2OWSA

Crystal structure of bordetella pertussis holo ferric binding protein bound with two synergistic oxalate anions
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
318
structure length
314
Chain Sequence
DEVSLYTTREPKLIQPLLDAFAKDSGIKVNTVFVKDGLLERVRAEGDKSPADVLMTVDIGNLIDLVNGGVTQKIQSQTLDSVVPANLRGAEGSWYALSLRDRVLYVEKDLKLDSFRYGDLADPKWKGKVCIRSGQHPYNTALVAAMIAHDGAEATEKWLRGVKANLARKAAGGDRDVARDILGGICDIGLANAYYVGHMKNAEPGTDARKWGDAIKVVRPTFAGGTHVNISGAAVAAHAPNKANAVKLLEYLVSEPAQTLYAQANYEYPVRAGVKLDAVVASFGPLKVDTLPVAEIAKYRKQASELVDKVGFDN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative iron binding protein
publication title Anion-dependent hinge motion in ferric binding proteins
rcsb
source organism Bordetella pertussis tohama i
molecule tags Metal binding protein
total genus 110
structure length 314
sequence length 318
ec nomenclature
pdb deposition date 2007-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13343 SBP_bac_6 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2owsA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2owsA02
1ZBMA 4NE4A 1Y4TA 4RPOA 2XX7A 2OCUA 1QKBA 1IXIA 5BWJA 3OD7A 3ZKKA 3LSLA 1OMPA 5KDTB 1I6AA 2UYEA 3O6GA 1ATGA 1Z7ME 3I6VA 4OETA 1I6QA 4G8NA 3FIRA 3OEKA 3UK4A 1M5EA 5I59A 4BLAA 4O3CA 4JBZA 4RA1A 2GRVA 1AIVA 3KSJA 5I56A 1N0TA 4TLMB 4IO4A 1BP5A 3LR1A 5H8FA 3SEXA 2I0CA 5IKBA 2A5SA 3UA8A 2OZZA 5TP9A 4R2BA 5H8QA 1USYE 4F1UA 3K2DA 3FXRA 3C32A 1US5A 4GXAA 3P7IA 1QVSA 1B0HA 3KG2A 1LAHE 4RXLA 2XXYA 3G3GA 1B3GA 5FTHA 3RLFE 4G8HA 3MVYA 3QIMA 4HTGA 4NWCA 1SW1A 4WXJA 3N6TA 1IIWA 4ELQA 4KCDA 1MS7A 2PYYA 3KEIA 5DVIA 1EZOA 3TQWA 2THIA 3B6TA 1A40A 4LATA 1H3DA 1MQDA 1POY1 5H8HA 4BDRA 4YB6A 3AXFA 1Y4CA 3G3KA 4TLLB 1FQDA 3VLWA 5CM6A 2D5WA 3B7DA 4H5FA 3OOAA 2F78A 1SI1A 1BIYA 1B5JA 3RTFB 4K3FA 4Q5TA 2RC8A 1N7WA 3IAZA 1JNFA 4XKQA 5I59B 2R9JA 3CVGA 2UVGA 5I56B 4R2FA 4G4PA 1IXHA 3CSGA 3DP8A 2Y7WA 1LFHA 1A99A 3OMBA 4QHQA 3TELA 4XKRA 3EHSA 5L8DA 2GH9A 1MH4A 3O66A 1SDXA 3PD8A 4H0WA 3U72A 5TP9B 1B0LA 3BFTA 2ALUA 4F3PA 4LONB 1B40A 2ZNTA 4PQJA 3CSBA 3S9MC 1PB9A 5K2XA 3U1OA 1FCKA 3O29A 1JVYA 5CMBA 1QULA 4PP0A 3A3UA 4OEVA 4GOTA 2IEEA 5A5XA 5ISUA 4BDOA 3U8QA 5CMMA 4L17A 1ELJA 3O6IA 5H8HB 4QRZA 2XXUA 1UQWA 4YKKA 1RYOA 4C0RA 3MZ9A 1MXZA 4KYEA 4N6PA 1QUIA 3DP4A 4RPNA 4IO2A 2PT1A 3K6VA 4FEDA 4EQ7A 5JEIA 1SW2A 4JWYA 3FD3A 5L9SA 3KGCA 4F3BA 2O1LA 2FYIA 3TZAA 1WVJA 1DPPA 2QJEA 2DWHA 2VOZA 2XXPA 1M5CA 3VE1B 2G93A 1URDA 3CIJA 2V3TA 3G3JA 3VXBA 3FV2A 4DXBA 3IOTA 3TTRA 3MP6A 3QXMA 1B7HA 3S9LC 3H6UA 5I2NA 1MQIA 4Z7EA 1MDQA 4JB7A 2AIXA 1YCJA 2NWJA 2QRYA 1B4ZA 2XXHA 4HCYA 4YU0A 1LFIA 2DXYA 2Q89A 3Q29A 4KR5A 5A5XB 1JW4A 3MVXA 1DOTA 1YPNA 4POXA 3EPEA 3C36A 2DQVA 2I3VA 2LAOA 3LSFB 1QJMA 2D21A 3RY3A 2XXIA 1OIBA 1MG1A 3O28A 3ONMA 5BUUA 3T9VA 1B58A 3G3IA 4GQOA 2NUVA 4E0WA 1B52A 3C4MA 2Y84A 1F9BA 3ILUB 1O63A 3LBSA 2X7PA 3T9HB 3IJOB 4XKNA 3OENA 1ANFA 3DM0A 1Q1KA 3UGWA 4ZECA 4X48A 2V84A 1N76A 3D4GA 1N3WA 3FVOA 4PFTA 3FZVA 1TT1A 1D3KA 1LSTA 1XC1A 2HQ0A 1B32A 2YLNA 3EHTA 5LOMA 1IITA 4GRKA 4KFQA 4U4SA 5F7VA 1LCTA 1D9YA 1QKAA 1SI0A 1OLCA 1M5DA 3TUSA 2OJTA 3FV1A 2NVUB 1KWHA 5I2NB 4LUBA 1CE2A 4JXIA 4I1DA 2DYXA 1N84A 4HW8A 5CI5A 3Q27A 3DELB 3SEUA 1NNPA 3HHFA 3CI8A 3MAMA 4YKJA 4TOZA 3K1NA 4IO7A 3H6TA 2X7QA 4EQBA 3WAEA 1NKXA 1R9QA 1FTOA 1RYXA 4OWDA 3PMXA 2CMOA 4XIGQ 4JSDA 1LAXA 1UIUA 1MY3A 3KFMA 5KZTA 3OSQA 1SW5A 3PUXE 1GTKA 4F3SA 3K6WA 3RUMA 3SEYA 2I3WA 4FAJA 1SD3A 1PDAA 1XVXA 4GL0A 3Q25A 3T9XB 1DPEA 2VD3A 1CB6A 4XKPA 1JETA 4BDQA 1P1NA 1TWYA 2HCAA 1R6ZA 4I62A 1SW4A 3CG3A 4NEDA 1FQEA 2I6EA 4P0IA 1FQBA 4MLQA 3ILTB 4ZEBA 1H45A 3MZBA 2H25A 4DXCA 3MBPA 2DWJA 2OWSA 3HN0A 1SVXB 1ZKBA 1Y1ZA 2F35A 4JSOA 3I3VA 5HBCA 4ESWA 4AQ4A 1O7TA 3PD9A 1LLSA 5EHSA 5FHMA 2ANJA 3JYRA 4QSCA 5FHNA 3W9WA 3QK6A 2HXWA 3OELA 3E4RA 1EZPA 2ZNSA 4YB7A 5I57A 2Y7PA 4THIA 1TFAA 3FATA 1LFGA 1MPCA 3FXUA 2Z23A 1MY1A 4ZE9A 4KQPA 3FVNA 4OQOA 1VFEA 2VHAA 4M4GA 3OO9A 3BKIB 2DE4A 3RQTA 2HAUA 1ZU0A 4NF4A 2HZLA 2NOOA 3QSLA 3OEMA 1EU8A 3VXCA 3KJTA 3MP8A 1J1NA 4IY6A 4QFKA 2GHBA 1MDP1 3TFLA 1M5BA 3MQ9A 1IXCA 4UA8A 4OTEA 1ZIUA 2F7AA 1P1OA 2REGA 2XX8A 3MJNA 5J1DA 4G8MA 4X1DA 3JV9A 5EYFA 1Y3PA 1D9VA 5AA1A 1M5FA 3PPQA 1URSA 3S9NC 4RYAA 4KHZE 5EHMA 4R72A 2ZYKA 1MY4A 4IO6A 4R73A 3TDJA 3TEPA 1SQYA 1UTBA 4NF5A 2ZXTA 4R9FA 1DTGA 4X1BA 1SYHA 3IJXB 1JQFA 5ICQA 3MP1A 1A7LA 1ZTYA 1URGA 2RCAA 2VGQA 1VFDA 1UTHA 1HSLA 5ITPA 3O97A 5I57B 3IO6A 4F2OA 2H9BA 1PC3A 3LSWA 3ZS6A 3S9EA 4Z0IA 5TU0A 4IO5A 1H76A 4H65A 4GFRA 4FE8A 5DT6A 3A3CA 3K1PA 3RNNA 1MRPA 4NF4B 1MXVA 4O3AA 4N13A 3HPIA 5H8FB 3LC8A 3TCHA 3N26A 1FW0A 1XVYA 4ONYA 1BTJA 3H06B 2ZYOA 5AA3A 5KCJA 4ELOA 4QSEA 4ISUA 3GBAA 5H8QB 4G2ZA 4GVOA 3C35A 4IO3A 1MQJA 3UORA 1B9JA 2XXRA 3QUJA 2Z8FA 3VLVA 4GWOA 2ONSA 2AL5A 1TFDA 2HAVA 4O3BA 5DEXA 3R7XA 3TMGA 3VVFA 4AB6A 1UTBB 1B3HA 1II5A 4DXUA 3VLUA 4NF6A 4R74A 4LZ5A 2PBWA 3H7MA 2I4BA 3W9VA 1AL3A 3MVWA 1XHYA 1UTHB 3CR9A 5DVJA 3G3HA 3T22A 1LB9A 2KLFA 2Z22A 2V3UA 3EF7A 4G68C 1ZMGA 1LAGE 1B1XA 5B70A 3M3LA 5H8NA 1EZ9A 2BJJX 4PFYA 1IEJA 4GLIA 4MFIA 1A8EA 2HEUA 4KI0E 2RINA 4HCWA 5TPAA 3KOSA 2O7IA 3SDFA 5AA2A 5I58A 1LCFA 3E9XA 5KCJB 2Q9TA 4OERA 3KN7A 3FJMA 4E0XA 4DCXA 4MF3A 3MC2A 2F5XA 1A8FA 2ONRA 4IGRA 1B6HA 2ABHA 1B7UA 3MZ1A 2ZMBA 3A09A 1H44A 4RNSA 1MXXA 4QFOA 4OFLA 3V8XB 1A54A 4JWOA 4M1VA 5CRYA 2H4IA 5ICTA 4U22A 3HO7A 4Q8RA 5DEXB 2Q8JA 2QSXA 5JK4A 4F31B 4NF6B 2DSFA 2X26A 3KN8A 4LQ2A 3S2VA 1OLAA 2B65A 4DE8A 1MH3A 2OBGA 4NWDA 5CBSA 1ZJLA 3SKPA 4ZZEA 2AYSA 3PGFA 4KCCA 2PX1A 5H8SA 3THIA 1LBBA 4FECA 4OEUA 4U1ZA 4NTLA 1B51A 3HV1A 3SEWA 4FJPA 4ZDMA 1MXUA 2O6AA 1EH3A 2QS3A 3HCQA 3PUVE 1DSNA 1LBCA 4U2RA 1XS5A 2QS4A 3K4UA 4F1VA 5TPAB 2Y7KA 3VV5A 4C1TA 2P1SA 5AA2B 5I58B 4U23A 2O51A 3IOWA 2VP1A 3HSTA 4GL8A 3C31A 3M3KA 3MW0A 2GFEA 1VSOA 4AB5A 5I84A 4F22A 4PETA 1QUJA 4BDMA 4OFJA 2P2AA 1N7XA 5CBRA 1VE4A 3C34A 2FA7A 4GD5A 1TXFA 1IZ1A 2F7CA 1NH8A 2H5YA 3N94A 2UXAA 3U94A 1PB7A 3N5LA 3OXNA 1FTLA 3PV0E 1NNKA 4QFPA 1MQGA 5I2KA 5FHOA 4ESXA 4H8JA 1B5IA 4ND9A 3OO8A 2XXXA 1N3XA 3ZKLA 4R9GA 3FASA 3G7WA 4QSDA 2DWIA 3ECRA 1JEUA 3TYHA 5AA2D 4EQ9A 1P1UA 2DP8A 3Q26A 2W7YA 1MXWA 4LZ7A 1IQ7A 3BBRA 2Z8EA 1AH5A 3TKDA 4ZEDA 4EXLA 3UP9A 4H8IA 1D4NA 3T93B 3ZSFA 2O68A 3B6WA 2ZYNA 3H3GA 1H43A 2I4CA 3L6GA 3KSXA 4KYDA 3FXQA 4LQ5A 1I6BA 3TTLA 3R26A 2RF1A 4PFUA 4U21A 5CMCA 3PPOA 3WAFA 2RC9A 2DOJA 1NH7A 2XD3A 2E1SA 2F36A 3G3FA 3EN3A 5CC2A 5L9OA 2A5TA 1DTZA 1B3EA 2ZNUA 4KPTA 4F39A 3M8UA 3IB0A 4OZ9A 1Q35A 4NMYA 2QPQA 1BLFA 2G29A 1JVXA 4R75A 1OQHA 2DXRA 4DLDA 3K02A 3GXAA 2Y7RA 1B05A 3IL1B 5I2KB 3I5OA 3V89B 2I0BA 3UN6A 3EQ1A 1P1QA 3E3KA 3KJ7A 1S50A 3FGSA 4ELRA 2AL4A 3KOTA 1FTMA 3MPKA 2YJPA 2REJA 4Q0CA 3TPAA 3V5AA 4OXVA 2ZYMA 1T0KA 3C33A 3U93A 5DYHA 3FUZA 3QAXA 4EF1A 3PPNA 2Q2CA 1MM7A 3R6UA 4LA9A 1VR5A 3H4ZA 3GBBA 2QMXA 3SEVA 1WDNA 1NL5A 4R6YA 4PE5B 1O64A 1USYH 2XXQA 3FJGA 2PMSA 2NXOA 4OVJA 3RT8A 4ZEKA 3TCFA 1B4HA 3PMVA 4P0GA 2Y7IA 4FIMA 3VDFA 3MPLA 3FVKA 4YICA 1S9TA 1MY0A 5F1QA 3K00A 1LGBC 2Q2AA 3OO6A 4OHNA 2WKYA 3K01A 2A5TB 4ZS9A 4WEPA 4GF8A 3TODA 1FTJA 3TTKA 1IXGA 3DLNA 4H5GA 3IOUA 3F11A 5DVFA 2Z8DA 4FORA 4YKIA 1B2HA 2O1MA 1FTKA 3JZJA 4C1UA 4YMBA 2O84X 3PMWA 1JW5A 3H6WA 3OSRA 1Y3NA 4H67A 1ZLQA 3TAJA 4OENA 4F19A 3TQLA 1B3LA 1WODA 3E13X 4PFWA 3O9PA 1Z7NE 1LB8A 1R9LA 3GZGA 4OESA 3CG1A 4EXKA 3PU5A 1OVBA 4XXUA 1Y3QA 3FJ7A 2PT2A 1FQCA 2OK2A 2M8CA 4EUOA 4RK2A 4ZZAA 3PUYE 4OYVA 2ESNA 2HFBA 3PUZE 2QS1A 2XXTA 3VVDA 4I9DA 4ZEIA 3PPPA 4TQUQ 4UACA 1PBQA 2V25A 5ITOA 1B46A 4RK9A 5IAIA 4BDLA 4X9TA 2RCBA 1B1HA 3IORA 4MBPA 2XXWA 3TCGA 3CRBA 3IOVA 3IB1A 4LVQA 5JTYA 2CZLA 4DDDA 5HPQA 1QW0A 1Y20A 1XOCA 4Q30B 2ONKE 3IX1A 2QMWA 2I48A 2DVCA 1SBPA 4U1OA 3KBRA 3T66A 4LP2B 2I58A 4NF5B 2R71A 5FTIA 3SETA 3MVZA 3S4UA 2DVZA 1OVTA 2F8DA 1JW1A 3RTWB 1PB8A 3H03A 1UIVA 3SERA 4I8CA 4YMAA 1XT8A 3RGYA 2V3QA 1SYIA 2RC7A 1AOVA 3Q28A 1NNFA 3HHGA 5M2VA 1RKMA 5B7DA 3CFXA 2QS2A 4QFLA 1IUDA 4F3GA 1FQFA 3BFUA 3O2AA 2YPNA 4IGTA 1OQGA 4ELPA 2O7UA 4MLVA 3QUFA 3PUWE 1PEBA 2D3IA 1AMFA 1HSJA 5ELVA 2F6PA 5JTYB 3KZGA 1MPBA 4POWA 3FVGA 2XX9A 3RPWA 4WKMA 1QUKA 3VFJA 4IB2A 4DCYA 3IK6B 5HM4B 2R6GE 2V93A 4JDFA 3D4CA 3TTNA 1MQHA 4P11A 4BDNA 3K6XA 2DE2A 1GGGA 4JWXA 1DMBA 2DE3A 3K1MA 1LAFE 1NMUA 5K2YA 2UYFA 1JEVA 5L9MA 1GV8A 1MXYA 1YAEA 2H99A 2F6GA 4DZ1A 1B5HA 2I49A 4OMBA 3B6QA 3GLBA 4YZZA 4R6KA 4ZEFA 3MWBA 5H8NB 5CMKA 2F34A 4MH5A 3K6UA 3C9HA 2Q88A 3OO7A 4H6DA 3T96B 3M3FA 1Y9UA 4YKPA 4NF8A 4XTCQ 1A55A 1S7YA 2P0SA 1GVCA 2E0SA 3IB2A 2FNCA 3V83A 4ZE8A 2O69A 1MPDA 2PVUA 5AA4A 1P1WA 4F29A 2IA4A 3N6UA 3VVEA 3SESA 4KYSA 2QL3A 2B3FA 1P99A 3CFLA 3K0VA 3KN3A 4RY1A 1B7ZA 4F18A 1PBPA 3EHUA 4G68A 3QYTA 3LUYA 4N07A 3RT6B 4F2QA 3TTMA 4FATA 2UVIA 4R6HA 3MUQA 3W15C 4G77A 2DS9A 4F1YA 3ODBA 2F7BA 2DWAA 2OLBA 2F97A 2XD2A 2UVHA 4YAHX 3U92A 3RN8A 4EDPA 1YTVA 2RKMA 5DTBA 4H1XA 4LZ8A 1GR2A 4FEBA 4OFOA 1NFTA 2VD2A 5KDTA 1NNTA 1B3FA 4GXSB 1I69A 2XXVA 4ECFA 4U4XA 4QFNA 4YB5A 4NF8B 3UIFA 3CFZA 2GHAA 1MM6A 3T9UA 1US4A 4RJZA 3L6HA 5AA4B 4KD5A 4QF9A 3IR1A 4WEDA 1BKAA 3LSXA 4GIZA 2XHDA 3H6VA 4HS7A 1R1NA 4G68B 1HSEA 2OWTA 3IO4A 3USDA 1N04A 3DP6A 5AE4A 2B3BA 1L5TA 2UVJA 1FQAA 3O6HA 3PPRA 2HZKA 1POTA 1Y1MA 4IY5A 2H98A 1MY2A 4DIGA 4EF2A
chains in the Genus database with same CATH superfamily
1ZBMA 4NE4A 1Y4TA 4RPOA 2XX7A 2PFZA 2OCUA 1QKBA 1IXIA 5BWJA 1LBZA 3OD7A 3ZKKA 3LSLA 1OMPA 5KDTB 1I6AA 2UYEA 3O6GA 1ATGA 1Z7ME 3ISPA 3I6VA 4I40A 4OETA 1I6QA 4G8NA 3FIRA 3OEKA 3E79A 3UK4A 1M5EA 4MNIA 2FVZA 5I59A 4BLAA 4O3CA 4JBZA 4RA1A 2GRVA 1AIVA 3KSJA 5I56A 1N0TA 4PFIA 1JP4A 4TLMB 4NG7A 4GBWA 4IO4A 1BP5A 3LR1A 4GWZA 5H8FA 3SEXA 2I0CA 5IKBA 2A5SA 1FBDA 4O8MA 1SPIA 3UA8A 2OZZA 3U65A 1AWBA 5TP9A 4R2BA 5H8QA 2FIXA 1USYE 4F1UA 3K2DA 5EQ8A 3FXRA 3C32A 1US5A 4GXAA 3NOHA 4PF6A 3P7IA 1QVSA 1B0HA 3KG2A 1LAHE 4RXLA 2XXYA 1DCUA 2HHMA 3G3GA 1B3GA 5FTHA 3RLFE 4G8HA 3MVYA 3QIMA 4HTGA 4NWCA 1SW1A 4WXJA 2VPOA 3N6TA 1IIWA 4ELQA 4KCDA 2XWOA 1MS7A 2PYYA 3KEIA 5DVIA 1EZOA 4PAFA 3TQWA 4OANA 2THIA 3B6TA 1A40A 4OVPA 4LATA 1H3DA 1MQDA 1POY1 1RDZA 5H8HA 4BDRA 4YB6A 3AXFA 1Y4CA 3QMFA 4GWWA 3G3KA 4TLLB 1FQDA 3VLWA 1NV3A 5CM6A 2FBPA 2D5WA 3B7DA 4H5FA 3OOAA 2F78A 5I3SA 1SI1A 1BIYA 1B5JA 3RTFB 4K3FA 4Q5TA 2RC8A 1N7WA 3IAZA 1JNFA 5LTCA 3KBZA 4XKQA 5I59B 2R9JA 3CVGA 2UVGA 5I56B 4R2FA 4G4PA 1IXHA 3CSGA 3DP8A 2Y7WA 1LFHA 1A99A 3OMBA 4QHQA 3TELA 4XKRA 3EHSA 5L8DA 2GH9A 2VT5A 3PTYA 1MH4A 3E78A 3O66A 1SDXA 3PD8A 1LBWA 4H0WA 4P47A 3U72A 5TP9B 3RPLA 1B0LA 3BFTA 2ALUA 4F3PA 4LONB 2DDKA 1NV0A 1B40A 4N17A 3EKIA 2ZNTA 4HE1A 4PQJA 1D9QA 3CSBA 3S9MC 1PB9A 4GWUA 1FRPA 5K2XA 3U1OA 3CHGA 1FCKA 3O29A 1JVYA 4MIJA 1QULA 5CMBA 4PP0A 3A3UA 4OEVA 4GOTA 2IEEA 5A5XA 5ISUA 1IMDA 5IZ3A 4BDOA 3U8QA 4MMPA 5CMMA 4L17A 1ELJA 1FPKA 3O6IA 5H8HB 4QRZA 2XXUA 4O7MA 3FXBA 1UQWA 4YKKA 1RYOA 4C0RA 3MZ9A 1MXZA 4KYEA 1K9ZA 4N6PA 1FPBA 1QUIA 3DP4A 4RPNA 2MKZA 4IO2A 2PT1A 3K6VA 4FEDA 4PGNA 4EQ7A 5JEIA 1SW2A 3LV0A 4JWYA 3FD3A 4DI4B 5L9SA 3KGCA 4F3BA 1DK4A 2O1LA 2FYIA 2XWKA 3TZAA 1WVJA 1DPPA 2QJEA 2DWHA 2VOZA 2ZZXA 2XXPA 1M5CA 3VE1B 2F3BA 2G93A 1URDA 3CIJA 3RPLB 4O94A 2QVRA 2V3TA 3G3JA 3VXBA 3FV2A 5F24A 1LEVA 4DXBA 3IOTA 3TTRA 3MP6A 3QXMA 1B7HA 3S9LC 4G61A 3H6UA 5I2NA 1MQIA 4Z7EA 1MDQA 4JB7A 4GBVA 2AIXA 1YCJA 2NWJA 4XFEA 2QRYA 1B4ZA 5DW8A 2XXHA 4HCYA 4YU0A 1LFIA 2DXYA 2Q89A 3Q29A 4KR5A 5A5XB 4PFRA 5IZ3B 1JW4A 3MVXA 1DOTA 1YPNA 4POXA 1IMAA 3EPEA 3C36A 2DQVA 2I3VA 2LAOA 3LSFB 1QJMA 2D21A 3RY3A 2XXIA 1OIBA 1MG1A 3O28A 3ONMA 5BUUA 3T9VA 1B58A 3G3IA 4GQOA 2NUVA 4E0WA 1B52A 2QFLA 1IMCA 3C4MA 2Y84A 2B4LA 1F9BA 3ILUB 1O63A 3LBSA 2X7PA 3T9HB 3FBPA 3IJOB 4XKNA 3OENA 1ANFA 3DM0A 1Q1KA 3UGWA 4ZECA 4X48A 2V84A 1N76A 4PFBA 3D4GA 1N3WA 3FVOA 4PFTA 3FZVA 1TT1A 1D3KA 1LSTA 1XC1A 2HQ0A 1B32A 2YLNA 3EHTA 5LOMA 1IITA 4GRKA 4KFQA 4U4SA 1FBEA 5F7VA 1LCTA 1D9YA 1EYKA 1QKAA 1SI0A 2ZZWA 1OLCA 1M5DA 1XI6A 3TUSA 2OJTA 3FV1A 2NVUB 1KWHA 5I2NB 4LUBA 4AS4A 1CE2A 4JXIA 4I1DA 3MYUA 1INPA 2DYXA 1N84A 2BJIA 2CZKA 4HW8A 1FJ9A 5CI5A 3Q27A 3DELB 3SEUA 1NNPA 3HHFA 3CI8A 2XWVA 3MAMA 4YKJA 4TOZA 4UABA 3K1NA 4IO7A 4GX6A 3H6TA 2X7QA 4EQBA 3WAEA 1NKXA 1R9QA 1FTOA 1KA1A 1RYXA 4JVDA 4OWDA 3PMXA 2CMOA 4XIGQ 4JSDA 1LAXA 1UIUA 1MY3A 3KFMA 5KZTA 4P56A 3OSQA 4I3YA 1SW5A 3PUXE 5J16A 1GTKA 4F3SA 3K6WA 3RUMA 3SEYA 2I3WA 4FAJA 1SD3A 1YYZA 2ZZVA 1PDAA 1XVXA 4GL0A 1YXIA 3Q25A 3T9XB 1DPEA 2VD3A 1CB6A 4OVQA 4XKPA 1JETA 4BDQA 1P1NA 1TWYA 2HCAA 3KC0A 1R6ZA 4I62A 1SW4A 3CG3A 4NEDA 1FQEA 2I6EA 4P0IA 5IM2A 1FQBA 4MLQA 3MSTA 4GX4A 3ILTB 4ZEBA 1H45A 3MZBA 2H25A 4DXCA 3MBPA 2DWJA 2OWSA 3HN0A 1SVXB 1ZKBA 4NQ8A 1Y1ZA 2F35A 4JSOA 2GQ1A 3I3VA 5HBCA 3KC1A 4ESWA 2KQZA 4AQ4A 1O7TA 3PD9A 1LLSA 5EHSA 4N8YA 5FHMA 1EYJA 2ANJA 3JYRA 4QSCA 5EQ9A 5FHNA 3W9WA 3QK6A 2HXWA 3OELA 3E4RA 1EZPA 2ZNSA 1LBXA 4YB7A 5I57A 2Y7PA 4THIA 1TFAA 3FATA 1LFGA 1MPCA 3FXUA 2JJKA 2Z23A 1MY1A 4ZE9A 4KQPA 3FVNA 4OQOA 1NV7A 4MX6A 1VFEA 2VHAA 4M4GA 3OO9A 3BKIB 2OX3A 2DE4A 3RQTA 2HAUA 1ZU0A 4NF4A 2HZLA 2Q74A 2NOOA 3QSLA 3OEMA 1EU8A 3VXCA 3KJTA 3MP8A 1J1NA 4IY6A 4QFKA 2GHBA 1MDP1 3TFLA 1M5BA 3MQ9A 5EQAA 1RDYA 1IXCA 4UA8A 4OTEA 1ZIUA 4MHFA 2F7AA 1P1OA 2REGA 2XX8A 3MJNA 5J1DA 4G8MA 4X1DA 2B4MA 3JV9A 5EYFA 1Y3PA 1D9VA 5AA1A 1M5FA 3PPQA 4MAGA 1URSA 3S9NC 4RYAA 4KHZE 5EHMA 4R72A 2ZYKA 1MY4A 4IO6A 4R73A 3TDJA 3TEPA 1SQYA 1UTBA 3ROJA 4NF5A 2ZXTA 4R9FA 1DTGA 4X1BA 1SYHA 3IJXB 1JQFA 4H45A 5ICQA 3MP1A 1A7LA 1ZTYA 1URGA 2RCAA 2VGQA 1VFDA 1UTHA 1HSLA 1FTAA 5ITPA 4PBHA 1NUYA 3O97A 3B8BA 5I57B 3IO6A 4F2OA 2H9BA 1PC3A 3LSWA 2CZHA 3ZS6A 3S9EA 4Z0IA 5TU0A 4IO5A 1LBVA 1H76A 4H65A 4GFRA 4FE8A 5DT6A 3A3CA 3K1PA 3RNNA 5A5LA 1MRPA 4NF4B 1MXVA 4O3AA 1K9YA 4N13A 3HPIA 5H8FB 3LC8A 3TCHA 3N26A 1FW0A 1XVYA 4ONYA 1BTJA 3H06B 2ZYOA 5AA3A 5KCJA 2HXRA 4ELOA 4QSEA 4ISUA 3GBAA 5H8QB 4G2ZA 4GVOA 1KZ8A 3C35A 4IO3A 1MQJA 3UORA 1B9JA 2XXRA 5LDZA 3QUJA 2Z8FA 4XEQA 3VLVA 4GWOA 2ONSA 5IZZA 2AL5A 1TFDA 1QGXA 2HAVA 4O3BA 4H46A 4GX3A 5DEXA 3LUZA 3R7XA 3TMGA 3VVFA 4AB6A 1UTBB 1B3HA 1II5A 4DXUA 3VLUA 4NF6A 4R74A 4LZ5A 2PBWA 3H7MA 2I4BA 4AS5A 1FBCA 3W9VA 1AL3A 1FPGA 3MVWA 4I3EA 2CZIA 1XHYA 3HFUA 1UTHB 3CR9A 5DVJA 3G3HA 3T22A 1LB9A 2KLFA 2Z22A 2V3UA 3EF7A 5I5PA 1IMBA 4G68C 5EYGA 1ZMGA 1LAGE 1B1XA 5B70A 3M3LA 5H8NA 1EZ9A 2BJJX 4PFYA 1IEJA 4GLIA 4MFIA 1A8EA 2HEUA 4KI0E 2RINA 4HCWA 5TPAA 1NUZA 3KOSA 2O7IA 3SDFA 5AA2A 5I58A 1LCFA 3E9XA 5KCJB 2Q9TA 5ET6A 4OERA 3KN7A 3FJMA 4E0XA 5IGAA 4DCXA 4MF3A 3MC2A 1IMEA 2F5XA 1A8FA 2ONRA 4IGRA 1B6HA 2ABHA 1B7UA 3MZ1A 2ZMBA 2KR0A 3A09A 1H44A 4RNSA 1MXXA 4PBQA 4QFOA 4OFLA 3V8XB 3T1BA 1A54A 4JWOA 1VDWA 4M1VA 5CRYA 2R8TA 1FJ6A 2H4IA 5ICTA 4U22A 3HO7A 4Q8RA 5DEXB 2Q8JA 4O7IA 2QSXA 5JK4A 4F31B 4NF6B 2DSFA 2X26A 3KN8A 5ET5A 4LQ2A 3S2VA 1OLAA 2Y5LA 4XF5A 2B65A 4DE8A 1MH3A 2OBGA 4MJOA 4NWDA 3RYDA 5CBSA 1ZJLA 3SKPA 4ZZEA 2AYSA 3PGFA 4KCCA 2PX1A 4P1LA 5H8SA 3THIA 1LBBA 5T3JA 4FECA 4PGPA 4OEUA 4U1ZA 4NTLA 1B51A 3HV1A 1FBHA 3SEWA 4FJPA 4ZDMA 1MXUA 2O6AA 1EH3A 2QS3A 3HCQA 3PUVE 1DSNA 4N81A 1LBCA 4U2RA 1XS5A 2QS4A 3K4UA 4F1VA 5TPAB 2Y7KA 1FBFA 3VV5A 4C1TA 2P1SA 5AA2B 5I58B 2XXKA 4U23A 4X8RA 2O51A 4MCOA 4QXDA 3IOWA 2VP1A 3HSTA 4GL8A 1NV5A 3C31A 3M3KA 3MW0A 2GFEA 1VSOA 4AB5A 5I84A 4F22A 4QBAA 4PETA 1QUJA 4BDMA 4OFJA 2P2AA 2WYKA 1N7XA 5CBRA 1VE4A 3C34A 2Y5KA 2FA7A 4GD5A 1TXFA 1IZ1A 2F7CA 1NH8A 2H5YA 3N94A 2UXAA 3U94A 1PB7A 3N5LA 3OXNA 1FTLA 3PV0E 1NNKA 4QFPA 1MQGA 4DI3D 4PC9A 5I2KA 5FHOA 4NAPA 4ESXA 4H8JA 1NV1A 4JVCA 1B5IA 1NUWA 4ND9A 3OO8A 2XXXA 1N3XA 3ZKLA 4R9GA 3FASA 3G7WA 4QSDA 1FPLA 2DWIA 3ECRA 1JEUA 3TYHA 5AA2D 4EQ9A 1P1UA 2DP8A 3Q26A 1NI9A 1MXWA 2W7YA 4LZ7A 1IQ7A 2Q8MA 3BBRA 2Z8EA 1AH5A 3TKDA 4ZEDA 4EXLA 1DBZA 3UP9A 4H8IA 1D4NA 3T93B 3ZSFA 2O68A 3B6WA 2ZYNA 3H3GA 4MNCA 1H43A 2I4CA 3L6GA 3KSXA 4KYDA 3BIHA 3FXQA 4LQ5A 1I6BA 3TTLA 3R26A 2RF1A 4N8GA 4PFUA 4U21A 5CMCA 3PPOA 1CNQA 5IZ1A 3WAFA 2RC9A 2DOJA 1NH7A 2XD3A 2E1SA 2F36A 3G3FA 3EN3A 5CC2A 5L9OA 2A5TA 1DTZA 1B3EA 2ZNUA 4KPTA 4F39A 3M8UA 4OVRA 3IB0A 4OZ9A 1Q35A 2PFYA 4NMYA 4JVIA 2QPQA 1BLFA 2G29A 1JVXA 4R75A 1OQHA 2DXRA 4DLDA 3K02A 3GXAA 2Y7RA 1B05A 3IL1B 5I2KB 3I5OA 2P3NA 1FPDA 4X04A 3V89B 1IMFA 2I0BA 3UN6A 3EQ1A 1NUXA 1P1QA 5ET7A 3E3KA 3KJ7A 1S50A 3FGSA 4ELRA 1NV6A 2AL4A 3KOTA 1FTMA 1NV4A 2FHYA 3MPKA 2YJPA 2CEXA 2REJA 4Q0CA 3TPAA 3V5AA 4OXVA 2ZYMA 1T0KA 3C33A 3U93A 5DYHA 3FUZA 3QAXA 4EF1A 3PPNA 2Q2CA 1MM7A 2PCRA 3R6UA 2WYPA 4LA9A 1VR5A 2QVVA 3H4ZA 3GBBA 2QMXA 3SEVA 1WDNA 1NL5A 4R6YA 4PE5B 1O64A 1USYH 1RDXA 2XXQA 3FJGA 2PMSA 2NXOA 2CEYA 4OVJA 3RT8A 4ZEKA 3TCFA 1B4HA 3PMVA 4P0GA 2Y7IA 3GYYA 4FIMA 3VDFA 3MPLA 3FVKA 4YICA 1S9TA 4NHBA 3D1RA 1G0HA 1MY0A 5ET8A 3K00A 5F1QA 1LGBC 2Q2AA 3OO6A 4OHNA 2WKYA 3K01A 2A5TB 4ZS9A 1NV2A 4WEPA 4GF8A 3TODA 2V4CA 4GWSA 1FTJA 3TTKA 1IXGA 3DLNA 4H5GA 3IOUA 3F11A 5DVFA 2Z8DA 4FORA 1YZ0A 2P3VA 4YKIA 1B2HA 2O1MA 1FTKA 3JZJA 4C1UA 4YMBA 2O84X 3PMWA 1JW5A 3H6WA 3OSRA 4KXPA 1Y3NA 4H67A 1ZLQA 3TAJA 4OENA 4F19A 3TQLA 1B3LA 4HXVA 1WODA 3E13X 4PFWA 1FBGA 3O9PA 1Z7NE 1LB8A 1R9LA 3GZGA 3T0JA 4LN5A 4OESA 3CG1A 4EXKA 3PU5A 1OVBA 4XXUA 1Y3QA 3FJ7A 2PT2A 1FPFA 1FQCA 2OK2A 2M8CA 4EUOA 1FSAA 3BIGA 4RK2A 4P3LA 4ZZAA 3PUYE 4OYVA 2ESNA 2HFBA 3PUZE 4NGUA 2QS1A 2XXTA 3VVDA 4I9DA 4ZEIA 3PPPA 4TQUQ 2F3DA 4UACA 1PBQA 2V25A 5ITOA 1B46A 4RK9A 5IAIA 4BDLA 2VPNA 4X9TA 2RCBA 1B1HA 4NF0A 3IORA 4P9KA 4OA4A 4MBPA 2XXWA 4OVSA 3TCGA 3CRBA 3IOVA 3IB1A 4LVQA 5JTYA 2CZLA 4DDDA 5HPQA 4MEVA 1QW0A 1Y20A 1XOCA 4Q30B 2ONKE 3IX1A 4HE2A 2QMWA 2I48A 2DVCA 1SBPA 4U1OA 3KBRA 3T66A 4N6DA 4LP2B 3IFCA 1G0IA 4PF8A 2I58A 4NF5B 2R71A 5FTIA 3SETA 3MVZA 3S4UA 2DVZA 1OVTA 2F8DA 1JW1A 3RTWB 1PB8A 3H03A 1UIVA 3A29A 3SERA 4I8CA 4YMAA 1XT8A 3RGYA 2V3QA 1SYIA 4GWXA 2RC7A 1AOVA 3Q28A 1NNFA 5EYHA 3HHGA 5M2VA 4P8BA 5EQ7A 1RKMA 3B50A 5B7DA 3CFXA 2QS2A 4QFLA 1IUDA 4F3GA 1FQFA 3BFUA 4NX1A 3O2AA 2YPNA 4PE3A 4IGTA 1OQGA 4ELPA 2O7UA 4MLVA 4PCDA 3QUFA 1EYIA 3PUWE 1PEBA 2D3IA 1AMFA 1HSJA 5ELVA 2F6PA 5JTYB 3KZGA 1MPBA 4POWA 3FVGA 2XX9A 3RPWA 4WKMA 1QUKA 3VFJA 4IB2A 4DCYA 3IK6B 4N6KA 1LBYA 5HM4B 2R6GE 2V93A 4JDFA 3D4CA 3TTNA 1MQHA 4P11A 4BDNA 3K6XA 2DE2A 4N91A 4NN3A 1GGGA 4JWXA 1DMBA 2DE3A 3K1MA 1LAFE 1NMUA 1Q9DA 5K2YA 2UYFA 1JEVA 5L9MA 1GV8A 4PTKA 1MXYA 1YAEA 2H99A 2F6GA 2WBBA 4GWYA 4DZ1A 1B5HA 2I49A 4OMBA 2L5VA 3B6QA 3GLBA 4YZZA 2OWZA 4R6KA 4ZEFA 3MWBA 5H8NB 5CMKA 2F34A 4MH5A 3K6UA 3C9HA 2Q88A 3OO7A 2WEFA 4H6DA 3T96B 4N4UA 3M3FA 4N15A 1Y9UA 4YKPA 4NF8A 4XTCQ 1A55A 1S7YA 2P0SA 1GVCA 2E0SA 3IB2A 5ESYA 2FNCA 3V83A 4ZE8A 2O69A 1MPDA 2PVUA 5AA4A 1P1WA 2WX9A 4F29A 2IA4A 3N6UA 3VVEA 3SESA 4FBPA 4KYSA 2XA5A 2QL3A 2B3FA 1P99A 3CFLA 4PAIA 3K0VA 3KN3A 4RY1A 2QVUA 1B7ZA 4F18A 1PBPA 3EHUA 4G68A 2WBDA 3QYTA 3LUYA 4P1EA 4N07A 5I7IA 3RT6B 4F2QA 3TTMA 4FATA 2UVIA 1FPEA 4R6HA 3MUQA 3W15C 4G77A 2DS9A 4F1YA 3ODBA 4HE0A 2F7BA 2DWAA 2OLBA 2F97A 2XD2A 2UVHA 4YAHX 3U92A 3RN8A 4EDPA 1YTVA 2RKMA 5DTBA 4PAKA 4H1XA 4LZ8A 1GR2A 3IFAA 5FBPA 4FEBA 4OFOA 1NFTA 2VD2A 5KDTA 2XWIA 1NNTA 1B3FA 4GXSB 1KA0A 1I69A 2XXVA 4ECFA 4U4XA 4QFNA 2HPGA 4YB5A 2FIEA 4NF8B 3UIFA 3CFZA 2GHAA 1MM6A 3T9UA 1US4A 4RJZA 4PDHA 3L6HA 4IR8A 5AA4B 4KD5A 4QF9A 3IR1A 1BK4A 4WEDA 1BKAA 1FBPA 3LSXA 4GIZA 3SZPA 2XHDA 3H6VA 4HS7A 1R1NA 4G68B 1HSEA 2OWTA 4MNPA 3IO4A 3USDA 1FPIA 1N04A 3DP6A 5AE4A 2B3BA 1L5TA 2UVJA 1FQAA 3O6HA 3PPRA 4PDDA 2HZKA 1POTA 1Y1MA 4IY5A 4OVTA 2H98A 1FPJA 1MY2A 4DIGA 4EF2A
chains in the Genus database with same CATH topology
1ZBMA 4NE4A 1Y4TA 4RPOA 2XX7A 2OCUA 1QKBA 1IXIA 5BWJA 3OD7A 3ZKKA 3LSLA 1OMPA 5KDTB 1I6AA 2UYEA 3O6GA 1ATGA 1Z7ME 3I6VA 4OETA 1I6QA 4G8NA 3FIRA 3OEKA 3UK4A 1M5EA 5I59A 4BLAA 4O3CA 4JBZA 4RA1A 2GRVA 1AIVA 3KSJA 5I56A 1N0TA 4TLMB 4IO4A 1BP5A 3LR1A 5H8FA 3SEXA 2I0CA 5IKBA 2A5SA 3UA8A 2OZZA 5TP9A 4R2BA 5H8QA 1USYE 4F1UA 3K2DA 3FXRA 3C32A 1US5A 4GXAA 3P7IA 1QVSA 1B0HA 3KG2A 1LAHE 4RXLA 2XXYA 3G3GA 1B3GA 5FTHA 3RLFE 4G8HA 3MVYA 3QIMA 4HTGA 4NWCA 1SW1A 4WXJA 3N6TA 1IIWA 4ELQA 4KCDA 1MS7A 2PYYA 3KEIA 5DVIA 1EZOA 3TQWA 2THIA 3B6TA 1A40A 4LATA 1H3DA 1MQDA 1POY1 5H8HA 4BDRA 4YB6A 3AXFA 1Y4CA 3G3KA 4TLLB 1FQDA 3VLWA 5CM6A 2D5WA 3B7DA 4H5FA 3OOAA 2F78A 1SI1A 1BIYA 1B5JA 3RTFB 4K3FA 4Q5TA 2RC8A 1N7WA 3IAZA 1JNFA 4XKQA 5I59B 2R9JA 3CVGA 2UVGA 5I56B 4R2FA 4G4PA 1IXHA 3CSGA 3DP8A 2Y7WA 1LFHA 1A99A 3OMBA 4QHQA 3TELA 4XKRA 3EHSA 5L8DA 2GH9A 1MH4A 3O66A 1SDXA 3PD8A 4H0WA 3U72A 5TP9B 1B0LA 3BFTA 2ALUA 4F3PA 4LONB 1B40A 2ZNTA 4PQJA 3CSBA 3S9MC 1PB9A 5K2XA 3U1OA 1FCKA 3O29A 1JVYA 5CMBA 1QULA 4PP0A 3A3UA 4OEVA 4GOTA 2IEEA 5A5XA 5ISUA 4BDOA 3U8QA 5CMMA 4L17A 1ELJA 3O6IA 5H8HB 4QRZA 2XXUA 1UQWA 4YKKA 1RYOA 4C0RA 3MZ9A 1MXZA 4KYEA 4N6PA 1QUIA 3DP4A 4RPNA 4IO2A 2PT1A 3K6VA 4FEDA 4EQ7A 5JEIA 1SW2A 4JWYA 3FD3A 5L9SA 3KGCA 4F3BA 2O1LA 2FYIA 3TZAA 1WVJA 1DPPA 2QJEA 2DWHA 2VOZA 2XXPA 1M5CA 3VE1B 2G93A 1URDA 3CIJA 2V3TA 3G3JA 3VXBA 3FV2A 4DXBA 3IOTA 3TTRA 3MP6A 3QXMA 1B7HA 3S9LC 3H6UA 5I2NA 1MQIA 4Z7EA 1MDQA 4JB7A 2AIXA 1YCJA 2NWJA 2QRYA 1B4ZA 2XXHA 4HCYA 4YU0A 1LFIA 2DXYA 2Q89A 3Q29A 4KR5A 5A5XB 1JW4A 3MVXA 1DOTA 1YPNA 4POXA 3EPEA 3C36A 2DQVA 2I3VA 2LAOA 3LSFB 1QJMA 2D21A 3RY3A 2XXIA 1OIBA 1MG1A 3O28A 3ONMA 5BUUA 3T9VA 1B58A 3G3IA 4GQOA 2NUVA 4E0WA 1B52A 3C4MA 2Y84A 1F9BA 3ILUB 1O63A 3LBSA 2X7PA 3T9HB 3IJOB 4XKNA 3OENA 1ANFA 3DM0A 1Q1KA 3UGWA 4ZECA 4X48A 2V84A 1N76A 3D4GA 1N3WA 3FVOA 4PFTA 3FZVA 1TT1A 1D3KA 1LSTA 1XC1A 2HQ0A 1B32A 2YLNA 3EHTA 5LOMA 1IITA 4GRKA 4KFQA 4U4SA 5F7VA 1LCTA 1D9YA 1QKAA 1SI0A 1OLCA 1M5DA 3TUSA 2OJTA 3FV1A 2NVUB 1KWHA 5I2NB 4LUBA 1CE2A 4JXIA 4I1DA 2DYXA 1N84A 4HW8A 5CI5A 3Q27A 3DELB 3SEUA 1NNPA 3HHFA 3CI8A 3MAMA 4YKJA 4TOZA 3K1NA 4IO7A 3H6TA 2X7QA 4EQBA 3WAEA 1NKXA 1R9QA 1FTOA 1RYXA 4OWDA 3PMXA 2CMOA 4XIGQ 4JSDA 1LAXA 1UIUA 1MY3A 3KFMA 5KZTA 3OSQA 1SW5A 3PUXE 1GTKA 4F3SA 3K6WA 3RUMA 3SEYA 2I3WA 4FAJA 1SD3A 1PDAA 1XVXA 4GL0A 3Q25A 3T9XB 1DPEA 2VD3A 1CB6A 4XKPA 1JETA 4BDQA 1P1NA 1TWYA 2HCAA 1R6ZA 4I62A 1SW4A 3CG3A 4NEDA 1FQEA 2I6EA 4P0IA 1FQBA 4MLQA 3ILTB 4ZEBA 1H45A 3MZBA 2H25A 4DXCA 3MBPA 2DWJA 2OWSA 3HN0A 1SVXB 1ZKBA 1Y1ZA 2F35A 4JSOA 3I3VA 5HBCA 4ESWA 4AQ4A 1O7TA 3PD9A 1LLSA 5EHSA 5FHMA 2ANJA 3JYRA 4QSCA 5FHNA 3W9WA 3QK6A 2HXWA 3OELA 3E4RA 1EZPA 2ZNSA 4YB7A 5I57A 2Y7PA 4THIA 1TFAA 3FATA 1LFGA 1MPCA 3FXUA 2Z23A 1MY1A 4ZE9A 4KQPA 3FVNA 4OQOA 1VFEA 2VHAA 4M4GA 3OO9A 3BKIB 2DE4A 3RQTA 2HAUA 1ZU0A 4NF4A 2HZLA 2NOOA 3QSLA 3OEMA 1EU8A 3VXCA 3KJTA 3MP8A 1J1NA 4IY6A 4QFKA 2GHBA 1MDP1 3TFLA 1M5BA 3MQ9A 1IXCA 4UA8A 4OTEA 1ZIUA 2F7AA 1P1OA 2REGA 2XX8A 3MJNA 5J1DA 4G8MA 4X1DA 3JV9A 5EYFA 1Y3PA 1D9VA 5AA1A 1M5FA 3PPQA 1URSA 3S9NC 4RYAA 4KHZE 5EHMA 4R72A 2ZYKA 1MY4A 4IO6A 4R73A 3TDJA 3TEPA 1SQYA 1UTBA 4NF5A 2ZXTA 4R9FA 1DTGA 4X1BA 1SYHA 3IJXB 1JQFA 5ICQA 3MP1A 1A7LA 1ZTYA 1URGA 2RCAA 2VGQA 1VFDA 1UTHA 1HSLA 5ITPA 3O97A 5I57B 3IO6A 4F2OA 2H9BA 1PC3A 3LSWA 3ZS6A 3S9EA 4Z0IA 5TU0A 4IO5A 1H76A 4H65A 4GFRA 4FE8A 5DT6A 3A3CA 3K1PA 3RNNA 1MRPA 4NF4B 1MXVA 4O3AA 4N13A 3HPIA 5H8FB 3LC8A 3TCHA 3N26A 1FW0A 1XVYA 4ONYA 1BTJA 3H06B 2ZYOA 5AA3A 5KCJA 4ELOA 4QSEA 4ISUA 3GBAA 5H8QB 4G2ZA 4GVOA 3C35A 4IO3A 1MQJA 3UORA 1B9JA 2XXRA 3QUJA 2Z8FA 3VLVA 4GWOA 2ONSA 2AL5A 1TFDA 2HAVA 4O3BA 5DEXA 3R7XA 3TMGA 3VVFA 4AB6A 1UTBB 1B3HA 1II5A 4DXUA 3VLUA 4NF6A 4R74A 4LZ5A 2PBWA 3H7MA 2I4BA 3W9VA 1AL3A 3MVWA 1XHYA 1UTHB 3CR9A 5DVJA 3G3HA 3T22A 1LB9A 2KLFA 2Z22A 2V3UA 3EF7A 4G68C 1ZMGA 1LAGE 1B1XA 5B70A 3M3LA 5H8NA 1EZ9A 2BJJX 4PFYA 1IEJA 4GLIA 4MFIA 1A8EA 2HEUA 4KI0E 2RINA 4HCWA 5TPAA 3KOSA 2O7IA 3SDFA 5AA2A 5I58A 1LCFA 3E9XA 5KCJB 2Q9TA 4OERA 3KN7A 3FJMA 4E0XA 4DCXA 4MF3A 3MC2A 2F5XA 1A8FA 2ONRA 4IGRA 1B6HA 2ABHA 1B7UA 3MZ1A 2ZMBA 3A09A 1H44A 4RNSA 1MXXA 4QFOA 4OFLA 3V8XB 1A54A 4JWOA 4M1VA 5CRYA 2H4IA 5ICTA 4U22A 3HO7A 4Q8RA 5DEXB 2Q8JA 2QSXA 5JK4A 4F31B 4NF6B 2DSFA 2X26A 3KN8A 4LQ2A 3S2VA 1OLAA 2B65A 4DE8A 1MH3A 2OBGA 4NWDA 5CBSA 1ZJLA 3SKPA 4ZZEA 2AYSA 3PGFA 4KCCA 2PX1A 5H8SA 3THIA 1LBBA 4FECA 4OEUA 4U1ZA 4NTLA 1B51A 3HV1A 3SEWA 4FJPA 4ZDMA 1MXUA 2O6AA 1EH3A 2QS3A 3HCQA 3PUVE 1DSNA 1LBCA 4U2RA 1XS5A 2QS4A 3K4UA 4F1VA 5TPAB 2Y7KA 3VV5A 4C1TA 2P1SA 5AA2B 5I58B 4U23A 2O51A 3IOWA 2VP1A 3HSTA 4GL8A 3C31A 3M3KA 3MW0A 2GFEA 1VSOA 4AB5A 5I84A 4F22A 4PETA 1QUJA 4BDMA 4OFJA 2P2AA 1N7XA 5CBRA 1VE4A 3C34A 2FA7A 4GD5A 1TXFA 1IZ1A 2F7CA 1NH8A 2H5YA 3N94A 2UXAA 3U94A 1PB7A 3N5LA 3OXNA 1FTLA 3PV0E 1NNKA 4QFPA 1MQGA 5I2KA 5FHOA 4ESXA 4H8JA 1B5IA 4ND9A 3OO8A 2XXXA 1N3XA 3ZKLA 4R9GA 3FASA 3G7WA 4QSDA 2DWIA 3ECRA 1JEUA 3TYHA 5AA2D 4EQ9A 1P1UA 2DP8A 3Q26A 2W7YA 1MXWA 4LZ7A 1IQ7A 3BBRA 2Z8EA 1AH5A 3TKDA 4ZEDA 4EXLA 3UP9A 4H8IA 1D4NA 3T93B 3ZSFA 2O68A 3B6WA 2ZYNA 3H3GA 1H43A 2I4CA 3L6GA 3KSXA 4KYDA 3FXQA 4LQ5A 1I6BA 3TTLA 3R26A 2RF1A 4PFUA 4U21A 5CMCA 3PPOA 3WAFA 2RC9A 2DOJA 1NH7A 2XD3A 2E1SA 2F36A 3G3FA 3EN3A 5CC2A 5L9OA 2A5TA 1DTZA 1B3EA 2ZNUA 4KPTA 4F39A 3M8UA 3IB0A 4OZ9A 1Q35A 4NMYA 2QPQA 1BLFA 2G29A 1JVXA 4R75A 1OQHA 2DXRA 4DLDA 3K02A 3GXAA 2Y7RA 1B05A 3IL1B 5I2KB 3I5OA 3V89B 2I0BA 3UN6A 3EQ1A 1P1QA 3E3KA 3KJ7A 1S50A 3FGSA 4ELRA 2AL4A 3KOTA 1FTMA 3MPKA 2YJPA 2REJA 4Q0CA 3TPAA 3V5AA 4OXVA 2ZYMA 1T0KA 3C33A 3U93A 5DYHA 3FUZA 3QAXA 4EF1A 3PPNA 2Q2CA 1MM7A 3R6UA 4LA9A 1VR5A 3H4ZA 3GBBA 2QMXA 3SEVA 1WDNA 1NL5A 4R6YA 4PE5B 1O64A 1USYH 2XXQA 3FJGA 2PMSA 2NXOA 4OVJA 3RT8A 4ZEKA 3TCFA 1B4HA 3PMVA 4P0GA 2Y7IA 4FIMA 3VDFA 3MPLA 3FVKA 4YICA 1S9TA 1MY0A 5F1QA 3K00A 1LGBC 2Q2AA 3OO6A 4OHNA 2WKYA 3K01A 2A5TB 4ZS9A 4WEPA 4GF8A 3TODA 1FTJA 3TTKA 1IXGA 3DLNA 4H5GA 3IOUA 3F11A 5DVFA 2Z8DA 4FORA 4YKIA 1B2HA 2O1MA 1FTKA 3JZJA 4C1UA 4YMBA 2O84X 3PMWA 1JW5A 3H6WA 3OSRA 1Y3NA 4H67A 1ZLQA 3TAJA 4OENA 4F19A 3TQLA 1B3LA 1WODA 3E13X 4PFWA 3O9PA 1Z7NE 1LB8A 1R9LA 3GZGA 4OESA 3CG1A 4EXKA 3PU5A 1OVBA 4XXUA 1Y3QA 3FJ7A 2PT2A 1FQCA 2OK2A 2M8CA 4EUOA 4RK2A 4ZZAA 3PUYE 4OYVA 2ESNA 2HFBA 3PUZE 2QS1A 2XXTA 3VVDA 4I9DA 4ZEIA 3PPPA 4TQUQ 4UACA 1PBQA 2V25A 5ITOA 1B46A 4RK9A 5IAIA 4BDLA 4X9TA 2RCBA 1B1HA 3IORA 4MBPA 2XXWA 3TCGA 3CRBA 3IOVA 3IB1A 4LVQA 5JTYA 2CZLA 4DDDA 5HPQA 1QW0A 1Y20A 1XOCA 4Q30B 2ONKE 3IX1A 2QMWA 2I48A 2DVCA 1SBPA 4U1OA 3KBRA 3T66A 4LP2B 2I58A 4NF5B 2R71A 5FTIA 3SETA 3MVZA 3S4UA 2DVZA 1OVTA 2F8DA 1JW1A 3RTWB 1PB8A 3H03A 1UIVA 3SERA 4I8CA 4YMAA 1XT8A 3RGYA 2V3QA 1SYIA 2RC7A 1AOVA 3Q28A 1NNFA 3HHGA 5M2VA 1RKMA 5B7DA 3CFXA 2QS2A 4QFLA 1IUDA 4F3GA 1FQFA 3BFUA 3O2AA 2YPNA 4IGTA 1OQGA 4ELPA 2O7UA 4MLVA 3QUFA 3PUWE 1PEBA 2D3IA 1AMFA 1HSJA 5ELVA 2F6PA 5JTYB 3KZGA 1MPBA 4POWA 3FVGA 2XX9A 3RPWA 4WKMA 1QUKA 3VFJA 4IB2A 4DCYA 3IK6B 5HM4B 2R6GE 2V93A 4JDFA 3D4CA 3TTNA 1MQHA 4P11A 4BDNA 3K6XA 2DE2A 1GGGA 4JWXA 1DMBA 2DE3A 3K1MA 1LAFE 1NMUA 5K2YA 2UYFA 1JEVA 5L9MA 1GV8A 1MXYA 1YAEA 2H99A 2F6GA 4DZ1A 1B5HA 2I49A 4OMBA 3B6QA 3GLBA 4YZZA 4R6KA 4ZEFA 3MWBA 5H8NB 5CMKA 2F34A 4MH5A 3K6UA 3C9HA 2Q88A 3OO7A 4H6DA 3T96B 3M3FA 1Y9UA 4YKPA 4NF8A 4XTCQ 1A55A 1S7YA 2P0SA 1GVCA 2E0SA 3IB2A 2FNCA 3V83A 4ZE8A 2O69A 1MPDA 2PVUA 5AA4A 1P1WA 4F29A 2IA4A 3N6UA 3VVEA 3SESA 4KYSA 2QL3A 2B3FA 1P99A 3CFLA 3K0VA 3KN3A 4RY1A 1B7ZA 4F18A 1PBPA 3EHUA 4G68A 3QYTA 3LUYA 4N07A 3RT6B 4F2QA 3TTMA 4FATA 2UVIA 4R6HA 3MUQA 3W15C 4G77A 2DS9A 4F1YA 3ODBA 2F7BA 2DWAA 2OLBA 2F97A 2XD2A 2UVHA 4YAHX 3U92A 3RN8A 4EDPA 1YTVA 2RKMA 5DTBA 4H1XA 4LZ8A 1GR2A 4FEBA 4OFOA 1NFTA 2VD2A 5KDTA 1NNTA 1B3FA 4GXSB 1I69A 2XXVA 4ECFA 4U4XA 4QFNA 4YB5A 4NF8B 3UIFA 3CFZA 2GHAA 1MM6A 3T9UA 1US4A 4RJZA 3L6HA 5AA4B 4KD5A 4QF9A 3IR1A 4WEDA 1BKAA 3LSXA 4GIZA 2XHDA 3H6VA 4HS7A 1R1NA 4G68B 1HSEA 2OWTA 3IO4A 3USDA 1N04A 3DP6A 5AE4A 2B3BA 1L5TA 2UVJA 1FQAA 3O6HA 3PPRA 2HZKA 1POTA 1Y1MA 4IY5A 2H98A 1MY2A 4DIGA 4EF2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZBM A;  4NE4 A;  1Y4T A;  4RPO A;  2XX7 A;  2OCU A;  1QKB A;  1IXI A;  5BWJ A;  3OD7 A;  3ZKK A;  3LSL A;  1OMP A;  5KDT B;  1I6A A;  2UYE A;  3O6G A;  1ATG A;  1Z7M E;  3I6V A;  4OET A;  1I6Q A;  4G8N A;  3FIR A;  3OEK A;  3UK4 A;  1M5E A;  5I59 A;  4BLA A;  4O3C A;  4JBZ A;  4RA1 A;  2GRV A;  1AIV A;  3KSJ A;  5I56 A;  1N0T A;  4TLM B;  4IO4 A;  1BP5 A;  3LR1 A;  5H8F A;  3SEX A;  2I0C A;  5IKB A;  2A5S A;  3UA8 A;  2OZZ A;  5TP9 A;  4R2B A;  5H8Q A;  1USY E;  4F1U A;  3K2D A;  3FXR A;  3C32 A;  1US5 A;  4GXA A;  3P7I A;  1QVS A;  1B0H A;  3KG2 A;  1LAH E;  4RXL A;  2XXY A;  3G3G A;  1B3G A;  5FTH A;  3RLF E;  4G8H A;  3MVY A;  3QIM A;  4HTG A;  4NWC A;  1SW1 A;  4WXJ A;  3N6T A;  1IIW A;  4ELQ A;  4KCD A;  1MS7 A;  2PYY A;  3KEI A;  5DVI A;  1EZO A;  3TQW A;  2THI A;  3B6T A;  1A40 A;  4LAT A;  1H3D A;  1MQD A;  1POY 1;  5H8H A;  4BDR A;  4YB6 A;  3AXF A;  1Y4C A;  3G3K A;  4TLL B;  1FQD A;  3VLW A;  5CM6 A;  2D5W A;  3B7D A;  4H5F A;  3OOA A;  2F78 A;  1SI1 A;  1BIY A;  1B5J A;  3RTF B;  4K3F A;  4Q5T A;  2RC8 A;  1N7W A;  3IAZ A;  1JNF A;  4XKQ A;  5I59 B;  2R9J A;  3CVG A;  2UVG A;  5I56 B;  4R2F A;  4G4P A;  1IXH A;  3CSG A;  3DP8 A;  2Y7W A;  1LFH A;  1A99 A;  3OMB A;  4QHQ A;  3TEL A;  4XKR A;  3EHS A;  5L8D A;  2GH9 A;  1MH4 A;  3O66 A;  1SDX A;  3PD8 A;  4H0W A;  3U72 A;  5TP9 B;  1B0L A;  3BFT A;  2ALU A;  4F3P A;  4LON B;  1B40 A;  2ZNT A;  4PQJ A;  3CSB A;  3S9M C;  1PB9 A;  5K2X A;  3U1O A;  1FCK A;  3O29 A;  1JVY A;  5CMB A;  1QUL A;  4PP0 A;  3A3U A;  4OEV A;  4GOT A;  2IEE A;  5A5X A;  5ISU A;  4BDO A;  3U8Q A;  5CMM A;  4L17 A;  1ELJ A;  3O6I A;  5H8H B;  4QRZ A;  2XXU A;  1UQW A;  4YKK A;  1RYO A;  4C0R A;  3MZ9 A;  1MXZ A;  4KYE A;  4N6P A;  1QUI A;  3DP4 A;  4RPN A;  4IO2 A;  2PT1 A;  3K6V A;  4FED A;  4EQ7 A;  5JEI A;  1SW2 A;  4JWY A;  3FD3 A;  5L9S A;  3KGC A;  4F3B A;  2O1L A;  2FYI A;  3TZA A;  1WVJ A;  1DPP A;  2QJE A;  2DWH A;  2VOZ A;  2XXP A;  1M5C A;  3VE1 B;  2G93 A;  1URD A;  3CIJ A;  2V3T A;  3G3J A;  3VXB A;  3FV2 A;  4DXB A;  3IOT A;  3TTR A;  3MP6 A;  3QXM A;  1B7H A;  3S9L C;  3H6U A;  5I2N A;  1MQI A;  4Z7E A;  1MDQ A;  4JB7 A;  2AIX A;  1YCJ A;  2NWJ A;  2QRY A;  1B4Z A;  2XXH A;  4HCY A;  4YU0 A;  1LFI A;  2DXY A;  2Q89 A;  3Q29 A;  4KR5 A;  5A5X B;  1JW4 A;  3MVX A;  1DOT A;  1YPN A;  4POX A;  3EPE A;  3C36 A;  2DQV A;  2I3V A;  2LAO A;  3LSF B;  1QJM A;  2D21 A;  3RY3 A;  2XXI A;  1OIB A;  1MG1 A;  3O28 A;  3ONM A;  5BUU A;  3T9V A;  1B58 A;  3G3I A;  4GQO A;  2NUV A;  4E0W A;  1B52 A;  3C4M A;  2Y84 A;  1F9B A;  3ILU B;  1O63 A;  3LBS A;  2X7P A;  3T9H B;  3IJO B;  4XKN A;  3OEN A;  1ANF A;  3DM0 A;  1Q1K A;  3UGW A;  4ZEC A;  4X48 A;  2V84 A;  1N76 A;  3D4G A;  1N3W A;  3FVO A;  4PFT A;  3FZV A;  1TT1 A;  1D3K A;  1LST A;  1XC1 A;  2HQ0 A;  1B32 A;  2YLN A;  3EHT A;  5LOM A;  1IIT A;  4GRK A;  4KFQ A;  4U4S A;  5F7V A;  1LCT A;  1D9Y A;  1QKA A;  1SI0 A;  1OLC A;  1M5D A;  3TUS A;  2OJT A;  3FV1 A;  2NVU B;  1KWH A;  5I2N B;  4LUB A;  1CE2 A;  4JXI A;  4I1D A;  2DYX A;  1N84 A;  4HW8 A;  5CI5 A;  3Q27 A;  3DEL B;  3SEU A;  1NNP A;  3HHF A;  3CI8 A;  3MAM A;  4YKJ A;  4TOZ A;  3K1N A;  4IO7 A;  3H6T A;  2X7Q A;  4EQB A;  3WAE A;  1NKX A;  1R9Q A;  1FTO A;  1RYX A;  4OWD A;  3PMX A;  2CMO A;  4XIG Q;  4JSD A;  1LAX A;  1UIU A;  1MY3 A;  3KFM A;  5KZT A;  3OSQ A;  1SW5 A;  3PUX E;  1GTK A;  4F3S A;  3K6W A;  3RUM A;  3SEY A;  2I3W A;  4FAJ A;  1SD3 A;  1PDA A;  1XVX A;  4GL0 A;  3Q25 A;  3T9X B;  1DPE A;  2VD3 A;  1CB6 A;  4XKP A;  1JET A;  4BDQ A;  1P1N A;  1TWY A;  2HCA A;  1R6Z A;  4I62 A;  1SW4 A;  3CG3 A;  4NED A;  1FQE A;  2I6E A;  4P0I A;  1FQB A;  4MLQ A;  3ILT B;  4ZEB A;  1H45 A;  3MZB A;  2H25 A;  4DXC A;  3MBP A;  2DWJ A;  2OWS A;  3HN0 A;  1SVX B;  1ZKB A;  1Y1Z A;  2F35 A;  4JSO A;  3I3V A;  5HBC A;  4ESW A;  4AQ4 A;  1O7T A;  3PD9 A;  1LLS A;  5EHS A;  5FHM A;  2ANJ A;  3JYR A;  4QSC A;  5FHN A;  3W9W A;  3QK6 A;  2HXW A;  3OEL A;  3E4R A;  1EZP A;  2ZNS A;  4YB7 A;  5I57 A;  2Y7P A;  4THI A;  1TFA A;  3FAT A;  1LFG A;  1MPC A;  3FXU A;  2Z23 A;  1MY1 A;  4ZE9 A;  4KQP A;  3FVN A;  4OQO A;  1VFE A;  2VHA A;  4M4G A;  3OO9 A;  3BKI B;  2DE4 A;  3RQT A;  2HAU A;  1ZU0 A;  4NF4 A;  2HZL A;  2NOO A;  3QSL A;  3OEM A;  1EU8 A;  3VXC A;  3KJT A;  3MP8 A;  1J1N A;  4IY6 A;  4QFK A;  2GHB A;  1MDP 1;  3TFL A;  1M5B A;  3MQ9 A;  1IXC A;  4UA8 A;  4OTE A;  1ZIU A;  2F7A A;  1P1O A;  2REG A;  2XX8 A;  3MJN A;  5J1D A;  4G8M A;  4X1D A;  3JV9 A;  5EYF A;  1Y3P A;  1D9V A;  5AA1 A;  1M5F A;  3PPQ A;  1URS A;  3S9N C;  4RYA A;  4KHZ E;  5EHM A;  4R72 A;  2ZYK A;  1MY4 A;  4IO6 A;  4R73 A;  3TDJ A;  3TEP A;  1SQY A;  1UTB A;  4NF5 A;  2ZXT A;  4R9F A;  1DTG A;  4X1B A;  1SYH A;  3IJX B;  1JQF A;  5ICQ A;  3MP1 A;  1A7L A;  1ZTY A;  1URG A;  2RCA A;  2VGQ A;  1VFD A;  1UTH A;  1HSL A;  5ITP A;  3O97 A;  5I57 B;  3IO6 A;  4F2O A;  2H9B A;  1PC3 A;  3LSW A;  3ZS6 A;  3S9E A;  4Z0I A;  5TU0 A;  4IO5 A;  1H76 A;  4H65 A;  4GFR A;  4FE8 A;  5DT6 A;  3A3C A;  3K1P A;  3RNN A;  1MRP A;  4NF4 B;  1MXV A;  4O3A A;  4N13 A;  3HPI A;  5H8F B;  3LC8 A;  3TCH A;  3N26 A;  1FW0 A;  1XVY A;  4ONY A;  1BTJ A;  3H06 B;  2ZYO A;  5AA3 A;  5KCJ A;  4ELO A;  4QSE A;  4ISU A;  3GBA A;  5H8Q B;  4G2Z A;  4GVO A;  3C35 A;  4IO3 A;  1MQJ A;  3UOR A;  1B9J A;  2XXR A;  3QUJ A;  2Z8F A;  3VLV A;  4GWO A;  2ONS A;  2AL5 A;  1TFD A;  2HAV A;  4O3B A;  5DEX A;  3R7X A;  3TMG A;  3VVF A;  4AB6 A;  1UTB B;  1B3H A;  1II5 A;  4DXU A;  3VLU A;  4NF6 A;  4R74 A;  4LZ5 A;  2PBW A;  3H7M A;  2I4B A;  3W9V A;  1AL3 A;  3MVW A;  1XHY A;  1UTH B;  3CR9 A;  5DVJ A;  3G3H A;  3T22 A;  1LB9 A;  2KLF A;  2Z22 A;  2V3U A;  3EF7 A;  4G68 C;  1ZMG A;  1LAG E;  1B1X A;  5B70 A;  3M3L A;  5H8N A;  1EZ9 A;  2BJJ X;  4PFY A;  1IEJ A;  4GLI A;  4MFI A;  1A8E A;  2HEU A;  4KI0 E;  2RIN A;  4HCW A;  5TPA A;  3KOS A;  2O7I A;  3SDF A;  5AA2 A;  5I58 A;  1LCF A;  3E9X A;  5KCJ B;  2Q9T A;  4OER A;  3KN7 A;  3FJM A;  4E0X A;  4DCX A;  4MF3 A;  3MC2 A;  2F5X A;  1A8F A;  2ONR A;  4IGR A;  1B6H A;  2ABH A;  1B7U A;  3MZ1 A;  2ZMB A;  3A09 A;  1H44 A;  4RNS A;  1MXX A;  4QFO A;  4OFL A;  3V8X B;  1A54 A;  4JWO A;  4M1V A;  5CRY A;  2H4I A;  5ICT A;  4U22 A;  3HO7 A;  4Q8R A;  5DEX B;  2Q8J A;  2QSX A;  5JK4 A;  4F31 B;  4NF6 B;  2DSF A;  2X26 A;  3KN8 A;  4LQ2 A;  3S2V A;  1OLA A;  2B65 A;  4DE8 A;  1MH3 A;  2OBG A;  4NWD A;  5CBS A;  1ZJL A;  3SKP A;  4ZZE A;  2AYS A;  3PGF A;  4KCC A;  2PX1 A;  5H8S A;  3THI A;  1LBB A;  4FEC A;  4OEU A;  4U1Z A;  4NTL A;  1B51 A;  3HV1 A;  3SEW A;  4FJP A;  4ZDM A;  1MXU A;  2O6A A;  1EH3 A;  2QS3 A;  3HCQ A;  3PUV E;  1DSN A;  1LBC A;  4U2R A;  1XS5 A;  2QS4 A;  3K4U A;  4F1V A;  5TPA B;  2Y7K A;  3VV5 A;  4C1T A;  2P1S A;  5AA2 B;  5I58 B;  4U23 A;  2O51 A;  3IOW A;  2VP1 A;  3HST A;  4GL8 A;  3C31 A;  3M3K A;  3MW0 A;  2GFE A;  1VSO A;  4AB5 A;  5I84 A;  4F22 A;  4PET A;  1QUJ A;  4BDM A;  4OFJ A;  2P2A A;  1N7X A;  5CBR A;  1VE4 A;  3C34 A;  2FA7 A;  4GD5 A;  1TXF A;  1IZ1 A;  2F7C A;  1NH8 A;  2H5Y A;  3N94 A;  2UXA A;  3U94 A;  1PB7 A;  3N5L A;  3OXN A;  1FTL A;  3PV0 E;  1NNK A;  4QFP A;  1MQG A;  5I2K A;  5FHO A;  4ESX A;  4H8J A;  1B5I A;  4ND9 A;  3OO8 A;  2XXX A;  1N3X A;  3ZKL A;  4R9G A;  3FAS A;  3G7W A;  4QSD A;  2DWI A;  3ECR A;  1JEU A;  3TYH A;  5AA2 D;  4EQ9 A;  1P1U A;  2DP8 A;  3Q26 A;  2W7Y A;  1MXW A;  4LZ7 A;  1IQ7 A;  3BBR A;  2Z8E A;  1AH5 A;  3TKD A;  4ZED A;  4EXL A;  3UP9 A;  4H8I A;  1D4N A;  3T93 B;  3ZSF A;  2O68 A;  3B6W A;  2ZYN A;  3H3G A;  1H43 A;  2I4C A;  3L6G A;  3KSX A;  4KYD A;  3FXQ A;  4LQ5 A;  1I6B A;  3TTL A;  3R26 A;  2RF1 A;  4PFU A;  4U21 A;  5CMC A;  3PPO A;  3WAF A;  2RC9 A;  2DOJ A;  1NH7 A;  2XD3 A;  2E1S A;  2F36 A;  3G3F A;  3EN3 A;  5CC2 A;  5L9O A;  2A5T A;  1DTZ A;  1B3E A;  2ZNU A;  4KPT A;  4F39 A;  3M8U A;  3IB0 A;  4OZ9 A;  1Q35 A;  4NMY A;  2QPQ A;  1BLF A;  2G29 A;  1JVX A;  4R75 A;  1OQH A;  2DXR A;  4DLD A;  3K02 A;  3GXA A;  2Y7R A;  1B05 A;  3IL1 B;  5I2K B;  3I5O A;  3V89 B;  2I0B A;  3UN6 A;  3EQ1 A;  1P1Q A;  3E3K A;  3KJ7 A;  1S50 A;  3FGS A;  4ELR A;  2AL4 A;  3KOT A;  1FTM A;  3MPK A;  2YJP A;  2REJ A;  4Q0C A;  3TPA A;  3V5A A;  4OXV A;  2ZYM A;  1T0K A;  3C33 A;  3U93 A;  5DYH A;  3FUZ A;  3QAX A;  4EF1 A;  3PPN A;  2Q2C A;  1MM7 A;  3R6U A;  4LA9 A;  1VR5 A;  3H4Z A;  3GBB A;  2QMX A;  3SEV A;  1WDN A;  1NL5 A;  4R6Y A;  4PE5 B;  1O64 A;  1USY H;  2XXQ A;  3FJG A;  2PMS A;  2NXO A;  4OVJ A;  3RT8 A;  4ZEK A;  3TCF A;  1B4H A;  3PMV A;  4P0G A;  2Y7I A;  4FIM A;  3VDF A;  3MPL A;  3FVK A;  4YIC A;  1S9T A;  1MY0 A;  5F1Q A;  3K00 A;  1LGB C;  2Q2A A;  3OO6 A;  4OHN A;  2WKY A;  3K01 A;  2A5T B;  4ZS9 A;  4WEP A;  4GF8 A;  3TOD A;  1FTJ A;  3TTK A;  1IXG A;  3DLN A;  4H5G A;  3IOU A;  3F11 A;  5DVF A;  2Z8D A;  4FOR A;  4YKI A;  1B2H A;  2O1M A;  1FTK A;  3JZJ A;  4C1U A;  4YMB A;  2O84 X;  3PMW A;  1JW5 A;  3H6W A;  3OSR A;  1Y3N A;  4H67 A;  1ZLQ A;  3TAJ A;  4OEN A;  4F19 A;  3TQL A;  1B3L A;  1WOD A;  3E13 X;  4PFW A;  3O9P A;  1Z7N E;  1LB8 A;  1R9L A;  3GZG A;  4OES A;  3CG1 A;  4EXK A;  3PU5 A;  1OVB A;  4XXU A;  1Y3Q A;  3FJ7 A;  2PT2 A;  1FQC A;  2OK2 A;  2M8C A;  4EUO A;  4RK2 A;  4ZZA A;  3PUY E;  4OYV A;  2ESN A;  2HFB A;  3PUZ E;  2QS1 A;  2XXT A;  3VVD A;  4I9D A;  4ZEI A;  3PPP A;  4TQU Q;  4UAC A;  1PBQ A;  2V25 A;  5ITO A;  1B46 A;  4RK9 A;  5IAI A;  4BDL A;  4X9T A;  2RCB A;  1B1H A;  3IOR A;  4MBP A;  2XXW A;  3TCG A;  3CRB A;  3IOV A;  3IB1 A;  4LVQ A;  5JTY A;  2CZL A;  4DDD A;  5HPQ A;  1QW0 A;  1Y20 A;  1XOC A;  4Q30 B;  2ONK E;  3IX1 A;  2QMW A;  2I48 A;  2DVC A;  1SBP A;  4U1O A;  3KBR A;  3T66 A;  4LP2 B;  2I58 A;  4NF5 B;  2R71 A;  5FTI A;  3SET A;  3MVZ A;  3S4U A;  2DVZ A;  1OVT A;  2F8D A;  1JW1 A;  3RTW B;  1PB8 A;  3H03 A;  1UIV A;  3SER A;  4I8C A;  4YMA A;  1XT8 A;  3RGY A;  2V3Q A;  1SYI A;  2RC7 A;  1AOV A;  3Q28 A;  1NNF A;  3HHG A;  5M2V A;  1RKM A;  5B7D A;  3CFX A;  2QS2 A;  4QFL A;  1IUD A;  4F3G A;  1FQF A;  3BFU A;  3O2A A;  2YPN A;  4IGT A;  1OQG A;  4ELP A;  2O7U A;  4MLV A;  3QUF A;  3PUW E;  1PEB A;  2D3I A;  1AMF A;  1HSJ A;  5ELV A;  2F6P A;  5JTY B;  3KZG A;  1MPB A;  4POW A;  3FVG A;  2XX9 A;  3RPW A;  4WKM A;  1QUK A;  3VFJ A;  4IB2 A;  4DCY A;  3IK6 B;  5HM4 B;  2R6G E;  2V93 A;  4JDF A;  3D4C A;  3TTN A;  1MQH A;  4P11 A;  4BDN A;  3K6X A;  2DE2 A;  1GGG A;  4JWX A;  1DMB A;  2DE3 A;  3K1M A;  1LAF E;  1NMU A;  5K2Y A;  2UYF A;  1JEV A;  5L9M A;  1GV8 A;  1MXY A;  1YAE A;  2H99 A;  2F6G A;  4DZ1 A;  1B5H A;  2I49 A;  4OMB A;  3B6Q A;  3GLB A;  4YZZ A;  4R6K A;  4ZEF A;  3MWB A;  5H8N B;  5CMK A;  2F34 A;  4MH5 A;  3K6U A;  3C9H A;  2Q88 A;  3OO7 A;  4H6D A;  3T96 B;  3M3F A;  1Y9U A;  4YKP A;  4NF8 A;  4XTC Q;  1A55 A;  1S7Y A;  2P0S A;  1GVC A;  2E0S A;  3IB2 A;  2FNC A;  3V83 A;  4ZE8 A;  2O69 A;  1MPD A;  2PVU A;  5AA4 A;  1P1W A;  4F29 A;  2IA4 A;  3N6U A;  3VVE A;  3SES A;  4KYS A;  2QL3 A;  2B3F A;  1P99 A;  3CFL A;  3K0V A;  3KN3 A;  4RY1 A;  1B7Z A;  4F18 A;  1PBP A;  3EHU A;  4G68 A;  3QYT A;  3LUY A;  4N07 A;  3RT6 B;  4F2Q A;  3TTM A;  4FAT A;  2UVI A;  4R6H A;  3MUQ A;  3W15 C;  4G77 A;  2DS9 A;  4F1Y A;  3ODB A;  2F7B A;  2DWA A;  2OLB A;  2F97 A;  2XD2 A;  2UVH A;  4YAH X;  3U92 A;  3RN8 A;  4EDP A;  1YTV A;  2RKM A;  5DTB A;  4H1X A;  4LZ8 A;  1GR2 A;  4FEB A;  4OFO A;  1NFT A;  2VD2 A;  5KDT A;  1NNT A;  1B3F A;  4GXS B;  1I69 A;  2XXV A;  4ECF A;  4U4X A;  4QFN A;  4YB5 A;  4NF8 B;  3UIF A;  3CFZ A;  2GHA A;  1MM6 A;  3T9U A;  1US4 A;  4RJZ A;  3L6H A;  5AA4 B;  4KD5 A;  4QF9 A;  3IR1 A;  4WED A;  1BKA A;  3LSX A;  4GIZ A;  2XHD A;  3H6V A;  4HS7 A;  1R1N A;  4G68 B;  1HSE A;  2OWT A;  3IO4 A;  3USD A;  1N04 A;  3DP6 A;  5AE4 A;  2B3B A;  1L5T A;  2UVJ A;  1FQA A;  3O6H A;  3PPR A;  2HZK A;  1POT A;  1Y1M A;  4IY5 A;  2H98 A;  1MY2 A;  4DIG A;  4EF2 A; 
#chains in the Genus database with same CATH topology
 1ZBM A;  4NE4 A;  1Y4T A;  4RPO A;  2XX7 A;  2PFZ A;  2OCU A;  1QKB A;  1IXI A;  5BWJ A;  1LBZ A;  3OD7 A;  3ZKK A;  3LSL A;  1OMP A;  5KDT B;  1I6A A;  2UYE A;  3O6G A;  1ATG A;  1Z7M E;  3ISP A;  3I6V A;  4I40 A;  4OET A;  1I6Q A;  4G8N A;  3FIR A;  3OEK A;  3E79 A;  3UK4 A;  1M5E A;  4MNI A;  2FVZ A;  5I59 A;  4BLA A;  4O3C A;  4JBZ A;  4RA1 A;  2GRV A;  1AIV A;  3KSJ A;  5I56 A;  1N0T A;  4PFI A;  1JP4 A;  4TLM B;  4NG7 A;  4GBW A;  4IO4 A;  1BP5 A;  3LR1 A;  4GWZ A;  5H8F A;  3SEX A;  2I0C A;  5IKB A;  2A5S A;  1FBD A;  4O8M A;  1SPI A;  3UA8 A;  2OZZ A;  3U65 A;  1AWB A;  5TP9 A;  4R2B A;  5H8Q A;  2FIX A;  1USY E;  4F1U A;  3K2D A;  5EQ8 A;  3FXR A;  3C32 A;  1US5 A;  4GXA A;  3NOH A;  4PF6 A;  3P7I A;  1QVS A;  1B0H A;  3KG2 A;  1LAH E;  4RXL A;  2XXY A;  1DCU A;  2HHM A;  3G3G A;  1B3G A;  5FTH A;  3RLF E;  4G8H A;  3MVY A;  3QIM A;  4HTG A;  4NWC A;  1SW1 A;  4WXJ A;  2VPO A;  3N6T A;  1IIW A;  4ELQ A;  4KCD A;  2XWO A;  1MS7 A;  2PYY A;  3KEI A;  5DVI A;  1EZO A;  4PAF A;  3TQW A;  4OAN A;  2THI A;  3B6T A;  1A40 A;  4OVP A;  4LAT A;  1H3D A;  1MQD A;  1POY 1;  1RDZ A;  5H8H A;  4BDR A;  4YB6 A;  3AXF A;  1Y4C A;  3QMF A;  4GWW A;  3G3K A;  4TLL B;  1FQD A;  3VLW A;  1NV3 A;  5CM6 A;  2FBP A;  2D5W A;  3B7D A;  4H5F A;  3OOA A;  2F78 A;  5I3S A;  1SI1 A;  1BIY A;  1B5J A;  3RTF B;  4K3F A;  4Q5T A;  2RC8 A;  1N7W A;  3IAZ A;  1JNF A;  5LTC A;  3KBZ A;  4XKQ A;  5I59 B;  2R9J A;  3CVG A;  2UVG A;  5I56 B;  4R2F A;  4G4P A;  1IXH A;  3CSG A;  3DP8 A;  2Y7W A;  1LFH A;  1A99 A;  3OMB A;  4QHQ A;  3TEL A;  4XKR A;  3EHS A;  5L8D A;  2GH9 A;  2VT5 A;  3PTY A;  1MH4 A;  3E78 A;  3O66 A;  1SDX A;  3PD8 A;  1LBW A;  4H0W A;  4P47 A;  3U72 A;  5TP9 B;  3RPL A;  1B0L A;  3BFT A;  2ALU A;  4F3P A;  4LON B;  2DDK A;  1NV0 A;  1B40 A;  4N17 A;  3EKI A;  2ZNT A;  4HE1 A;  4PQJ A;  1D9Q A;  3CSB A;  3S9M C;  1PB9 A;  4GWU A;  1FRP A;  5K2X A;  3U1O A;  3CHG A;  1FCK A;  3O29 A;  1JVY A;  4MIJ A;  1QUL A;  5CMB A;  4PP0 A;  3A3U A;  4OEV A;  4GOT A;  2IEE A;  5A5X A;  5ISU A;  1IMD A;  5IZ3 A;  4BDO A;  3U8Q A;  4MMP A;  5CMM A;  4L17 A;  1ELJ A;  1FPK A;  3O6I A;  5H8H B;  4QRZ A;  2XXU A;  4O7M A;  3FXB A;  1UQW A;  4YKK A;  1RYO A;  4C0R A;  3MZ9 A;  1MXZ A;  4KYE A;  1K9Z A;  4N6P A;  1FPB A;  1QUI A;  3DP4 A;  4RPN A;  2MKZ A;  4IO2 A;  2PT1 A;  3K6V A;  4FED A;  4PGN A;  4EQ7 A;  5JEI A;  1SW2 A;  3LV0 A;  4JWY A;  3FD3 A;  4DI4 B;  5L9S A;  3KGC A;  4F3B A;  1DK4 A;  2O1L A;  2FYI A;  2XWK A;  3TZA A;  1WVJ A;  1DPP A;  2QJE A;  2DWH A;  2VOZ A;  2ZZX A;  2XXP A;  1M5C A;  3VE1 B;  2F3B A;  2G93 A;  1URD A;  3CIJ A;  3RPL B;  4O94 A;  2QVR A;  2V3T A;  3G3J A;  3VXB A;  3FV2 A;  5F24 A;  1LEV A;  4DXB A;  3IOT A;  3TTR A;  3MP6 A;  3QXM A;  1B7H A;  3S9L C;  4G61 A;  3H6U A;  5I2N A;  1MQI A;  4Z7E A;  1MDQ A;  4JB7 A;  4GBV A;  2AIX A;  1YCJ A;  2NWJ A;  4XFE A;  2QRY A;  1B4Z A;  5DW8 A;  2XXH A;  4HCY A;  4YU0 A;  1LFI A;  2DXY A;  2Q89 A;  3Q29 A;  4KR5 A;  5A5X B;  4PFR A;  5IZ3 B;  1JW4 A;  3MVX A;  1DOT A;  1YPN A;  4POX A;  1IMA A;  3EPE A;  3C36 A;  2DQV A;  2I3V A;  2LAO A;  3LSF B;  1QJM A;  2D21 A;  3RY3 A;  2XXI A;  1OIB A;  1MG1 A;  3O28 A;  3ONM A;  5BUU A;  3T9V A;  1B58 A;  3G3I A;  4GQO A;  2NUV A;  4E0W A;  1B52 A;  2QFL A;  1IMC A;  3C4M A;  2Y84 A;  2B4L A;  1F9B A;  3ILU B;  1O63 A;  3LBS A;  2X7P A;  3T9H B;  3FBP A;  3IJO B;  4XKN A;  3OEN A;  1ANF A;  3DM0 A;  1Q1K A;  3UGW A;  4ZEC A;  4X48 A;  2V84 A;  1N76 A;  4PFB A;  3D4G A;  1N3W A;  3FVO A;  4PFT A;  3FZV A;  1TT1 A;  1D3K A;  1LST A;  1XC1 A;  2HQ0 A;  1B32 A;  2YLN A;  3EHT A;  5LOM A;  1IIT A;  4GRK A;  4KFQ A;  4U4S A;  1FBE A;  5F7V A;  1LCT A;  1D9Y A;  1EYK A;  1QKA A;  1SI0 A;  2ZZW A;  1OLC A;  1M5D A;  1XI6 A;  3TUS A;  2OJT A;  3FV1 A;  2NVU B;  1KWH A;  5I2N B;  4LUB A;  4AS4 A;  1CE2 A;  4JXI A;  4I1D A;  3MYU A;  1INP A;  2DYX A;  1N84 A;  2BJI A;  2CZK A;  4HW8 A;  1FJ9 A;  5CI5 A;  3Q27 A;  3DEL B;  3SEU A;  1NNP A;  3HHF A;  3CI8 A;  2XWV A;  3MAM A;  4YKJ A;  4TOZ A;  4UAB A;  3K1N A;  4IO7 A;  4GX6 A;  3H6T A;  2X7Q A;  4EQB A;  3WAE A;  1NKX A;  1R9Q A;  1FTO A;  1KA1 A;  1RYX A;  4JVD A;  4OWD A;  3PMX A;  2CMO A;  4XIG Q;  4JSD A;  1LAX A;  1UIU A;  1MY3 A;  3KFM A;  5KZT A;  4P56 A;  3OSQ A;  4I3Y A;  1SW5 A;  3PUX E;  5J16 A;  1GTK A;  4F3S A;  3K6W A;  3RUM A;  3SEY A;  2I3W A;  4FAJ A;  1SD3 A;  1YYZ A;  2ZZV A;  1PDA A;  1XVX A;  4GL0 A;  1YXI A;  3Q25 A;  3T9X B;  1DPE A;  2VD3 A;  1CB6 A;  4OVQ A;  4XKP A;  1JET A;  4BDQ A;  1P1N A;  1TWY A;  2HCA A;  3KC0 A;  1R6Z A;  4I62 A;  1SW4 A;  3CG3 A;  4NED A;  1FQE A;  2I6E A;  4P0I A;  5IM2 A;  1FQB A;  4MLQ A;  3MST A;  4GX4 A;  3ILT B;  4ZEB A;  1H45 A;  3MZB A;  2H25 A;  4DXC A;  3MBP A;  2DWJ A;  2OWS A;  3HN0 A;  1SVX B;  1ZKB A;  4NQ8 A;  1Y1Z A;  2F35 A;  4JSO A;  2GQ1 A;  3I3V A;  5HBC A;  3KC1 A;  4ESW A;  2KQZ A;  4AQ4 A;  1O7T A;  3PD9 A;  1LLS A;  5EHS A;  4N8Y A;  5FHM A;  1EYJ A;  2ANJ A;  3JYR A;  4QSC A;  5EQ9 A;  5FHN A;  3W9W A;  3QK6 A;  2HXW A;  3OEL A;  3E4R A;  1EZP A;  2ZNS A;  1LBX A;  4YB7 A;  5I57 A;  2Y7P A;  4THI A;  1TFA A;  3FAT A;  1LFG A;  1MPC A;  3FXU A;  2JJK A;  2Z23 A;  1MY1 A;  4ZE9 A;  4KQP A;  3FVN A;  4OQO A;  1NV7 A;  4MX6 A;  1VFE A;  2VHA A;  4M4G A;  3OO9 A;  3BKI B;  2OX3 A;  2DE4 A;  3RQT A;  2HAU A;  1ZU0 A;  4NF4 A;  2HZL A;  2Q74 A;  2NOO A;  3QSL A;  3OEM A;  1EU8 A;  3VXC A;  3KJT A;  3MP8 A;  1J1N A;  4IY6 A;  4QFK A;  2GHB A;  1MDP 1;  3TFL A;  1M5B A;  3MQ9 A;  5EQA A;  1RDY A;  1IXC A;  4UA8 A;  4OTE A;  1ZIU A;  4MHF A;  2F7A A;  1P1O A;  2REG A;  2XX8 A;  3MJN A;  5J1D A;  4G8M A;  4X1D A;  2B4M A;  3JV9 A;  5EYF A;  1Y3P A;  1D9V A;  5AA1 A;  1M5F A;  3PPQ A;  4MAG A;  1URS A;  3S9N C;  4RYA A;  4KHZ E;  5EHM A;  4R72 A;  2ZYK A;  1MY4 A;  4IO6 A;  4R73 A;  3TDJ A;  3TEP A;  1SQY A;  1UTB A;  3ROJ A;  4NF5 A;  2ZXT A;  4R9F A;  1DTG A;  4X1B A;  1SYH A;  3IJX B;  1JQF A;  4H45 A;  5ICQ A;  3MP1 A;  1A7L A;  1ZTY A;  1URG A;  2RCA A;  2VGQ A;  1VFD A;  1UTH A;  1HSL A;  1FTA A;  5ITP A;  4PBH A;  1NUY A;  3O97 A;  3B8B A;  5I57 B;  3IO6 A;  4F2O A;  2H9B A;  1PC3 A;  3LSW A;  2CZH A;  3ZS6 A;  3S9E A;  4Z0I A;  5TU0 A;  4IO5 A;  1LBV A;  1H76 A;  4H65 A;  4GFR A;  4FE8 A;  5DT6 A;  3A3C A;  3K1P A;  3RNN A;  5A5L A;  1MRP A;  4NF4 B;  1MXV A;  4O3A A;  1K9Y A;  4N13 A;  3HPI A;  5H8F B;  3LC8 A;  3TCH A;  3N26 A;  1FW0 A;  1XVY A;  4ONY A;  1BTJ A;  3H06 B;  2ZYO A;  5AA3 A;  5KCJ A;  2HXR A;  4ELO A;  4QSE A;  4ISU A;  3GBA A;  5H8Q B;  4G2Z A;  4GVO A;  1KZ8 A;  3C35 A;  4IO3 A;  1MQJ A;  3UOR A;  1B9J A;  2XXR A;  5LDZ A;  3QUJ A;  2Z8F A;  4XEQ A;  3VLV A;  4GWO A;  2ONS A;  5IZZ A;  2AL5 A;  1TFD A;  1QGX A;  2HAV A;  4O3B A;  4H46 A;  4GX3 A;  5DEX A;  3LUZ A;  3R7X A;  3TMG A;  3VVF A;  4AB6 A;  1UTB B;  1B3H A;  1II5 A;  4DXU A;  3VLU A;  4NF6 A;  4R74 A;  4LZ5 A;  2PBW A;  3H7M A;  2I4B A;  4AS5 A;  1FBC A;  3W9V A;  1AL3 A;  1FPG A;  3MVW A;  4I3E A;  2CZI A;  1XHY A;  3HFU A;  1UTH B;  3CR9 A;  5DVJ A;  3G3H A;  3T22 A;  1LB9 A;  2KLF A;  2Z22 A;  2V3U A;  3EF7 A;  5I5P A;  1IMB A;  4G68 C;  5EYG A;  1ZMG A;  1LAG E;  1B1X A;  5B70 A;  3M3L A;  5H8N A;  1EZ9 A;  2BJJ X;  4PFY A;  1IEJ A;  4GLI A;  4MFI A;  1A8E A;  2HEU A;  4KI0 E;  2RIN A;  4HCW A;  5TPA A;  1NUZ A;  3KOS A;  2O7I A;  3SDF A;  5AA2 A;  5I58 A;  1LCF A;  3E9X A;  5KCJ B;  2Q9T A;  5ET6 A;  4OER A;  3KN7 A;  3FJM A;  4E0X A;  5IGA A;  4DCX A;  4MF3 A;  3MC2 A;  1IME A;  2F5X A;  1A8F A;  2ONR A;  4IGR A;  1B6H A;  2ABH A;  1B7U A;  3MZ1 A;  2ZMB A;  2KR0 A;  3A09 A;  1H44 A;  4RNS A;  1MXX A;  4PBQ A;  4QFO A;  4OFL A;  3V8X B;  3T1B A;  1A54 A;  4JWO A;  1VDW A;  4M1V A;  5CRY A;  2R8T A;  1FJ6 A;  2H4I A;  5ICT A;  4U22 A;  3HO7 A;  4Q8R A;  5DEX B;  2Q8J A;  4O7I A;  2QSX A;  5JK4 A;  4F31 B;  4NF6 B;  2DSF A;  2X26 A;  3KN8 A;  5ET5 A;  4LQ2 A;  3S2V A;  1OLA A;  2Y5L A;  4XF5 A;  2B65 A;  4DE8 A;  1MH3 A;  2OBG A;  4MJO A;  4NWD A;  3RYD A;  5CBS A;  1ZJL A;  3SKP A;  4ZZE A;  2AYS A;  3PGF A;  4KCC A;  2PX1 A;  4P1L A;  5H8S A;  3THI A;  1LBB A;  5T3J A;  4FEC A;  4PGP A;  4OEU A;  4U1Z A;  4NTL A;  1B51 A;  3HV1 A;  1FBH A;  3SEW A;  4FJP A;  4ZDM A;  1MXU A;  2O6A A;  1EH3 A;  2QS3 A;  3HCQ A;  3PUV E;  1DSN A;  4N81 A;  1LBC A;  4U2R A;  1XS5 A;  2QS4 A;  3K4U A;  4F1V A;  5TPA B;  2Y7K A;  1FBF A;  3VV5 A;  4C1T A;  2P1S A;  5AA2 B;  5I58 B;  2XXK A;  4U23 A;  4X8R A;  2O51 A;  4MCO A;  4QXD A;  3IOW A;  2VP1 A;  3HST A;  4GL8 A;  1NV5 A;  3C31 A;  3M3K A;  3MW0 A;  2GFE A;  1VSO A;  4AB5 A;  5I84 A;  4F22 A;  4QBA A;  4PET A;  1QUJ A;  4BDM A;  4OFJ A;  2P2A A;  2WYK A;  1N7X A;  5CBR A;  1VE4 A;  3C34 A;  2Y5K A;  2FA7 A;  4GD5 A;  1TXF A;  1IZ1 A;  2F7C A;  1NH8 A;  2H5Y A;  3N94 A;  2UXA A;  3U94 A;  1PB7 A;  3N5L A;  3OXN A;  1FTL A;  3PV0 E;  1NNK A;  4QFP A;  1MQG A;  4DI3 D;  4PC9 A;  5I2K A;  5FHO A;  4NAP A;  4ESX A;  4H8J A;  1NV1 A;  4JVC A;  1B5I A;  1NUW A;  4ND9 A;  3OO8 A;  2XXX A;  1N3X A;  3ZKL A;  4R9G A;  3FAS A;  3G7W A;  4QSD A;  1FPL A;  2DWI A;  3ECR A;  1JEU A;  3TYH A;  5AA2 D;  4EQ9 A;  1P1U A;  2DP8 A;  3Q26 A;  1NI9 A;  1MXW A;  2W7Y A;  4LZ7 A;  1IQ7 A;  2Q8M A;  3BBR A;  2Z8E A;  1AH5 A;  3TKD A;  4ZED A;  4EXL A;  1DBZ A;  3UP9 A;  4H8I A;  1D4N A;  3T93 B;  3ZSF A;  2O68 A;  3B6W A;  2ZYN A;  3H3G A;  4MNC A;  1H43 A;  2I4C A;  3L6G A;  3KSX A;  4KYD A;  3BIH A;  3FXQ A;  4LQ5 A;  1I6B A;  3TTL A;  3R26 A;  2RF1 A;  4N8G A;  4PFU A;  4U21 A;  5CMC A;  3PPO A;  1CNQ A;  5IZ1 A;  3WAF A;  2RC9 A;  2DOJ A;  1NH7 A;  2XD3 A;  2E1S A;  2F36 A;  3G3F A;  3EN3 A;  5CC2 A;  5L9O A;  2A5T A;  1DTZ A;  1B3E A;  2ZNU A;  4KPT A;  4F39 A;  3M8U A;  4OVR A;  3IB0 A;  4OZ9 A;  1Q35 A;  2PFY A;  4NMY A;  4JVI A;  2QPQ A;  1BLF A;  2G29 A;  1JVX A;  4R75 A;  1OQH A;  2DXR A;  4DLD A;  3K02 A;  3GXA A;  2Y7R A;  1B05 A;  3IL1 B;  5I2K B;  3I5O A;  2P3N A;  1FPD A;  4X04 A;  3V89 B;  1IMF A;  2I0B A;  3UN6 A;  3EQ1 A;  1NUX A;  1P1Q A;  5ET7 A;  3E3K A;  3KJ7 A;  1S50 A;  3FGS A;  4ELR A;  1NV6 A;  2AL4 A;  3KOT A;  1FTM A;  1NV4 A;  2FHY A;  3MPK A;  2YJP A;  2CEX A;  2REJ A;  4Q0C A;  3TPA A;  3V5A A;  4OXV A;  2ZYM A;  1T0K A;  3C33 A;  3U93 A;  5DYH A;  3FUZ A;  3QAX A;  4EF1 A;  3PPN A;  2Q2C A;  1MM7 A;  2PCR A;  3R6U A;  2WYP A;  4LA9 A;  1VR5 A;  2QVV A;  3H4Z A;  3GBB A;  2QMX A;  3SEV A;  1WDN A;  1NL5 A;  4R6Y A;  4PE5 B;  1O64 A;  1USY H;  1RDX A;  2XXQ A;  3FJG A;  2PMS A;  2NXO A;  2CEY A;  4OVJ A;  3RT8 A;  4ZEK A;  3TCF A;  1B4H A;  3PMV A;  4P0G A;  2Y7I A;  3GYY A;  4FIM A;  3VDF A;  3MPL A;  3FVK A;  4YIC A;  1S9T A;  4NHB A;  3D1R A;  1G0H A;  1MY0 A;  5ET8 A;  3K00 A;  5F1Q A;  1LGB C;  2Q2A A;  3OO6 A;  4OHN A;  2WKY A;  3K01 A;  2A5T B;  4ZS9 A;  1NV2 A;  4WEP A;  4GF8 A;  3TOD A;  2V4C A;  4GWS A;  1FTJ A;  3TTK A;  1IXG A;  3DLN A;  4H5G A;  3IOU A;  3F11 A;  5DVF A;  2Z8D A;  4FOR A;  1YZ0 A;  2P3V A;  4YKI A;  1B2H A;  2O1M A;  1FTK A;  3JZJ A;  4C1U A;  4YMB A;  2O84 X;  3PMW A;  1JW5 A;  3H6W A;  3OSR A;  4KXP A;  1Y3N A;  4H67 A;  1ZLQ A;  3TAJ A;  4OEN A;  4F19 A;  3TQL A;  1B3L A;  4HXV A;  1WOD A;  3E13 X;  4PFW A;  1FBG A;  3O9P A;  1Z7N E;  1LB8 A;  1R9L A;  3GZG A;  3T0J A;  4LN5 A;  4OES A;  3CG1 A;  4EXK A;  3PU5 A;  1OVB A;  4XXU A;  1Y3Q A;  3FJ7 A;  2PT2 A;  1FPF A;  1FQC A;  2OK2 A;  2M8C A;  4EUO A;  1FSA A;  3BIG A;  4RK2 A;  4P3L A;  4ZZA A;  3PUY E;  4OYV A;  2ESN A;  2HFB A;  3PUZ E;  4NGU A;  2QS1 A;  2XXT A;  3VVD A;  4I9D A;  4ZEI A;  3PPP A;  4TQU Q;  2F3D A;  4UAC A;  1PBQ A;  2V25 A;  5ITO A;  1B46 A;  4RK9 A;  5IAI A;  4BDL A;  2VPN A;  4X9T A;  2RCB A;  1B1H A;  4NF0 A;  3IOR A;  4P9K A;  4OA4 A;  4MBP A;  2XXW A;  4OVS A;  3TCG A;  3CRB A;  3IOV A;  3IB1 A;  4LVQ A;  5JTY A;  2CZL A;  4DDD A;  5HPQ A;  4MEV A;  1QW0 A;  1Y20 A;  1XOC A;  4Q30 B;  2ONK E;  3IX1 A;  4HE2 A;  2QMW A;  2I48 A;  2DVC A;  1SBP A;  4U1O A;  3KBR A;  3T66 A;  4N6D A;  4LP2 B;  3IFC A;  1G0I A;  4PF8 A;  2I58 A;  4NF5 B;  2R71 A;  5FTI A;  3SET A;  3MVZ A;  3S4U A;  2DVZ A;  1OVT A;  2F8D A;  1JW1 A;  3RTW B;  1PB8 A;  3H03 A;  1UIV A;  3A29 A;  3SER A;  4I8C A;  4YMA A;  1XT8 A;  3RGY A;  2V3Q A;  1SYI A;  4GWX A;  2RC7 A;  1AOV A;  3Q28 A;  1NNF A;  5EYH A;  3HHG A;  5M2V A;  4P8B A;  5EQ7 A;  1RKM A;  3B50 A;  5B7D A;  3CFX A;  2QS2 A;  4QFL A;  1IUD A;  4F3G A;  1FQF A;  3BFU A;  4NX1 A;  3O2A A;  2YPN A;  4PE3 A;  4IGT A;  1OQG A;  4ELP A;  2O7U A;  4MLV A;  4PCD A;  3QUF A;  1EYI A;  3PUW E;  1PEB A;  2D3I A;  1AMF A;  1HSJ A;  5ELV A;  2F6P A;  5JTY B;  3KZG A;  1MPB A;  4POW A;  3FVG A;  2XX9 A;  3RPW A;  4WKM A;  1QUK A;  3VFJ A;  4IB2 A;  4DCY A;  3IK6 B;  4N6K A;  1LBY A;  5HM4 B;  2R6G E;  2V93 A;  4JDF A;  3D4C A;  3TTN A;  1MQH A;  4P11 A;  4BDN A;  3K6X A;  2DE2 A;  4N91 A;  4NN3 A;  1GGG A;  4JWX A;  1DMB A;  2DE3 A;  3K1M A;  1LAF E;  1NMU A;  1Q9D A;  5K2Y A;  2UYF A;  1JEV A;  5L9M A;  1GV8 A;  4PTK A;  1MXY A;  1YAE A;  2H99 A;  2F6G A;  2WBB A;  4GWY A;  4DZ1 A;  1B5H A;  2I49 A;  4OMB A;  2L5V A;  3B6Q A;  3GLB A;  4YZZ A;  2OWZ A;  4R6K A;  4ZEF A;  3MWB A;  5H8N B;  5CMK A;  2F34 A;  4MH5 A;  3K6U A;  3C9H A;  2Q88 A;  3OO7 A;  2WEF A;  4H6D A;  3T96 B;  4N4U A;  3M3F A;  4N15 A;  1Y9U A;  4YKP A;  4NF8 A;  4XTC Q;  1A55 A;  1S7Y A;  2P0S A;  1GVC A;  2E0S A;  3IB2 A;  5ESY A;  2FNC A;  3V83 A;  4ZE8 A;  2O69 A;  1MPD A;  2PVU A;  5AA4 A;  1P1W A;  2WX9 A;  4F29 A;  2IA4 A;  3N6U A;  3VVE A;  3SES A;  4FBP A;  4KYS A;  2XA5 A;  2QL3 A;  2B3F A;  1P99 A;  3CFL A;  4PAI A;  3K0V A;  3KN3 A;  4RY1 A;  2QVU A;  1B7Z A;  4F18 A;  1PBP A;  3EHU A;  4G68 A;  2WBD A;  3QYT A;  3LUY A;  4P1E A;  4N07 A;  5I7I A;  3RT6 B;  4F2Q A;  3TTM A;  4FAT A;  2UVI A;  1FPE A;  4R6H A;  3MUQ A;  3W15 C;  4G77 A;  2DS9 A;  4F1Y A;  3ODB A;  4HE0 A;  2F7B A;  2DWA A;  2OLB A;  2F97 A;  2XD2 A;  2UVH A;  4YAH X;  3U92 A;  3RN8 A;  4EDP A;  1YTV A;  2RKM A;  5DTB A;  4PAK A;  4H1X A;  4LZ8 A;  1GR2 A;  3IFA A;  5FBP A;  4FEB A;  4OFO A;  1NFT A;  2VD2 A;  5KDT A;  2XWI A;  1NNT A;  1B3F A;  4GXS B;  1KA0 A;  1I69 A;  2XXV A;  4ECF A;  4U4X A;  4QFN A;  2HPG A;  4YB5 A;  2FIE A;  4NF8 B;  3UIF A;  3CFZ A;  2GHA A;  1MM6 A;  3T9U A;  1US4 A;  4RJZ A;  4PDH A;  3L6H A;  4IR8 A;  5AA4 B;  4KD5 A;  4QF9 A;  3IR1 A;  1BK4 A;  4WED A;  1BKA A;  1FBP A;  3LSX A;  4GIZ A;  3SZP A;  2XHD A;  3H6V A;  4HS7 A;  1R1N A;  4G68 B;  1HSE A;  2OWT A;  4MNP A;  3IO4 A;  3USD A;  1FPI A;  1N04 A;  3DP6 A;  5AE4 A;  2B3B A;  1L5T A;  2UVJ A;  1FQA A;  3O6H A;  3PPR A;  4PDD A;  2HZK A;  1POT A;  1Y1M A;  4IY5 A;  4OVT A;  2H98 A;  1FPJ A;  1MY2 A;  4DIG A;  4EF2 A; 
#chains in the Genus database with same CATH homology
 1ZBM A;  4NE4 A;  1Y4T A;  4RPO A;  2XX7 A;  2OCU A;  1QKB A;  1IXI A;  5BWJ A;  3OD7 A;  3ZKK A;  3LSL A;  1OMP A;  5KDT B;  1I6A A;  2UYE A;  3O6G A;  1ATG A;  1Z7M E;  3I6V A;  4OET A;  1I6Q A;  4G8N A;  3FIR A;  3OEK A;  3UK4 A;  1M5E A;  5I59 A;  4BLA A;  4O3C A;  4JBZ A;  4RA1 A;  2GRV A;  1AIV A;  3KSJ A;  5I56 A;  1N0T A;  4TLM B;  4IO4 A;  1BP5 A;  3LR1 A;  5H8F A;  3SEX A;  2I0C A;  5IKB A;  2A5S A;  3UA8 A;  2OZZ A;  5TP9 A;  4R2B A;  5H8Q A;  1USY E;  4F1U A;  3K2D A;  3FXR A;  3C32 A;  1US5 A;  4GXA A;  3P7I A;  1QVS A;  1B0H A;  3KG2 A;  1LAH E;  4RXL A;  2XXY A;  3G3G A;  1B3G A;  5FTH A;  3RLF E;  4G8H A;  3MVY A;  3QIM A;  4HTG A;  4NWC A;  1SW1 A;  4WXJ A;  3N6T A;  1IIW A;  4ELQ A;  4KCD A;  1MS7 A;  2PYY A;  3KEI A;  5DVI A;  1EZO A;  3TQW A;  2THI A;  3B6T A;  1A40 A;  4LAT A;  1H3D A;  1MQD A;  1POY 1;  5H8H A;  4BDR A;  4YB6 A;  3AXF A;  1Y4C A;  3G3K A;  4TLL B;  1FQD A;  3VLW A;  5CM6 A;  2D5W A;  3B7D A;  4H5F A;  3OOA A;  2F78 A;  1SI1 A;  1BIY A;  1B5J A;  3RTF B;  4K3F A;  4Q5T A;  2RC8 A;  1N7W A;  3IAZ A;  1JNF A;  4XKQ A;  5I59 B;  2R9J A;  3CVG A;  2UVG A;  5I56 B;  4R2F A;  4G4P A;  1IXH A;  3CSG A;  3DP8 A;  2Y7W A;  1LFH A;  1A99 A;  3OMB A;  4QHQ A;  3TEL A;  4XKR A;  3EHS A;  5L8D A;  2GH9 A;  1MH4 A;  3O66 A;  1SDX A;  3PD8 A;  4H0W A;  3U72 A;  5TP9 B;  1B0L A;  3BFT A;  2ALU A;  4F3P A;  4LON B;  1B40 A;  2ZNT A;  4PQJ A;  3CSB A;  3S9M C;  1PB9 A;  5K2X A;  3U1O A;  1FCK A;  3O29 A;  1JVY A;  5CMB A;  1QUL A;  4PP0 A;  3A3U A;  4OEV A;  4GOT A;  2IEE A;  5A5X A;  5ISU A;  4BDO A;  3U8Q A;  5CMM A;  4L17 A;  1ELJ A;  3O6I A;  5H8H B;  4QRZ A;  2XXU A;  1UQW A;  4YKK A;  1RYO A;  4C0R A;  3MZ9 A;  1MXZ A;  4KYE A;  4N6P A;  1QUI A;  3DP4 A;  4RPN A;  4IO2 A;  2PT1 A;  3K6V A;  4FED A;  4EQ7 A;  5JEI A;  1SW2 A;  4JWY A;  3FD3 A;  5L9S A;  3KGC A;  4F3B A;  2O1L A;  2FYI A;  3TZA A;  1WVJ A;  1DPP A;  2QJE A;  2DWH A;  2VOZ A;  2XXP A;  1M5C A;  3VE1 B;  2G93 A;  1URD A;  3CIJ A;  2V3T A;  3G3J A;  3VXB A;  3FV2 A;  4DXB A;  3IOT A;  3TTR A;  3MP6 A;  3QXM A;  1B7H A;  3S9L C;  3H6U A;  5I2N A;  1MQI A;  4Z7E A;  1MDQ A;  4JB7 A;  2AIX A;  1YCJ A;  2NWJ A;  2QRY A;  1B4Z A;  2XXH A;  4HCY A;  4YU0 A;  1LFI A;  2DXY A;  2Q89 A;  3Q29 A;  4KR5 A;  5A5X B;  1JW4 A;  3MVX A;  1DOT A;  1YPN A;  4POX A;  3EPE A;  3C36 A;  2DQV A;  2I3V A;  2LAO A;  3LSF B;  1QJM A;  2D21 A;  3RY3 A;  2XXI A;  1OIB A;  1MG1 A;  3O28 A;  3ONM A;  5BUU A;  3T9V A;  1B58 A;  3G3I A;  4GQO A;  2NUV A;  4E0W A;  1B52 A;  3C4M A;  2Y84 A;  1F9B A;  3ILU B;  1O63 A;  3LBS A;  2X7P A;  3T9H B;  3IJO B;  4XKN A;  3OEN A;  1ANF A;  3DM0 A;  1Q1K A;  3UGW A;  4ZEC A;  4X48 A;  2V84 A;  1N76 A;  3D4G A;  1N3W A;  3FVO A;  4PFT A;  3FZV A;  1TT1 A;  1D3K A;  1LST A;  1XC1 A;  2HQ0 A;  1B32 A;  2YLN A;  3EHT A;  5LOM A;  1IIT A;  4GRK A;  4KFQ A;  4U4S A;  5F7V A;  1LCT A;  1D9Y A;  1QKA A;  1SI0 A;  1OLC A;  1M5D A;  3TUS A;  2OJT A;  3FV1 A;  2NVU B;  1KWH A;  5I2N B;  4LUB A;  1CE2 A;  4JXI A;  4I1D A;  2DYX A;  1N84 A;  4HW8 A;  5CI5 A;  3Q27 A;  3DEL B;  3SEU A;  1NNP A;  3HHF A;  3CI8 A;  3MAM A;  4YKJ A;  4TOZ A;  3K1N A;  4IO7 A;  3H6T A;  2X7Q A;  4EQB A;  3WAE A;  1NKX A;  1R9Q A;  1FTO A;  1RYX A;  4OWD A;  3PMX A;  2CMO A;  4XIG Q;  4JSD A;  1LAX A;  1UIU A;  1MY3 A;  3KFM A;  5KZT A;  3OSQ A;  1SW5 A;  3PUX E;  1GTK A;  4F3S A;  3K6W A;  3RUM A;  3SEY A;  2I3W A;  4FAJ A;  1SD3 A;  1PDA A;  1XVX A;  4GL0 A;  3Q25 A;  3T9X B;  1DPE A;  2VD3 A;  1CB6 A;  4XKP A;  1JET A;  4BDQ A;  1P1N A;  1TWY A;  2HCA A;  1R6Z A;  4I62 A;  1SW4 A;  3CG3 A;  4NED A;  1FQE A;  2I6E A;  4P0I A;  1FQB A;  4MLQ A;  3ILT B;  4ZEB A;  1H45 A;  3MZB A;  2H25 A;  4DXC A;  3MBP A;  2DWJ A;  2OWS A;  3HN0 A;  1SVX B;  1ZKB A;  1Y1Z A;  2F35 A;  4JSO A;  3I3V A;  5HBC A;  4ESW A;  4AQ4 A;  1O7T A;  3PD9 A;  1LLS A;  5EHS A;  5FHM A;  2ANJ A;  3JYR A;  4QSC A;  5FHN A;  3W9W A;  3QK6 A;  2HXW A;  3OEL A;  3E4R A;  1EZP A;  2ZNS A;  4YB7 A;  5I57 A;  2Y7P A;  4THI A;  1TFA A;  3FAT A;  1LFG A;  1MPC A;  3FXU A;  2Z23 A;  1MY1 A;  4ZE9 A;  4KQP A;  3FVN A;  4OQO A;  1VFE A;  2VHA A;  4M4G A;  3OO9 A;  3BKI B;  2DE4 A;  3RQT A;  2HAU A;  1ZU0 A;  4NF4 A;  2HZL A;  2NOO A;  3QSL A;  3OEM A;  1EU8 A;  3VXC A;  3KJT A;  3MP8 A;  1J1N A;  4IY6 A;  4QFK A;  2GHB A;  1MDP 1;  3TFL A;  1M5B A;  3MQ9 A;  1IXC A;  4UA8 A;  4OTE A;  1ZIU A;  2F7A A;  1P1O A;  2REG A;  2XX8 A;  3MJN A;  5J1D A;  4G8M A;  4X1D A;  3JV9 A;  5EYF A;  1Y3P A;  1D9V A;  5AA1 A;  1M5F A;  3PPQ A;  1URS A;  3S9N C;  4RYA A;  4KHZ E;  5EHM A;  4R72 A;  2ZYK A;  1MY4 A;  4IO6 A;  4R73 A;  3TDJ A;  3TEP A;  1SQY A;  1UTB A;  4NF5 A;  2ZXT A;  4R9F A;  1DTG A;  4X1B A;  1SYH A;  3IJX B;  1JQF A;  5ICQ A;  3MP1 A;  1A7L A;  1ZTY A;  1URG A;  2RCA A;  2VGQ A;  1VFD A;  1UTH A;  1HSL A;  5ITP A;  3O97 A;  5I57 B;  3IO6 A;  4F2O A;  2H9B A;  1PC3 A;  3LSW A;  3ZS6 A;  3S9E A;  4Z0I A;  5TU0 A;  4IO5 A;  1H76 A;  4H65 A;  4GFR A;  4FE8 A;  5DT6 A;  3A3C A;  3K1P A;  3RNN A;  1MRP A;  4NF4 B;  1MXV A;  4O3A A;  4N13 A;  3HPI A;  5H8F B;  3LC8 A;  3TCH A;  3N26 A;  1FW0 A;  1XVY A;  4ONY A;  1BTJ A;  3H06 B;  2ZYO A;  5AA3 A;  5KCJ A;  4ELO A;  4QSE A;  4ISU A;  3GBA A;  5H8Q B;  4G2Z A;  4GVO A;  3C35 A;  4IO3 A;  1MQJ A;  3UOR A;  1B9J A;  2XXR A;  3QUJ A;  2Z8F A;  3VLV A;  4GWO A;  2ONS A;  2AL5 A;  1TFD A;  2HAV A;  4O3B A;  5DEX A;  3R7X A;  3TMG A;  3VVF A;  4AB6 A;  1UTB B;  1B3H A;  1II5 A;  4DXU A;  3VLU A;  4NF6 A;  4R74 A;  4LZ5 A;  2PBW A;  3H7M A;  2I4B A;  3W9V A;  1AL3 A;  3MVW A;  1XHY A;  1UTH B;  3CR9 A;  5DVJ A;  3G3H A;  3T22 A;  1LB9 A;  2KLF A;  2Z22 A;  2V3U A;  3EF7 A;  4G68 C;  1ZMG A;  1LAG E;  1B1X A;  5B70 A;  3M3L A;  5H8N A;  1EZ9 A;  2BJJ X;  4PFY A;  1IEJ A;  4GLI A;  4MFI A;  1A8E A;  2HEU A;  4KI0 E;  2RIN A;  4HCW A;  5TPA A;  3KOS A;  2O7I A;  3SDF A;  5AA2 A;  5I58 A;  1LCF A;  3E9X A;  5KCJ B;  2Q9T A;  4OER A;  3KN7 A;  3FJM A;  4E0X A;  4DCX A;  4MF3 A;  3MC2 A;  2F5X A;  1A8F A;  2ONR A;  4IGR A;  1B6H A;  2ABH A;  1B7U A;  3MZ1 A;  2ZMB A;  3A09 A;  1H44 A;  4RNS A;  1MXX A;  4QFO A;  4OFL A;  3V8X B;  1A54 A;  4JWO A;  4M1V A;  5CRY A;  2H4I A;  5ICT A;  4U22 A;  3HO7 A;  4Q8R A;  5DEX B;  2Q8J A;  2QSX A;  5JK4 A;  4F31 B;  4NF6 B;  2DSF A;  2X26 A;  3KN8 A;  4LQ2 A;  3S2V A;  1OLA A;  2B65 A;  4DE8 A;  1MH3 A;  2OBG A;  4NWD A;  5CBS A;  1ZJL A;  3SKP A;  4ZZE A;  2AYS A;  3PGF A;  4KCC A;  2PX1 A;  5H8S A;  3THI A;  1LBB A;  4FEC A;  4OEU A;  4U1Z A;  4NTL A;  1B51 A;  3HV1 A;  3SEW A;  4FJP A;  4ZDM A;  1MXU A;  2O6A A;  1EH3 A;  2QS3 A;  3HCQ A;  3PUV E;  1DSN A;  1LBC A;  4U2R A;  1XS5 A;  2QS4 A;  3K4U A;  4F1V A;  5TPA B;  2Y7K A;  3VV5 A;  4C1T A;  2P1S A;  5AA2 B;  5I58 B;  4U23 A;  2O51 A;  3IOW A;  2VP1 A;  3HST A;  4GL8 A;  3C31 A;  3M3K A;  3MW0 A;  2GFE A;  1VSO A;  4AB5 A;  5I84 A;  4F22 A;  4PET A;  1QUJ A;  4BDM A;  4OFJ A;  2P2A A;  1N7X A;  5CBR A;  1VE4 A;  3C34 A;  2FA7 A;  4GD5 A;  1TXF A;  1IZ1 A;  2F7C A;  1NH8 A;  2H5Y A;  3N94 A;  2UXA A;  3U94 A;  1PB7 A;  3N5L A;  3OXN A;  1FTL A;  3PV0 E;  1NNK A;  4QFP A;  1MQG A;  5I2K A;  5FHO A;  4ESX A;  4H8J A;  1B5I A;  4ND9 A;  3OO8 A;  2XXX A;  1N3X A;  3ZKL A;  4R9G A;  3FAS A;  3G7W A;  4QSD A;  2DWI A;  3ECR A;  1JEU A;  3TYH A;  5AA2 D;  4EQ9 A;  1P1U A;  2DP8 A;  3Q26 A;  2W7Y A;  1MXW A;  4LZ7 A;  1IQ7 A;  3BBR A;  2Z8E A;  1AH5 A;  3TKD A;  4ZED A;  4EXL A;  3UP9 A;  4H8I A;  1D4N A;  3T93 B;  3ZSF A;  2O68 A;  3B6W A;  2ZYN A;  3H3G A;  1H43 A;  2I4C A;  3L6G A;  3KSX A;  4KYD A;  3FXQ A;  4LQ5 A;  1I6B A;  3TTL A;  3R26 A;  2RF1 A;  4PFU A;  4U21 A;  5CMC A;  3PPO A;  3WAF A;  2RC9 A;  2DOJ A;  1NH7 A;  2XD3 A;  2E1S A;  2F36 A;  3G3F A;  3EN3 A;  5CC2 A;  5L9O A;  2A5T A;  1DTZ A;  1B3E A;  2ZNU A;  4KPT A;  4F39 A;  3M8U A;  3IB0 A;  4OZ9 A;  1Q35 A;  4NMY A;  2QPQ A;  1BLF A;  2G29 A;  1JVX A;  4R75 A;  1OQH A;  2DXR A;  4DLD A;  3K02 A;  3GXA A;  2Y7R A;  1B05 A;  3IL1 B;  5I2K B;  3I5O A;  3V89 B;  2I0B A;  3UN6 A;  3EQ1 A;  1P1Q A;  3E3K A;  3KJ7 A;  1S50 A;  3FGS A;  4ELR A;  2AL4 A;  3KOT A;  1FTM A;  3MPK A;  2YJP A;  2REJ A;  4Q0C A;  3TPA A;  3V5A A;  4OXV A;  2ZYM A;  1T0K A;  3C33 A;  3U93 A;  5DYH A;  3FUZ A;  3QAX A;  4EF1 A;  3PPN A;  2Q2C A;  1MM7 A;  3R6U A;  4LA9 A;  1VR5 A;  3H4Z A;  3GBB A;  2QMX A;  3SEV A;  1WDN A;  1NL5 A;  4R6Y A;  4PE5 B;  1O64 A;  1USY H;  2XXQ A;  3FJG A;  2PMS A;  2NXO A;  4OVJ A;  3RT8 A;  4ZEK A;  3TCF A;  1B4H A;  3PMV A;  4P0G A;  2Y7I A;  4FIM A;  3VDF A;  3MPL A;  3FVK A;  4YIC A;  1S9T A;  1MY0 A;  5F1Q A;  3K00 A;  1LGB C;  2Q2A A;  3OO6 A;  4OHN A;  2WKY A;  3K01 A;  2A5T B;  4ZS9 A;  4WEP A;  4GF8 A;  3TOD A;  1FTJ A;  3TTK A;  1IXG A;  3DLN A;  4H5G A;  3IOU A;  3F11 A;  5DVF A;  2Z8D A;  4FOR A;  4YKI A;  1B2H A;  2O1M A;  1FTK A;  3JZJ A;  4C1U A;  4YMB A;  2O84 X;  3PMW A;  1JW5 A;  3H6W A;  3OSR A;  1Y3N A;  4H67 A;  1ZLQ A;  3TAJ A;  4OEN A;  4F19 A;  3TQL A;  1B3L A;  1WOD A;  3E13 X;  4PFW A;  3O9P A;  1Z7N E;  1LB8 A;  1R9L A;  3GZG A;  4OES A;  3CG1 A;  4EXK A;  3PU5 A;  1OVB A;  4XXU A;  1Y3Q A;  3FJ7 A;  2PT2 A;  1FQC A;  2OK2 A;  2M8C A;  4EUO A;  4RK2 A;  4ZZA A;  3PUY E;  4OYV A;  2ESN A;  2HFB A;  3PUZ E;  2QS1 A;  2XXT A;  3VVD A;  4I9D A;  4ZEI A;  3PPP A;  4TQU Q;  4UAC A;  1PBQ A;  2V25 A;  5ITO A;  1B46 A;  4RK9 A;  5IAI A;  4BDL A;  4X9T A;  2RCB A;  1B1H A;  3IOR A;  4MBP A;  2XXW A;  3TCG A;  3CRB A;  3IOV A;  3IB1 A;  4LVQ A;  5JTY A;  2CZL A;  4DDD A;  5HPQ A;  1QW0 A;  1Y20 A;  1XOC A;  4Q30 B;  2ONK E;  3IX1 A;  2QMW A;  2I48 A;  2DVC A;  1SBP A;  4U1O A;  3KBR A;  3T66 A;  4LP2 B;  2I58 A;  4NF5 B;  2R71 A;  5FTI A;  3SET A;  3MVZ A;  3S4U A;  2DVZ A;  1OVT A;  2F8D A;  1JW1 A;  3RTW B;  1PB8 A;  3H03 A;  1UIV A;  3SER A;  4I8C A;  4YMA A;  1XT8 A;  3RGY A;  2V3Q A;  1SYI A;  2RC7 A;  1AOV A;  3Q28 A;  1NNF A;  3HHG A;  5M2V A;  1RKM A;  5B7D A;  3CFX A;  2QS2 A;  4QFL A;  1IUD A;  4F3G A;  1FQF A;  3BFU A;  3O2A A;  2YPN A;  4IGT A;  1OQG A;  4ELP A;  2O7U A;  4MLV A;  3QUF A;  3PUW E;  1PEB A;  2D3I A;  1AMF A;  1HSJ A;  5ELV A;  2F6P A;  5JTY B;  3KZG A;  1MPB A;  4POW A;  3FVG A;  2XX9 A;  3RPW A;  4WKM A;  1QUK A;  3VFJ A;  4IB2 A;  4DCY A;  3IK6 B;  5HM4 B;  2R6G E;  2V93 A;  4JDF A;  3D4C A;  3TTN A;  1MQH A;  4P11 A;  4BDN A;  3K6X A;  2DE2 A;  1GGG A;  4JWX A;  1DMB A;  2DE3 A;  3K1M A;  1LAF E;  1NMU A;  5K2Y A;  2UYF A;  1JEV A;  5L9M A;  1GV8 A;  1MXY A;  1YAE A;  2H99 A;  2F6G A;  4DZ1 A;  1B5H A;  2I49 A;  4OMB A;  3B6Q A;  3GLB A;  4YZZ A;  4R6K A;  4ZEF A;  3MWB A;  5H8N B;  5CMK A;  2F34 A;  4MH5 A;  3K6U A;  3C9H A;  2Q88 A;  3OO7 A;  4H6D A;  3T96 B;  3M3F A;  1Y9U A;  4YKP A;  4NF8 A;  4XTC Q;  1A55 A;  1S7Y A;  2P0S A;  1GVC A;  2E0S A;  3IB2 A;  2FNC A;  3V83 A;  4ZE8 A;  2O69 A;  1MPD A;  2PVU A;  5AA4 A;  1P1W A;  4F29 A;  2IA4 A;  3N6U A;  3VVE A;  3SES A;  4KYS A;  2QL3 A;  2B3F A;  1P99 A;  3CFL A;  3K0V A;  3KN3 A;  4RY1 A;  1B7Z A;  4F18 A;  1PBP A;  3EHU A;  4G68 A;  3QYT A;  3LUY A;  4N07 A;  3RT6 B;  4F2Q A;  3TTM A;  4FAT A;  2UVI A;  4R6H A;  3MUQ A;  3W15 C;  4G77 A;  2DS9 A;  4F1Y A;  3ODB A;  2F7B A;  2DWA A;  2OLB A;  2F97 A;  2XD2 A;  2UVH A;  4YAH X;  3U92 A;  3RN8 A;  4EDP A;  1YTV A;  2RKM A;  5DTB A;  4H1X A;  4LZ8 A;  1GR2 A;  4FEB A;  4OFO A;  1NFT A;  2VD2 A;  5KDT A;  1NNT A;  1B3F A;  4GXS B;  1I69 A;  2XXV A;  4ECF A;  4U4X A;  4QFN A;  4YB5 A;  4NF8 B;  3UIF A;  3CFZ A;  2GHA A;  1MM6 A;  3T9U A;  1US4 A;  4RJZ A;  3L6H A;  5AA4 B;  4KD5 A;  4QF9 A;  3IR1 A;  4WED A;  1BKA A;  3LSX A;  4GIZ A;  2XHD A;  3H6V A;  4HS7 A;  1R1N A;  4G68 B;  1HSE A;  2OWT A;  3IO4 A;  3USD A;  1N04 A;  3DP6 A;  5AE4 A;  2B3B A;  1L5T A;  2UVJ A;  1FQA A;  3O6H A;  3PPR A;  2HZK A;  1POT A;  1Y1M A;  4IY5 A;  2H98 A;  1MY2 A;  4DIG A;  4EF2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...