I8CA 2V25A 3MBPA 3OO8A 5AE4A 4PFRA 1JNFA 1MXZA 4LUBA 4YZZA 1K9ZA 4IO7A 4PQJA 4TLLB 5I57B 3PV0E 1MM7A 2Z22A 4F19A 3FZVA 5I2KB 4AS5A 3KG2A 5H8NA 4P9KA 3IB0A 2FBPA 2OK2A 3EHUA 5TPAB 2HAUA 1Y4TA 3S9MC 5M2VA 4EF2A 1SPIA 2F6PA 2H4IA 2I3WA 4G8NA 4NF0A 4H67A 4U4XA 3IFCA 3FGSA 1JVYA 3VLWA 1FQBA 3VFJA 3RT6B 1VDWA 2B4LA 3TELA 1MDQA 1DMBA 2O7UA 4R72A 4DDDA 2Y7IA 4P11A 3GLBA 2I0CA 3G7WA 5LOMA 3KOTA 2VD3A 1IXIA 1B7HA 2F34A 4OENA 1WODA 2IEEA 1Y3QA 2KR0A 4GXAA 4P56A 4OXVA 1UQWA 5AA2D 2WYPA 1N3XA 3SEWA 1R9QA 1LBVA 1QUJA 4XKPA 1A8FA 2XX9A 2I6EA 2F36A 5TP9B 2IA4A 4OWDA 1YPNA 3M3LA 1BIYA 1B3EA 3G3KA 2F5XA 4YKKA 1FSAA 3FUZA 2XXIA 4POWA 5EYGA 2XXTA 4DI3D 2DYXA 2F35A 1VSOA 4R9FA 4KHZE 4P3LA 3TFLA 4FEDA 4Q8RA 4OZ9A 1IMFA 2G93A 2XXWA 2CEXA 2MKZA 4NX1A 3RTFB 2ZMBA 1SW4A 3IB2A 1WVJA 2CEYA 2V3QA 3MYUA 4NWDA 1KA1A 4LA9A 2HXRA 4M4GA 4YMAA 1Y1MA 4OFJA 3B8BA 4NF5B 3PUYE 2Q74A 1A8EA 4ELOA 1B40A 3MZ1A 4QFPA 3T96B 3UP9A 1YCJA 5EQ7A 2Y7WA 4PBHA 1UTHA 4ZEFA 3PMXA 4GRKA 1Y4CA 2NOOA 4E0WA 4OVJA 3HFUA 1MY0A 3JZJA 5KCJA 4WEPA 5EHMA 4ZECA 5HPQA 4F31B 4U22A 1OQHA 1NH7A 2CZLA 5EHSA 2P0SA 4GXSB 2O1LA 3KJ7A 4PF6A 2QSXA 1B7ZA 3IB1A 3OMBA 4EUOA 4O7MA 3NOHA 3Q28A 2XXYA 2WKYA 2DE2A 4LP2B 2Y7PA 4C1TA 1FQEA 4ZZEA 3PUVE 4M1VA 3O28A 3EF7A 5BUUA 2ZYMA 4OFLA 2NXOA 3PU5A 3H03A 3H7MA 5JK4A 1F9BA 5DEXA 2W7YA 4O94A 1B0HA 4N6DA 4RA1A 3ZKKA 4PAIA 3IO4A 2Z23A 3DLNA 2ABHA 1KA0A 1MG1A 1B9JA 1R9LA 4QFKA 1PDAA 3W9WA 3QK6A 1VFDA 3CG1A 1LFGA 3B50A 5IKBA 2PVUA 4GX4A 4KI0E 3SERA 2XXQA 4MAGA 3PMVA 2R9JA 1LBBA 4MJOA 1DTGA 3BFTA 1MXVA 3LR1A 5L8DA 4PGPA 2RC9A 3K02A 3RLFE 1LB8A 3B7DA 4ZEKA 4H46A 5CM6A 4OEVA 1VR5A 4PFTA 3CFZA 4NN3A 4R6HA 4PC9A 2DE4A 2DWAA 3E3KA 4JBZA 2DWJA 3QAXA 3ZSFA 4H0WA 5CMMA 1NV0A 1YYZA 5CC2A 4P0GA 1LAGE 3CIJA 2OZZA 1G0IA 3TODA 4THIA 1MY2A 3FVGA 2XX8A 4UABA 1FBCA 3KC1A 3CVGA 5DW8A 1RYXA 4JB7A 1AL3A 3CHGA 2ZNUA 3VDFA 2OWTA 4RJZA 2O6AA 1UTBA 3MP8A 4IY6A 4O8MA 1URDA 1P99A 2RC7A 4MH5A 3TYHA 5EYHA 4H8JA 3TTMA 1SDXA 3MAMA 4HCYA 4F18A 1N84A 3T9HB 2Q88A 1K9YA 3T0JA 3KOSA 4I62A 4R2BA 3HV1A 3OELA 4MHFA 1FBGA 1I69A 1M5DA 1NNFA 3RYDA 2D3IA 4QSDA 3O66A 1LCTA 5IM2A 4H5FA 4BDMA 3FVOA 2DS9A 2HAVA 1FTKA 1URSA 4PE5B 1XOCA 1IXHA 3KSXA 1IMAA 1GV8A 2UVHA 1MY4A 4ZS9A 2D21A 4EXKA 2Y7KA 3U8QA 4X1BA 4DE8A 3EHTA 3P7IA 3OXNA 3TTNA 4NMYA 1MQIA 4O3AA 4QF9A 4XKRA 3FXUA 2XX7A 3IOTA 1A54A 2YPNA 1Z7NE 5AA2B 4LQ5A 5I59B 3MVZA 4PFWA 1EZOA 5CMCA 4PAFA 1M5BA 3IO6A 2A5TA 4XXUA 3FD3A 5I58A 2QL3A 4R73A 3MSTA 5ITOA 2P2AA 4NF8A 3FVKA 1B5IA 3IOUA 1JEVA 4DXCA 2Y5KA 2ZZXA 4MBPA 3CRBA 3O29A 3PUWE 4H6DA 2F7AA 3FJGA 3U65A 5I2KA 4YAHX 3T9UA 4KYEA 2VOZA 5KDTB 1XHYA 2VPNA 4G77A 3L6HA 2Z8EA 4N6PA 3GZGA 3TAJA 1D9YA 1LGBC 1FQAA 3EKIA 1QULA 3KN7A 4G4PA 2RF1A 1FQDA 5CMKA 1VFEA 5HM4B 2HEUA 4HCWA 4AB6A 3LUYA 2A5TB 5EYFA 5EQ8A 3Q29A 4N4UA 3BIGA 3K00A 4ESXA 2QVRA 2ANJA 4GVOA 3KJTA 1B46A 2F7CA 3DP6A 5EQAA 2I0BA 4GWZA 4MNPA 1NV6A 3B6QA 3PPPA 1SBPA 2P3NA 4XIGQ 4QSEA 1MY3A 2PFZA 3T9XB 2H25A 4POXA 2DQVA 4U23A 2ZXTA 1PB7A 4KFQA 2E1SA 5ICTA 4MNIA 1IEJA 4WKMA 2ONSA 2V93A 1D4NA 2GHAA 5JEIA 4GL0A 1B4ZA 1R6ZA 3RGYA 3VLUA 1BP5A 1GVCA 4R75A 3OO6A 2R71A 4KXPA 1MY1A 3VVDA 3IOVA 3H06B 4TQUQ 5I58B 4OYVA 4ECFA 1H45A 5I5PA 5I59A 5CMBA 3TEPA 1ZIUA 2UYEA 2QS1A 1B1HA 3B6TA 2Q89A 5B70A 4N81A 1FTJA 4F3SA 3QIMA 3U1OA 3M3FA 2PCRA 3GYYA 3PGFA 3VVEA 2OWSA 3K6XA 1NV2A 4X1DA 1PC3A 1DK4A 3MW0A 1MQJA 3MUQA 2ZZVA 1NV5A 1SW2A 3FVNA 1IMCA 4BLAA 4AQ4A 3ZS6A 3F11A 3FJ7A 4ZEDA 3EPEA 2RCAA 1O63A 4IO2A 3QSLA 4KCCA 3CFLA 3MZBA 2F6GA 4KQPA 3PUZE 3A29A 2X7QA 4EF1A 2F3BA 1IMEA 4C1UA 1ZMGA 1J1NA 3PPQA 3MVWA 4WEDA 4OQOA 4YKIA 3IOWA 3JV9A 4ONYA 2O7IA 3RN8A 2FVZA 1UTBB 1LFIA 2ZYNA 4ZDMA 4MLVA 3JYRA 1LBYA 1BTJA 1UIVA 4NF6A 3I3VA 2UXAA 2XWKA 2HCAA 1BK4A 3GBAA 1MPDA 3LSLA 1FPDA 3G3HA 2Q9TA 2AYSA 3RY3A 5DVJA 4PBQA 1DOTA 1NMUA 4ISUA 2F7BA 5ET8A 2ZZWA 4UA8A 3LBSA 1NNPA 3IR1A 4O3BA 3LSXA 2AL4A 4LZ8A 3SETA 1XS5A 5LTCA 1OVBA 1SVXB 1MM6A 4JVIA 3K1MA 4LZ5A 1FTLA 1JW1A 3RTWB 4IGRA 4EQ9A 1B05A 1H44A 4OERA 3RQTA 1QKAA 4NF6B 3TKDA 3M3KA 1LBCA 2P3VA 1FBDA 2G29A 1MPBA 3ILTB 3UORA 2JJKA 2XXRA 3K4UA 3HHFA 2QS2A 1POTA 2B4MA 1B51A 3OO9A 4KR5A 4LN5A 3S4UA 2O51A 5KCJB 4QFLA 1Y9UA 1B7UA 1I6AA 4L17A 1ZJLA 1RKMA 3C33A 2F3DA 2QVUA 5J16A 3O6GA 2DVZA 4EDPA 2UVJA 1JVXA 4OVTA 4H65A 1QGXA 1N0TA 4H5GA 4QBAA 1ELJA 4N13A 3SKPA 4OVSA 4NAPA 3K1PA 1S9TA 3SEVA 1N04A 4F3BA 4JVDA 3UA8A 1SYHA 1URGA 5DTBA 5IZ3A 3DP4A 4GIZA 3T93B 1JQFA 4MLQA 3V89B 5I84A 3MVXA 3QYTA 4H1XA 1FJ9A 2XWIA 2XXHA 1RDYA 1S50A 2CZHA 4HTGA 4P0IA 5CI5A 1A40A 2FYIA 4OVQA 5KZTA 3I5OA 2HZKA 4H45A 1UTHB 4JWOA 2Z8FA 2OJTA 3MC2A 3N6UA 4OETA 3U94A 1VE4A 4YB5A 4YICA 2RCBA 2BJJX 1B0LA 3SEYA 4LATA 3QXMA 3Q26A 2RINA 2UVIA 1USYE 4XKQA 4NF8B 4QFOA 2XWOA 5HBCA 4GWYA 2Y7RA 3QUJA 5ET6A 5H8QA 4JXIA 4QFNA 1AWBA 2KQZA 2PT1A 1PEBA 1YAEA 4XKNA 3S2VA 3TQLA 4GWXA 4ZEIA 2VT5A 3N94A 4NEDA 1NKXA 1OLAA 5L9OA 3PD8A 3TCHA 2THIA 1IITA 5BWJA 1KZ8A 4G8MA 1PB8A 3U72A 3IJXB 4GWSA 1EZ9A 3MQ9A 2OBGA 3VXCA 2VPOA 4FEBA 2HFBA 4HE0A 2DOJA 4KYDA 4R6KA 3MJNA 2B3FA 4KYSA 1FPFA 4NF4B 5I57A 3SESA 3TMGA 4O3CA 4F3PA 2DP8A 3MWBA 1RYOA 4OTEA 1AMFA 4ZZAA 2DWHA 1QJMA 4I3YA 4AB5A 1QUIA 3G3IA 1MXUA 1TWYA 3IFAA 3KBZA 2ONKE 4I3EA 4XF5A 1HSEA 1DPPA 1II5A 3C36A 4C0RA 1MQDA 1SI1A 1MXXA 2QMWA 3R6UA 4DI4B 2GQ1A 3E78A 4R6YA 1NV3A 1FBFA 4N8YA 2HPGA 3RPLB 2CZIA 1D9VA 3VLVA 3K2DA 4MFIA 3HSTA 5A5XB 2LAOA 4E0XA 4GFRA 2F97A 3UIFA 1XI6A 2V3TA 2GFEA 2CMOA 4MNCA 2DXYA 3FIRA 4PFUA 1OQGA 2FHYA 1S7YA 4HS7A 1QVSA 1OVTA 1P1WA 3OOAA 2DXRA 1MH4A 3K01A 4R74A 4YMBA 4F39A 1I6BA 2KLFA 2WEFA 1IIWA 3L6GA 3R7XA 2R6GE 3IL1B 3QUFA 2RC8A 3I6VA 4NGUA 2DVCA 4OVPA 2OCUA 2B65A 2O68A 5I2NA 4IGTA 1LAHE 3RUMA 4OA4A 1US5A 3LV0A 2WX9A 3D4CA 2OWZA 4RPOA 3KC0A 4F1YA 1FBHA 5DVFA 1CB6A 1M5EA 2QRYA 1MRPA 2BJIA 3HHGA 1B6HA 1SI0A 4Z7EA 1A99A 1B3GA 4I40A 3ECRA 3FXQA 3FATA 1IQ7A 3IAZA 4IY5A 5ISUA 3EN3A 4WXJA 4PFIA 4Q0CA 4F1UA 1KWHA 3E4RA 4DIGA 4U21A 1LBWA 1FBEA 2I3VA 3Q27A 4MMPA 4F29A 2AIXA 4TLMB 3G3FA 1CE2A 5K2YA 1US4A 4XFEA 1ANFA 3VVFA 1QUKA 2FA7A 1NFTA 1Q1KA 1Q35A 3N6TA 4G8HA 4OHNA 3H6UA 4DXUA 1GTKA 3DELB 2V4CA 2GH9A 3OSQA 3HO7A 2DE3A 1NUWA 1Q9DA 4F2OA 2XXUA 4GQOA 3OSRA 5F24A 4X8RA 3S9EA 4ELPA 2Q8MA 1IXCA 2B3BA 3THIA 4NWCA 1FCKA 3CR9A 1A7LA 1OLCA 4N07A 1YTVA 1FW0A 1FPJA 3U93A 1PB9A 3O9PA 4G68A 1FPIA 1EYJA 4NF5A 3HN0A 2VGQA 1DCUA 4PDHA 2VP1A 3O97A 2RKMA 4GWUA 1GR2A 4BDQA 3C34A 1EZPA 1EU8A 4N15A 3BBRA 4FECA 4NTLA 2V3UA 4PCDA 1HSJA 4MEVA 3T1BA 4U4SA 2PMSA 3O2AA 3ILUB 4FATA 1L5TA 3UK4A 1JEUA 1DPEA 5DVIA 3TCFA 3O6HA 1FQFA 2NVUB 1NNTA 1MS7A 2H5YA 2PYYA 4ESWA 4XTCQ 1JW5A
chains in the Genus database with same CATH topology
4MF3A 2OLBA 5TU0A 2XD2A 4P0GA 1LAGE 3UORA 3CIJA 3SDFA 3WAFA 2XXRA 3FJMA 3K4UA 2OZZA 2F78A 1POTA 2QS2A 3HHFA 3PMWA 4GWOA 1MDP1 4RY1A 3TODA 1B51A 1Y1ZA 3OO9A 5DYHA 4KR5A 3S4UA 5A5XA 4THIA 2O51A 4RYAA 2HQ0A 5CRYA 2H9BA 5KCJB 4QFLA 1MY2A 3OD7A 3FVGA 1Y9UA 1B7UA 1I6AA 2QPQA 3C31A 4L17A 2UVGA 4JSDA 2ZYKA 4R2FA 4FJPA 3C35A 1ZJLA 1RKMA 3C33A 2XX8A 3O6IA 3O6GA 2DVZA 3CFXA 1FTMA 4HW8A 4GL8A 2GRVA 1B52A 4EDPA 1BLFA 2UVJA 3T9VA 5H8HB 1IXGA 1JVXA 3CVGA 4X48A 1RYXA 4JB7A 4H65A 1AL3A 1QW0A 4UACA 5I56B 1N0TA 1B3HA 2ZNUA 4H5GA 4JWYA 2OWTA 4R9GA 4RK2A 4YU0A 1ELJA 1POY1 2O69A 4N13A 5I2NB 2ESNA 3SKPA 3W15C 4RJZA 2D5WA 2O6AA 4PFYA 4Q5TA 2I4BA 1UTBA 3MP8A 4IY6A 3K1PA 1S9TA 3SEVA 3TQWA 1NH8A 1URDA 3S9LC 1ZKBA 1N04A 1P99A 5FTIA 2RC7A 3LC8A 4F3BA 4MH5A 3TYHA 2ZNSA 3OO7A 5L9MA 4DCYA 5CBSA 4H8JA 3UA8A 3TTMA 5IAIA 1SDXA 1SYHA 1URGA 4Q30B 3C32A 1PBPA 5DTBA 5AA4A 3MAMA 3CG3A 4HCYA 4F18A 3DP4A 1N84A 4GIZA 1TFAA 1Y20A 3TDJA 2AL5A 3T9HB 2Q88A 1ZLQA 3T93B 3EHSA 3KOSA 4IO6A 1JQFA 2XXVA 1LLSA 4I62A 4MLQA 4NF4A 4R2BA 4YB6A 3U92A 3V89B 1SW1A 5I84A 3HV1A 2Y84A 3MVXA 2PX1A 3H6TA 2Q2CA 3OELA 2XXHA 3QYTA 4H1XA 4KD5A 5JTYB 3FXRA 1S50A 2ALUA 1I69A 3PPNA 5TPAA 1M5DA 3BFUA 4DZ1A 1NNFA 4RXLA 2D3IA 3V8XB 1R1NA 3GXAA 4HTGA 5H8FB 4QRZA 1M5CA 4P0IA 5CI5A 1LCFA 1A40A 1XVXA 2QJEA 5H8QB 3RT8A 3EQ1A 2FYIA 3PD9A 4QSDA 3O66A 3WAEA 5KZTA 4F3GA 1LCTA 3FV2A 3K6UA 4X9TA 4H5FA 4BDMA 2NWJA 3I5OA 2HZKA 5J1DA 5F7VA 4DLDA 3TCGA 3FVOA 1UTHB 2FNCA 4IO3A 3SEXA 2DS9A 2HAVA 4JWOA 4ND9A 1FTKA 1URSA 2Z8FA 2OJTA 3MPKA 4EXLA 4PE5B 3MC2A 4EQ7A 3N6UA 1N3WA 3IJOB 1XOCA 1IXHA 3TTRA 3VV5A 3KSXA 4QHQA 1T0KA 4OETA 4G68C 3U94A 4LVQA 1LFHA 3D4GA 1VE4A 4YB5A 4YICA 3S9NC 4YKJA 2RCBA 1GV8A 1LAXA 3USDA 2BJJX 2UVHA 3KZGA 1B0LA 1MY4A 3LSFB 4FE8A 3SEYA 4LATA 2D21A 4ZS9A 4EXKA 3QXMA 1ZU0A 2Y7KA 3Q26A 3PPRA 4X1BA 1B3LA 3U8QA 2RINA 1PBQA 4FIMA 3EHTA 5TP9A 4DE8A 3P7IA 5AA2A 3TPAA 4U1ZA 2UVIA 2X7PA 4BDOA 1USYE 2Z8DA 4XKQA 2QS3A 3OXNA 3TTNA 1USYH 4NF8B 4QFOA 1Z7ME 5HBCA 4NMYA 3A09A 2I49A 3N5LA 1TXFA 2Y7RA 3QUJA 5FHMA 1MQIA 5H8QA 4O3AA 1NL5A 4QF9A 4H8IA 1P1OA 1N76A 3A3UA 3FXUA 4XKRA 2XX7A 3MP1A 3H3GA 3IOTA 1A54A 2YPNA 1Z7NE 3KGCA 1XT8A 4GOTA 4JXIA 2HZLA 4QFNA 4LQ5A 5K2XA 3KFMA 5AA2B 2PT1A 5H8NB 3Q25A 5I59B 2QS4A 1JETA 1PEBA 1YAEA 3MVZA 4ZEBA 4XKNA 4KPTA 4PFWA 3VE1B 1EZOA 5CMCA 3S2VA 3TQLA 1M5BA 2NUVA 3IO6A 4ZEIA 3MVYA 1TFDA 4IO4A 4U2RA 1B1XA 2ZYOA 3MP6A 3N94A 4LQ2A 4OEUA 4NEDA 2A5TA 4XXUA 3RN8A 3FD3A 3VDFA 3FV1A 3TTKA 4FORA 5I58A 4IB2A 1NKXA 2QL3A 4JSOA 4R73A 1OLAA 3VXBA 3PD8A 4I8CA 5L9OA 5ITOA 2P2AA 2V25A 1A55A 3TCHA 2THIA 2E0SA 3MBPA 3OO8A 5AE4A 1IITA 1JNFA 4GLIA 4NF8A 3FVKA 5BWJA 2O1MA 4G8MA 1MXZA 1B5IA 4LUBA 3IOUA 1JEVA 1PB8A 4YZZA 1FTOA 4IO7A 4DXCA 3A3CA 4PQJA 4TLLB 1HSLA 3U72A 4F22A 2Q2AA 1ZBMA 3IJXB 5I57B 4ELQA 2M8CA 3M8UA 1NNKA 3PV0E 4MBPA 1OIBA 1MM7A 2Z22A 3CRBA 4KCDA 4F19A 1EZ9A 3MQ9A 5FHNA 3O29A 3FZVA 4BDRA 2OBGA 1H43A 3PUWE 5I2KB 3VXCA 1O7TA 3KG2A 4H6DA 5H8NA 2F7AA 2HXWA 3FJGA 5DVIA 3IB0A 1UIUA 3ONMA 2OK2A 3B6WA 4FEBA 3EHUA 2HFBA 5TPAB 5I2KA 2DOJA 2HAUA 1Y4TA 2XD3A 3PPOA 2Q8JA 3ZKLA 4KYDA 1Y3NA 4R6KA 3MJNA 2B3FA 4YAHX 3T9UA 2H98A 4KYSA 4KYEA 3S9MC 2VOZA 5KDTB 5M2VA 4NF4B 1XHYA 5I57A 4G77A 3SESA 4EF2A 3IK6B 3L6HA 5CBRA 1AIVA 3TMGA 4O3CA 4F3PA 2DP8A 2F6PA 2H4IA 2I3WA 3MWBA 1RYOA 4G8NA 3R26A 2Z8EA 4N6PA 3GZGA 1AMFA 3G3JA 3OEMA 4OTEA 4RNSA 3TAJA 5KDTA 1D9YA 4OMBA 1LGBC 4H67A 1FQAA 1XVYA 1QULA 3KN7A 4G4PA 4U4XA 4ZZAA 2RF1A 2DWHA 3G3GA 1FQDA 5CMKA 1QJMA 1VFEA 1P1NA 4AB5A 1QUIA 3FGSA 5HM4B 3G3IA 1JVYA 2HEUA 1ATGA 2A5SA 5JK4A 3VLWA 1FQBA 1MXUA 3VFJA 4PETA 3V83A 4HCWA 1TWYA 4AB6A 3LUYA 5ICQA 1B3FA 2A5TB 2ONKE 5EYFA 3RT6B 1HSEA 1DPPA 1II5A 3C36A 3KEIA 3Q29A 3TELA 4BDLA 1MDQA 1DMBA 4C0RA 1MQDA 1SI1A 1MXXA 2O7UA 1N7XA 1M5FA 1Y3PA 2QMWA 4R72A 5H8SA 3UN6A 3K00A 4DDDA 4ESXA 3R6UA 2Y7IA 5AA4B 1MPCA 2ANJA 4GVOA 3KJTA 4P11A 3GLBA 1B46A 2REGA 4R6YA 3K0VA 2F7CA 2I0CA 2P1SA 3DP6A 1XC1A 3G7WA 3CSGA 2I0BA 3KOTA 4GD5A 5LOMA 2YJPA 3GBBA 2VD3A 1IXIA 3B6QA 3PPPA 1B7HA 1SBPA 1D9VA 4I1DA 3VLVA 5H8FA 2F34A 3K2DA 4MFIA 3HSTA 4OENA 5A5XB 4YB7A 2LAOA 4XIGQ 1WODA 4GFRA 4E0XA 4QSEA 1MY3A 2IEEA 3T9XB 1Y3QA 4TOZA 2F97A 2H25A 4POXA 2DQVA 1B5JA 2V3TA 3KSJA 4U23A 3UIFA 2ZXTA 1PB7A 4KFQA 2E1SA 5ICTA 4GXAA 3OEKA 2GFEA 4OXVA 1IEJA 2CMOA 1UQWA 2ONSA 1B4HA 2DXYA 3FIRA 4WKMA 4PFUA 5AA2D 2I4CA 1OQGA 3N26A 5B7DA 4K3FA 2V93A 1D4NA 1S7YA 4HS7A 1QVSA 2GHAA 1H3DA 5JEIA 4DXBA 2DSFA 1N3XA 1OVTA 4GL0A 1B4ZA 1P1WA 2F8DA 3OOAA 1R6ZA 2DXRA 1MH4A 1R9QA 5AA1A 3K01A 4R74A 3RGYA 3SEWA 3OENA 4YMBA 3KBRA 3VLUA 1LB9A 1DSNA 3DM0A 1QUJA 1BP5A 4XKPA 1A8FA 4NE4A 1I6BA 2KLFA 2I6EA 2I48A 2XX9A 3OO6A 2F36A 4R75A 1GVCA 5TP9B 2IA4A 1QKBA 4OWDA 1IIWA 3FASA 1YPNA 3L6GA 3M3LA 4GF8A 1BIYA 1B3EA 3G3KA 2F5XA 2R71A 3R7XA 3TUSA 1MY1A 2R6GE 3VVDA 3IOVA 4QSCA 3H06B 4YKKA 4TQUQ 3IL1B 3QUFA 3H6VA 1BKAA 2RC8A 3FUZA 2XXIA 3I6VA 4POWA 3C4MA 5I58B 5F1QA 2DVCA 3CI8A 1I6QA 2OCUA 4OYVA 2B65A 2O68A 4ECFA 2XXTA 3ODBA 5I2NA 1H45A 1IZ1A 2DYXA 1LSTA 2F35A 4Z0IA 5JTYA 1VSOA 4IGTA 1LAHE 3RUMA 3TZAA 5I59A 5CMBA 4R9FA 1US5A 4JWXA 4KHZE 3TEPA 2GHBA 1ZIUA 3TFLA 4FEDA 2UYEA 4Q8RA 4OZ9A 2QS1A 2G93A 3D4CA 1B1HA 2XXWA 2ZNTA 3B6TA 4RPOA 2Q89A 4F1YA 1AOVA 5B70A 3RTFB 2ZMBA 1CB6A 1FTJA 1SW4A 3KN3A 5DVFA 1M5EA 2QMXA 2QRYA 3IB2A 4F3SA 3QIMA 3KN8A 1MRPA 1WVJA 3IORA 2V3QA 3HHGA 4RK9A 4NWDA 1B6HA 1SI0A 4LA9A 4Z7EA 1A99A 4YKPA 4F39A 3U1OA 4LZ7A 3HCQA 3M3FA 1B3GA 4M4GA 5DT6A 4ELRA 4YMAA 1Y1MA 1SQYA 2XXPA 5I56A 3ECRA 3PGFA 4OFJA 1TT1A 3FXQA 3PUYE 4NF5B 3C9HA 3FATA 3W9VA 1IQ7A 3IAZA 1MXYA 4IY5A 4ELOA 1A8EA 3VVEA 2OWSA 5ISUA 1B40A 3EN3A 3K6XA 3MZ1A 4WXJA 4QFPA 5FHOA 3T96B 4Q0CA 2REJA 3HPIA 1YCJA 4X1DA 3UP9A 1PC3A 2I58A 2O84X 4F1UA 2Y7WA 3MW0A 4RPNA 1MQJA 3MUQA 1KWHA 1UTHA 2PT2A 3E4RA 3PMXA 4ZEFA 4GRKA 3V5AA 1Y4CA 2NOOA 4E0WA 1SW2A 3FVNA 4F2QA 4DIGA 3DP8A 4OVJA 3H4ZA 1D3KA 1MY0A 3JZJA 4U21A 5ITPA 4BLAA 4AQ4A 2I3VA 3Q27A 4WEPA 4F29A 1IUDA 5AA3A 3ZS6A 5KCJA 2AIXA 5EHMA 3F11A 4ZECA 3FJ7A 2VHAA 4DCXA 4TLMB 4ZEDA 3EPEA 5HPQA 2RCAA 3G3FA 4F31B 1WDNA 1P1UA 4U22A 1O63A 4IO2A 1B2HA 1OQHA 1NH7A 3QSLA 1O64A 2CZLA 1CE2A 4U1OA 4KCCA 5K2YA 1N7WA 1US4A 2P0SA 3CFLA 5EHSA 3MZBA 1ANFA 4GXSB 1B5HA 2F6GA 4KQPA 1QUKA 1ZTYA 3VVFA 2FA7A 2O1LA 4EQBA 2UYFA 3KJ7A 1NFTA 1Q1KA 3PUZE 2X7QA 1OMPA 2QSXA 4EF1A 1B7ZA 1Q35A 3N6TA 3IB1A 4C1UA 4G8HA 3OMBA 4EUOA 5L9SA 1MXWA 1ZMGA 4ZE9A 1J1NA 3PPQA 4OHNA 3Q28A 1AH5A 2DWIA 2XXYA 3MVWA 2WKYA 2DE2A 4WEDA 1DTZA 3T22A 4G2ZA 4OQOA 3AXFA 3E13X 4YKIA 1GGGA 3H6UA 4DXUA 4LP2B 2Y7PA 1GTKA 4C1TA 3DELB 1FQEA 3IOWA 4ZZEA 3PUVE 4M1VA 3JV9A 3EF7A 3O28A 4I9DA 4ONYA 2O7IA 5BUUA 2GH9A 3OSQA 2ZYMA 2NXOA 2X26A 3K6WA 3PU5A 3HO7A 1UTBB 2DE3A 3H03A 4OFOA 4OFLA 3TTLA 1LFIA 3H7MA 1F9BA 1JW4A 2ZYNA 5ELVA 5DEXA 3K1NA 2W7YA 4MLVA 4ZDMA 3JYRA 1SYIA 3LSWA 1B0HA 1BTJA 1UIVA 4NF6A 3H6WA 3I3VA 2UXAA 4RA1A 5H8HA 1MQHA 2H99A 2HCAA 4F2OA 3ZKKA 1SD3A 3GBAA 1MPDA 2XXUA 4GQOA 3LSLA 3G3HA 3OSRA 3S9EA 2PBWA 2Q9TA 3IO4A 2AYSA 4G68B 4ELPA 2Z23A 1IXCA 3E9XA 2B3BA 3DLNA 2ABHA 3RY3A 3THIA 4NWCA 1MG1A 4IO5A 1B9JA 5DVJA 1FCKA 3CR9A 1A7LA 3MPLA 1R9LA 1OLCA 1DOTA 3IX1A 4N07A 4QFKA 1PDAA 1FQCA 1NMUA 1YTVA 3W9WA 4PP0A 2VD2A 3MZ9A 3QK6A 1VFDA 1P1QA 4JDFA 1B58A 4LONB 1FW0A 3U93A 4ISUA 2F7BA 1PB9A 3CG1A 1LFGA 3O9PA 2XHDA 4UA8A 4G68A 2V84A 1MH3A 1MQGA 3LBSA 4NF5A 5IKBA 1NNPA 2PVUA 3IR1A 3HN0A 4KI0E 4O3BA 2VGQA 3LSXA 2YLNA 5FTHA 3SERA 2ONRA 2XXQA 2AL4A 4LZ8A 3PMVA 1LAFE 1H76A 2VP1A 2RKMA 3O97A 1GR2A 4BDQA 4BDNA 3C34A 3BKIB 1XS5A 3SETA 2R9JA 1EZPA 3PUXE 1LBBA 1EU8A 1DTGA 3BFTA 3BBRA 1OVBA 1SVXB 1MXVA 3LR1A 4FECA 1MM6A 4LZ5A 3K1MA 3K6VA 5L8DA 3RNNA 4NTLA 3SEUA 2V3UA 1HSJA 4ZE8A 1FTLA 2RC9A 3K02A 3RLFE 1JW1A 1LB8A 4FAJA 3RTWB 3B7DA 1EH3A 3CSBA 4ZEKA 3UGWA 4U4SA 4IGRA 4F1VA 4OESA 5CM6A 2PMSA 1B32A 4EQ9A 3O2AA 3ILUB 4OEVA 1B05A 4FATA 1L5TA 1VR5A 3UK4A 2XXXA 4PFTA 3CFZA 4R6HA 1JEUA 1H44A 4OERA 3RQTA 1DPEA 3RPWA 1QKAA 2DE4A 2DWAA 3E3KA 4NF6B 3O6HA 4JBZA 1SW5A 1FQFA 2DWJA 3M3KA 1LBCA 2NVUB 3TCFA 3TKDA 3QAXA 5DEXB 1NNTA 3T66A 3ZSFA 1MS7A 4H0WA 2H5YA 2PYYA 5CMMA 2G29A 4ESWA 4XTCQ 1JW5A 1MPBA 5CC2A 3ILTB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MF3 A;  2OLB A;  5TU0 A;  2XD2 A;  4P0G A;  1LAG E;  3UOR A;  3CIJ A;  3SDF A;  3WAF A;  2XXR A;  3FJM A;  3K4U A;  2OZZ A;  2F78 A;  1POT A;  2QS2 A;  3HHF A;  3PMW A;  4GWO A;  1MDP 1;  4RY1 A;  3TOD A;  1B51 A;  1Y1Z A;  3OO9 A;  5DYH A;  4KR5 A;  3S4U A;  5A5X A;  4THI A;  2O51 A;  4RYA A;  2HQ0 A;  5CRY A;  2H9B A;  5KCJ B;  4QFL A;  1MY2 A;  3OD7 A;  3FVG A;  1Y9U A;  1B7U A;  1I6A A;  2QPQ A;  3C31 A;  4L17 A;  2UVG A;  4JSD A;  2ZYK A;  4R2F A;  4FJP A;  3C35 A;  1ZJL A;  1RKM A;  3C33 A;  2XX8 A;  3O6I A;  3O6G A;  2DVZ A;  3CFX A;  1FTM A;  4HW8 A;  4GL8 A;  2GRV A;  1B52 A;  4EDP A;  1BLF A;  2UVJ A;  3T9V A;  5H8H B;  1IXG A;  1JVX A;  3CVG A;  4X48 A;  1RYX A;  4JB7 A;  4H65 A;  1AL3 A;  1QW0 A;  4UAC A;  5I56 B;  1N0T A;  1B3H A;  2ZNU A;  4H5G A;  4JWY A;  2OWT A;  4R9G A;  4RK2 A;  4YU0 A;  1ELJ A;  1POY 1;  2O69 A;  4N13 A;  5I2N B;  2ESN A;  3SKP A;  3W15 C;  4RJZ A;  2D5W A;  2O6A A;  4PFY A;  4Q5T A;  2I4B A;  1UTB A;  3MP8 A;  4IY6 A;  3K1P A;  1S9T A;  3SEV A;  3TQW A;  1NH8 A;  1URD A;  3S9L C;  1ZKB A;  1N04 A;  1P99 A;  5FTI A;  2RC7 A;  3LC8 A;  4F3B A;  4MH5 A;  3TYH A;  2ZNS A;  3OO7 A;  5L9M A;  4DCY A;  5CBS A;  4H8J A;  3UA8 A;  3TTM A;  5IAI A;  1SDX A;  1SYH A;  1URG A;  4Q30 B;  3C32 A;  1PBP A;  5DTB A;  5AA4 A;  3MAM A;  3CG3 A;  4HCY A;  4F18 A;  3DP4 A;  1N84 A;  4GIZ A;  1TFA A;  1Y20 A;  3TDJ A;  2AL5 A;  3T9H B;  2Q88 A;  1ZLQ A;  3T93 B;  3EHS A;  3KOS A;  4IO6 A;  1JQF A;  2XXV A;  1LLS A;  4I62 A;  4MLQ A;  4NF4 A;  4R2B A;  4YB6 A;  3U92 A;  3V89 B;  1SW1 A;  5I84 A;  3HV1 A;  2Y84 A;  3MVX A;  2PX1 A;  3H6T A;  2Q2C A;  3OEL A;  2XXH A;  3QYT A;  4H1X A;  4KD5 A;  5JTY B;  3FXR A;  1S50 A;  2ALU A;  1I69 A;  3PPN A;  5TPA A;  1M5D A;  3BFU A;  4DZ1 A;  1NNF A;  4RXL A;  2D3I A;  3V8X B;  1R1N A;  3GXA A;  4HTG A;  5H8F B;  4QRZ A;  1M5C A;  4P0I A;  5CI5 A;  1LCF A;  1A40 A;  1XVX A;  2QJE A;  5H8Q B;  3RT8 A;  3EQ1 A;  2FYI A;  3PD9 A;  4QSD A;  3O66 A;  3WAE A;  5KZT A;  4F3G A;  1LCT A;  3FV2 A;  3K6U A;  4X9T A;  4H5F A;  4BDM A;  2NWJ A;  3I5O A;  2HZK A;  5J1D A;  5F7V A;  4DLD A;  3TCG A;  3FVO A;  1UTH B;  2FNC A;  4IO3 A;  3SEX A;  2DS9 A;  2HAV A;  4JWO A;  4ND9 A;  1FTK A;  1URS A;  2Z8F A;  2OJT A;  3MPK A;  4EXL A;  4PE5 B;  3MC2 A;  4EQ7 A;  3N6U A;  1N3W A;  3IJO B;  1XOC A;  1IXH A;  3TTR A;  3VV5 A;  3KSX A;  4QHQ A;  1T0K A;  4OET A;  4G68 C;  3U94 A;  4LVQ A;  1LFH A;  3D4G A;  1VE4 A;  4YB5 A;  4YIC A;  3S9N C;  4YKJ A;  2RCB A;  1GV8 A;  1LAX A;  3USD A;  2BJJ X;  2UVH A;  3KZG A;  1B0L A;  1MY4 A;  3LSF B;  4FE8 A;  3SEY A;  4LAT A;  2D21 A;  4ZS9 A;  4EXK A;  3QXM A;  1ZU0 A;  2Y7K A;  3Q26 A;  3PPR A;  4X1B A;  1B3L A;  3U8Q A;  2RIN A;  1PBQ A;  4FIM A;  3EHT A;  5TP9 A;  4DE8 A;  3P7I A;  5AA2 A;  3TPA A;  4U1Z A;  2UVI A;  2X7P A;  4BDO A;  1USY E;  2Z8D A;  4XKQ A;  2QS3 A;  3OXN A;  3TTN A;  1USY H;  4NF8 B;  4QFO A;  1Z7M E;  5HBC A;  4NMY A;  3A09 A;  2I49 A;  3N5L A;  1TXF A;  2Y7R A;  3QUJ A;  5FHM A;  1MQI A;  5H8Q A;  4O3A A;  1NL5 A;  4QF9 A;  4H8I A;  1P1O A;  1N76 A;  3A3U A;  3FXU A;  4XKR A;  2XX7 A;  3MP1 A;  3H3G A;  3IOT A;  1A54 A;  2YPN A;  1Z7N E;  3KGC A;  1XT8 A;  4GOT A;  4JXI A;  2HZL A;  4QFN A;  4LQ5 A;  5K2X A;  3KFM A;  5AA2 B;  2PT1 A;  5H8N B;  3Q25 A;  5I59 B;  2QS4 A;  1JET A;  1PEB A;  1YAE A;  3MVZ A;  4ZEB A;  4XKN A;  4KPT A;  4PFW A;  3VE1 B;  1EZO A;  5CMC A;  3S2V A;  3TQL A;  1M5B A;  2NUV A;  3IO6 A;  4ZEI A;  3MVY A;  1TFD A;  4IO4 A;  4U2R A;  1B1X A;  2ZYO A;  3MP6 A;  3N94 A;  4LQ2 A;  4OEU A;  4NED A;  2A5T A;  4XXU A;  3RN8 A;  3FD3 A;  3VDF A;  3FV1 A;  3TTK A;  4FOR A;  5I58 A;  4IB2 A;  1NKX A;  2QL3 A;  4JSO A;  4R73 A;  1OLA A;  3VXB A;  3PD8 A;  4I8C A;  5L9O A;  5ITO A;  2P2A A;  2V25 A;  1A55 A;  3TCH A;  2THI A;  2E0S A;  3MBP A;  3OO8 A;  5AE4 A;  1IIT A;  1JNF A;  4GLI A;  4NF8 A;  3FVK A;  5BWJ A;  2O1M A;  4G8M A;  1MXZ A;  1B5I A;  4LUB A;  3IOU A;  1JEV A;  1PB8 A;  4YZZ A;  1FTO A;  4IO7 A;  4DXC A;  3A3C A;  4PQJ A;  4TLL B;  1HSL A;  3U72 A;  4F22 A;  2Q2A A;  1ZBM A;  3IJX B;  5I57 B;  4ELQ A;  2M8C A;  3M8U A;  1NNK A;  3PV0 E;  4MBP A;  1OIB A;  1MM7 A;  2Z22 A;  3CRB A;  4KCD A;  4F19 A;  1EZ9 A;  3MQ9 A;  5FHN A;  3O29 A;  3FZV A;  4BDR A;  2OBG A;  1H43 A;  3PUW E;  5I2K B;  3VXC A;  1O7T A;  3KG2 A;  4H6D A;  5H8N A;  2F7A A;  2HXW A;  3FJG A;  5DVI A;  3IB0 A;  1UIU A;  3ONM A;  2OK2 A;  3B6W A;  4FEB A;  3EHU A;  2HFB A;  5TPA B;  5I2K A;  2DOJ A;  2HAU A;  1Y4T A;  2XD3 A;  3PPO A;  2Q8J A;  3ZKL A;  4KYD A;  1Y3N A;  4R6K A;  3MJN A;  2B3F A;  4YAH X;  3T9U A;  2H98 A;  4KYS A;  4KYE A;  3S9M C;  2VOZ A;  5KDT B;  5M2V A;  4NF4 B;  1XHY A;  5I57 A;  4G77 A;  3SES A;  4EF2 A;  3IK6 B;  3L6H A;  5CBR A;  1AIV A;  3TMG A;  4O3C A;  4F3P A;  2DP8 A;  2F6P A;  2H4I A;  2I3W A;  3MWB A;  1RYO A;  4G8N A;  3R26 A;  2Z8E A;  4N6P A;  3GZG A;  1AMF A;  3G3J A;  3OEM A;  4OTE A;  4RNS A;  3TAJ A;  5KDT A;  1D9Y A;  4OMB A;  1LGB C;  4H67 A;  1FQA A;  1XVY A;  1QUL A;  3KN7 A;  4G4P A;  4U4X A;  4ZZA A;  2RF1 A;  2DWH A;  3G3G A;  1FQD A;  5CMK A;  1QJM A;  1VFE A;  1P1N A;  4AB5 A;  1QUI A;  3FGS A;  5HM4 B;  3G3I A;  1JVY A;  2HEU A;  1ATG A;  2A5S A;  5JK4 A;  3VLW A;  1FQB A;  1MXU A;  3VFJ A;  4PET A;  3V83 A;  4HCW A;  1TWY A;  4AB6 A;  3LUY A;  5ICQ A;  1B3F A;  2A5T B;  2ONK E;  5EYF A;  3RT6 B;  1HSE A;  1DPP A;  1II5 A;  3C36 A;  3KEI A;  3Q29 A;  3TEL A;  4BDL A;  1MDQ A;  1DMB A;  4C0R A;  1MQD A;  1SI1 A;  1MXX A;  2O7U A;  1N7X A;  1M5F A;  1Y3P A;  2QMW A;  4R72 A;  5H8S A;  3UN6 A;  3K00 A;  4DDD A;  4ESX A;  3R6U A;  2Y7I A;  5AA4 B;  1MPC A;  2ANJ A;  4GVO A;  3KJT A;  4P11 A;  3GLB A;  1B46 A;  2REG A;  4R6Y A;  3K0V A;  2F7C A;  2I0C A;  2P1S A;  3DP6 A;  1XC1 A;  3G7W A;  3CSG A;  2I0B A;  3KOT A;  4GD5 A;  5LOM A;  2YJP A;  3GBB A;  2VD3 A;  1IXI A;  3B6Q A;  3PPP A;  1B7H A;  1SBP A;  1D9V A;  4I1D A;  3VLV A;  5H8F A;  2F34 A;  3K2D A;  4MFI A;  3HST A;  4OEN A;  5A5X B;  4YB7 A;  2LAO A;  4XIG Q;  1WOD A;  4GFR A;  4E0X A;  4QSE A;  1MY3 A;  2IEE A;  3T9X B;  1Y3Q A;  4TOZ A;  2F97 A;  2H25 A;  4POX A;  2DQV A;  1B5J A;  2V3T A;  3KSJ A;  4U23 A;  3UIF A;  2ZXT A;  1PB7 A;  4KFQ A;  2E1S A;  5ICT A;  4GXA A;  3OEK A;  2GFE A;  4OXV A;  1IEJ A;  2CMO A;  1UQW A;  2ONS A;  1B4H A;  2DXY A;  3FIR A;  4WKM A;  4PFU A;  5AA2 D;  2I4C A;  1OQG A;  3N26 A;  5B7D A;  4K3F A;  2V93 A;  1D4N A;  1S7Y A;  4HS7 A;  1QVS A;  2GHA A;  1H3D A;  5JEI A;  4DXB A;  2DSF A;  1N3X A;  1OVT A;  4GL0 A;  1B4Z A;  1P1W A;  2F8D A;  3OOA A;  1R6Z A;  2DXR A;  1MH4 A;  1R9Q A;  5AA1 A;  3K01 A;  4R74 A;  3RGY A;  3SEW A;  3OEN A;  4YMB A;  3KBR A;  3VLU A;  1LB9 A;  1DSN A;  3DM0 A;  1QUJ A;  1BP5 A;  4XKP A;  1A8F A;  4NE4 A;  1I6B A;  2KLF A;  2I6E A;  2I48 A;  2XX9 A;  3OO6 A;  2F36 A;  4R75 A;  1GVC A;  5TP9 B;  2IA4 A;  1QKB A;  4OWD A;  1IIW A;  3FAS A;  1YPN A;  3L6G A;  3M3L A;  4GF8 A;  1BIY A;  1B3E A;  3G3K A;  2F5X A;  2R71 A;  3R7X A;  3TUS A;  1MY1 A;  2R6G E;  3VVD A;  3IOV A;  4QSC A;  3H06 B;  4YKK A;  4TQU Q;  3IL1 B;  3QUF A;  3H6V A;  1BKA A;  2RC8 A;  3FUZ A;  2XXI A;  3I6V A;  4POW A;  3C4M A;  5I58 B;  5F1Q A;  2DVC A;  3CI8 A;  1I6Q A;  2OCU A;  4OYV A;  2B65 A;  2O68 A;  4ECF A;  2XXT A;  3ODB A;  5I2N A;  1H45 A;  1IZ1 A;  2DYX A;  1LST A;  2F35 A;  4Z0I A;  5JTY A;  1VSO A;  4IGT A;  1LAH E;  3RUM A;  3TZA A;  5I59 A;  5CMB A;  4R9F A;  1US5 A;  4JWX A;  4KHZ E;  3TEP A;  2GHB A;  1ZIU A;  3TFL A;  4FED A;  2UYE A;  4Q8R A;  4OZ9 A;  2QS1 A;  2G93 A;  3D4C A;  1B1H A;  2XXW A;  2ZNT A;  3B6T A;  4RPO A;  2Q89 A;  4F1Y A;  1AOV A;  5B70 A;  3RTF B;  2ZMB A;  1CB6 A;  1FTJ A;  1SW4 A;  3KN3 A;  5DVF A;  1M5E A;  2QMX A;  2QRY A;  3IB2 A;  4F3S A;  3QIM A;  3KN8 A;  1MRP A;  1WVJ A;  3IOR A;  2V3Q A;  3HHG A;  4RK9 A;  4NWD A;  1B6H A;  1SI0 A;  4LA9 A;  4Z7E A;  1A99 A;  4YKP A;  4F39 A;  3U1O A;  4LZ7 A;  3HCQ A;  3M3F A;  1B3G A;  4M4G A;  5DT6 A;  4ELR A;  4YMA A;  1Y1M A;  1SQY A;  2XXP A;  5I56 A;  3ECR A;  3PGF A;  4OFJ A;  1TT1 A;  3FXQ A;  3PUY E;  4NF5 B;  3C9H A;  3FAT A;  3W9V A;  1IQ7 A;  3IAZ A;  1MXY A;  4IY5 A;  4ELO A;  1A8E A;  3VVE A;  2OWS A;  5ISU A;  1B40 A;  3EN3 A;  3K6X A;  3MZ1 A;  4WXJ A;  4QFP A;  5FHO A;  3T96 B;  4Q0C A;  2REJ A;  3HPI A;  1YCJ A;  4X1D A;  3UP9 A;  1PC3 A;  2I58 A;  2O84 X;  4F1U A;  2Y7W A;  3MW0 A;  4RPN A;  1MQJ A;  3MUQ A;  1KWH A;  1UTH A;  2PT2 A;  3E4R A;  3PMX A;  4ZEF A;  4GRK A;  3V5A A;  1Y4C A;  2NOO A;  4E0W A;  1SW2 A;  3FVN A;  4F2Q A;  4DIG A;  3DP8 A;  4OVJ A;  3H4Z A;  1D3K A;  1MY0 A;  3JZJ A;  4U21 A;  5ITP A;  4BLA A;  4AQ4 A;  2I3V A;  3Q27 A;  4WEP A;  4F29 A;  1IUD A;  5AA3 A;  3ZS6 A;  5KCJ A;  2AIX A;  5EHM A;  3F11 A;  4ZEC A;  3FJ7 A;  2VHA A;  4DCX A;  4TLM B;  4ZED A;  3EPE A;  5HPQ A;  2RCA A;  3G3F A;  4F31 B;  1WDN A;  1P1U A;  4U22 A;  1O63 A;  4IO2 A;  1B2H A;  1OQH A;  1NH7 A;  3QSL A;  1O64 A;  2CZL A;  1CE2 A;  4U1O A;  4KCC A;  5K2Y A;  1N7W A;  1US4 A;  2P0S A;  3CFL A;  5EHS A;  3MZB A;  1ANF A;  4GXS B;  1B5H A;  2F6G A;  4KQP A;  1QUK A;  1ZTY A;  3VVF A;  2FA7 A;  2O1L A;  4EQB A;  2UYF A;  3KJ7 A;  1NFT A;  1Q1K A;  3PUZ E;  2X7Q A;  1OMP A;  2QSX A;  4EF1 A;  1B7Z A;  1Q35 A;  3N6T A;  3IB1 A;  4C1U A;  4G8H A;  3OMB A;  4EUO A;  5L9S A;  1MXW A;  1ZMG A;  4ZE9 A;  1J1N A;  3PPQ A;  4OHN A;  3Q28 A;  1AH5 A;  2DWI A;  2XXY A;  3MVW A;  2WKY A;  2DE2 A;  4WED A;  1DTZ A;  3T22 A;  4G2Z A;  4OQO A;  3AXF A;  3E13 X;  4YKI A;  1GGG A;  3H6U A;  4DXU A;  4LP2 B;  2Y7P A;  1GTK A;  4C1T A;  3DEL B;  1FQE A;  3IOW A;  4ZZE A;  3PUV E;  4M1V A;  3JV9 A;  3EF7 A;  3O28 A;  4I9D A;  4ONY A;  2O7I A;  5BUU A;  2GH9 A;  3OSQ A;  2ZYM A;  2NXO A;  2X26 A;  3K6W A;  3PU5 A;  3HO7 A;  1UTB B;  2DE3 A;  3H03 A;  4OFO A;  4OFL A;  3TTL A;  1LFI A;  3H7M A;  1F9B A;  1JW4 A;  2ZYN A;  5ELV A;  5DEX A;  3K1N A;  2W7Y A;  4MLV A;  4ZDM A;  3JYR A;  1SYI A;  3LSW A;  1B0H A;  1BTJ A;  1UIV A;  4NF6 A;  3H6W A;  3I3V A;  2UXA A;  4RA1 A;  5H8H A;  1MQH A;  2H99 A;  2HCA A;  4F2O A;  3ZKK A;  1SD3 A;  3GBA A;  1MPD A;  2XXU A;  4GQO A;  3LSL A;  3G3H A;  3OSR A;  3S9E A;  2PBW A;  2Q9T A;  3IO4 A;  2AYS A;  4G68 B;  4ELP A;  2Z23 A;  1IXC A;  3E9X A;  2B3B A;  3DLN A;  2ABH A;  3RY3 A;  3THI A;  4NWC A;  1MG1 A;  4IO5 A;  1B9J A;  5DVJ A;  1FCK A;  3CR9 A;  1A7L A;  3MPL A;  1R9L A;  1OLC A;  1DOT A;  3IX1 A;  4N07 A;  4QFK A;  1PDA A;  1FQC A;  1NMU A;  1YTV A;  3W9W A;  4PP0 A;  2VD2 A;  3MZ9 A;  3QK6 A;  1VFD A;  1P1Q A;  4JDF A;  1B58 A;  4LON B;  1FW0 A;  3U93 A;  4ISU A;  2F7B A;  1PB9 A;  3CG1 A;  1LFG A;  3O9P A;  2XHD A;  4UA8 A;  4G68 A;  2V84 A;  1MH3 A;  1MQG A;  3LBS A;  4NF5 A;  5IKB A;  1NNP A;  2PVU A;  3IR1 A;  3HN0 A;  4KI0 E;  4O3B A;  2VGQ A;  3LSX A;  2YLN A;  5FTH A;  3SER A;  2ONR A;  2XXQ A;  2AL4 A;  4LZ8 A;  3PMV A;  1LAF E;  1H76 A;  2VP1 A;  2RKM A;  3O97 A;  1GR2 A;  4BDQ A;  4BDN A;  3C34 A;  3BKI B;  1XS5 A;  3SET A;  2R9J A;  1EZP A;  3PUX E;  1LBB A;  1EU8 A;  1DTG A;  3BFT A;  3BBR A;  1OVB A;  1SVX B;  1MXV A;  3LR1 A;  4FEC A;  1MM6 A;  4LZ5 A;  3K1M A;  3K6V A;  5L8D A;  3RNN A;  4NTL A;  3SEU A;  2V3U A;  1HSJ A;  4ZE8 A;  1FTL A;  2RC9 A;  3K02 A;  3RLF E;  1JW1 A;  1LB8 A;  4FAJ A;  3RTW B;  3B7D A;  1EH3 A;  3CSB A;  4ZEK A;  3UGW A;  4U4S A;  4IGR A;  4F1V A;  4OES A;  5CM6 A;  2PMS A;  1B32 A;  4EQ9 A;  3O2A A;  3ILU B;  4OEV A;  1B05 A;  4FAT A;  1L5T A;  1VR5 A;  3UK4 A;  2XXX A;  4PFT A;  3CFZ A;  4R6H A;  1JEU A;  1H44 A;  4OER A;  3RQT A;  1DPE A;  3RPW A;  1QKA A;  2DE4 A;  2DWA A;  3E3K A;  4NF6 B;  3O6H A;  4JBZ A;  1SW5 A;  1FQF A;  2DWJ A;  3M3K A;  1LBC A;  2NVU B;  3TCF A;  3TKD A;  3QAX A;  5DEX B;  1NNT A;  3T66 A;  3ZSF A;  1MS7 A;  4H0W A;  2H5Y A;  2PYY A;  5CMM A;  2G29 A;  4ESW A;  4XTC Q;  1JW5 A;  1MPB A;  5CC2 A;  3ILT B; 
#chains in the Genus database with same CATH topology
 4MF3 A;  2OLB A;  2XD2 A;  3WAF A;  4RY1 A;  1LBZ A;  5DYH A;  5A5X A;  5CRY A;  1D9Q A;  3OD7 A;  2QPQ A;  3C31 A;  3RPL A;  2ZYK A;  4R2F A;  3C35 A;  4JVC A;  2QVV A;  1QW0 A;  5I56 B;  1B3H A;  4JWY A;  4R9G A;  5I2N B;  1POY 1;  2O69 A;  3W15 C;  2D5W A;  4PFY A;  4Q5T A;  2I4B A;  1DBZ A;  1YXI A;  5IGA A;  5FTI A;  3LC8 A;  3OO7 A;  5L9M A;  5CBS A;  4Q30 B;  3C32 A;  1PBP A;  5AA4 A;  3TDJ A;  2AL5 A;  1ZLQ A;  4YB6 A;  4NF4 A;  2PX1 A;  1EYI A;  3H6T A;  4NQ8 A;  5JTY B;  4KD5 A;  3FXR A;  2ALU A;  3PPN A;  4HE1 A;  3BFU A;  2XWV A;  1EYK A;  1LCF A;  1XVX A;  1LEV A;  3EQ1 A;  3PD9 A;  3WAE A;  1FPK A;  1NV7 A;  3K6U A;  2NWJ A;  3TCG A;  3SEX A;  2QFL A;  3MPK A;  4EXL A;  3IJO B;  3TTR A;  4QHQ A;  1T0K A;  3D4G A;  3USD A;  1LAX A;  3KZG A;  3PPR A;  1B3L A;  1PBQ A;  4FIM A;  3TPA A;  4U1Z A;  2QS3 A;  1Z7M E;  3A09 A;  3PTY A;  3ROJ A;  1NL5 A;  4H8I A;  1N76 A;  3H3G A;  3KGC A;  1XT8 A;  5H8N B;  1JET A;  3E79 A;  3MVY A;  4MIJ A;  4IO4 A;  4U2R A;  1B1X A;  3MP6 A;  4LQ2 A;  4OEU A;  4GWW A;  3FV1 A;  3TTK A;  4IB2 A;  3VXB A;  1A55 A;  2E0S A;  2WBD A;  4GLI A;  2O1M A;  4N6K A;  1JP4 A;  1NV4 A;  1FTO A;  2FIE A;  3A3C A;  1HSL A;  4F22 A;  2Q2A A;  1ZBM A;  4P8B A;  2WBB A;  2M8C A;  4ELQ A;  3M8U A;  1NNK A;  1OIB A;  4KCD A;  5FHN A;  4BDR A;  1H43 A;  1O7T A;  2XXK A;  2HXW A;  1UIU A;  3ONM A;  3B6W A;  2Q8J A;  3PPO A;  2XD3 A;  5ET7 A;  3ZKL A;  4PTK A;  1Y3N A;  2H98 A;  2L5V A;  3IK6 B;  5CBR A;  1AIV A;  5IZ3 B;  3R26 A;  2FIX A;  3OEM A;  4RNS A;  3G3J A;  5IZ1 A;  5KDT A;  4OMB A;  1XVY A;  3G3G A;  1FJ6 A;  1P1N A;  2OX3 A;  1RDX A;  1ATG A;  2A5S A;  4PET A;  3V83 A;  5ICQ A;  1B3F A;  1CNQ A;  3KEI A;  4BDL A;  2XA5 A;  1N7X A;  1M5F A;  1Y3P A;  5H8S A;  3UN6 A;  5AA4 B;  1MPC A;  1NUZ A;  1FPB A;  2REG A;  3K0V A;  2P1S A;  1NUY A;  1XC1 A;  4GD5 A;  3CSG A;  2YJP A;  4PAK A;  3GBB A;  4I1D A;  5H8F A;  4YB7 A;  4GX3 A;  4TOZ A;  1B5J A;  3KSJ A;  3OEK A;  1B4H A;  4O7I A;  1RDZ A;  2PFY A;  2I4C A;  3N26 A;  5B7D A;  4K3F A;  2Y5L A;  1LBX A;  1H3D A;  4DXB A;  2DSF A;  4IO6 A;  2F8D A;  5AA1 A;  1AOV A;  3OEN A;  4N91 A;  3KBR A;  1LB9 A;  1DSN A;  3DM0 A;  4P47 A;  4NE4 A;  2I48 A;  4HXV A;  1NI9 A;  1QKB A;  3FAS A;  4GF8 A;  3TUS A;  4QSC A;  3H6V A;  1BKA A;  1FRP A;  3C4M A;  5F1Q A;  3CI8 A;  1I6Q A;  3ODB A;  1INP A;  2R8T A;  1IZ1 A;  5LDZ A;  3SZP A;  1LST A;  4Z0I A;  5JTY A;  3TZA A;  4JWX A;  2GHB A;  2ZNT A;  4OVR A;  1NUX A;  3KN3 A;  2QMX A;  3QMF A;  3KN8 A;  3IOR A;  4RK9 A;  4FBP A;  4YKP A;  4LZ7 A;  3HCQ A;  5DT6 A;  4ELR A;  5I56 A;  1SQY A;  2XXP A;  1TT1 A;  3C9H A;  3W9V A;  1MXY A;  4PDD A;  4HE2 A;  5FHO A;  2REJ A;  2CZK A;  3HPI A;  2I58 A;  2O84 X;  4RPN A;  1IMD A;  2PT2 A;  3V5A A;  4F2Q A;  3DP8 A;  3H4Z A;  1D3K A;  5ITP A;  5AA3 A;  1IUD A;  2VHA A;  4DCX A;  4PFB A;  1WDN A;  1P1U A;  1B2H A;  1O64 A;  4U1O A;  1N7W A;  1B5H A;  4EQB A;  1ZTY A;  2UYF A;  4PGN A;  1OMP A;  5I3S A;  4XEQ A;  5L9S A;  1MXW A;  4ZE9 A;  5I7I A;  1AH5 A;  2DWI A;  4OAN A;  3T22 A;  1DTZ A;  4G2Z A;  3AXF A;  3E13 X;  1GGG A;  4I9D A;  4GX6 A;  2HHM A;  2X26 A;  3K6W A;  3TTL A;  4OFO A;  5ELV A;  1JW4 A;  3K1N A;  1SYI A;  3LSW A;  3H6W A;  4MX6 A;  4QXD A;  4NHB A;  5H8H A;  1MQH A;  2H99 A;  1SD3 A;  2PBW A;  4G68 B;  3E9X A;  4IO5 A;  2WYK A;  3MPL A;  5ESY A;  3IX1 A;  1FQC A;  4PP0 A;  2VD2 A;  3MZ9 A;  1P1Q A;  4JDF A;  4NG7 A;  1B58 A;  4LON B;  2XHD A;  2V84 A;  1MH3 A;  1MQG A;  5EQ9 A;  1NV1 A;  2YLN A;  5FTH A;  2ONR A;  3FXB A;  1LAF E;  1H76 A;  4N8G A;  4BDN A;  4PE3 A;  3BKI B;  3PUX E;  3RNN A;  3K6V A;  3SEU A;  4ZE8 A;  1FPL A;  4FAJ A;  3CSB A;  1EH3 A;  3UGW A;  4F1V A;  3D1R A;  4OES A;  1B32 A;  5FBP A;  2XXX A;  3LUZ A;  4P1E A;  3RPW A;  4MCO A;  1SW5 A;  4P1L A;  5DEX B;  3T66 A;  5TU0 A;  1FBP A;  3SDF A;  3FJM A;  2F78 A;  3PMW A;  4GWO A;  1MDP 1;  1Y1Z A;  4RYA A;  2HQ0 A;  2H9B A;  4N17 A;  4GBV A;  2UVG A;  1YZ0 A;  4JSD A;  4FJP A;  3O6I A;  4HW8 A;  3CFX A;  1FTM A;  4GL8 A;  2GRV A;  1B52 A;  1BLF A;  3T9V A;  5H8H B;  1IXG A;  4X48 A;  4UAC A;  4YU0 A;  4RK2 A;  1FPG A;  2ESN A;  3TQW A;  3S9L C;  1NH8 A;  3ISP A;  1ZKB A;  3FBP A;  1IMB A;  2ZNS A;  4DCY A;  5IAI A;  3CG3 A;  1TFA A;  1Y20 A;  4G61 A;  3EHS A;  2XXV A;  1LLS A;  3U92 A;  1SW1 A;  2Y84 A;  2Q2C A;  5TPA A;  4DZ1 A;  4RXL A;  3V8X B;  1R1N A;  3GXA A;  5H8F B;  4QRZ A;  1M5C A;  3RT8 A;  2QJE A;  5H8Q B;  5A5L A;  5ET5 A;  4F3G A;  5T3J A;  3FV2 A;  5IZZ A;  3BIH A;  4X9T A;  5J1D A;  5F7V A;  4DLD A;  2FNC A;  4IO3 A;  4ND9 A;  4EQ7 A;  1N3W A;  3VV5 A;  1FTA A;  4G68 C;  4LVQ A;  1LFH A;  3S9N C;  4YKJ A;  1FPE A;  4FE8 A;  3LSF B;  4X04 A;  1ZU0 A;  1G0H A;  5AA2 A;  5TP9 A;  2X7P A;  4BDO A;  2Z8D A;  1USY H;  2DDK A;  2I49 A;  3N5L A;  1TXF A;  5FHM A;  1P1O A;  3A3U A;  3MP1 A;  4GOT A;  4IR8 A;  2HZL A;  4GBW A;  5K2X A;  3KFM A;  4AS4 A;  3Q25 A;  2QS4 A;  4ZEB A;  3VE1 B;  4KPT A;  2NUV A;  1TFD A;  2ZYO A;  4FOR A;  4JSO A;  4PF8 A;  4I8C A;  2V25 A;  3MBP A;  3OO8 A;  5AE4 A;  4PFR A;  1JNF A;  1MXZ A;  4LUB A;  4YZZ A;  1K9Z A;  4IO7 A;  4PQJ A;  4TLL B;  5I57 B;  3PV0 E;  1MM7 A;  2Z22 A;  4F19 A;  3FZV A;  5I2K B;  4AS5 A;  3KG2 A;  5H8N A;  4P9K A;  3IB0 A;  2FBP A;  2OK2 A;  3EHU A;  5TPA B;  2HAU A;  1Y4T A;  3S9M C;  5M2V A;  4EF2 A;  1SPI A;  2F6P A;  2H4I A;  2I3W A;  4G8N A;  4NF0 A;  4H67 A;  4U4X A;  3IFC A;  3FGS A;  1JVY A;  3VLW A;  1FQB A;  3VFJ A;  3RT6 B;  1VDW A;  2B4L A;  3TEL A;  1MDQ A;  1DMB A;  2O7U A;  4R72 A;  4DDD A;  2Y7I A;  4P11 A;  3GLB A;  2I0C A;  3G7W A;  5LOM A;  3KOT A;  2VD3 A;  1IXI A;  1B7H A;  2F34 A;  4OEN A;  1WOD A;  2IEE A;  1Y3Q A;  2KR0 A;  4GXA A;  4P56 A;  4OXV A;  1UQW A;  5AA2 D;  2WYP A;  1N3X A;  3SEW A;  1R9Q A;  1LBV A;  1QUJ A;  4XKP A;  1A8F A;  2XX9 A;  2I6E A;  2F36 A;  5TP9 B;  2IA4 A;  4OWD A;  1YPN A;  3M3L A;  1BIY A;  1B3E A;  3G3K A;  2F5X A;  4YKK A;  1FSA A;  3FUZ A;  2XXI A;  4POW A;  5EYG A;  2XXT A;  4DI3 D;  2DYX A;  2F35 A;  1VSO A;  4R9F A;  4KHZ E;  4P3L A;  3TFL A;  4FED A;  4Q8R A;  4OZ9 A;  1IMF A;  2G93 A;  2XXW A;  2CEX A;  2MKZ A;  4NX1 A;  3RTF B;  2ZMB A;  1SW4 A;  3IB2 A;  1WVJ A;  2CEY A;  2V3Q A;  3MYU A;  4NWD A;  1KA1 A;  4LA9 A;  2HXR A;  4M4G A;  4YMA A;  1Y1M A;  4OFJ A;  3B8B A;  4NF5 B;  3PUY E;  2Q74 A;  1A8E A;  4ELO A;  1B40 A;  3MZ1 A;  4QFP A;  3T96 B;  3UP9 A;  1YCJ A;  5EQ7 A;  2Y7W A;  4PBH A;  1UTH A;  4ZEF A;  3PMX A;  4GRK A;  1Y4C A;  2NOO A;  4E0W A;  4OVJ A;  3HFU A;  1MY0 A;  3JZJ A;  5KCJ A;  4WEP A;  5EHM A;  4ZEC A;  5HPQ A;  4F31 B;  4U22 A;  1OQH A;  1NH7 A;  2CZL A;  5EHS A;  2P0S A;  4GXS B;  2O1L A;  3KJ7 A;  4PF6 A;  2QSX A;  1B7Z A;  3IB1 A;  3OMB A;  4EUO A;  4O7M A;  3NOH A;  3Q28 A;  2XXY A;  2WKY A;  2DE2 A;  4LP2 B;  2Y7P A;  4C1T A;  1FQE A;  4ZZE A;  3PUV E;  4M1V A;  3O28 A;  3EF7 A;  5BUU A;  2ZYM A;  4OFL A;  2NXO A;  3PU5 A;  3H03 A;  3H7M A;  5JK4 A;  1F9B A;  5DEX A;  2W7Y A;  4O94 A;  1B0H A;  4N6D A;  4RA1 A;  3ZKK A;  4PAI A;  3IO4 A;  2Z23 A;  3DLN A;  2ABH A;  1KA0 A;  1MG1 A;  1B9J A;  1R9L A;  4QFK A;  1PDA A;  3W9W A;  3QK6 A;  1VFD A;  3CG1 A;  1LFG A;  3B50 A;  5IKB A;  2PVU A;  4GX4 A;  4KI0 E;  3SER A;  2XXQ A;  4MAG A;  3PMV A;  2R9J A;  1LBB A;  4MJO A;  1DTG A;  3BFT A;  1MXV A;  3LR1 A;  5L8D A;  4PGP A;  2RC9 A;  3K02 A;  3RLF E;  1LB8 A;  3B7D A;  4ZEK A;  4H46 A;  5CM6 A;  4OEV A;  1VR5 A;  4PFT A;  3CFZ A;  4NN3 A;  4R6H A;  4PC9 A;  2DE4 A;  2DWA A;  3E3K A;  4JBZ A;  2DWJ A;  3QAX A;  3ZSF A;  4H0W A;  5CMM A;  1NV0 A;  1YYZ A;  5CC2 A;  4P0G A;  1LAG E;  3CIJ A;  2OZZ A;  1G0I A;  3TOD A;  4THI A;  1MY2 A;  3FVG A;  2XX8 A;  4UAB A;  1FBC A;  3KC1 A;  3CVG A;  5DW8 A;  1RYX A;  4JB7 A;  1AL3 A;  3CHG A;  2ZNU A;  3VDF A;  2OWT A;  4RJZ A;  2O6A A;  1UTB A;  3MP8 A;  4IY6 A;  4O8M A;  1URD A;  1P99 A;  2RC7 A;  4MH5 A;  3TYH A;  5EYH A;  4H8J A;  3TTM A;  1SDX A;  3MAM A;  4HCY A;  4F18 A;  1N84 A;  3T9H B;  2Q88 A;  1K9Y A;  3T0J A;  3KOS A;  4I62 A;  4R2B A;  3HV1 A;  3OEL A;  4MHF A;  1FBG A;  1I69 A;  1M5D A;  1NNF A;  3RYD A;  2D3I A;  4QSD A;  3O66 A;  1LCT A;  5IM2 A;  4H5F A;  4BDM A;  3FVO A;  2DS9 A;  2HAV A;  1FTK A;  1URS A;  4PE5 B;  1XOC A;  1IXH A;  3KSX A;  1IMA A;  1GV8 A;  2UVH A;  1MY4 A;  4ZS9 A;  2D21 A;  4EXK A;  2Y7K A;  3U8Q A;  4X1B A;  4DE8 A;  3EHT A;  3P7I A;  3OXN A;  3TTN A;  4NMY A;  1MQI A;  4O3A A;  4QF9 A;  4XKR A;  3FXU A;  2XX7 A;  3IOT A;  1A54 A;  2YPN A;  1Z7N E;  5AA2 B;  4LQ5 A;  5I59 B;  3MVZ A;  4PFW A;  1EZO A;  5CMC A;  4PAF A;  1M5B A;  3IO6 A;  2A5T A;  4XXU A;  3FD3 A;  5I58 A;  2QL3 A;  4R73 A;  3MST A;  5ITO A;  2P2A A;  4NF8 A;  3FVK A;  1B5I A;  3IOU A;  1JEV A;  4DXC A;  2Y5K A;  2ZZX A;  4MBP A;  3CRB A;  3O29 A;  3PUW E;  4H6D A;  2F7A A;  3FJG A;  3U65 A;  5I2K A;  4YAH X;  3T9U A;  4KYE A;  2VOZ A;  5KDT B;  1XHY A;  2VPN A;  4G77 A;  3L6H A;  2Z8E A;  4N6P A;  3GZG A;  3TAJ A;  1D9Y A;  1LGB C;  1FQA A;  3EKI A;  1QUL A;  3KN7 A;  4G4P A;  2RF1 A;  1FQD A;  5CMK A;  1VFE A;  5HM4 B;  2HEU A;  4HCW A;  4AB6 A;  3LUY A;  2A5T B;  5EYF A;  5EQ8 A;  3Q29 A;  4N4U A;  3BIG A;  3K00 A;  4ESX A;  2QVR A;  2ANJ A;  4GVO A;  3KJT A;  1B46 A;  2F7C A;  3DP6 A;  5EQA A;  2I0B A;  4GWZ A;  4MNP A;  1NV6 A;  3B6Q A;  3PPP A;  1SBP A;  2P3N A;  4XIG Q;  4QSE A;  1MY3 A;  2PFZ A;  3T9X B;  2H25 A;  4POX A;  2DQV A;  4U23 A;  2ZXT A;  1PB7 A;  4KFQ A;  2E1S A;  5ICT A;  4MNI A;  1IEJ A;  4WKM A;  2ONS A;  2V93 A;  1D4N A;  2GHA A;  5JEI A;  4GL0 A;  1B4Z A;  1R6Z A;  3RGY A;  3VLU A;  1BP5 A;  1GVC A;  4R75 A;  3OO6 A;  2R71 A;  4KXP A;  1MY1 A;  3VVD A;  3IOV A;  3H06 B;  4TQU Q;  5I58 B;  4OYV A;  4ECF A;  1H45 A;  5I5P A;  5I59 A;  5CMB A;  3TEP A;  1ZIU A;  2UYE A;  2QS1 A;  1B1H A;  3B6T A;  2Q89 A;  5B70 A;  4N81 A;  1FTJ A;  4F3S A;  3QIM A;  3U1O A;  3M3F A;  2PCR A;  3GYY A;  3PGF A;  3VVE A;  2OWS A;  3K6X A;  1NV2 A;  4X1D A;  1PC3 A;  1DK4 A;  3MW0 A;  1MQJ A;  3MUQ A;  2ZZV A;  1NV5 A;  1SW2 A;  3FVN A;  1IMC A;  4BLA A;  4AQ4 A;  3ZS6 A;  3F11 A;  3FJ7 A;  4ZED A;  3EPE A;  2RCA A;  1O63 A;  4IO2 A;  3QSL A;  4KCC A;  3CFL A;  3MZB A;  2F6G A;  4KQP A;  3PUZ E;  3A29 A;  2X7Q A;  4EF1 A;  2F3B A;  1IME A;  4C1U A;  1ZMG A;  1J1N A;  3PPQ A;  3MVW A;  4WED A;  4OQO A;  4YKI A;  3IOW A;  3JV9 A;  4ONY A;  2O7I A;  3RN8 A;  2FVZ A;  1UTB B;  1LFI A;  2ZYN A;  4ZDM A;  4MLV A;  3JYR A;  1LBY A;  1BTJ A;  1UIV A;  4NF6 A;  3I3V A;  2UXA A;  2XWK A;  2HCA A;  1BK4 A;  3GBA A;  1MPD A;  3LSL A;  1FPD A;  3G3H A;  2Q9T A;  2AYS A;  3RY3 A;  5DVJ A;  4PBQ A;  1DOT A;  1NMU A;  4ISU A;  2F7B A;  5ET8 A;  2ZZW A;  4UA8 A;  3LBS A;  1NNP A;  3IR1 A;  4O3B A;  3LSX A;  2AL4 A;  4LZ8 A;  3SET A;  1XS5 A;  5LTC A;  1OVB A;  1SVX B;  1MM6 A;  4JVI A;  3K1M A;  4LZ5 A;  1FTL A;  1JW1 A;  3RTW B;  4IGR A;  4EQ9 A;  1B05 A;  1H44 A;  4OER A;  3RQT A;  1QKA A;  4NF6 B;  3TKD A;  3M3K A;  1LBC A;  2P3V A;  1FBD A;  2G29 A;  1MPB A;  3ILT B;  3UOR A;  2JJK A;  2XXR A;  3K4U A;  3HHF A;  2QS2 A;  1POT A;  2B4M A;  1B51 A;  3OO9 A;  4KR5 A;  4LN5 A;  3S4U A;  2O51 A;  5KCJ B;  4QFL A;  1Y9U A;  1B7U A;  1I6A A;  4L17 A;  1ZJL A;  1RKM A;  3C33 A;  2F3D A;  2QVU A;  5J16 A;  3O6G A;  2DVZ A;  4EDP A;  2UVJ A;  1JVX A;  4OVT A;  4H65 A;  1QGX A;  1N0T A;  4H5G A;  4QBA A;  1ELJ A;  4N13 A;  3SKP A;  4OVS A;  4NAP A;  3K1P A;  1S9T A;  3SEV A;  1N04 A;  4F3B A;  4JVD A;  3UA8 A;  1SYH A;  1URG A;  5DTB A;  5IZ3 A;  3DP4 A;  4GIZ A;  3T93 B;  1JQF A;  4MLQ A;  3V89 B;  5I84 A;  3MVX A;  3QYT A;  4H1X A;  1FJ9 A;  2XWI A;  2XXH A;  1RDY A;  1S50 A;  2CZH A;  4HTG A;  4P0I A;  5CI5 A;  1A40 A;  2FYI A;  4OVQ A;  5KZT A;  3I5O A;  2HZK A;  4H45 A;  1UTH B;  4JWO A;  2Z8F A;  2OJT A;  3MC2 A;  3N6U A;  4OET A;  3U94 A;  1VE4 A;  4YB5 A;  4YIC A;  2RCB A;  2BJJ X;  1B0L A;  3SEY A;  4LAT A;  3QXM A;  3Q26 A;  2RIN A;  2UVI A;  1USY E;  4XKQ A;  4NF8 B;  4QFO A;  2XWO A;  5HBC A;  4GWY A;  2Y7R A;  3QUJ A;  5ET6 A;  5H8Q A;  4JXI A;  4QFN A;  1AWB A;  2KQZ A;  2PT1 A;  1PEB A;  1YAE A;  4XKN A;  3S2V A;  3TQL A;  4GWX A;  4ZEI A;  2VT5 A;  3N94 A;  4NED A;  1NKX A;  1OLA A;  5L9O A;  3PD8 A;  3TCH A;  2THI A;  1IIT A;  5BWJ A;  1KZ8 A;  4G8M A;  1PB8 A;  3U72 A;  3IJX B;  4GWS A;  1EZ9 A;  3MQ9 A;  2OBG A;  3VXC A;  2VPO A;  4FEB A;  2HFB A;  4HE0 A;  2DOJ A;  4KYD A;  4R6K A;  3MJN A;  2B3F A;  4KYS A;  1FPF A;  4NF4 B;  5I57 A;  3SES A;  3TMG A;  4O3C A;  4F3P A;  2DP8 A;  3MWB A;  1RYO A;  4OTE A;  1AMF A;  4ZZA A;  2DWH A;  1QJM A;  4I3Y A;  4AB5 A;  1QUI A;  3G3I A;  1MXU A;  1TWY A;  3IFA A;  3KBZ A;  2ONK E;  4I3E A;  4XF5 A;  1HSE A;  1DPP A;  1II5 A;  3C36 A;  4C0R A;  1MQD A;  1SI1 A;  1MXX A;  2QMW A;  3R6U A;  4DI4 B;  2GQ1 A;  3E78 A;  4R6Y A;  1NV3 A;  1FBF A;  4N8Y A;  2HPG A;  3RPL B;  2CZI A;  1D9V A;  3VLV A;  3K2D A;  4MFI A;  3HST A;  5A5X B;  2LAO A;  4E0X A;  4GFR A;  2F97 A;  3UIF A;  1XI6 A;  2V3T A;  2GFE A;  2CMO A;  4MNC A;  2DXY A;  3FIR A;  4PFU A;  1OQG A;  2FHY A;  1S7Y A;  4HS7 A;  1QVS A;  1OVT A;  1P1W A;  3OOA A;  2DXR A;  1MH4 A;  3K01 A;  4R74 A;  4YMB A;  4F39 A;  1I6B A;  2KLF A;  2WEF A;  1IIW A;  3L6G A;  3R7X A;  2R6G E;  3IL1 B;  3QUF A;  2RC8 A;  3I6V A;  4NGU A;  2DVC A;  4OVP A;  2OCU A;  2B65 A;  2O68 A;  5I2N A;  4IGT A;  1LAH E;  3RUM A;  4OA4 A;  1US5 A;  3LV0 A;  2WX9 A;  3D4C A;  2OWZ A;  4RPO A;  3KC0 A;  4F1Y A;  1FBH A;  5DVF A;  1CB6 A;  1M5E A;  2QRY A;  1MRP A;  2BJI A;  3HHG A;  1B6H A;  1SI0 A;  4Z7E A;  1A99 A;  1B3G A;  4I40 A;  3ECR A;  3FXQ A;  3FAT A;  1IQ7 A;  3IAZ A;  4IY5 A;  5ISU A;  3EN3 A;  4WXJ A;  4PFI A;  4Q0C A;  4F1U A;  1KWH A;  3E4R A;  4DIG A;  4U21 A;  1LBW A;  1FBE A;  2I3V A;  3Q27 A;  4MMP A;  4F29 A;  2AIX A;  4TLM B;  3G3F A;  1CE2 A;  5K2Y A;  1US4 A;  4XFE A;  1ANF A;  3VVF A;  1QUK A;  2FA7 A;  1NFT A;  1Q1K A;  1Q35 A;  3N6T A;  4G8H A;  4OHN A;  3H6U A;  4DXU A;  1GTK A;  3DEL B;  2V4C A;  2GH9 A;  3OSQ A;  3HO7 A;  2DE3 A;  1NUW A;  1Q9D A;  4F2O A;  2XXU A;  4GQO A;  3OSR A;  5F24 A;  4X8R A;  3S9E A;  4ELP A;  2Q8M A;  1IXC A;  2B3B A;  3THI A;  4NWC A;  1FCK A;  3CR9 A;  1A7L A;  1OLC A;  4N07 A;  1YTV A;  1FW0 A;  1FPJ A;  3U93 A;  1PB9 A;  3O9P A;  4G68 A;  1FPI A;  1EYJ A;  4NF5 A;  3HN0 A;  2VGQ A;  1DCU A;  4PDH A;  2VP1 A;  3O97 A;  2RKM A;  4GWU A;  1GR2 A;  4BDQ A;  3C34 A;  1EZP A;  1EU8 A;  4N15 A;  3BBR A;  4FEC A;  4NTL A;  2V3U A;  4PCD A;  1HSJ A;  4MEV A;  3T1B A;  4U4S A;  2PMS A;  3O2A A;  3ILU B;  4FAT A;  1L5T A;  3UK4 A;  1JEU A;  1DPE A;  5DVI A;  3TCF A;  3O6H A;  1FQF A;  2NVU B;  1NNT A;  1MS7 A;  2H5Y A;  2PYY A;  4ESW A;  4XTC Q;  1JW5 A; 
#chains in the Genus database with same CATH homology
 4MF3 A;  2OLB A;  5TU0 A;  2XD2 A;  4P0G A;  1LAG E;  3UOR A;  3CIJ A;  3SDF A;  3WAF A;  2XXR A;  3FJM A;  3K4U A;  2OZZ A;  2F78 A;  1POT A;  2QS2 A;  3HHF A;  3PMW A;  4GWO A;  1MDP 1;  4RY1 A;  3TOD A;  1B51 A;  1Y1Z A;  3OO9 A;  5DYH A;  4KR5 A;  3S4U A;  5A5X A;  4THI A;  2O51 A;  4RYA A;  2HQ0 A;  5CRY A;  2H9B A;  5KCJ B;  4QFL A;  1MY2 A;  3OD7 A;  3FVG A;  1Y9U A;  1B7U A;  1I6A A;  2QPQ A;  3C31 A;  4L17 A;  2UVG A;  4JSD A;  2ZYK A;  4R2F A;  4FJP A;  3C35 A;  1ZJL A;  1RKM A;  3C33 A;  2XX8 A;  3O6I A;  3O6G A;  2DVZ A;  3CFX A;  1FTM A;  4HW8 A;  4GL8 A;  2GRV A;  1B52 A;  4EDP A;  1BLF A;  2UVJ A;  3T9V A;  5H8H B;  1IXG A;  1JVX A;  3CVG A;  4X48 A;  1RYX A;  4JB7 A;  4H65 A;  1AL3 A;  1QW0 A;  4UAC A;  5I56 B;  1N0T A;  1B3H A;  2ZNU A;  4H5G A;  4JWY A;  2OWT A;  4R9G A;  4RK2 A;  4YU0 A;  1ELJ A;  1POY 1;  2O69 A;  4N13 A;  5I2N B;  2ESN A;  3SKP A;  3W15 C;  4RJZ A;  2D5W A;  2O6A A;  4PFY A;  4Q5T A;  2I4B A;  1UTB A;  3MP8 A;  4IY6 A;  3K1P A;  1S9T A;  3SEV A;  3TQW A;  1NH8 A;  1URD A;  3S9L C;  1ZKB A;  1N04 A;  1P99 A;  5FTI A;  2RC7 A;  3LC8 A;  4F3B A;  4MH5 A;  3TYH A;  2ZNS A;  3OO7 A;  5L9M A;  4DCY A;  5CBS A;  4H8J A;  3UA8 A;  3TTM A;  5IAI A;  1SDX A;  1SYH A;  1URG A;  4Q30 B;  3C32 A;  1PBP A;  5DTB A;  5AA4 A;  3MAM A;  3CG3 A;  4HCY A;  4F18 A;  3DP4 A;  1N84 A;  4GIZ A;  1TFA A;  1Y20 A;  3TDJ A;  2AL5 A;  3T9H B;  2Q88 A;  1ZLQ A;  3T93 B;  3EHS A;  3KOS A;  4IO6 A;  1JQF A;  2XXV A;  1LLS A;  4I62 A;  4MLQ A;  4NF4 A;  4R2B A;  4YB6 A;  3U92 A;  3V89 B;  1SW1 A;  5I84 A;  3HV1 A;  2Y84 A;  3MVX A;  2PX1 A;  3H6T A;  2Q2C A;  3OEL A;  2XXH A;  3QYT A;  4H1X A;  4KD5 A;  5JTY B;  3FXR A;  1S50 A;  2ALU A;  1I69 A;  3PPN A;  5TPA A;  1M5D A;  3BFU A;  4DZ1 A;  1NNF A;  4RXL A;  2D3I A;  3V8X B;  1R1N A;  3GXA A;  4HTG A;  5H8F B;  4QRZ A;  1M5C A;  4P0I A;  5CI5 A;  1LCF A;  1A40 A;  1XVX A;  2QJE A;  5H8Q B;  3RT8 A;  3EQ1 A;  2FYI A;  3PD9 A;  4QSD A;  3O66 A;  3WAE A;  5KZT A;  4F3G A;  1LCT A;  3FV2 A;  3K6U A;  4X9T A;  4H5F A;  4BDM A;  2NWJ A;  3I5O A;  2HZK A;  5J1D A;  5F7V A;  4DLD A;  3TCG A;  3FVO A;  1UTH B;  2FNC A;  4IO3 A;  3SEX A;  2DS9 A;  2HAV A;  4JWO A;  4ND9 A;  1FTK A;  1URS A;  2Z8F A;  2OJT A;  3MPK A;  4EXL A;  4PE5 B;  3MC2 A;  4EQ7 A;  3N6U A;  1N3W A;  3IJO B;  1XOC A;  1IXH A;  3TTR A;  3VV5 A;  3KSX A;  4QHQ A;  1T0K A;  4OET A;  4G68 C;  3U94 A;  4LVQ A;  1LFH A;  3D4G A;  1VE4 A;  4YB5 A;  4YIC A;  3S9N C;  4YKJ A;  2RCB A;  1GV8 A;  1LAX A;  3USD A;  2BJJ X;  2UVH A;  3KZG A;  1B0L A;  1MY4 A;  3LSF B;  4FE8 A;  3SEY A;  4LAT A;  2D21 A;  4ZS9 A;  4EXK A;  3QXM A;  1ZU0 A;  2Y7K A;  3Q26 A;  3PPR A;  4X1B A;  1B3L A;  3U8Q A;  2RIN A;  1PBQ A;  4FIM A;  3EHT A;  5TP9 A;  4DE8 A;  3P7I A;  5AA2 A;  3TPA A;  4U1Z A;  2UVI A;  2X7P A;  4BDO A;  1USY E;  2Z8D A;  4XKQ A;  2QS3 A;  3OXN A;  3TTN A;  1USY H;  4NF8 B;  4QFO A;  1Z7M E;  5HBC A;  4NMY A;  3A09 A;  2I49 A;  3N5L A;  1TXF A;  2Y7R A;  3QUJ A;  5FHM A;  1MQI A;  5H8Q A;  4O3A A;  1NL5 A;  4QF9 A;  4H8I A;  1P1O A;  1N76 A;  3A3U A;  3FXU A;  4XKR A;  2XX7 A;  3MP1 A;  3H3G A;  3IOT A;  1A54 A;  2YPN A;  1Z7N E;  3KGC A;  1XT8 A;  4GOT A;  4JXI A;  2HZL A;  4QFN A;  4LQ5 A;  5K2X A;  3KFM A;  5AA2 B;  2PT1 A;  5H8N B;  3Q25 A;  5I59 B;  2QS4 A;  1JET A;  1PEB A;  1YAE A;  3MVZ A;  4ZEB A;  4XKN A;  4KPT A;  4PFW A;  3VE1 B;  1EZO A;  5CMC A;  3S2V A;  3TQL A;  1M5B A;  2NUV A;  3IO6 A;  4ZEI A;  3MVY A;  1TFD A;  4IO4 A;  4U2R A;  1B1X A;  2ZYO A;  3MP6 A;  3N94 A;  4LQ2 A;  4OEU A;  4NED A;  2A5T A;  4XXU A;  3RN8 A;  3FD3 A;  3VDF A;  3FV1 A;  3TTK A;  4FOR A;  5I58 A;  4IB2 A;  1NKX A;  2QL3 A;  4JSO A;  4R73 A;  1OLA A;  3VXB A;  3PD8 A;  4I8C A;  5L9O A;  5ITO A;  2P2A A;  2V25 A;  1A55 A;  3TCH A;  2THI A;  2E0S A;  3MBP A;  3OO8 A;  5AE4 A;  1IIT A;  1JNF A;  4GLI A;  4NF8 A;  3FVK A;  5BWJ A;  2O1M A;  4G8M A;  1MXZ A;  1B5I A;  4LUB A;  3IOU A;  1JEV A;  1PB8 A;  4YZZ A;  1FTO A;  4IO7 A;  4DXC A;  3A3C A;  4PQJ A;  4TLL B;  1HSL A;  3U72 A;  4F22 A;  2Q2A A;  1ZBM A;  3IJX B;  5I57 B;  4ELQ A;  2M8C A;  3M8U A;  1NNK A;  3PV0 E;  4MBP A;  1OIB A;  1MM7 A;  2Z22 A;  3CRB A;  4KCD A;  4F19 A;  1EZ9 A;  3MQ9 A;  5FHN A;  3O29 A;  3FZV A;  4BDR A;  2OBG A;  1H43 A;  3PUW E;  5I2K B;  3VXC A;  1O7T A;  3KG2 A;  4H6D A;  5H8N A;  2F7A A;  2HXW A;  3FJG A;  5DVI A;  3IB0 A;  1UIU A;  3ONM A;  2OK2 A;  3B6W A;  4FEB A;  3EHU A;  2HFB A;  5TPA B;  5I2K A;  2DOJ A;  2HAU A;  1Y4T A;  2XD3 A;  3PPO A;  2Q8J A;  3ZKL A;  4KYD A;  1Y3N A;  4R6K A;  3MJN A;  2B3F A;  4YAH X;  3T9U A;  2H98 A;  4KYS A;  4KYE A;  3S9M C;  2VOZ A;  5KDT B;  5M2V A;  4NF4 B;  1XHY A;  5I57 A;  4G77 A;  3SES A;  4EF2 A;  3IK6 B;  3L6H A;  5CBR A;  1AIV A;  3TMG A;  4O3C A;  4F3P A;  2DP8 A;  2F6P A;  2H4I A;  2I3W A;  3MWB A;  1RYO A;  4G8N A;  3R26 A;  2Z8E A;  4N6P A;  3GZG A;  1AMF A;  3G3J A;  3OEM A;  4OTE A;  4RNS A;  3TAJ A;  5KDT A;  1D9Y A;  4OMB A;  1LGB C;  4H67 A;  1FQA A;  1XVY A;  1QUL A;  3KN7 A;  4G4P A;  4U4X A;  4ZZA A;  2RF1 A;  2DWH A;  3G3G A;  1FQD A;  5CMK A;  1QJM A;  1VFE A;  1P1N A;  4AB5 A;  1QUI A;  3FGS A;  5HM4 B;  3G3I A;  1JVY A;  2HEU A;  1ATG A;  2A5S A;  5JK4 A;  3VLW A;  1FQB A;  1MXU A;  3VFJ A;  4PET A;  3V83 A;  4HCW A;  1TWY A;  4AB6 A;  3LUY A;  5ICQ A;  1B3F A;  2A5T B;  2ONK E;  5EYF A;  3RT6 B;  1HSE A;  1DPP A;  1II5 A;  3C36 A;  3KEI A;  3Q29 A;  3TEL A;  4BDL A;  1MDQ A;  1DMB A;  4C0R A;  1MQD A;  1SI1 A;  1MXX A;  2O7U A;  1N7X A;  1M5F A;  1Y3P A;  2QMW A;  4R72 A;  5H8S A;  3UN6 A;  3K00 A;  4DDD A;  4ESX A;  3R6U A;  2Y7I A;  5AA4 B;  1MPC A;  2ANJ A;  4GVO A;  3KJT A;  4P11 A;  3GLB A;  1B46 A;  2REG A;  4R6Y A;  3K0V A;  2F7C A;  2I0C A;  2P1S A;  3DP6 A;  1XC1 A;  3G7W A;  3CSG A;  2I0B A;  3KOT A;  4GD5 A;  5LOM A;  2YJP A;  3GBB A;  2VD3 A;  1IXI A;  3B6Q A;  3PPP A;  1B7H A;  1SBP A;  1D9V A;  4I1D A;  3VLV A;  5H8F A;  2F34 A;  3K2D A;  4MFI A;  3HST A;  4OEN A;  5A5X B;  4YB7 A;  2LAO A;  4XIG Q;  1WOD A;  4GFR A;  4E0X A;  4QSE A;  1MY3 A;  2IEE A;  3T9X B;  1Y3Q A;  4TOZ A;  2F97 A;  2H25 A;  4POX A;  2DQV A;  1B5J A;  2V3T A;  3KSJ A;  4U23 A;  3UIF A;  2ZXT A;  1PB7 A;  4KFQ A;  2E1S A;  5ICT A;  4GXA A;  3OEK A;  2GFE A;  4OXV A;  1IEJ A;  2CMO A;  1UQW A;  2ONS A;  1B4H A;  2DXY A;  3FIR A;  4WKM A;  4PFU A;  5AA2 D;  2I4C A;  1OQG A;  3N26 A;  5B7D A;  4K3F A;  2V93 A;  1D4N A;  1S7Y A;  4HS7 A;  1QVS A;  2GHA A;  1H3D A;  5JEI A;  4DXB A;  2DSF A;  1N3X A;  1OVT A;  4GL0 A;  1B4Z A;  1P1W A;  2F8D A;  3OOA A;  1R6Z A;  2DXR A;  1MH4 A;  1R9Q A;  5AA1 A;  3K01 A;  4R74 A;  3RGY A;  3SEW A;  3OEN A;  4YMB A;  3KBR A;  3VLU A;  1LB9 A;  1DSN A;  3DM0 A;  1QUJ A;  1BP5 A;  4XKP A;  1A8F A;  4NE4 A;  1I6B A;  2KLF A;  2I6E A;  2I48 A;  2XX9 A;  3OO6 A;  2F36 A;  4R75 A;  1GVC A;  5TP9 B;  2IA4 A;  1QKB A;  4OWD A;  1IIW A;  3FAS A;  1YPN A;  3L6G A;  3M3L A;  4GF8 A;  1BIY A;  1B3E A;  3G3K A;  2F5X A;  2R71 A;  3R7X A;  3TUS A;  1MY1 A;  2R6G E;  3VVD A;  3IOV A;  4QSC A;  3H06 B;  4YKK A;  4TQU Q;  3IL1 B;  3QUF A;  3H6V A;  1BKA A;  2RC8 A;  3FUZ A;  2XXI A;  3I6V A;  4POW A;  3C4M A;  5I58 B;  5F1Q A;  2DVC A;  3CI8 A;  1I6Q A;  2OCU A;  4OYV A;  2B65 A;  2O68 A;  4ECF A;  2XXT A;  3ODB A;  5I2N A;  1H45 A;  1IZ1 A;  2DYX A;  1LST A;  2F35 A;  4Z0I A;  5JTY A;  1VSO A;  4IGT A;  1LAH E;  3RUM A;  3TZA A;  5I59 A;  5CMB A;  4R9F A;  1US5 A;  4JWX A;  4KHZ E;  3TEP A;  2GHB A;  1ZIU A;  3TFL A;  4FED A;  2UYE A;  4Q8R A;  4OZ9 A;  2QS1 A;  2G93 A;  3D4C A;  1B1H A;  2XXW A;  2ZNT A;  3B6T A;  4RPO A;  2Q89 A;  4F1Y A;  1AOV A;  5B70 A;  3RTF B;  2ZMB A;  1CB6 A;  1FTJ A;  1SW4 A;  3KN3 A;  5DVF A;  1M5E A;  2QMX A;  2QRY A;  3IB2 A;  4F3S A;  3QIM A;  3KN8 A;  1MRP A;  1WVJ A;  3IOR A;  2V3Q A;  3HHG A;  4RK9 A;  4NWD A;  1B6H A;  1SI0 A;  4LA9 A;  4Z7E A;  1A99 A;  4YKP A;  4F39 A;  3U1O A;  4LZ7 A;  3HCQ A;  3M3F A;  1B3G A;  4M4G A;  5DT6 A;  4ELR A;  4YMA A;  1Y1M A;  1SQY A;  2XXP A;  5I56 A;  3ECR A;  3PGF A;  4OFJ A;  1TT1 A;  3FXQ A;  3PUY E;  4NF5 B;  3C9H A;  3FAT A;  3W9V A;  1IQ7 A;  3IAZ A;  1MXY A;  4IY5 A;  4ELO A;  1A8E A;  3VVE A;  2OWS A;  5ISU A;  1B40 A;  3EN3 A;  3K6X A;  3MZ1 A;  4WXJ A;  4QFP A;  5FHO A;  3T96 B;  4Q0C A;  2REJ A;  3HPI A;  1YCJ A;  4X1D A;  3UP9 A;  1PC3 A;  2I58 A;  2O84 X;  4F1U A;  2Y7W A;  3MW0 A;  4RPN A;  1MQJ A;  3MUQ A;  1KWH A;  1UTH A;  2PT2 A;  3E4R A;  3PMX A;  4ZEF A;  4GRK A;  3V5A A;  1Y4C A;  2NOO A;  4E0W A;  1SW2 A;  3FVN A;  4F2Q A;  4DIG A;  3DP8 A;  4OVJ A;  3H4Z A;  1D3K A;  1MY0 A;  3JZJ A;  4U21 A;  5ITP A;  4BLA A;  4AQ4 A;  2I3V A;  3Q27 A;  4WEP A;  4F29 A;  1IUD A;  5AA3 A;  3ZS6 A;  5KCJ A;  2AIX A;  5EHM A;  3F11 A;  4ZEC A;  3FJ7 A;  2VHA A;  4DCX A;  4TLM B;  4ZED A;  3EPE A;  5HPQ A;  2RCA A;  3G3F A;  4F31 B;  1WDN A;  1P1U A;  4U22 A;  1O63 A;  4IO2 A;  1B2H A;  1OQH A;  1NH7 A;  3QSL A;  1O64 A;  2CZL A;  1CE2 A;  4U1O A;  4KCC A;  5K2Y A;  1N7W A;  1US4 A;  2P0S A;  3CFL A;  5EHS A;  3MZB A;  1ANF A;  4GXS B;  1B5H A;  2F6G A;  4KQP A;  1QUK A;  1ZTY A;  3VVF A;  2FA7 A;  2O1L A;  4EQB A;  2UYF A;  3KJ7 A;  1NFT A;  1Q1K A;  3PUZ E;  2X7Q A;  1OMP A;  2QSX A;  4EF1 A;  1B7Z A;  1Q35 A;  3N6T A;  3IB1 A;  4C1U A;  4G8H A;  3OMB A;  4EUO A;  5L9S A;  1MXW A;  1ZMG A;  4ZE9 A;  1J1N A;  3PPQ A;  4OHN A;  3Q28 A;  1AH5 A;  2DWI A;  2XXY A;  3MVW A;  2WKY A;  2DE2 A;  4WED A;  1DTZ A;  3T22 A;  4G2Z A;  4OQO A;  3AXF A;  3E13 X;  4YKI A;  1GGG A;  3H6U A;  4DXU A;  4LP2 B;  2Y7P A;  1GTK A;  4C1T A;  3DEL B;  1FQE A;  3IOW A;  4ZZE A;  3PUV E;  4M1V A;  3JV9 A;  3EF7 A;  3O28 A;  4I9D A;  4ONY A;  2O7I A;  5BUU A;  2GH9 A;  3OSQ A;  2ZYM A;  2NXO A;  2X26 A;  3K6W A;  3PU5 A;  3HO7 A;  1UTB B;  2DE3 A;  3H03 A;  4OFO A;  4OFL A;  3TTL A;  1LFI A;  3H7M A;  1F9B A;  1JW4 A;  2ZYN A;  5ELV A;  5DEX A;  3K1N A;  2W7Y A;  4MLV A;  4ZDM A;  3JYR A;  1SYI A;  3LSW A;  1B0H A;  1BTJ A;  1UIV A;  4NF6 A;  3H6W A;  3I3V A;  2UXA A;  4RA1 A;  5H8H A;  1MQH A;  2H99 A;  2HCA A;  4F2O A;  3ZKK A;  1SD3 A;  3GBA A;  1MPD A;  2XXU A;  4GQO A;  3LSL A;  3G3H A;  3OSR A;  3S9E A;  2PBW A;  2Q9T A;  3IO4 A;  2AYS A;  4G68 B;  4ELP A;  2Z23 A;  1IXC A;  3E9X A;  2B3B A;  3DLN A;  2ABH A;  3RY3 A;  3THI A;  4NWC A;  1MG1 A;  4IO5 A;  1B9J A;  5DVJ A;  1FCK A;  3CR9 A;  1A7L A;  3MPL A;  1R9L A;  1OLC A;  1DOT A;  3IX1 A;  4N07 A;  4QFK A;  1PDA A;  1FQC A;  1NMU A;  1YTV A;  3W9W A;  4PP0 A;  2VD2 A;  3MZ9 A;  3QK6 A;  1VFD A;  1P1Q A;  4JDF A;  1B58 A;  4LON B;  1FW0 A;  3U93 A;  4ISU A;  2F7B A;  1PB9 A;  3CG1 A;  1LFG A;  3O9P A;  2XHD A;  4UA8 A;  4G68 A;  2V84 A;  1MH3 A;  1MQG A;  3LBS A;  4NF5 A;  5IKB A;  1NNP A;  2PVU A;  3IR1 A;  3HN0 A;  4KI0 E;  4O3B A;  2VGQ A;  3LSX A;  2YLN A;  5FTH A;  3SER A;  2ONR A;  2XXQ A;  2AL4 A;  4LZ8 A;  3PMV A;  1LAF E;  1H76 A;  2VP1 A;  2RKM A;  3O97 A;  1GR2 A;  4BDQ A;  4BDN A;  3C34 A;  3BKI B;  1XS5 A;  3SET A;  2R9J A;  1EZP A;  3PUX E;  1LBB A;  1EU8 A;  1DTG A;  3BFT A;  3BBR A;  1OVB A;  1SVX B;  1MXV A;  3LR1 A;  4FEC A;  1MM6 A;  4LZ5 A;  3K1M A;  3K6V A;  5L8D A;  3RNN A;  4NTL A;  3SEU A;  2V3U A;  1HSJ A;  4ZE8 A;  1FTL A;  2RC9 A;  3K02 A;  3RLF E;  1JW1 A;  1LB8 A;  4FAJ A;  3RTW B;  3B7D A;  1EH3 A;  3CSB A;  4ZEK A;  3UGW A;  4U4S A;  4IGR A;  4F1V A;  4OES A;  5CM6 A;  2PMS A;  1B32 A;  4EQ9 A;  3O2A A;  3ILU B;  4OEV A;  1B05 A;  4FAT A;  1L5T A;  1VR5 A;  3UK4 A;  2XXX A;  4PFT A;  3CFZ A;  4R6H A;  1JEU A;  1H44 A;  4OER A;  3RQT A;  1DPE A;  3RPW A;  1QKA A;  2DE4 A;  2DWA A;  3E3K A;  4NF6 B;  3O6H A;  4JBZ A;  1SW5 A;  1FQF A;  2DWJ A;  3M3K A;  1LBC A;  2NVU B;  3TCF A;  3TKD A;  3QAX A;  5DEX B;  1NNT A;  3T66 A;  3ZSF A;  1MS7 A;  4H0W A;  2H5Y A;  2PYY A;  5CMM A;  2G29 A;  4ESW A;  4XTC Q;  1JW5 A;  1MPB A;  5CC2 A;  3ILT B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...