2OX0A

Crystal structure of jmjd2a complexed with histone h3 peptide dimethylated at lys9
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
349
structure length
349
Chain Sequence
TLNPSARIMTFYPTMEEFRNFSRYIAYIESQGAHRAGLAKVVPPKEWKPRASYDDIDDLVIPAPIQQLVTGQSGLFTQYNIQKKAMTVREFRKIANSDKYCTPRYSEFEELERKYWKNLTFNPPIYGADVNGTLYEKHVDEWNIGRLRTILDLVEKESGITIEGVNTPYLYFGMWKTSFAWHTEDMDLYSINYLHFGEPKSWYSVPPEHGKRLERLAKGFFPGSAQSCEAFLRHKMTLISPLMLKKYGIPFDKVTQEAGEFMITFPYGYHAGFNHGFNCAESTNFATRRWIEYGKQAVLCSCRKDMVKISMDVFVRKFQPERYKLWKAGKDNTVIDHTLPTPEAAEFLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords JmjC domain-containing histone demethylation protein 3A
publication title Crystal structures of histone demethylase JMJD2A reveal basis for substrate specificity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 112
structure length 349
sequence length 349
chains with identical sequence B
ec nomenclature ec 1.14.11.-:
pdb deposition date 2007-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF02375 JmjN jmjN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 2ox0A01
5A7OA 4CCLA 2OQ7A 5FPAA 4UF0A 5A3WA 2OT7A 2Q8CA 4CCNA 4CCMA 5CEHA 5A7WA 5IVBA 2P5BA 5FZ6A 5FP4A 4GAZA 4V2VA 4V2WA 5A1LA 3K2OA 5IVVA 5A1FA 5FZMA 5FPUA 5IVJA 4AAPA 5F37A 5FZEA 3U78A 3ZLIA 4CCOA 5F2SA 5A7PA 4GD4A 4GJYA 5FJKA 2Q8DA 4QXBA 3LDBA 5FYUA 4EZ4A 5IVCA 2OQ6A 5E6HA 2YU1A 5F5CA 3OPWA 5F39A 5IVEA 4D6RA 5A3NA 4BISA 5FZ8A 3AVSA 5FY9A 2PXJA 3AL6A 4XDOA 2Q8EA 5FZOB 3PU8A 4QWNA 3KVAA 5F3GA 5FUNA 5FYHA 2XUEA 5FZFA 4CCJA 3AL5A 5F3CA 5LW9A 2W2IA 5FZGA 5LY2A 5FYSA 5FV3A 3KV9A 5F3IA 5IVFA 4E4HA 5F5AA 5K4LA 4ASKA 4QU1A 5FY1A 4Y4RA 5F2WA 2XDVA 4UF0B 5FY4A 5FYVA 5FYBA 5FZ9A 3DXUA 3N9MA 5FZCA 5A7SA 5A7WB 3N9QA 5FYZA 5FY0A 3N9NA 3PUAA 4LIVA 5FZBA 5IVYA 1VRBA 4QX7A 5FZHA 5FXVA 5A3PA 3AVRA 5FUPA 3RVHA 5FYYA 4HONA 4BXFA 3KV5A 5F32A 4TN7A 4BU2A 3PUQA 3PU3A 4AI9A 4LXLA 3N9PA 4CUGA 4DIQA 5FXWA 5FPLA 5F3EA 5LWBA 2VD7A 5FYTA 5FXXA 4CSWA 2OS2A 4IGOA 3ZPOA 2XMLA 3K3OA 5FPVA 2YPDA 5FZDA 4DO0A 3NJYA 5ANQA 4GJZA 3PTRB 5FP9A 2GP5A 5FZAA 4C8DA 5KR7A 5FZ3A 3PDQA 5FJHA 5FZ4A 5FXZA 4IGQA 3OPTA 4Y3OA 3LD8A 4D6SA 5FP7A 5FWJA 5FZKA 3KVBA 2YBPA 5FPBA 4CCKA 4QXHA 3KV6A 4LIUA 5FYMA 5FYIA 4HOOA 3PURA 4LITA 5A7QA 2YU2A 4Y33A 5FZOA 3DXTA 5FBJA 3N9LA 5FY7A 5FZ0A 3U4SA 3PUSA 5FP3A 2OX0A 2YBKA 2WWUA 4NUBA 5FYCA 5LY1A 4EZHA 5A3TA 4IGPA 5A80A 4QXCA 5ISLA 5F5IA 2GP3A 3KV4A 3N9OA 5IW0A 4XDPA 3UYJA 5IWFA 5FZLA 2YBSA 5FY8A 5FZ7A 4QX8A 2WWJA 3K3NA 5FP8A 5FZ1A 5FWEA 4D6QA 4EYUA 5A7NA 5FZIA 5FY5A 2XXZA 4URAA
chains in the Genus database with same CATH superfamily
1R1ZA 2B45X 2WBKA 3H42B 3GZAA 4XOGA 4A45A 1DDLA 2VZOA 1J59A 3KWVA 3ZFEC 4JX0A 2VAUA 1DIWA 5FZMA 5GLTA 2VZSA 3I59B 5LBEA 3ZVXA 3RWNA 4XW3A 1VRH3 2OVUA 4CXYA 4XURA 4A7KA 4GJYA 4Y1UA 5FJKA 2EXIA 1HB2A 5ERLA 4PLOA 1REDA 3WF3A 2XHKA 4COZA 3VLBB 3OPWA 3Q8EA 4CUAA 3FHAA 5IVEA 3RFRA 4N9IA 5L9BA 4D6RA 5LZ6A 1SLBA 5E89A 2QE3A 4JTOA 3I2KA 4I3GA 2WS93 2X5IB 3IDBB 1TNRA 1F35A 4CEYC 3A21A 2ET7A 1KD7A 3AMQA 3WDWA 4LJHA 4YARA 1W6MB 1PX3A 1ZZCA 2ZGLA 1J1LA 3NW4A 3IBMA 4ASLA 2VNGA 3FHIB 2HYKA 4GWNA 4CEWB 3MLLA 3RQ0A 1K45A 5AVAA 2ZZQA 5F5AA 1EUTA 5EPAA 2WNUC 4WM7C 4P00B 2XDVA 4CP2A 2FZ2A 4JVAA 2MPFA 4CUBA 4XFGA 3AJYA 3T4VA 2IUWA 1TMF1 1JN2P 2WLQA 2WIIB 2RJ2A 5E88A 2W68A 2D44A 5C3QA 5FYYA 1D4M1 1RUI1 3FUQA 2YROA 1JXNA 1Q8QA 1FMD2 2KXLA 2R1DA 3HJRA 3S6PA 4AI0A 1CZSA 1F31A 2E51A 4K21A 4XILA 1ZZ7A 2R071 3WOGA 1BHGA 4CUGA 5IK4A 4WZFA 4AVBA 2JDMA 4N7IA 4LKSA 4IGOA 3RZZA 3IDEA 4Q1RA 4QM8A 2TBVA 5LA1A 2IVJA 2E31A 4DO0A 1LOAA 1N1YA 4LTAA 2IVIB 1S0BA 4MYEA 3MIGA 3VBFC 1ENRA 2GDFA 3DPRA 4DXTA 1TMF3 1LGBA 3PDQA 3BN6A 3B9IA 4RYDA 3TOJA 1MQTC 1OH3A 1ASJ1 2CL2A 3OD0A 3AP4A 2JDPA 2HLEA 2J1UA 2D43A 2LW8A 3SCGA 1D4M3 4FTEA 1BZWA 1RUI3 2XH6A 3O14A 1QHDA 4BK5A 5FYMA 2R061 2JDKA 3FC0A 2ZHLA 2R073 4LA3A 3IPVA 2BNMA 5CBLA 1OKOA 2PHTA 2XUMA 3DEMA 3OY8B 4GALA 4MGKE 4NHKA 3GJAA 5L7OC 5CFDC 3WG4A 1D0HA 1S0IA 2DV9A 4BDVB 5EIYB 2D5HA 4YM0A 4LO7A 2L9LA 2IXLA 2WLPA 5J98B 4KG0A 4OHWA 2RDQA 5CFCC 3ROUA 1O8PA 1V9U1 2AC1A 4URAA 1NA1A 5AC91 1ASJ3 4JHTA 5A3WA 3RZHA 1M4WA 2DU1A 2P3KA 3EQEA 3ASIA 4E8CA 2UWBA 4XFIA 3WP5A 1AR61 1ULEA 4P5YA 4YM3A 4Y5Z0 4YGBA 2XJQA 1H9PA 2R063 4NROA 3V65A 3MW3A 3OUHA 4XYXA 3ZN6A 3KF3A 4AZZA 1Q56A 5JR2A 5F37A 3U78A 5C3OA 3WW4A 2B4KA 5F2SA 3GBFA 4W6XA 4AGVA 5G04L 4TLGA 4DOUA 2B8MA 2WFF2 3FL7A 1WA6X 3OGRA 4U36A 1CAVB 3WNMA 2A5ZA 2R041 2JD9A 1O4TA 4GXLA 2RM22 5FZ8A 4UT5A 1V9U3 5AC93 5CG9A 3O1VA 4ZY9A 4NO4A 4EQVA 1EY2A 3J7HA 3KVAA 2ZACA 3VBHB 2ZGPA 4QT6A 1AR63 4LHSA 2WNVB 4OMCA 4RD7A 1VBA1 2WWSA 1ZA4A 4QGLA 4O65A 5AFEA 4IERA 4AQTA 3V64A 4L11A 1IKPA 1AXYA 2LTNA 4W4ZA 3JB4C 2MEV2 2VZ1A 4Q27A 2HWF2 3A7QA 4Y4RA 2Z5WA 4N53A 2OUJA 3O7OA 1ZVFA 3PVNA 3DXUA 1Z0HA 2R043 1QJY2 1YQ8A 3NL1A 3ZXJA 4EN7B 1RC6A 3TEYA 1JUHA 2A73B 1W9FA 2W0XA 1PZ8A 3ACGA 2GMEA 2WYFA 4MVTA 2RMU2 4H7MA 3DUIA 5FXVA 3HQUA 3AVRA 3SCHA 1DQ0A 1TG7A 2JXAA 3DF0A 1AR81 1FX5A 2R16A 1JHJA 2G19A 1RXGA 1VBA3 4LKEA 1W0PA 2PAEA 4FBFA 4WM8B 3D5OA 1SEFA 3RWKX 1W0NA 2GZWA 2WNOA 1TME1 4XQDA 5FMBA 3USUA 1WW6A 1UNBA 2C26A 3I2JA 5FXXA 3TNPB 5C5TA 5BNPB 1TVGA 4YM1A 3O1UA 2GMMA 3L9JT 3L2HA 1V6IA 2XLFA 4LULA 2DUQA 5DUXA 1ULGA 5DXDA 1Y43B 2JE8A 2Y6HA 4AHZA 4BPZA 3WP6A 1LODA 4CDUB 1D7PM 3LFIA 2WZPP 1DYOA 5L9VA 1AR83 2ZEZA 5ABJB 1ULPA 1SCSA 3TN91 1UU4A 4K20A 3E5XA 3WX5A 4AFMA 2SBAA 1US2A 2YBKA 2VR4A 4FI9A 2YC2A 1TME3 5FK8A 3ILNA 1GV9A 1RMU1 5FYCA 1UL9A 4FPKA 5JXIA 1XE8A 2R0HA 4N8MA 2XL9A 2YBSA 3KGLA 5I8SA 3ACHA 5FZ1A 2ARAA 3KCXA 5DUVA 1VBE2 3W21A 3ETPA 3MW2A 5HV4A 3H3ZA 2P17A 5D8AC 4Q0PA 2JDNA 3NWKA 2CGPA 3KMHA 4FAHA 3NMBA 4M4PA 1JYTA 4CDXA 4V2VA 2W1SA 3T0AA 1HQNA 2WC2A 5IVVA 2QQLA 3TN93 2LRPA 3POGA 4DUXA 2NM1A 4CDWB 5HPOA 1YIFA 1QDCA 4QKFA 1T6GC 3T2QA 3VD4A 1A3KA 4JDNA 1RMU3 2PHLA 5IAXA 5T5JA 1HX6A 1W04A 5FYUA 5T5LA 2JJ6A 3FE5A 4CDXB 2ARCA 4OHYA 4D7YA 4Y24A 2QJVA 5A3NA 3VD5A 1EV11 1OVPA 1PHMA 3HBZA 2VQAA 1KXGA 4Q0SA 4R9CA 3FWEA 1XQNA 2RE9A 4FPFA 4HK9A 2W3JA 2KM2A 1QJEA 4UW4A 2XL7A 5LBCA 4OI0A 1BMV2 4BMEA 1BVP1 3KHBA 5BNNC 3E6BA 5FOBB 1W3VA 5DUWA 3HD8B 2V4VA 1NZIA 1SLCA 3ZN5A 1DFQA 4FTBA 2VOVA 4E4DX 4IV3A 1UZYA 2B46X 3SCFA 1OURA 3W59A 4SLIA 3VBOA 3W5MA 3MIDA 4M0HA 4FP2A 1X7NA 1GOHA 4Z07A 5JZGA 2WZR2 1MEC1 1H6XA 5FZCA 4A42A 1BEV1 3K51A 1T6BX 3WG2A 1EV13 1QGLA 3HNMA 5FCCA 4EWDA 1CIYA 1BBT2 3I8TA 3HNYM 4C91A 1NY71 1HW5A 2QFEA 1QMJA 1CX1A 3RZGA 2JDAA 4FCAA 5DAWA 3N7JA 4F83A 2GH8A 2CHHA 3PU3A 2CY6A 4AI9A 1DGRA 4KG8A 3KT1A 3N4MA 1OF4A 1JZ5A 4IQPA 5LB6A 3ZR6A 2VMIA 4BQ1A 5J37A 2HWE1 2AH2A 4XVHA 3UKVA 2HWC1 5I0UA 5FPLA 2QQMA 4P9LA 5KXBA 2ZX0A 1XYOA 1RUF2 3O5SA 2D3RA 2VZUA 1AYN1 1H0BA 4HKOA 1HXS1 3VKFC 5KXDA 5FZDA 1MEC3 3RJ2X 2AACA 4GJZA 1BEV3 2HBUA 2ZABA 4AEDC 3ZXKA 2NLRA 2K2SA 3AYCA 3W5NA 1OQ1A 3AFGA 3J4UH 1Q8VA 1PIV2 3PVEA 4YW5A 3ST7A 4YZ5A 2CDPA 2IFRA 2XJRA 3AMMA 3UETA 4QB2A 4Q29A 2D6PA 4XQ4A 2BGPA 4DMIA 1O59A 3PURA 3AKTA 3JB8A 3OB8A 4LITA 2IXJA 4DEVA 2FDKA 1LHUA 1CESA 1GP6A 4YVWC 2BU9A 1WBFA 4AWDA 2HWE3 3U4SA 3WF2A 3PVOA 1CWPA 2HWC3 4UYBA 3WHTA 1ST8A 1C8M1 5H9SA 3HBKA 1OUXA 5LBBA 1IGOA 1AYN3 2JG8C 3DKQA 1HXS3 3KS7A 4XDPA 4UAPA 5JMCA 1UOJA 4Z92B 3H8RA 1WMEA 2DTWA 2F4LA 2H6CA 1UKGA 3ZSJA 1AR71 4N9HA 1JYCA 2GN7A 4HVOA 1GFF2 4P9XA 5D1IA 2C4XA 5A7NA 3PL0A 5FY5A 3WNPA 4EN9B 4K6BA 3BUCA 5C4WB 2OQ7A 4D3WA 4YGEA 2E63A 4JKKA 3FFQA 1UKRA 3D0SA 4GH4A 4XUTA 3VBSC 1H1MA 1LNSA 2FCUA 2FDGA 1H8TA 1VMJA 4YW6A 1COV2 5K0UC 1I5ZA 4XHBA 4CU8A 2CYFA 3OPZA 4PT6A 2Q0AA 3W9AA 3NAPC 2QCSB 4RN5A 3WUCA 2Y38A 1FOD1 1C8M3 1JMUB 4QX3A 5GZEA 4COVA 3G6JB 1RJ7A 2XJVA 2ZGQA 4Q2FA 4QX5A 4R9DA 4WV8A 1AR73 5J96B 4BOWA 2FQPA 2E6VA 2GC1A 4FT8A 4JGYB 3HOBA 3AL6A 4M3CB 4XFHA 1LU2A 2BRTA 1XNCA 3LZZA 3X29B 4RS5A 4EN6B 5IFPA 2V09A 2VCAA 4QPGA 1SFPA 5TSWA 4K1YA 1E5HA 5IJRA 1WD4A 3NSTA 4LLFA 5K7PA 1ZBE2 1ND2B 1R64A 2FDJA 3TYJA 1GWMA 1AX1A 3LAGA 1QJFA 4B4RA 5JSOA 1QNYA 2VQ0A 3PIGA 2YFZA 1FOD3 4IEOA 4E2GA 3RRDA 5C33A 2WT2A 1Z7S2 4J1XA 5FY4A 4Z2AA 3O1OA 5J3UA 1YO8A 1HRV1 3WP4A 3N9MA 2GC3A 3LB9A 3NNMA 4A44A 2EALA 1UQXA 3P1IA 1WCUA 4QAWA 3PUAA 3AKSA 1VRBA 3WLUA 1PMJX 4XXAA 1PO11 1IPKA 1F4HA 3R0RA 5E8AA 4WVZA 4CP9B 4NIGA 3OD4A 5FR3A 4NHXA 2QDNA 3LEGA 2DF7A 3WQBA 5FLHA 1OOPA 4WVMB 3JBG3 1WKYA 2D6MA 4TXWA 3OGVA 4QXKA 1JI6A 1YEWA 1O4YA 1W8HA 4KWJA 5GZFA 2K46A 1W3XA 5JOYA 3SH4A 2V4AA 2OS2A 3HT1A 4I30A 1B35A 3HEIA 1HRV3 3SITA 5EP9A 3QLQA 3I54A 3CJIC 1GUIA 2CV6A 4Z8BA 5FJHA 2VZ3A 5FZ4A 3AMPA 4FPHA 1PO13 2W5FA 1NCQA 2BWAA 1JOJA 4X6RB 4BWOA 4NMIA 3CQOA 2YBPA 2LM3A 3CIHA 2LALA 2WJSA 4HSJA 4PIXA 5FYIA 3PHMA 1DQ2A 2BOJA 4QD2A 4RFT0 5JI9A 2VC9A 3LF7A 1XNKA 5EYXA 1NQJA 1NCRB 3PUSA 3B01A 4CYDA 1WMXA 5A3TA 3O1MA 1PO21 4IV1B 4FSJA 1S55A 2X09A 4JKLA 4ZU4A 4NRPA 3ZFGA 4AHXA 4OLLA 2V72A 4JTNA 3OYWB 4XUPA 2F4PA 4XDQA 5GKAC 3B94A 3ZFFA 3ZKYA 4D6QA 2YXSA 3T2TA 1UYZA 4BJ0A 1IS6A 3HT2A 4NOTA 4Y1ZA 1VMFA 5T55A 5KC5A 2Q8CA 1CR7A 5JIAA 3P3PA 4PLMA 4EV0A 4YFWA 1LR5A 2ZCWA 3FFZA 1L3JA 4V2WA 4E9KA 5I8TA 1PK6C 3CZJA 4CPBA 4COYA 4QM9A 4YSFA 5BPXA 3LDKA 2VBPA 4AAPA 2GALA 2PN5A 2XVKA 4OYUA 4PDWC 2TUNA 4KU8A 1MR5A 5C9AC 4HG6B 1UU5A 3R05A 3WW3A 4BQWA 2BNOA 4CVUA 1DGLA 3MGUA 4MV2A 3WT3A 1I5PA 1PO23 4Q4V2 4AR2A 2O8QA 5IVCA 4Y22A 5KC6A 4HPKA 4YVSC 1N3OA 5IAVA 5LK5A 2IZWA 2XLGA 3FLTA 3U14A 5FO7B 5LK7B 5IATA 2PXJA 4QQ2A 1R1A2 4ZONA 2YGMA 5FZOB 1DQ4A 1JOBA 2PFWA 2PQQA 4LK7A 2PHWA 1RYYA 4RGKA 5F6KA 1Q3EA 3ETQA 3KB5A 1UY2A 1S0FA 2VQUA 4CU6A 2DCZA 5DAPA 4MXWB 1W2TA 4ZZ8A 4NRQA 4WZCA 4KGGA 2WN3A 5A70A 3GZUC 4NE9A 1X8MA 1EAH2 2XBO2 5IVFA 4L9BA 2O8OA 5DZEA 1GZWB 3ZO0B 2BV4A 2Y26A 2PAKA 2C1FA 3B93A 3D3AA 4DFSA 1IG0A 1QJX2 1W6PB 1WLTA 2R1BA 4ZS2A 1IQAA 3VDDB 2VMFA 5KHGA 1URXA 2Y6FA 2DBIA 4N43B 3WEZA 4E8DA 1KQRA 5FZHA 1SBDA 5FQ0B 4ZZ5A 2PHRA 1MZFA 2ZKNA 4F3JA 1IS5A 3RYRA 1RTVA 2CNAA 1JYNA 1JUIA 3VDDC 1CAWA 3ZXFA 2BPA2 2A70A 4UW6A 3V0BA 4RR3C 2BDRA 3LSDA 1VPHA 3VKNA 1H4HA 2VW2A 4AVAA 1KDMA 2QQIA 4W8JA 1FAYA 4XMIA 4Q4W1 4QB1A 2XMLA 1HJGA 1UZWA 3NNJA 3VBRA 1VMHA 5E1RA 1OUSA 1AXKA 4LHKA 4AGGA 1CAXB 3E5UA 4LBQD 1GBGA 3VKLA 1O5LA 3I3DA 3PTRB 4CDQC 1Q43A 2ORZA 3DYPA 4C8DA 3QD6A 5B2GB 3RZKA 1ODMA 4GWMA 3VZOA 2Q4SA 4DRRA 4EN0A 4LBKA 1GWLA 3VZMA 4LHNA 2VQTA 2DVFA 3LD8A 4A7ZA 2PAMA 2Q1FA 1DGWA 1PVC2 4MGZE 4K9SA 1GICA 2UU8A 3GZTB 1QQP2 4FFHA 4HXCA 2NN8A 4ITCA 2B39A 1Y4WA 2WDBA 1IZ3A 3I97A 5BNOB 1BQPA 2Y6KA 5SV5A 2IXCA 2XKOA 4MO3M 4Q4W3 5KXEA 4IETA 3Q8CA 2HEWF 5K8SA 5LRRA 2IXIA 2C9KA 3ZYIB 1D4VB 3UK9A 3K3NA 1DG6A 3ATGA 3VBUB 1SBFA 2QZ3A 3C8XA 2A75A 3ALQA 2JG9B 2PHXA 4KU7A 4PJYA 1UOFA 1V6OA 3I49A 4HMZA 1W9SA 2P6HA 2ZEWA 3AXEA 4KGQA 3HQRA 4IEXA 3JCIA 5DAXA 2RJLA 1T2XA 2W1UA 3SH5A 3V56A 3M3QA 5KHHA 2JDZA 4I0WB 1ENSA 1H2MA 3AZYA 3ITQA 4NPMA 1UY4A 3NVCA 5CVRA 3IIAA 3ZSKA 5IK7A 2PHUA 5IK5A 1HB3A 1ZBA2 1W6NA 1Q8PA 5HXVA 4AFAA 4E4ZA 1CPMA 2UY8A 1DF0A 3B5LB 2PYTA 3O0VA 2BBVA 1XXNA 4OUEA 3MLKA 2QQNA 3WCSA 4BQXA 5HI0A 1G9FA 2PTMA 5EJ1B 2ZHKA 3J8F2 5I93A 4BK4A 5C8WA 2VVFA 4META 3CLPA 4QGMA 5JLVA 2VZRA 1OFNA 3WV6A 1TQ5A 4FPOB 3QH7A 3ZFEA 1ZRRA 3FHQA 3WD5A 1IS4A 1GNYA 1UW8A 3N7LA 4PI2A 4PQ9A 3O1TA 1SLTA 1QF3A 1WA4A 3UJQA 4NVPA 5C8CB 1FMD1 1XE0A 4MGQA 4JGZA 4NRMA 4XABA 3WHUA 4UBGA 5C7GA 2Y6JA 3K4DA 4K8RB 4DRVA 1RUOA 2A71A 2EIDA 2AGSA 1YRZA 3AZZA 1W8OA 3DGTA 1JZ6A 5FYVA 4F7ZA 2VGDA 1HQLA 1NAEA 1UXZA 3ON7A 4MGSA 3LQCA 4GQ7A 2Q1MA 3AP9A 2D3SA 1ZRDA 1WCSA 1VAKA 4CEYA 1LOBA 3KCYA 4HBNA 2I74A 1QU0A 3VL9A 3LFMA 1F15A 4XFBA 2VH9A 4QHZA 3ZPYA 1DZQA 1MVQA 2VMGA 3JQXA 3N3HA 3POFA 2BOIA 4AHYA 5IYYA 1FMD3 1E5IA 2VVEA 4QU2A 3T2OA 1S0GA 2EXJA 1RUE2 5JPMB 1N1VA 2WNUA 2X5IC 2P34A 2WNEA 3C7HA 1Q8SA 4WM7A 3GCWA 3KQRA 4TLFA 5L19A 5GZDA 5LWBA 4COUA 3O0XA 2W1QA 2D97A 5FPVA 5FBZA 2YPDA 1ULDA 3QH6A 4I09A 1QH7A 4CEWC 4PQQA 1EUUA 5KR7A 1GQGA 3ZM8A 5FXZA 1AX0A 1QJU2 1RUG1 1X50A 1WUVA 4W65A 1U5XA 3MBWA 3U1XA 5K9YA 3S57A 2BEOA 3D4KA 4IE0A 4JDOA 1KS5A 2WFPA 4ET7A 4LLOA 1YLLA 4OZOA 1QNWA 4A6SA 2CTVA 4M3CE 4DINB 2YU2A 3DXTA 4K3UA 5FBJA 1LOEA 4JRAA 2J42A 4EZHA 1OQDA 1OXCA 4LO8A 2GP3A 1Z78A 2VL4A 2EIEA 4I01A 1Q5OA 1BK1A 3O1RA 3VBFA 3W20A 2WS92 3UV9A 3CL1A 2FCVA 5APAA 3U07A 4OCTA 1MQTA 2RM21 5LA2A 2Y6LA 2P2KA 1RUG3 3MW4A 1C5IA 1YJKA 2WO7A 2ZEXA 2G4IA 3BB6A 5DABA 4ORFA 2BWCA 1LEMA 1SBEA 2D6KA 2PLV2 3H8XA 4K7JA 2VNOA 4NIAA 3HIFA 3POYA 3GXUA 1YYNA 2ZPXA 5A1FA 1BJQA 3HR9A 4AW7A 1PNGA 1TZOA 5L7OA 5JXGA 3KSCA 1A6CA 3TEXA 3DPRB 3BYWA 4XF9A 2OKXA 2VNVA 3ZDVA 2HKXA 1W06A 4UOJA 1LKNA 1K5MA 2VU9A 4C1WA 2G9FA 5CFCA 3EBRA 4XUNA 4KMQA 3BODA 3M3OA 4R9BA 2Q5TA 2YY1A 2RM23 3TEZA 2FZ1A 3VUOA 3Q9OA 2Q8EA 4BQ3A 4QWNA 3IPVB 4PF5A 4URTA 1MS1A 5FZFA 4CCJA 1NE6A 3GF6A 1S2EA 3SXWA 4D94A 4I0BA 2RVAA 3ES1A 1L7QA 2WN2A 3KV9A 1XJAA 1X36A 4P9JA 5F3IA 2DBNA 2AYHA 1W0OA 1JZ2A 5FREA 4QKNA 1NA1B 2AENA 3N35A 3NV1A 4JZRA 1UIKA 3K77A 4NWWA 4XAAA 3ZOIA 2OZ6A 1YI9A 3MV01 1OSGA 2F6BA 3LEKA 1O6UA 3HN3A 3N9QA 1TMF2 3C3VA 2DUPA 2QQWA 3MPBA 2H6BA 1CAUA 4Q4Y1 1NXD1 2VNRA 4FOVA 3TNQA 3ZN6B 1C3HA 1AR92 3WNLA 4CE8A 2CWMA 1BK0A 4R8HA 3WNKA 3J9SA 4LBOA 1D4M2 1RUI2 2VUDA 1OD3A 1RHI1 2WT1A 2R32A 4PLNA 1YFUA 5EZWA 2FMYA 2R072 3PNAA 2Y6GA 4J25A 4O61A 1S2BA 1QOOA 2DCKA 3T0BA 5GLVA 3OEBA 2I45A 2CWSA 2D3PA 1R082 4CXXA 4Y5SA 5A1AA 3KD4A 4INDA 4CSWA 2HWD2 2VJXA 3I2HA 3K3OA 3VBHC 1H2KA 5T5OA 5JR7B 2WNVC 3WW2A 2J1AA 5ACA2 5I0DA 2UY9A 4Q4Y3 3JUUA 1VB4A 1X33A 3FX3A 3GBGA 1V6KA 4YZ1A 1ASJ2 4FOWA 5FLJA 1POV1 2C6SA 5FMOL 5JUVA 1KJRA 1OHFA 4LUKA 4BIFA 2PQSA 1AL0G 2W91A 4PIYA 3MZHA 1RHI3 5FTTC 3VV1A 1OLRA 2WQ8A 1LOFC 1CZTA 4N53B 3WG1A 1JZ3A 1NOVA 1UZZA 1RUD1 1LHNA 3KT4A 2DVBA 3B69A 1SACA 3AP5A 5LEJA 4NUBA 1C57A 1YFXA 5JAXA 3I3MA 2DUOA 4B7KA 3POWA 4LO5B 3THPA 3UGFA 2F17A 4ONUA 4F8AA 3E6DA 5A3MA 2ADEA 2WWJA 3BVCA 1V9U2 5GALA 3VHOA 3NO8A 4W6WA 4QDRA 4WM8C 2HWB2 4YG0A 3ZYPA 5AC92 1POV3 3IM0A 2IC1A 5IUQA 4XJ9A 5H9PA 5J09A 4LEJA 3ACIA 3GHMA 2PHFA 4AVCA 4CCNA 5BNPC 1EP0A 3USUB 2ZX2A 4IXLA 4RSUA 4OHXA 2GNTA 1W6OA 1GWKA 4SBVA 3UNPA 2GSYA 1AJOA 1RUD3 1Y9QA 1N1SA 3MIFA 4AI3A 4CCOA 5KBFA 3H1WA 4LBNA 1C1LA 3TWIA 4CDUC 5CKQA 5F9TA 4XUQA 4LE4A 4YRDA 1NLRA 2R042 1WBLA 4EROA 3AZVA 4NHYA 3TB0A 3ZYGA 5F5CA 2WZR1 4OI1A 4I0AA 4OUSA 5ABJC 1JU3A 4QQPA 1OKQA 1ZZ9A 3F2ZA 2UYAA 5D8AA 1GZCA 3PJYA 4S2DA 1BBT1 1PGW2 3WY6A 1YXWA 3DCQA 4LBQA 5FFOC 2OW4A 3DKWA 5EQUA 1QEXA 4HVQA 1F8VA 5H9QA 4AEKA 2Q1ZB 4XETA 5LA0A 1JZ8A 1ZX5A 1W8FA 2VZPA 3OBZA 1HB4A 5LY2A 2YMZA 4E27A 4YLZA 1ACCA 2ES3A 3ES4A 4Q1PA 4CZSA 4DUVA 3K4AA 4LKDA 2Y8KA 1REFA 4ASKA 2XHNA 2ZX1A 5FMDA 5FY1A 2ZHNA 3SKJE 2EAKA 1FV2A 1VBB2 4QPIA 2AREA 2WZR3 4FFGA 3S5QA 3OBAA 3ILFA 4G4FA 2EVXA 3PIJA 3WG3A 5M0TA 4HETA 4E4SA 4CDWC 1BBT3 1QWRA 2YZ4A 4KWLA 4PI0A 4KL1A 5FUPA 1LOGA 3RVHA 5BNNA 3POIA 2BP6A 4NN0A 1NX9A 1LRHA 4B3NA 1AZDA 1GZTA 2JECA 2VTXA 4QPIB 4CDXC 3CNAA 1AXZA 1TME2 1VALA 4IDZA 4L99A 3PMSA 3NJXA 3C7OA 3GBWA 2JICA 3OCPA 2OUHA 2VUCA 4OUMA 4XCAA 4AVVA 3ZPOA 1KFXL 2WO1A 1F2NA 4JQRA 4BB3A 3UT0A 3TRSB 3BGAA 3G7DA 1YHFA 5FAXA 1O3TA 1QH6A 2EICA 3LGRA 3HMYA 3JZVA 2ENRA 3BTXA 1VP6A 4UWDA 1AL22 3WP3A 1WCQA 1HRI1 3APBA 1LULA 4IGQA 2YHJA 1JYXA 1SCRA 3AYDA 3M70A 1K12A 1DP0A 2FBEA 2G9ZA 4KQ7A 5EV7A 5FWJA 1JYWA 3PLQA 5CISA 2O0OA 3KVBA 3S0MA 2R49A 1ZREA 3CZUA 4IV3B 3BU0A 3THDA 3J7NA 3LA7A 4QXHA 4XAEA 5DPNA 3VBOB 1TEIA 5JZGB 1GNHA 2P1BA 4D7SA 1O3SA 1AJKA 1RMU2 5FY7A 3EJKA 5LY1A 1REEA 5EWSA 3CDZB 3MV11 2ZEYA 5JPNB 4FOYA 3RYPA 1YI7A 1WLWA 5CU1A 2W9XA 3KZ4C 2ZBJA 5LATA 2R7EB 5FZLA 5CNAA 4AEDA 5FY8A 4L0PA 4QMAA 1OLME 5FUIA 1NKGA 3V0AA 1JBCA 2YV8A 3L2YA 3N36A 3OF1A 4LE3A 1HRI3 5FKBA 1U5IA 1S1AA 3O12A 1DYKA 5A7OA 5FPAA 4ASMB 1LTEA 1LCLA 1QDOA 1ZM1A 5A7WA 3JQWA 4MOAA 1AYM1 1WW7A 1OT5A 3WXPA 1HN1A 2JENA 4YVWA 3T30A 4MHUA 4XACA 1OQEA 3Q8BA 4OHZA 1ZBE1 4NPRA 3SQOA 1W28A 5DDJ1 3RNSA 3LE0A 5LCWL 3PUIA 1ZRIA 2JG8A 1LEDA 3FMGA 5BUVA 2VOKA 4JC1A 1W9WA 1GNZA 1YQ2A 2VM9A 2A7AA 4CCDA 3S7EA 2VO5A 4BXSV 3ACLA 4ISRA 2JEMA 1J83A 1EV12 2RS12 3PUHA 3H8UA 1GMMA 3OG2A 3URFA 3A22A 3LA3A 1W2NA 2GU9A 3AC0A 1D2QA 2JDYA 3BCWA 5JSPA 3OBRA 3UKTA 2W08A 3SLIA 4P9WA 1SDWA 3VBSA 2Y64A 3IB3A 3JXSA 5EJZB 5FUNA 3AZXA 1GU3A 2XUEA 3VKMA 2W1WA 5GLWA 3PTYA 1AYM3 2W2IA 5FIXA 5K0UA 5DZGA 3NAPA 4H2AA 1W05A 2JIJA 1ZBE3 2J1SA 3RI9A 5DDJ3 4P14A 2NPIA 2E7AA 4RQPA 5A33A 5C4WC 1FXZA 4YNIA 5K4LA 4UFKA 1MEC2 1BEV2 1UMZA 1NZCA 3RJRA 4M0NA 3AZWA 1LJ7A 4GH4B 2I07B 4A41A 1NY72 3N9NA 1H8TB 1KRIA 3SH3A 1E5SA 4AF9A 1DQ1A 3POBA 3QOPA 5LBFA 4CTEA 2XJSA 2VVDA 1I1EA 3MUZ1 4X8NA 4MGTA 3VHPA 4FVVA 5F32A 2E7QA 4JKMA 4BU2A 5L9RA 1FNZA 2VCCA 2BW8A 4XF4A 5JVVA 2DVAA 4QQLA 3WDTA 4JGYC 1DHKB 2E32A 2A3YA 3H7YA 1AYN2 1HXS2 4QKDA 2VD7A 5C5UA 4ZU7A 4R4XA 3MIEA 1XE7A 3IKWA 4GMP1 4RL7A 3T3YA 1XPWA 4NIIA 4RS5B 4QPGB 4X8PA 4PF1A 5AVPA 1UXXX 4HN0A 4YW4A 1ND2C 2Q30A 3R4SA 1GOFA 4YZ4A 4RHV1 4GKXA 4P08A 3OUIA 1VBD1 1FNYA 3I7DA 1DGRN 3VHNA 4FQ4A 4RS5C 2YGLA 2EIGA 1CN1A 1G8WA 3E1F1 3NV2A 4JHZA 3TEWA 2AZ5A 1RB8G 4NHMA 1UO9A 3A4UA 1GOGA 1SHWB 2Z4FA 4FP3A 4UFHA 4DNYA 1RUC2 5L36A 1PGL2 5JOXA 2WSVA 4E2QA 5KHKA 1N3PA 3NV4A 4RFRB 2XKPA 5B4XA 4QXCA 1N3QA 4DB5A 2XVGA 4GMP3 1CVNA 3CJIA 4QHOA 4UW5A 1AR72 1NLQA 2IFWA 2WYSA 3U0ZA 4IEUA 3C7EA 4K1ZA 1UMHA 2PA7A 1GYKA 2XWBB 2JIGA 3IZOA 1IPSA 1V6MA 1DQ5A 1OOPB 2OIIA 4RHV3 3UJOA 3M8LA 1QOTA 1R1A1 3EYPA 3UKNA 3VD9A 1LOCA 3GALA 5CEHA 2ZX3A 2VUJA 1KDKA 1O5UA 5CA6A 1VBD3 4S2HA 3LIHA 4OFGA 4ARYA 4YW3A 3GCXA 4FPCA 1WW4A 4ATFA 4C1XA 1B35B 1GKBA 4NPLA 2ZXQA 2E9QA 2JDUA 5FKCA 5FPUA 5IVJA 4I2OA 3EB7A 4UI9L 2GMPA 5T3NA 4DS0A 4HN1A 1O3QA 1W8ZA 4MG2A 3BOWA 1OA3A 1OA2A 3I2FA 1J1TA 1I3HA 3MIBA 2J1VA 4IEQA 1NCQB 4EZ4A 2ID4A 1QJX1 5A3OA 2TNFA 3M7AA 5T50A 3NKGA 5BXXA 1O8SA 3ZDSA 4QPWA 4B8EA 2V73A 4N90A 4H3WA 1V00A 5F6LB 5JIUA 2ERFA 4XDOA 1NCRC 4MUVA 1RUH2 5JDBA 2ZMNA 1R1A3 1VBC1 2WUHA 2ZGNA 3ZYJB 3ZXAC 1PK6A 2JE7A 2OZJA 2NP0A 2VZQA 4IV1C 1DZTA 2IWGB 3LOIA 3JBG2 4GWIA 4PDWA 2YYOA 3ZFGB 4O9GA 1VAMA 2RR12 2X10A 2YC0A 3ZFFB 2SLIA 4Q4X2 3NRUA 1BVVA 1HRV2 2RS32 4YVSA 1W8WA 4YG3A 5FYBA 5A32A 1HQWA 4BE3A 1QJX3 1RUJ1 1TNFA 3WQ1A 2CGNA 3RZLA 3VZJA 1MS3A 1MVEA 4QX7A 2XVLA 4CXWA 5A3PA 1UD1A 1VBC3 4DZGA 1UYPA 2XGXA 3T2PA 3KV5A 1XB9A 1WMFA 2VOTA 4Q0VA 4UFJA 1R091 2D40A 2TEPA 1ONAA 2QBXA 4Y22B 4LT5A 3AKPA 4HPKB 1SPPA 1VAVA 4KBZA 4P02B 1PMHX 3POSA 1FATA 4X6QB 4AK3A 3LEMA 2FHRA 4DUWA 5GZGA 3KQ4B 1A8DA 5FYTA 4GZ9A 1I9RA 4AE2A 2B9VA 1YCIA 3J7LA 1W39A 3USSA 2QNKA 1RUJ3 1S0EA 4XXPA 5FP9A 1UPSA 5FZAA 2A6ZA 4I02A 2PHDA 4C90A 4DY3A 2BVBA 3J26N 1KFUL 2HBTA 2LROA 4D0QA 3H7JA 2N7GA 4AEJA 4QQOA 3OEAA 3A23A 1HB1A 3DECA 3GHNA 1UY0A 2D98A 4KH9A 4PBOA 2BGCA 1UU6A 4RR3A 1R093 5CKNA 1U5ZA 4HK8A 1MS9A 1LENA 2VMHA 2WKKA 3LPGA 4Y33A 4N43C 4XJWA 1Y7BA 3ZSEA 2WWUA 4MXVA 4Z82A 2IXKA 1SFYA 3AKRA 5FMOS 4AOCA 4JRLA 1ZBA1 2VW1A 3NV3A 3N9OA 4XZPA 4LORA 1W8UA 3LIGA 4CDQA 2CAUA 2RV9A 4MX3A 1LAJA 5BY5A 4MGYE 2BYVE 4EYUA 4PIZA 1I6XA 1CAWB 1WD3A 5FZIA 4LK6A 3IMMA 3V0BB 4CCLA 4UF0A 1NE4A 2QVSB 1E5RA 4CCMA 4NIDA 1S0CA 1NG0A 2P5BA 4FFIA 5FZ6A 1L7RA 3BOPA 1PVXA 4HSLA 5T54A 2GAUA 2VCBA 2A6YA 1LU1A 3M1HA 4Y1XA 3VBRB 5A1LA 2ZHMA 3PMEA 4IESA 4ZXEA 1CQ9A 3VDCA 3DYOA 5FZEA 4A3ZA 4YM2A 3CF6E 2RDSA 4Q0QA 5B4NA 5A7PA 3MI8A 1RVF2 1ZBA3 3JD72 3LDBA 3WDUA 5CZKA 5D21A 3CHXA 4OHVA 4PBPA 2CAVA 2BUKA 4FTSA 4R9AA 1K42A 3NNFA 2AR6A 1U5YA 5DZFA 3ZXGA 4KI5M 3ILRA 1W6QA 3D8CA 4HVRA 5FY9A 1XYPA 2BTVC 5GM0A 1J58A 1UZ0A 2VECA 2VTXJ 4GB32 2QZ2A 3SEEA 5BNOC 5F3GA 3U11A 3KF5A 3M4FA 1CJPA 5E16A 5F3CA 2J1EA 5FOJB 4FAGA 1WLDA 5FZGA 4M4RA 4LO4B 3VBUC 2BVVA 1ND3A 4Q8LA 2DFBA 2GN3A 2JG9C 1QJZA 4XTMA 3AJZA 1UIJA 3I2DA 5KHIA 1OI6A 5C70A 4CU7A 1G9CA 4L92A 2W47A 1UOBA 2D6NA 4FXGB 2VZVA 1MZEA 5FYZA 2ZA9A 4QB6A 5FY0A 4ES9A 2FCTA 5D2AA 1UYYA 2VZTA 1DLLA 1QJU1 1J3PA 1W8NA 5F7UA 3FUOA 2QDRA 4H7LA 1C8NA 1W6NB 3RYKA 4BXFA 2DWRA 2EAAA 3LA2A 5CIRA 2LS6A 1PM7A 3HWJA 3H1YA 3B3QE 3GYDA 4Q5OA 4YGDA 5SV8A 1ZZ8A 3R6SA 3WQ0A 4BQ2A 2X05A 4XF3A 4DIQA 1YJLA 2RS52 1DYPA 1ZZBA 1NLSA 4OZXA 2VCMA 4Y5TA 1UOGA 2D6LX 2WQ4A 3MFCA 4XPVA 3ZFEB 4IUGA 3I59A 4Q26A 1OLMA 2WT0A 4HT1T 1STMA 5C8CC 3SEPA 3WCRA 3MF6A 3AKQA 5FK7A 3RDIA 4CRQA 4EN8B 1SQ4A 5HXMA 4JGZB 3RPQA 1X8EA 1QJU3 1LB2A 5FP7A 2ZGSA 1JS9A 2RHPA 4K40A 1FPN2 2PLV1 3H0OA 3Q8AA 4YW7A 1KJLA 4EJRA 5EJ3A 2VTFA 2R6QA 3CO2A 2X5IA 3VZKA 2QQKA 2W39A 4JGZC 3ABZA 4DXZA 2ZS6B 3SHRA 5I0TA 4CEYB 1XC6A 1BCXA 3ZSMA 4FPYA 1W6MA 5ISLA 2P4EA 1X82A 3KV4A 1JYIA 3RMYA 4CEWA 4LO6B 1AVBA 2WZ8A 1ULOA 1W9YA 3OOXA 4IEYA 4WVVA 4Y1YA 3ZXEA 4BYYA 5JWPA 2CDOA 5F5QA 3ZR5A 4V1PA 4AGRA 2XXZA 3MHZA 1RINA 2Y60A 4MZUA 4P5HA 1WW5A 2WNUB 1HN0A 1ENQA 4WM7B 1HV1A 2NMOA 1VIWB 3P3NA 2PLV3 5CB7A 1KGYA 2ORXA 5JOZA 5FRAA 3VZNA 4HL0A 5FPZA 1XNAA 4M00A 2ZMKA 4XFFA 2Z2SB 5HCBA 4YZ2A 1VRH2 4CP1A 2YB7A 1FYUA 3BTZA 3QBQA 1CGPA 2Y0OA 2AEZA 4JCKA 1UX6A 1CIWA 3OJBA 2Q8DA 3TBDA 3AYAA 4YYOA 3RZMA 4LNVA 5GLZA 3B7MA 3BU7A 5J7MA 3KGZA 3FJSA 2YU1A 4NAMA 1XU2A 2WFF1 4Q0UA 1XOYA 1S4CA 1WWYA 4JV4A 4ES8A 2C0ZA 1UN1A 1YUDA 3HQXA 1AR91 1FV3A 5LA9A 2Z42A 5JMOA 2CSGA 2QQPA 3WUDA 4LHLA 4NAOA 3I2GA 1QXJA 2JKBA 1PNFA 3AXDA 3WNOA 3O0WA 4I3PA 5EHDA 3R4UA 2VOXA 4B1LA 4IEVA 2ADDA 4AFDA 5F8PA 3JU9A 4OI4A 3VBFB 1UYXA 3NNLA 5JCTA 1OH4A 3NJZA 2FDIA 5CFDA 1MQTB 3FBYA 4AXOA 1O91A 1R081 3O1PA 1H6YA 2V5DA 1A78A 3GZEA 1L7LA 1V70A 3DN7A 1IKQA 2MEV1 2HWD1 1CZVA 2XJPA 3B02A 3BTAA 2HWF1 2FMDA 3T1LA 5C71A 3R4DB 3ZXDA 5EFUA 2WFF3 2ZGOA 1FI2A 5ACA1 4XCBA 1QJY1 2AEYA 3OY8A 4EWEA 2P3IA 2X8KA 3HAGA 1TE1B 1AR93 1YWKA 3WF0A 5L7OB 1XRUA 3S7IA 3OTFA 2WSUA 3DPRC 5CFDB 4BM8A 3I4IA 1OLQA 2RMU1 2VMDA 4AFBA 3VKOA 4HONA 4WVWA 4TZDA 2E7TA 1BLZA 4HANA 1LESA 2VW0A 1C5HA 1K5MB 2OPKA 4XUOA 4E2SA 5CFCB 3T0DA 2JB4A 2VXJA 3I2OA 5DAVA 1XBFA 3DYMA 2BQPA 3LDRA 5DG2A 3U4XA 1W2AX 5FXWA 3IWZA 2QQJA 5F3EA 1R083 4U2AA 1MS4A 1F4AA 1W2UA 1NYWA 2HWD3 2MEV3 4JAAA 1IHMA 1K5MC 2HWF3 4O9EA 4XJZA 5I0RA 3EMRA 1JZ7A 1GP5A 3RG0A 5ACA3 1RUG2 5FLIA 1NQDA 1QJY3 3T4HB 1S0DA 3W58A 2HWB1 1GQHA 4Y3OA 2Q8OA 4XHXA 4MHRA 4EWAA 2BFUL 3FBMA 1NA1C 1CAVA 2RMU3 5FZKA 1ZNPA 4AI2A 1XSRA 2QTWB 3SKVA 4CCKA 3CEWA 1QY4A 2ZZJA 3M3IA 4LIUA 3WNXA 2ATFA 4BIOA 4Q8KA 4B29A 1NT0A 1LHWA 2J7MA 1CAUB 2NQYA 2PELA 2ZX4A 2BZDA 1W8TA 3AP6A 1BXHA 3M3EA 3O1SA 2ILMA 3E5QA 4IL7A 3VBHA 4AHWA 2WNVA 5IW0A 4WBBA 3T08A 1HLCA 1S2KA 4XFCA 1G9BA 2D5FA 2JDHA 1JHNA 1OMIA 1WCDJ 1XNDA 2KA3A 3I3EA 4IE4A 4J1WA 2HWB3 4CU9A 2DU0A 4BCUA 4PCRA 2ZJCA 4Z1VA 1VBE1 3ZYFA 1PGW1 1D2SA 1PZ7A 4OQ9A 5HBAA 1ZZ6A 1LOFA 4IW3A 2JX9A 2W52A 4GAZA 5JXJA 3AP7A 4H55A 2R062 2YUEA 3C7GA 3MFAA 1OBNA 3WDYA 2QQUA 4CUCA 1EPWA 5JXHA 5J36A 3IAPA 1POQA 3N7MA 5KHJA 2D93A 4YGCA 4BLJA 4IE6A 4S2FA 2P6CA 4AL9A 5G05L 1PMIA 1NUKA 2NYYA 2WQZC 4ZKTB 3ZMNA 1F9KA 1BKZA 2DVDA 4QX1A 5LEKA 3CJXA 3T1MA 4AFCA 2EF6A 1YQ6A 1MPXA 1VBB1 4NR1A 4WM8A 3HVDA 4N53C 4C0HA 1SG3A 2O14A 3CBNA 2YG0A 4L8QA 1O4ZA 4CPBD 4COWA 4P9GA 3LCPA 3SNMA 1WGPA 3B00A 4H14A 5BNPA 1VBE3 3GM8A 4A2UA 1GLHA 4M3CF 1AR62 5JI7A 1RJ8A 3AMHA 4NWVA 4DY5A 3AL5A 5LW9A 3FLPA 1BMV1 5DAQA 5DG1A 4LA2A 4TWTA 5IK8A 5FV3A 1S0JA 2W94A 4CDUA 1H30A 4ZU5A 1UZVA 4AQ6A 3H9AA 4D69A 1P8JA 1ZRFA 3RS6A 2YPJA 4YZ3A 5ABJA 4FFFA 4L2NA 5F2WA 4B4QA 4Q4Y2 1IPJA 3RZJA 1VBB3 3IDAA 2W46A 4RA0A 1W6OB 1AL21 1OPOA 4LIVA 1AF9A 2X53S 1RHI2 3H3UA 3WNNA 4DEQA 4BMBA 2HEVF 2ZOEB 4OQ8A 3OSDA 1VBA2 3K48A 3PUQA 3EHKA 1LGNA 3WF1A 4W6YA 5C3RA 3BALA 4MGIE 2WINB 4QX2A 5FPXA 5H9RA 2R30A 2B7YA 3WDXA 2RJKA 4BQ5A 5D8AB 2ZAAA 2ZMLA 4AI8A 2Y33A 4LBQB 1RUF1 4K8FA 1XSQA 2WO3A 2K9ZA 1M06G 4ARXA 2ZTNA 4LOTA 3WQ7A 4CDWA 1V6LA 4KNCA 1DZRA 1PGSA 5FZ3A 1AL23 3VGIA 5JSRA 1RITA 4XEZA 3GGLA 3OPTA 2WABA 4L97A 4D6SA 5KXCA 4DQAA 1GANA 1AR82 1APNA 5FPBA 1PIV1 3IAQA 1RUD2 3IIIA 2FD8A 5C6CA 1LECA 2NMNA 1WMDA 2XWJB 4Y1VA 2WZEA 3ENRA 4R52A 2ZGKA 1VR3A 3M2MA 1G6NA 2UYBA 4LQRA 1KEXA 4XF0A 4S2GA 3QACA 5A80A 1XNBA 5A3UA 3ELNA 1RUF3 3QCWA 5I8YA 5BNNB 2OA2A 3H8OA 1MS0A 1QKQA 1MS8A 2VMCA 1DLCA 1JU4A 1H9WA 2RS11 3LWCA 4QPIC 4QX8A 4XMAA 5FP8A 4A3XA 2H0BA 3BIEA 1SLAA 3AB0A 4XC9A 2OT7A 1POV0 3MUY1 5IVBA 1W9TA 4ISQA 1W03A 1PIV3 1PX4A 2H0VA 4MH0E 5FO8B 4W50A 4XF1A 4XQWA 3EXUA 3TN92 1C4RA 3BPZA 5C3PA 3LOBA 3E97A 5CADA 1K5JA 2D7FA 5L73A 4B7EA 2VOWA 2LUWA 1COV1 1H1AA 3M3CA 3OGSA 1J3RA 1XU1A 2C24A 2VBBA 2EIBA 3I3QA 2DYCA 4IV3C 4PHZA 3KM5A 4AG4A 3VBOC 1VB2A 3Q8FA 4XBNA 5JZGC 3ORJA 2RS13 1QXRA 1D0GA 2VY0A 2EXHA 1HDKA 4LMFA 1OPMA 2Z69A 4ZXKA 5A6QA 4FPGA 2BNNA 3IDCB 1YIPA 3I3BA 1X9TA 1H2LA 4BA6A 1MACA 2G9GA 1OVSA 2GNDA 2ZGUA 3AYEA 1DBNA 2VBDA 1VE0A 2GNMA 4AEDB 3PJQA 4JQTA 2VULA 1Q8OA 4YW1A 3MF9A 1COV3 3V0AB 1OF3A 4E4HA 2XOMA 1U12A 1ZRCA 4RGAA 3S5AA 1OA4A 4BLIA 4LUMA 5KWRA 2XQXA 4XBLA 2VMEA 5FZ9A 5A7SA 1Z7S1 4QGNA 5A7WB 3ZIWA 3ZX7A 1GP4A 1UCXA 4Y4YA 2QKDA 5FMCA 2Y0IA 3NQHA 4YVWB 1UY1A 4UFLA 5IVYA 3MDPA 5GZCA 3ECQA 4TYSA 3OBTA 1RXFA 2VE1A 1C28A 3SMHA 2WAAA 5C3SA 2JG8B 4HKLA 4FXKB 4TN7A 3J7MA 4C0BA 2ZKLA 1U0AA 5C4WA 1RUC1 1PGL1 3K4ZA 2P3YA 4XJAA 1H4GA 4GIQA 3ZXLA 1KS4A 5DUUA 4QKBA 3CMGA 3MIHA 3VBSB 1W2OA 2R0FA 3ME2A 1Z7S3 3WF4A 2A6WA 1HRI2 4MLOA 2QQOA 2EA7A 5FO9B 5K0UB 3UGGA 2BBAA 3AMNA 3NAPB 1E57A 1VJ2A 3K46A 1OFSA 3WINE 5HCAA 5A3LA 2IXHA 4KBBA 4RQPB 5A33B 4FPLA 5AFBA 2A1XA 1G86A 3KV6A 3DL3A 4JGYA 1ALYA 4LR4A 4QX0A 2K0GA 4GH4C 3VL8A 4M3CA 1AHSA 1LHVA 5GLUA 4P9IA 2HWE2 1OC1A 1H8TC 1RUC3 2HWC2 3A0NA 5FP3A 1A8MA 2OX0A 3H1MA 5FZ0A 4AQSA 3WDVA 2WAOA 1SDDB 4IGPA 4RQPC 2XONA 3NJVA 4HZFA 4Y26A 3KLSA 4HKWA 2XPJA 1HIXA 1LHOA 1AUYA 4EE2A 4DXSA 4GWJA 3LPFA 1ND2A 3D82A 5FZ7A 2FDHA 1IOAA 4GA9A 2WA3A 2FDFA 2JWPA 2OXBA 1SMVA 2I2SA 2W92A 4AVTA 1V6JA 4UFIA 3AFKA 1JZ4A 2ET1A 1CX4A 2O1QA 1JYVA 2EXKA 4CCEA 1RUH1 2JB8A 1N47A 1AYM2 2HYXA 3ACFA 1CONA 4UW3A 3WW1A 2DFCA 4LBLA 1CJDA 3DV8A 1DQ6A 3JBG1 4RGGA 2A6XA 4QPGC 3BIWE 5DDJ2 3TAYA 4BZ4A 2RDRA 1A34A 1G9DA 1QIQA 1YFYA 2E33A 4P9YA 3RSJA 3AK0A 3VHRA 1SZBA 2ARBA 2RR11 1C8M2 4CP9A 4A7YA 4IEZA 1DCSA 5A6XA 5BNQA 5CAZA 2D6OX 4Q4X1 1F5JA 1WZXA 2A6VA 2AUYA 2RS31 3OGJA 4FQZA 4WVMA 2OQ6A 4YW2A 2Y34A 4Q4V1 3ZYHA 1ODNA 1WLCA 3IMNA 4XE9A 4BISA 4DPNA 3AVSA 4B1MA 5FDBA 1PM4A 2JE9A 3UGHA 4Z2WA 4B4PA 2WA4A 4IEWA 1UWWA 2XLAA 1G7YA 1RUH3 3GJBA 2B42B 5DMYA 3GNEA 2KD7A 4G3YC 1J3QA 1WCKA 2E53A 2QQVA 2DURA 5IHRA 3CJIB 5ANNA 3KT7A 3KHCA 1IS3A 2A3WA 3CU7A 4OI2A 1OOPC 3WR0A 2P3JA 3MICA 4A4AA 1RIRA 1Y9MA 1UX7A 2RR13 1FOD2 3MEPA 1JW6A 2XBO1 1EAH1 4Q4X3 4XIOA 3THTA 4AEMA 2RS33 4YG6A 5CKMA 4Q4V3 5J1XA 3MLJA 5I0SA 1B35C 1YC61 2J1RA 4KWKA 3LSEA 4UBHA 1NCRA 1SFNA 1GSLA 4YPJA 4J6GA 2DCTA 4NJ4A 1XNTA 2KR2A 3A0KA 2UWCA 3FN9A 4IV1A 4FPEA 4TSVA 2J1TA 5LRSA 2VPVA 4IE7A 3OYWA 5CYYA 3ZKUA 1NCQC 2WR9A 5CG8A 1GR3A 3EO6A 3SISA 2GC2A 4LXLA 3D6EA 3SC7X 5C9AA 1UMIA 3WZ1A 3N9PA 3INAA 2DDUA 1RUNA 2GNBA 2W87A 2HH9A 1XYNA 3C7FA 1KITA 1EAH3 1W90A 2XBO3 4GKYA 4JDMA 4UFMA 1PK6B 4OULA 3NJYA 1MZ6A 5ANQA 1NXMA 3ZFGC 2B9UA 2GP5A 2RDNA 4RHV2 2DTYA 1N1TA 4PDWB 5BYNA 5C9AB 5IFTA 1G9AA 2VUAA 5JOWA 1PO12 4OVEA 3ZFFC 3KCCA 4XIKA 4AYUA 1SLLA 1VBD2 2BJSA 3OUJA 1CD3G 2GC0A 4XJUA 3BPSA 4LOSA 1FT9A 3H50A 1W99A 1YNAA 1AX2A 1PVC1 4YVSB 5A32B 4HOOA 5EYYA 2VG9A 2P37A 2YC4A 5T5PA 2A3XA 1HJFA 1C1FA 1QQP1 5FZOA 3N9LA 1O3RA 4QDSA 1RVF1 1H2NA 1ULFA 3B9CA 5F5IA 2MNGA 3N7KA 2BFUS 1MS5A 3JD71 2JD4A 4MXWA 1US3A 4YFZA 4GMP0 4FOQA 4N7UA 3FLRA 4YWAA 1YQ5A 4ATEA 4BHPA 3HN1A 1HV0A 1ZA7A 1Y9GA 3HPNA 5A6YA 1GZWA 4LPLA 1SPPB 1UAIA 1IQDC 1RL3A 2GH2A 3T09A 2UWAA 4GB31 3VDAA 1W6PA 2ZAHA 4GULA 2C5DA 1QOSA 2DCYA 1EYBA 2WO2A 2XR4A 5FP4A 3VDDA 3ZIXA 4HLTA 3GDBA 1ENXA 1PVC3 3K2OA 4N43A 4A6OA 4NIHA 2CU5A 4ZS3A 2DVGA 3E6CC 5FQ0A 1QQP3 3ZLIA 4CA9A 4MSVA 2XJTA 4KWUA 4XJ8A 2Z79A 4GD4A 1PO22 4FPJA 2XQRA 4XBQA 1RVF3 2XG3A 4QXBA 1K3IA 2YDEA 4M01A 3JD73 3VD3A 5E6HA 4IE5A 5F39A 1X9PA 3POEA 4D7TA 5BV6A 4XTPA 2YFUA 4RR3B 1O7FA 3POJA 1V0AA 3AX4A 3U75A 1VBC2 4XFAA 5GJ6A 2PMWB 2ZGRA 3PU8A 4HFSA 3VB9A 3J8F1 1RGSA 5HCFA 4GB33 1CAXA 1EPZA 5FYHA 2J22A 2MHFA 3K75B 4CDQB 4DXRA 1LGCA 5FYSA 5HCHA 1JH5A 5A6ZA 2CGOA 3F95A 1HKDA 3MYXA 4AQ2A 5EXOA 1VLNA 3ZYRA 2V5YA 1OD5A 2E26A 3RI8A 2QUOA 1MZ5A 3H3LA 1J84A 3BKZA 4QU1A 2XJUA 2B5HA 1H8VA 2RS51 2W95A 1GQPA 1RUJ2 3I2IA 4UF0B 3UL2A 1QXPA 4CCCA 1F5FA 3OGGA 3VDBA 1JTZX 3U37A 3BI3A 3VBRC 3S30A 3VZLA 2OYZA 2JKXA 1PZ9A 1YFWA 1V6NA 3C2UA 4UXAA 3CKHA 5FZBA 5BNOA 3BTYA 3RGBA 1JODA 5I91A 3J8F3 4G9SB 3MPPG 3VD7A 5T52A 1R092 1CPNA 1FPN1 2ZGTA 4Y20A 5DQ0A 3VBUA 2ETEA 2NZ9A 3LEIA 2JG9A 4BQYA 1W6QB 2ZGMA 1ZYBA 1RUE1 1GZ9A 4LKFA 5HV0A 1Y3TA 3ZMOA 3IT8A 3RMXA 2RS53 3THCA 4CP0A 2DCJA 3IN9A 2RG4A 3WSOA 4LBMA 4ZPIA 3NNGA 4ZHNA 3FZ3A 4Y20B 1UY3A 5LASA 3UESA 4AI1A 2BERA 4BH9A 3PVBB 3P6BA 4R4ZA 4O7XA 4QDQA 3U10A 2X29A 1ND3B 1SLIA 3NKTA 2BGOA 3ZN4A 2G1MA 4QPYA 1DU3D 1FPN3 2OPWA 2HJIA 3P5BA 2VXRA 3AM2A 4TTGA 4D8MA 4IEPA 5A7QA 2WRAA 3MO4A 4AVSA 2HEYF 3HNBM 1VRH1 1ND3C 4MADA 3ZSLA 1BYHA 1RUE3 3D0JA 4Q4W2 4QQHA 4AAXA 4BQ4A 4OMDA 1ULCA 1H1IA 4LBJA 3UYJA 3ZYBA 1DGWX 5C8CA 5IWFA 4FO9A 1IG3A 2UURA 2WL1A 5F1RA 3LKJA 3WVJA 2C9AA 2ARXA 5IT6A 1UPIA 5DN2A 1UF2C 1JOPA 4NHLA 5FWEA 2WS91 2XB6C 4QHBA 1B09A 4XZUG 3VN4A 5J48A 1YQCA
chains in the Genus database with same CATH topology
5A7OA 4CCLA 2OQ7A 5FPAA 4UF0A 5A3WA 2OT7A 2Q8CA 4CCNA 4CCMA 5CEHA 5A7WA 5IVBA 2P5BA 5FZ6A 5FP4A 4GAZA 4V2VA 4V2WA 5A1LA 3K2OA 5IVVA 5A1FA 5FZMA 5FPUA 5IVJA 4AAPA 5F37A 5FZEA 3U78A 3ZLIA 4CCOA 5F2SA 5A7PA 4GD4A 4GJYA 5FJKA 2Q8DA 4QXBA 3LDBA 5FYUA 4EZ4A 5IVCA 2OQ6A 5E6HA 2YU1A 5F5CA 3OPWA 5F39A 5IVEA 4D6RA 5A3NA 4BISA 5FZ8A 3AVSA 5FY9A 2PXJA 3AL6A 4XDOA 2Q8EA 5FZOB 3PU8A 4QWNA 3KVAA 5F3GA 5FUNA 5FYHA 2XUEA 5FZFA 4CCJA 3AL5A 5F3CA 5LW9A 2W2IA 5FZGA 5LY2A 5FYSA 5FV3A 3KV9A 5F3IA 5IVFA 4E4HA 5F5AA 5K4LA 4ASKA 4QU1A 5FY1A 4Y4RA 5F2WA 2XDVA 4UF0B 5FY4A 5FYVA 5FYBA 5FZ9A 3DXUA 3N9MA 5FZCA 5A7SA 5A7WB 3N9QA 5FYZA 5FY0A 3N9NA 3PUAA 4LIVA 5FZBA 5IVYA 1VRBA 4QX7A 5FZHA 5FXVA 5A3PA 3AVRA 5FUPA 3RVHA 5FYYA 4HONA 4BXFA 3KV5A 5F32A 4TN7A 4BU2A 3PUQA 3PU3A 4AI9A 4LXLA 3N9PA 4CUGA 4DIQA 5FXWA 5FPLA 5F3EA 5LWBA 2VD7A 5FYTA 5FXXA 4CSWA 2OS2A 4IGOA 3ZPOA 2XMLA 3K3OA 5FPVA 2YPDA 5FZDA 4DO0A 3NJYA 5ANQA 4GJZA 3PTRB 5FP9A 2GP5A 5FZAA 4C8DA 5KR7A 5FZ3A 3PDQA 5FJHA 5FZ4A 5FXZA 4IGQA 3OPTA 4Y3OA 3LD8A 4D6SA 5FP7A 5FWJA 5FZKA 3KVBA 2YBPA 5FPBA 4CCKA 4QXHA 3KV6A 4LIUA 5FYMA 5FYIA 4HOOA 3PURA 4LITA 5A7QA 2YU2A 4Y33A 5FZOA 3DXTA 5FBJA 3N9LA 5FY7A 5FZ0A 3U4SA 3PUSA 5FP3A 2OX0A 2YBKA 2WWUA 4NUBA 5FYCA 5LY1A 4EZHA 5A3TA 4IGPA 5A80A 4QXCA 5ISLA 5F5IA 2GP3A 3KV4A 3N9OA 5IW0A 4XDPA 3UYJA 5IWFA 5FZLA 2YBSA 5FY8A 5FZ7A 4QX8A 2WWJA 3K3NA 5FP8A 5FZ1A 5FWEA 4D6QA 4EYUA 5A7NA 5FZIA 5FY5A 2XXZA 4URAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5A7O A;  4CCL A;  2OQ7 A;  5FPA A;  4UF0 A;  5A3W A;  2OT7 A;  2Q8C A;  4CCN A;  4CCM A;  5CEH A;  5A7W A;  5IVB A;  2P5B A;  5FZ6 A;  5FP4 A;  4GAZ A;  4V2V A;  4V2W A;  5A1L A;  3K2O A;  5IVV A;  5A1F A;  5FZM A;  5FPU A;  5IVJ A;  4AAP A;  5F37 A;  5FZE A;  3U78 A;  3ZLI A;  4CCO A;  5F2S A;  5A7P A;  4GD4 A;  4GJY A;  5FJK A;  2Q8D A;  4QXB A;  3LDB A;  5FYU A;  4EZ4 A;  5IVC A;  2OQ6 A;  5E6H A;  2YU1 A;  5F5C A;  3OPW A;  5F39 A;  5IVE A;  4D6R A;  5A3N A;  4BIS A;  5FZ8 A;  3AVS A;  5FY9 A;  2PXJ A;  3AL6 A;  4XDO A;  2Q8E A;  5FZO B;  3PU8 A;  4QWN A;  3KVA A;  5F3G A;  5FUN A;  5FYH A;  2XUE A;  5FZF A;  4CCJ A;  3AL5 A;  5F3C A;  5LW9 A;  2W2I A;  5FZG A;  5LY2 A;  5FYS A;  5FV3 A;  3KV9 A;  5F3I A;  5IVF A;  4E4H A;  5F5A A;  5K4L A;  4ASK A;  4QU1 A;  5FY1 A;  4Y4R A;  5F2W A;  2XDV A;  4UF0 B;  5FY4 A;  5FYV A;  5FYB A;  5FZ9 A;  3DXU A;  3N9M A;  5FZC A;  5A7S A;  5A7W B;  3N9Q A;  5FYZ A;  5FY0 A;  3N9N A;  3PUA A;  4LIV A;  5FZB A;  5IVY A;  1VRB A;  4QX7 A;  5FZH A;  5FXV A;  5A3P A;  3AVR A;  5FUP A;  3RVH A;  5FYY A;  4HON A;  4BXF A;  3KV5 A;  5F32 A;  4TN7 A;  4BU2 A;  3PUQ A;  3PU3 A;  4AI9 A;  4LXL A;  3N9P A;  4CUG A;  4DIQ A;  5FXW A;  5FPL A;  5F3E A;  5LWB A;  2VD7 A;  5FYT A;  5FXX A;  4CSW A;  2OS2 A;  4IGO A;  3ZPO A;  2XML A;  3K3O A;  5FPV A;  2YPD A;  5FZD A;  4DO0 A;  3NJY A;  5ANQ A;  4GJZ A;  3PTR B;  5FP9 A;  2GP5 A;  5FZA A;  4C8D A;  5KR7 A;  5FZ3 A;  3PDQ A;  5FJH A;  5FZ4 A;  5FXZ A;  4IGQ A;  3OPT A;  4Y3O A;  3LD8 A;  4D6S A;  5FP7 A;  5FWJ A;  5FZK A;  3KVB A;  2YBP A;  5FPB A;  4CCK A;  4QXH A;  3KV6 A;  4LIU A;  5FYM A;  5FYI A;  4HOO A;  3PUR A;  4LIT A;  5A7Q A;  2YU2 A;  4Y33 A;  5FZO A;  3DXT A;  5FBJ A;  3N9L A;  5FY7 A;  5FZ0 A;  3U4S A;  3PUS A;  5FP3 A;  2OX0 A;  2YBK A;  2WWU A;  4NUB A;  5FYC A;  5LY1 A;  4EZH A;  5A3T A;  4IGP A;  5A80 A;  4QXC A;  5ISL A;  5F5I A;  2GP3 A;  3KV4 A;  3N9O A;  5IW0 A;  4XDP A;  3UYJ A;  5IWF A;  5FZL A;  2YBS A;  5FY8 A;  5FZ7 A;  4QX8 A;  2WWJ A;  3K3N A;  5FP8 A;  5FZ1 A;  5FWE A;  4D6Q A;  4EYU A;  5A7N A;  5FZI A;  5FY5 A;  2XXZ A;  4URA A; 
#chains in the Genus database with same CATH topology
 1R1Z A;  2B45 X;  2WBK A;  3H42 B;  3GZA A;  4XOG A;  4A45 A;  1DDL A;  2VZO A;  1J59 A;  3KWV A;  3ZFE C;  4JX0 A;  2VAU A;  1DIW A;  5FZM A;  5GLT A;  2VZS A;  3I59 B;  5LBE A;  3ZVX A;  3RWN A;  4XW3 A;  1VRH 3;  2OVU A;  4CXY A;  4XUR A;  4A7K A;  4GJY A;  4Y1U A;  5FJK A;  2EXI A;  1HB2 A;  5ERL A;  4PLO A;  1RED A;  3WF3 A;  2XHK A;  4COZ A;  3VLB B;  3OPW A;  3Q8E A;  4CUA A;  3FHA A;  5IVE A;  3RFR A;  4N9I A;  5L9B A;  4D6R A;  5LZ6 A;  1SLB A;  5E89 A;  2QE3 A;  4JTO A;  3I2K A;  4I3G A;  2WS9 3;  2X5I B;  3IDB B;  1TNR A;  1F35 A;  4CEY C;  3A21 A;  2ET7 A;  1KD7 A;  3AMQ A;  3WDW A;  4LJH A;  4YAR A;  1W6M B;  1PX3 A;  1ZZC A;  2ZGL A;  1J1L A;  3NW4 A;  3IBM A;  4ASL A;  2VNG A;  3FHI B;  2HYK A;  4GWN A;  4CEW B;  3MLL A;  3RQ0 A;  1K45 A;  5AVA A;  2ZZQ A;  5F5A A;  1EUT A;  5EPA A;  2WNU C;  4WM7 C;  4P00 B;  2XDV A;  4CP2 A;  2FZ2 A;  4JVA A;  2MPF A;  4CUB A;  4XFG A;  3AJY A;  3T4V A;  2IUW A;  1TMF 1;  1JN2 P;  2WLQ A;  2WII B;  2RJ2 A;  5E88 A;  2W68 A;  2D44 A;  5C3Q A;  5FYY A;  1D4M 1;  1RUI 1;  3FUQ A;  2YRO A;  1JXN A;  1Q8Q A;  1FMD 2;  2KXL A;  2R1D A;  3HJR A;  3S6P A;  4AI0 A;  1CZS A;  1F31 A;  2E51 A;  4K21 A;  4XIL A;  1ZZ7 A;  2R07 1;  3WOG A;  1BHG A;  4CUG A;  5IK4 A;  4WZF A;  4AVB A;  2JDM A;  4N7I A;  4LKS A;  4IGO A;  3RZZ A;  3IDE A;  4Q1R A;  4QM8 A;  2TBV A;  5LA1 A;  2IVJ A;  2E31 A;  4DO0 A;  1LOA A;  1N1Y A;  4LTA A;  2IVI B;  1S0B A;  4MYE A;  3MIG A;  3VBF C;  1ENR A;  2GDF A;  3DPR A;  4DXT A;  1TMF 3;  1LGB A;  3PDQ A;  3BN6 A;  3B9I A;  4RYD A;  3TOJ A;  1MQT C;  1OH3 A;  1ASJ 1;  2CL2 A;  3OD0 A;  3AP4 A;  2JDP A;  2HLE A;  2J1U A;  2D43 A;  2LW8 A;  3SCG A;  1D4M 3;  4FTE A;  1BZW A;  1RUI 3;  2XH6 A;  3O14 A;  1QHD A;  4BK5 A;  5FYM A;  2R06 1;  2JDK A;  3FC0 A;  2ZHL A;  2R07 3;  4LA3 A;  3IPV A;  2BNM A;  5CBL A;  1OKO A;  2PHT A;  2XUM A;  3DEM A;  3OY8 B;  4GAL A;  4MGK E;  4NHK A;  3GJA A;  5L7O C;  5CFD C;  3WG4 A;  1D0H A;  1S0I A;  2DV9 A;  4BDV B;  5EIY B;  2D5H A;  4YM0 A;  4LO7 A;  2L9L A;  2IXL A;  2WLP A;  5J98 B;  4KG0 A;  4OHW A;  2RDQ A;  5CFC C;  3ROU A;  1O8P A;  1V9U 1;  2AC1 A;  4URA A;  1NA1 A;  5AC9 1;  1ASJ 3;  4JHT A;  5A3W A;  3RZH A;  1M4W A;  2DU1 A;  2P3K A;  3EQE A;  3ASI A;  4E8C A;  2UWB A;  4XFI A;  3WP5 A;  1AR6 1;  1ULE A;  4P5Y A;  4YM3 A;  4Y5Z 0;  4YGB A;  2XJQ A;  1H9P A;  2R06 3;  4NRO A;  3V65 A;  3MW3 A;  3OUH A;  4XYX A;  3ZN6 A;  3KF3 A;  4AZZ A;  1Q56 A;  5JR2 A;  5F37 A;  3U78 A;  5C3O A;  3WW4 A;  2B4K A;  5F2S A;  3GBF A;  4W6X A;  4AGV A;  5G04 L;  4TLG A;  4DOU A;  2B8M A;  2WFF 2;  3FL7 A;  1WA6 X;  3OGR A;  4U36 A;  1CAV B;  3WNM A;  2A5Z A;  2R04 1;  2JD9 A;  1O4T A;  4GXL A;  2RM2 2;  5FZ8 A;  4UT5 A;  1V9U 3;  5AC9 3;  5CG9 A;  3O1V A;  4ZY9 A;  4NO4 A;  4EQV A;  1EY2 A;  3J7H A;  3KVA A;  2ZAC A;  3VBH B;  2ZGP A;  4QT6 A;  1AR6 3;  4LHS A;  2WNV B;  4OMC A;  4RD7 A;  1VBA 1;  2WWS A;  1ZA4 A;  4QGL A;  4O65 A;  5AFE A;  4IER A;  4AQT A;  3V64 A;  4L11 A;  1IKP A;  1AXY A;  2LTN A;  4W4Z A;  3JB4 C;  2MEV 2;  2VZ1 A;  4Q27 A;  2HWF 2;  3A7Q A;  4Y4R A;  2Z5W A;  4N53 A;  2OUJ A;  3O7O A;  1ZVF A;  3PVN A;  3DXU A;  1Z0H A;  2R04 3;  1QJY 2;  1YQ8 A;  3NL1 A;  3ZXJ A;  4EN7 B;  1RC6 A;  3TEY A;  1JUH A;  2A73 B;  1W9F A;  2W0X A;  1PZ8 A;  3ACG A;  2GME A;  2WYF A;  4MVT A;  2RMU 2;  4H7M A;  3DUI A;  5FXV A;  3HQU A;  3AVR A;  3SCH A;  1DQ0 A;  1TG7 A;  2JXA A;  3DF0 A;  1AR8 1;  1FX5 A;  2R16 A;  1JHJ A;  2G19 A;  1RXG A;  1VBA 3;  4LKE A;  1W0P A;  2PAE A;  4FBF A;  4WM8 B;  3D5O A;  1SEF A;  3RWK X;  1W0N A;  2GZW A;  2WNO A;  1TME 1;  4XQD A;  5FMB A;  3USU A;  1WW6 A;  1UNB A;  2C26 A;  3I2J A;  5FXX A;  3TNP B;  5C5T A;  5BNP B;  1TVG A;  4YM1 A;  3O1U A;  2GMM A;  3L9J T;  3L2H A;  1V6I A;  2XLF A;  4LUL A;  2DUQ A;  5DUX A;  1ULG A;  5DXD A;  1Y43 B;  2JE8 A;  2Y6H A;  4AHZ A;  4BPZ A;  3WP6 A;  1LOD A;  4CDU B;  1D7P M;  3LFI A;  2WZP P;  1DYO A;  5L9V A;  1AR8 3;  2ZEZ A;  5ABJ B;  1ULP A;  1SCS A;  3TN9 1;  1UU4 A;  4K20 A;  3E5X A;  3WX5 A;  4AFM A;  2SBA A;  1US2 A;  2YBK A;  2VR4 A;  4FI9 A;  2YC2 A;  1TME 3;  5FK8 A;  3ILN A;  1GV9 A;  1RMU 1;  5FYC A;  1UL9 A;  4FPK A;  5JXI A;  1XE8 A;  2R0H A;  4N8M A;  2XL9 A;  2YBS A;  3KGL A;  5I8S A;  3ACH A;  5FZ1 A;  2ARA A;  3KCX A;  5DUV A;  1VBE 2;  3W21 A;  3ETP A;  3MW2 A;  5HV4 A;  3H3Z A;  2P17 A;  5D8A C;  4Q0P A;  2JDN A;  3NWK A;  2CGP A;  3KMH A;  4FAH A;  3NMB A;  4M4P A;  1JYT A;  4CDX A;  4V2V A;  2W1S A;  3T0A A;  1HQN A;  2WC2 A;  5IVV A;  2QQL A;  3TN9 3;  2LRP A;  3POG A;  4DUX A;  2NM1 A;  4CDW B;  5HPO A;  1YIF A;  1QDC A;  4QKF A;  1T6G C;  3T2Q A;  3VD4 A;  1A3K A;  4JDN A;  1RMU 3;  2PHL A;  5IAX A;  5T5J A;  1HX6 A;  1W04 A;  5FYU A;  5T5L A;  2JJ6 A;  3FE5 A;  4CDX B;  2ARC A;  4OHY A;  4D7Y A;  4Y24 A;  2QJV A;  5A3N A;  3VD5 A;  1EV1 1;  1OVP A;  1PHM A;  3HBZ A;  2VQA A;  1KXG A;  4Q0S A;  4R9C A;  3FWE A;  1XQN A;  2RE9 A;  4FPF A;  4HK9 A;  2W3J A;  2KM2 A;  1QJE A;  4UW4 A;  2XL7 A;  5LBC A;  4OI0 A;  1BMV 2;  4BME A;  1BVP 1;  3KHB A;  5BNN C;  3E6B A;  5FOB B;  1W3V A;  5DUW A;  3HD8 B;  2V4V A;  1NZI A;  1SLC A;  3ZN5 A;  1DFQ A;  4FTB A;  2VOV A;  4E4D X;  4IV3 A;  1UZY A;  2B46 X;  3SCF A;  1OUR A;  3W59 A;  4SLI A;  3VBO A;  3W5M A;  3MID A;  4M0H A;  4FP2 A;  1X7N A;  1GOH A;  4Z07 A;  5JZG A;  2WZR 2;  1MEC 1;  1H6X A;  5FZC A;  4A42 A;  1BEV 1;  3K51 A;  1T6B X;  3WG2 A;  1EV1 3;  1QGL A;  3HNM A;  5FCC A;  4EWD A;  1CIY A;  1BBT 2;  3I8T A;  3HNY M;  4C91 A;  1NY7 1;  1HW5 A;  2QFE A;  1QMJ A;  1CX1 A;  3RZG A;  2JDA A;  4FCA A;  5DAW A;  3N7J A;  4F83 A;  2GH8 A;  2CHH A;  3PU3 A;  2CY6 A;  4AI9 A;  1DGR A;  4KG8 A;  3KT1 A;  3N4M A;  1OF4 A;  1JZ5 A;  4IQP A;  5LB6 A;  3ZR6 A;  2VMI A;  4BQ1 A;  5J37 A;  2HWE 1;  2AH2 A;  4XVH A;  3UKV A;  2HWC 1;  5I0U A;  5FPL A;  2QQM A;  4P9L A;  5KXB A;  2ZX0 A;  1XYO A;  1RUF 2;  3O5S A;  2D3R A;  2VZU A;  1AYN 1;  1H0B A;  4HKO A;  1HXS 1;  3VKF C;  5KXD A;  5FZD A;  1MEC 3;  3RJ2 X;  2AAC A;  4GJZ A;  1BEV 3;  2HBU A;  2ZAB A;  4AED C;  3ZXK A;  2NLR A;  2K2S A;  3AYC A;  3W5N A;  1OQ1 A;  3AFG A;  3J4U H;  1Q8V A;  1PIV 2;  3PVE A;  4YW5 A;  3ST7 A;  4YZ5 A;  2CDP A;  2IFR A;  2XJR A;  3AMM A;  3UET A;  4QB2 A;  4Q29 A;  2D6P A;  4XQ4 A;  2BGP A;  4DMI A;  1O59 A;  3PUR A;  3AKT A;  3JB8 A;  3OB8 A;  4LIT A;  2IXJ A;  4DEV A;  2FDK A;  1LHU A;  1CES A;  1GP6 A;  4YVW C;  2BU9 A;  1WBF A;  4AWD A;  2HWE 3;  3U4S A;  3WF2 A;  3PVO A;  1CWP A;  2HWC 3;  4UYB A;  3WHT A;  1ST8 A;  1C8M 1;  5H9S A;  3HBK A;  1OUX A;  5LBB A;  1IGO A;  1AYN 3;  2JG8 C;  3DKQ A;  1HXS 3;  3KS7 A;  4XDP A;  4UAP A;  5JMC A;  1UOJ A;  4Z92 B;  3H8R A;  1WME A;  2DTW A;  2F4L A;  2H6C A;  1UKG A;  3ZSJ A;  1AR7 1;  4N9H A;  1JYC A;  2GN7 A;  4HVO A;  1GFF 2;  4P9X A;  5D1I A;  2C4X A;  5A7N A;  3PL0 A;  5FY5 A;  3WNP A;  4EN9 B;  4K6B A;  3BUC A;  5C4W B;  2OQ7 A;  4D3W A;  4YGE A;  2E63 A;  4JKK A;  3FFQ A;  1UKR A;  3D0S A;  4GH4 A;  4XUT A;  3VBS C;  1H1M A;  1LNS A;  2FCU A;  2FDG A;  1H8T A;  1VMJ A;  4YW6 A;  1COV 2;  5K0U C;  1I5Z A;  4XHB A;  4CU8 A;  2CYF A;  3OPZ A;  4PT6 A;  2Q0A A;  3W9A A;  3NAP C;  2QCS B;  4RN5 A;  3WUC A;  2Y38 A;  1FOD 1;  1C8M 3;  1JMU B;  4QX3 A;  5GZE A;  4COV A;  3G6J B;  1RJ7 A;  2XJV A;  2ZGQ A;  4Q2F A;  4QX5 A;  4R9D A;  4WV8 A;  1AR7 3;  5J96 B;  4BOW A;  2FQP A;  2E6V A;  2GC1 A;  4FT8 A;  4JGY B;  3HOB A;  3AL6 A;  4M3C B;  4XFH A;  1LU2 A;  2BRT A;  1XNC A;  3LZZ A;  3X29 B;  4RS5 A;  4EN6 B;  5IFP A;  2V09 A;  2VCA A;  4QPG A;  1SFP A;  5TSW A;  4K1Y A;  1E5H A;  5IJR A;  1WD4 A;  3NST A;  4LLF A;  5K7P A;  1ZBE 2;  1ND2 B;  1R64 A;  2FDJ A;  3TYJ A;  1GWM A;  1AX1 A;  3LAG A;  1QJF A;  4B4R A;  5JSO A;  1QNY A;  2VQ0 A;  3PIG A;  2YFZ A;  1FOD 3;  4IEO A;  4E2G A;  3RRD A;  5C33 A;  2WT2 A;  1Z7S 2;  4J1X A;  5FY4 A;  4Z2A A;  3O1O A;  5J3U A;  1YO8 A;  1HRV 1;  3WP4 A;  3N9M A;  2GC3 A;  3LB9 A;  3NNM A;  4A44 A;  2EAL A;  1UQX A;  3P1I A;  1WCU A;  4QAW A;  3PUA A;  3AKS A;  1VRB A;  3WLU A;  1PMJ X;  4XXA A;  1PO1 1;  1IPK A;  1F4H A;  3R0R A;  5E8A A;  4WVZ A;  4CP9 B;  4NIG A;  3OD4 A;  5FR3 A;  4NHX A;  2QDN A;  3LEG A;  2DF7 A;  3WQB A;  5FLH A;  1OOP A;  4WVM B;  3JBG 3;  1WKY A;  2D6M A;  4TXW A;  3OGV A;  4QXK A;  1JI6 A;  1YEW A;  1O4Y A;  1W8H A;  4KWJ A;  5GZF A;  2K46 A;  1W3X A;  5JOY A;  3SH4 A;  2V4A A;  2OS2 A;  3HT1 A;  4I30 A;  1B35 A;  3HEI A;  1HRV 3;  3SIT A;  5EP9 A;  3QLQ A;  3I54 A;  3CJI C;  1GUI A;  2CV6 A;  4Z8B A;  5FJH A;  2VZ3 A;  5FZ4 A;  3AMP A;  4FPH A;  1PO1 3;  2W5F A;  1NCQ A;  2BWA A;  1JOJ A;  4X6R B;  4BWO A;  4NMI A;  3CQO A;  2YBP A;  2LM3 A;  3CIH A;  2LAL A;  2WJS A;  4HSJ A;  4PIX A;  5FYI A;  3PHM A;  1DQ2 A;  2BOJ A;  4QD2 A;  4RFT 0;  5JI9 A;  2VC9 A;  3LF7 A;  1XNK A;  5EYX A;  1NQJ A;  1NCR B;  3PUS A;  3B01 A;  4CYD A;  1WMX A;  5A3T A;  3O1M A;  1PO2 1;  4IV1 B;  4FSJ A;  1S55 A;  2X09 A;  4JKL A;  4ZU4 A;  4NRP A;  3ZFG A;  4AHX A;  4OLL A;  2V72 A;  4JTN A;  3OYW B;  4XUP A;  2F4P A;  4XDQ A;  5GKA C;  3B94 A;  3ZFF A;  3ZKY A;  4D6Q A;  2YXS A;  3T2T A;  1UYZ A;  4BJ0 A;  1IS6 A;  3HT2 A;  4NOT A;  4Y1Z A;  1VMF A;  5T55 A;  5KC5 A;  2Q8C A;  1CR7 A;  5JIA A;  3P3P A;  4PLM A;  4EV0 A;  4YFW A;  1LR5 A;  2ZCW A;  3FFZ A;  1L3J A;  4V2W A;  4E9K A;  5I8T A;  1PK6 C;  3CZJ A;  4CPB A;  4COY A;  4QM9 A;  4YSF A;  5BPX A;  3LDK A;  2VBP A;  4AAP A;  2GAL A;  2PN5 A;  2XVK A;  4OYU A;  4PDW C;  2TUN A;  4KU8 A;  1MR5 A;  5C9A C;  4HG6 B;  1UU5 A;  3R05 A;  3WW3 A;  4BQW A;  2BNO A;  4CVU A;  1DGL A;  3MGU A;  4MV2 A;  3WT3 A;  1I5P A;  1PO2 3;  4Q4V 2;  4AR2 A;  2O8Q A;  5IVC A;  4Y22 A;  5KC6 A;  4HPK A;  4YVS C;  1N3O A;  5IAV A;  5LK5 A;  2IZW A;  2XLG A;  3FLT A;  3U14 A;  5FO7 B;  5LK7 B;  5IAT A;  2PXJ A;  4QQ2 A;  1R1A 2;  4ZON A;  2YGM A;  5FZO B;  1DQ4 A;  1JOB A;  2PFW A;  2PQQ A;  4LK7 A;  2PHW A;  1RYY A;  4RGK A;  5F6K A;  1Q3E A;  3ETQ A;  3KB5 A;  1UY2 A;  1S0F A;  2VQU A;  4CU6 A;  2DCZ A;  5DAP A;  4MXW B;  1W2T A;  4ZZ8 A;  4NRQ A;  4WZC A;  4KGG A;  2WN3 A;  5A70 A;  3GZU C;  4NE9 A;  1X8M A;  1EAH 2;  2XBO 2;  5IVF A;  4L9B A;  2O8O A;  5DZE A;  1GZW B;  3ZO0 B;  2BV4 A;  2Y26 A;  2PAK A;  2C1F A;  3B93 A;  3D3A A;  4DFS A;  1IG0 A;  1QJX 2;  1W6P B;  1WLT A;  2R1B A;  4ZS2 A;  1IQA A;  3VDD B;  2VMF A;  5KHG A;  1URX A;  2Y6F A;  2DBI A;  4N43 B;  3WEZ A;  4E8D A;  1KQR A;  5FZH A;  1SBD A;  5FQ0 B;  4ZZ5 A;  2PHR A;  1MZF A;  2ZKN A;  4F3J A;  1IS5 A;  3RYR A;  1RTV A;  2CNA A;  1JYN A;  1JUI A;  3VDD C;  1CAW A;  3ZXF A;  2BPA 2;  2A70 A;  4UW6 A;  3V0B A;  4RR3 C;  2BDR A;  3LSD A;  1VPH A;  3VKN A;  1H4H A;  2VW2 A;  4AVA A;  1KDM A;  2QQI A;  4W8J A;  1FAY A;  4XMI A;  4Q4W 1;  4QB1 A;  2XML A;  1HJG A;  1UZW A;  3NNJ A;  3VBR A;  1VMH A;  5E1R A;  1OUS A;  1AXK A;  4LHK A;  4AGG A;  1CAX B;  3E5U A;  4LBQ D;  1GBG A;  3VKL A;  1O5L A;  3I3D A;  3PTR B;  4CDQ C;  1Q43 A;  2ORZ A;  3DYP A;  4C8D A;  3QD6 A;  5B2G B;  3RZK A;  1ODM A;  4GWM A;  3VZO A;  2Q4S A;  4DRR A;  4EN0 A;  4LBK A;  1GWL A;  3VZM A;  4LHN A;  2VQT A;  2DVF A;  3LD8 A;  4A7Z A;  2PAM A;  2Q1F A;  1DGW A;  1PVC 2;  4MGZ E;  4K9S A;  1GIC A;  2UU8 A;  3GZT B;  1QQP 2;  4FFH A;  4HXC A;  2NN8 A;  4ITC A;  2B39 A;  1Y4W A;  2WDB A;  1IZ3 A;  3I97 A;  5BNO B;  1BQP A;  2Y6K A;  5SV5 A;  2IXC A;  2XKO A;  4MO3 M;  4Q4W 3;  5KXE A;  4IET A;  3Q8C A;  2HEW F;  5K8S A;  5LRR A;  2IXI A;  2C9K A;  3ZYI B;  1D4V B;  3UK9 A;  3K3N A;  1DG6 A;  3ATG A;  3VBU B;  1SBF A;  2QZ3 A;  3C8X A;  2A75 A;  3ALQ A;  2JG9 B;  2PHX A;  4KU7 A;  4PJY A;  1UOF A;  1V6O A;  3I49 A;  4HMZ A;  1W9S A;  2P6H A;  2ZEW A;  3AXE A;  4KGQ A;  3HQR A;  4IEX A;  3JCI A;  5DAX A;  2RJL A;  1T2X A;  2W1U A;  3SH5 A;  3V56 A;  3M3Q A;  5KHH A;  2JDZ A;  4I0W B;  1ENS A;  1H2M A;  3AZY A;  3ITQ A;  4NPM A;  1UY4 A;  3NVC A;  5CVR A;  3IIA A;  3ZSK A;  5IK7 A;  2PHU A;  5IK5 A;  1HB3 A;  1ZBA 2;  1W6N A;  1Q8P A;  5HXV A;  4AFA A;  4E4Z A;  1CPM A;  2UY8 A;  1DF0 A;  3B5L B;  2PYT A;  3O0V A;  2BBV A;  1XXN A;  4OUE A;  3MLK A;  2QQN A;  3WCS A;  4BQX A;  5HI0 A;  1G9F A;  2PTM A;  5EJ1 B;  2ZHK A;  3J8F 2;  5I93 A;  4BK4 A;  5C8W A;  2VVF A;  4MET A;  3CLP A;  4QGM A;  5JLV A;  2VZR A;  1OFN A;  3WV6 A;  1TQ5 A;  4FPO B;  3QH7 A;  3ZFE A;  1ZRR A;  3FHQ A;  3WD5 A;  1IS4 A;  1GNY A;  1UW8 A;  3N7L A;  4PI2 A;  4PQ9 A;  3O1T A;  1SLT A;  1QF3 A;  1WA4 A;  3UJQ A;  4NVP A;  5C8C B;  1FMD 1;  1XE0 A;  4MGQ A;  4JGZ A;  4NRM A;  4XAB A;  3WHU A;  4UBG A;  5C7G A;  2Y6J A;  3K4D A;  4K8R B;  4DRV A;  1RUO A;  2A71 A;  2EID A;  2AGS A;  1YRZ A;  3AZZ A;  1W8O A;  3DGT A;  1JZ6 A;  5FYV A;  4F7Z A;  2VGD A;  1HQL A;  1NAE A;  1UXZ A;  3ON7 A;  4MGS A;  3LQC A;  4GQ7 A;  2Q1M A;  3AP9 A;  2D3S A;  1ZRD A;  1WCS A;  1VAK A;  4CEY A;  1LOB A;  3KCY A;  4HBN A;  2I74 A;  1QU0 A;  3VL9 A;  3LFM A;  1F15 A;  4XFB A;  2VH9 A;  4QHZ A;  3ZPY A;  1DZQ A;  1MVQ A;  2VMG A;  3JQX A;  3N3H A;  3POF A;  2BOI A;  4AHY A;  5IYY A;  1FMD 3;  1E5I A;  2VVE A;  4QU2 A;  3T2O A;  1S0G A;  2EXJ A;  1RUE 2;  5JPM B;  1N1V A;  2WNU A;  2X5I C;  2P34 A;  2WNE A;  3C7H A;  1Q8S A;  4WM7 A;  3GCW A;  3KQR A;  4TLF A;  5L19 A;  5GZD A;  5LWB A;  4COU A;  3O0X A;  2W1Q A;  2D97 A;  5FPV A;  5FBZ A;  2YPD A;  1ULD A;  3QH6 A;  4I09 A;  1QH7 A;  4CEW C;  4PQQ A;  1EUU A;  5KR7 A;  1GQG A;  3ZM8 A;  5FXZ A;  1AX0 A;  1QJU 2;  1RUG 1;  1X50 A;  1WUV A;  4W65 A;  1U5X A;  3MBW A;  3U1X A;  5K9Y A;  3S57 A;  2BEO A;  3D4K A;  4IE0 A;  4JDO A;  1KS5 A;  2WFP A;  4ET7 A;  4LLO A;  1YLL A;  4OZO A;  1QNW A;  4A6S A;  2CTV A;  4M3C E;  4DIN B;  2YU2 A;  3DXT A;  4K3U A;  5FBJ A;  1LOE A;  4JRA A;  2J42 A;  4EZH A;  1OQD A;  1OXC A;  4LO8 A;  2GP3 A;  1Z78 A;  2VL4 A;  2EIE A;  4I01 A;  1Q5O A;  1BK1 A;  3O1R A;  3VBF A;  3W20 A;  2WS9 2;  3UV9 A;  3CL1 A;  2FCV A;  5APA A;  3U07 A;  4OCT A;  1MQT A;  2RM2 1;  5LA2 A;  2Y6L A;  2P2K A;  1RUG 3;  3MW4 A;  1C5I A;  1YJK A;  2WO7 A;  2ZEX A;  2G4I A;  3BB6 A;  5DAB A;  4ORF A;  2BWC A;  1LEM A;  1SBE A;  2D6K A;  2PLV 2;  3H8X A;  4K7J A;  2VNO A;  4NIA A;  3HIF A;  3POY A;  3GXU A;  1YYN A;  2ZPX A;  5A1F A;  1BJQ A;  3HR9 A;  4AW7 A;  1PNG A;  1TZO A;  5L7O A;  5JXG A;  3KSC A;  1A6C A;  3TEX A;  3DPR B;  3BYW A;  4XF9 A;  2OKX A;  2VNV A;  3ZDV A;  2HKX A;  1W06 A;  4UOJ A;  1LKN A;  1K5M A;  2VU9 A;  4C1W A;  2G9F A;  5CFC A;  3EBR A;  4XUN A;  4KMQ A;  3BOD A;  3M3O A;  4R9B A;  2Q5T A;  2YY1 A;  2RM2 3;  3TEZ A;  2FZ1 A;  3VUO A;  3Q9O A;  2Q8E A;  4BQ3 A;  4QWN A;  3IPV B;  4PF5 A;  4URT A;  1MS1 A;  5FZF A;  4CCJ A;  1NE6 A;  3GF6 A;  1S2E A;  3SXW A;  4D94 A;  4I0B A;  2RVA A;  3ES1 A;  1L7Q A;  2WN2 A;  3KV9 A;  1XJA A;  1X36 A;  4P9J A;  5F3I A;  2DBN A;  2AYH A;  1W0O A;  1JZ2 A;  5FRE A;  4QKN A;  1NA1 B;  2AEN A;  3N35 A;  3NV1 A;  4JZR A;  1UIK A;  3K77 A;  4NWW A;  4XAA A;  3ZOI A;  2OZ6 A;  1YI9 A;  3MV0 1;  1OSG A;  2F6B A;  3LEK A;  1O6U A;  3HN3 A;  3N9Q A;  1TMF 2;  3C3V A;  2DUP A;  2QQW A;  3MPB A;  2H6B A;  1CAU A;  4Q4Y 1;  1NXD 1;  2VNR A;  4FOV A;  3TNQ A;  3ZN6 B;  1C3H A;  1AR9 2;  3WNL A;  4CE8 A;  2CWM A;  1BK0 A;  4R8H A;  3WNK A;  3J9S A;  4LBO A;  1D4M 2;  1RUI 2;  2VUD A;  1OD3 A;  1RHI 1;  2WT1 A;  2R32 A;  4PLN A;  1YFU A;  5EZW A;  2FMY A;  2R07 2;  3PNA A;  2Y6G A;  4J25 A;  4O61 A;  1S2B A;  1QOO A;  2DCK A;  3T0B A;  5GLV A;  3OEB A;  2I45 A;  2CWS A;  2D3P A;  1R08 2;  4CXX A;  4Y5S A;  5A1A A;  3KD4 A;  4IND A;  4CSW A;  2HWD 2;  2VJX A;  3I2H A;  3K3O A;  3VBH C;  1H2K A;  5T5O A;  5JR7 B;  2WNV C;  3WW2 A;  2J1A A;  5ACA 2;  5I0D A;  2UY9 A;  4Q4Y 3;  3JUU A;  1VB4 A;  1X33 A;  3FX3 A;  3GBG A;  1V6K A;  4YZ1 A;  1ASJ 2;  4FOW A;  5FLJ A;  1POV 1;  2C6S A;  5FMO L;  5JUV A;  1KJR A;  1OHF A;  4LUK A;  4BIF A;  2PQS A;  1AL0 G;  2W91 A;  4PIY A;  3MZH A;  1RHI 3;  5FTT C;  3VV1 A;  1OLR A;  2WQ8 A;  1LOF C;  1CZT A;  4N53 B;  3WG1 A;  1JZ3 A;  1NOV A;  1UZZ A;  1RUD 1;  1LHN A;  3KT4 A;  2DVB A;  3B69 A;  1SAC A;  3AP5 A;  5LEJ A;  4NUB A;  1C57 A;  1YFX A;  5JAX A;  3I3M A;  2DUO A;  4B7K A;  3POW A;  4LO5 B;  3THP A;  3UGF A;  2F17 A;  4ONU A;  4F8A A;  3E6D A;  5A3M A;  2ADE A;  2WWJ A;  3BVC A;  1V9U 2;  5GAL A;  3VHO A;  3NO8 A;  4W6W A;  4QDR A;  4WM8 C;  2HWB 2;  4YG0 A;  3ZYP A;  5AC9 2;  1POV 3;  3IM0 A;  2IC1 A;  5IUQ A;  4XJ9 A;  5H9P A;  5J09 A;  4LEJ A;  3ACI A;  3GHM A;  2PHF A;  4AVC A;  4CCN A;  5BNP C;  1EP0 A;  3USU B;  2ZX2 A;  4IXL A;  4RSU A;  4OHX A;  2GNT A;  1W6O A;  1GWK A;  4SBV A;  3UNP A;  2GSY A;  1AJO A;  1RUD 3;  1Y9Q A;  1N1S A;  3MIF A;  4AI3 A;  4CCO A;  5KBF A;  3H1W A;  4LBN A;  1C1L A;  3TWI A;  4CDU C;  5CKQ A;  5F9T A;  4XUQ A;  4LE4 A;  4YRD A;  1NLR A;  2R04 2;  1WBL A;  4ERO A;  3AZV A;  4NHY A;  3TB0 A;  3ZYG A;  5F5C A;  2WZR 1;  4OI1 A;  4I0A A;  4OUS A;  5ABJ C;  1JU3 A;  4QQP A;  1OKQ A;  1ZZ9 A;  3F2Z A;  2UYA A;  5D8A A;  1GZC A;  3PJY A;  4S2D A;  1BBT 1;  1PGW 2;  3WY6 A;  1YXW A;  3DCQ A;  4LBQ A;  5FFO C;  2OW4 A;  3DKW A;  5EQU A;  1QEX A;  4HVQ A;  1F8V A;  5H9Q A;  4AEK A;  2Q1Z B;  4XET A;  5LA0 A;  1JZ8 A;  1ZX5 A;  1W8F A;  2VZP A;  3OBZ A;  1HB4 A;  5LY2 A;  2YMZ A;  4E27 A;  4YLZ A;  1ACC A;  2ES3 A;  3ES4 A;  4Q1P A;  4CZS A;  4DUV A;  3K4A A;  4LKD A;  2Y8K A;  1REF A;  4ASK A;  2XHN A;  2ZX1 A;  5FMD A;  5FY1 A;  2ZHN A;  3SKJ E;  2EAK A;  1FV2 A;  1VBB 2;  4QPI A;  2ARE A;  2WZR 3;  4FFG A;  3S5Q A;  3OBA A;  3ILF A;  4G4F A;  2EVX A;  3PIJ A;  3WG3 A;  5M0T A;  4HET A;  4E4S A;  4CDW C;  1BBT 3;  1QWR A;  2YZ4 A;  4KWL A;  4PI0 A;  4KL1 A;  5FUP A;  1LOG A;  3RVH A;  5BNN A;  3POI A;  2BP6 A;  4NN0 A;  1NX9 A;  1LRH A;  4B3N A;  1AZD A;  1GZT A;  2JEC A;  2VTX A;  4QPI B;  4CDX C;  3CNA A;  1AXZ A;  1TME 2;  1VAL A;  4IDZ A;  4L99 A;  3PMS A;  3NJX A;  3C7O A;  3GBW A;  2JIC A;  3OCP A;  2OUH A;  2VUC A;  4OUM A;  4XCA A;  4AVV A;  3ZPO A;  1KFX L;  2WO1 A;  1F2N A;  4JQR A;  4BB3 A;  3UT0 A;  3TRS B;  3BGA A;  3G7D A;  1YHF A;  5FAX A;  1O3T A;  1QH6 A;  2EIC A;  3LGR A;  3HMY A;  3JZV A;  2ENR A;  3BTX A;  1VP6 A;  4UWD A;  1AL2 2;  3WP3 A;  1WCQ A;  1HRI 1;  3APB A;  1LUL A;  4IGQ A;  2YHJ A;  1JYX A;  1SCR A;  3AYD A;  3M70 A;  1K12 A;  1DP0 A;  2FBE A;  2G9Z A;  4KQ7 A;  5EV7 A;  5FWJ A;  1JYW A;  3PLQ A;  5CIS A;  2O0O A;  3KVB A;  3S0M A;  2R49 A;  1ZRE A;  3CZU A;  4IV3 B;  3BU0 A;  3THD A;  3J7N A;  3LA7 A;  4QXH A;  4XAE A;  5DPN A;  3VBO B;  1TEI A;  5JZG B;  1GNH A;  2P1B A;  4D7S A;  1O3S A;  1AJK A;  1RMU 2;  5FY7 A;  3EJK A;  5LY1 A;  1REE A;  5EWS A;  3CDZ B;  3MV1 1;  2ZEY A;  5JPN B;  4FOY A;  3RYP A;  1YI7 A;  1WLW A;  5CU1 A;  2W9X A;  3KZ4 C;  2ZBJ A;  5LAT A;  2R7E B;  5FZL A;  5CNA A;  4AED A;  5FY8 A;  4L0P A;  4QMA A;  1OLM E;  5FUI A;  1NKG A;  3V0A A;  1JBC A;  2YV8 A;  3L2Y A;  3N36 A;  3OF1 A;  4LE3 A;  1HRI 3;  5FKB A;  1U5I A;  1S1A A;  3O12 A;  1DYK A;  5A7O A;  5FPA A;  4ASM B;  1LTE A;  1LCL A;  1QDO A;  1ZM1 A;  5A7W A;  3JQW A;  4MOA A;  1AYM 1;  1WW7 A;  1OT5 A;  3WXP A;  1HN1 A;  2JEN A;  4YVW A;  3T30 A;  4MHU A;  4XAC A;  1OQE A;  3Q8B A;  4OHZ A;  1ZBE 1;  4NPR A;  3SQO A;  1W28 A;  5DDJ 1;  3RNS A;  3LE0 A;  5LCW L;  3PUI A;  1ZRI A;  2JG8 A;  1LED A;  3FMG A;  5BUV A;  2VOK A;  4JC1 A;  1W9W A;  1GNZ A;  1YQ2 A;  2VM9 A;  2A7A A;  4CCD A;  3S7E A;  2VO5 A;  4BXS V;  3ACL A;  4ISR A;  2JEM A;  1J83 A;  1EV1 2;  2RS1 2;  3PUH A;  3H8U A;  1GMM A;  3OG2 A;  3URF A;  3A22 A;  3LA3 A;  1W2N A;  2GU9 A;  3AC0 A;  1D2Q A;  2JDY A;  3BCW A;  5JSP A;  3OBR A;  3UKT A;  2W08 A;  3SLI A;  4P9W A;  1SDW A;  3VBS A;  2Y64 A;  3IB3 A;  3JXS A;  5EJZ B;  5FUN A;  3AZX A;  1GU3 A;  2XUE A;  3VKM A;  2W1W A;  5GLW A;  3PTY A;  1AYM 3;  2W2I A;  5FIX A;  5K0U A;  5DZG A;  3NAP A;  4H2A A;  1W05 A;  2JIJ A;  1ZBE 3;  2J1S A;  3RI9 A;  5DDJ 3;  4P14 A;  2NPI A;  2E7A A;  4RQP A;  5A33 A;  5C4W C;  1FXZ A;  4YNI A;  5K4L A;  4UFK A;  1MEC 2;  1BEV 2;  1UMZ A;  1NZC A;  3RJR A;  4M0N A;  3AZW A;  1LJ7 A;  4GH4 B;  2I07 B;  4A41 A;  1NY7 2;  3N9N A;  1H8T B;  1KRI A;  3SH3 A;  1E5S A;  4AF9 A;  1DQ1 A;  3POB A;  3QOP A;  5LBF A;  4CTE A;  2XJS A;  2VVD A;  1I1E A;  3MUZ 1;  4X8N A;  4MGT A;  3VHP A;  4FVV A;  5F32 A;  2E7Q A;  4JKM A;  4BU2 A;  5L9R A;  1FNZ A;  2VCC A;  2BW8 A;  4XF4 A;  5JVV A;  2DVA A;  4QQL A;  3WDT A;  4JGY C;  1DHK B;  2E32 A;  2A3Y A;  3H7Y A;  1AYN 2;  1HXS 2;  4QKD A;  2VD7 A;  5C5U A;  4ZU7 A;  4R4X A;  3MIE A;  1XE7 A;  3IKW A;  4GMP 1;  4RL7 A;  3T3Y A;  1XPW A;  4NII A;  4RS5 B;  4QPG B;  4X8P A;  4PF1 A;  5AVP A;  1UXX X;  4HN0 A;  4YW4 A;  1ND2 C;  2Q30 A;  3R4S A;  1GOF A;  4YZ4 A;  4RHV 1;  4GKX A;  4P08 A;  3OUI A;  1VBD 1;  1FNY A;  3I7D A;  1DGR N;  3VHN A;  4FQ4 A;  4RS5 C;  2YGL A;  2EIG A;  1CN1 A;  1G8W A;  3E1F 1;  3NV2 A;  4JHZ A;  3TEW A;  2AZ5 A;  1RB8 G;  4NHM A;  1UO9 A;  3A4U A;  1GOG A;  1SHW B;  2Z4F A;  4FP3 A;  4UFH A;  4DNY A;  1RUC 2;  5L36 A;  1PGL 2;  5JOX A;  2WSV A;  4E2Q A;  5KHK A;  1N3P A;  3NV4 A;  4RFR B;  2XKP A;  5B4X A;  4QXC A;  1N3Q A;  4DB5 A;  2XVG A;  4GMP 3;  1CVN A;  3CJI A;  4QHO A;  4UW5 A;  1AR7 2;  1NLQ A;  2IFW A;  2WYS A;  3U0Z A;  4IEU A;  3C7E A;  4K1Z A;  1UMH A;  2PA7 A;  1GYK A;  2XWB B;  2JIG A;  3IZO A;  1IPS A;  1V6M A;  1DQ5 A;  1OOP B;  2OII A;  4RHV 3;  3UJO A;  3M8L A;  1QOT A;  1R1A 1;  3EYP A;  3UKN A;  3VD9 A;  1LOC A;  3GAL A;  5CEH A;  2ZX3 A;  2VUJ A;  1KDK A;  1O5U A;  5CA6 A;  1VBD 3;  4S2H A;  3LIH A;  4OFG A;  4ARY A;  4YW3 A;  3GCX A;  4FPC A;  1WW4 A;  4ATF A;  4C1X A;  1B35 B;  1GKB A;  4NPL A;  2ZXQ A;  2E9Q A;  2JDU A;  5FKC A;  5FPU A;  5IVJ A;  4I2O A;  3EB7 A;  4UI9 L;  2GMP A;  5T3N A;  4DS0 A;  4HN1 A;  1O3Q A;  1W8Z A;  4MG2 A;  3BOW A;  1OA3 A;  1OA2 A;  3I2F A;  1J1T A;  1I3H A;  3MIB A;  2J1V A;  4IEQ A;  1NCQ B;  4EZ4 A;  2ID4 A;  1QJX 1;  5A3O A;  2TNF A;  3M7A A;  5T50 A;  3NKG A;  5BXX A;  1O8S A;  3ZDS A;  4QPW A;  4B8E A;  2V73 A;  4N90 A;  4H3W A;  1V00 A;  5F6L B;  5JIU A;  2ERF A;  4XDO A;  1NCR C;  4MUV A;  1RUH 2;  5JDB A;  2ZMN A;  1R1A 3;  1VBC 1;  2WUH A;  2ZGN A;  3ZYJ B;  3ZXA C;  1PK6 A;  2JE7 A;  2OZJ A;  2NP0 A;  2VZQ A;  4IV1 C;  1DZT A;  2IWG B;  3LOI A;  3JBG 2;  4GWI A;  4PDW A;  2YYO A;  3ZFG B;  4O9G A;  1VAM A;  2RR1 2;  2X10 A;  2YC0 A;  3ZFF B;  2SLI A;  4Q4X 2;  3NRU A;  1BVV A;  1HRV 2;  2RS3 2;  4YVS A;  1W8W A;  4YG3 A;  5FYB A;  5A32 A;  1HQW A;  4BE3 A;  1QJX 3;  1RUJ 1;  1TNF A;  3WQ1 A;  2CGN A;  3RZL A;  3VZJ A;  1MS3 A;  1MVE A;  4QX7 A;  2XVL A;  4CXW A;  5A3P A;  1UD1 A;  1VBC 3;  4DZG A;  1UYP A;  2XGX A;  3T2P A;  3KV5 A;  1XB9 A;  1WMF A;  2VOT A;  4Q0V A;  4UFJ A;  1R09 1;  2D40 A;  2TEP A;  1ONA A;  2QBX A;  4Y22 B;  4LT5 A;  3AKP A;  4HPK B;  1SPP A;  1VAV A;  4KBZ A;  4P02 B;  1PMH X;  3POS A;  1FAT A;  4X6Q B;  4AK3 A;  3LEM A;  2FHR A;  4DUW A;  5GZG A;  3KQ4 B;  1A8D A;  5FYT A;  4GZ9 A;  1I9R A;  4AE2 A;  2B9V A;  1YCI A;  3J7L A;  1W39 A;  3USS A;  2QNK A;  1RUJ 3;  1S0E A;  4XXP A;  5FP9 A;  1UPS A;  5FZA A;  2A6Z A;  4I02 A;  2PHD A;  4C90 A;  4DY3 A;  2BVB A;  3J26 N;  1KFU L;  2HBT A;  2LRO A;  4D0Q A;  3H7J A;  2N7G A;  4AEJ A;  4QQO A;  3OEA A;  3A23 A;  1HB1 A;  3DEC A;  3GHN A;  1UY0 A;  2D98 A;  4KH9 A;  4PBO A;  2BGC A;  1UU6 A;  4RR3 A;  1R09 3;  5CKN A;  1U5Z A;  4HK8 A;  1MS9 A;  1LEN A;  2VMH A;  2WKK A;  3LPG A;  4Y33 A;  4N43 C;  4XJW A;  1Y7B A;  3ZSE A;  2WWU A;  4MXV A;  4Z82 A;  2IXK A;  1SFY A;  3AKR A;  5FMO S;  4AOC A;  4JRL A;  1ZBA 1;  2VW1 A;  3NV3 A;  3N9O A;  4XZP A;  4LOR A;  1W8U A;  3LIG A;  4CDQ A;  2CAU A;  2RV9 A;  4MX3 A;  1LAJ A;  5BY5 A;  4MGY E;  2BYV E;  4EYU A;  4PIZ A;  1I6X A;  1CAW B;  1WD3 A;  5FZI A;  4LK6 A;  3IMM A;  3V0B B;  4CCL A;  4UF0 A;  1NE4 A;  2QVS B;  1E5R A;  4CCM A;  4NID A;  1S0C A;  1NG0 A;  2P5B A;  4FFI A;  5FZ6 A;  1L7R A;  3BOP A;  1PVX A;  4HSL A;  5T54 A;  2GAU A;  2VCB A;  2A6Y A;  1LU1 A;  3M1H A;  4Y1X A;  3VBR B;  5A1L A;  2ZHM A;  3PME A;  4IES A;  4ZXE A;  1CQ9 A;  3VDC A;  3DYO A;  5FZE A;  4A3Z A;  4YM2 A;  3CF6 E;  2RDS A;  4Q0Q A;  5B4N A;  5A7P A;  3MI8 A;  1RVF 2;  1ZBA 3;  3JD7 2;  3LDB A;  3WDU A;  5CZK A;  5D21 A;  3CHX A;  4OHV A;  4PBP A;  2CAV A;  2BUK A;  4FTS A;  4R9A A;  1K42 A;  3NNF A;  2AR6 A;  1U5Y A;  5DZF A;  3ZXG A;  4KI5 M;  3ILR A;  1W6Q A;  3D8C A;  4HVR A;  5FY9 A;  1XYP A;  2BTV C;  5GM0 A;  1J58 A;  1UZ0 A;  2VEC A;  2VTX J;  4GB3 2;  2QZ2 A;  3SEE A;  5BNO C;  5F3G A;  3U11 A;  3KF5 A;  3M4F A;  1CJP A;  5E16 A;  5F3C A;  2J1E A;  5FOJ B;  4FAG A;  1WLD A;  5FZG A;  4M4R A;  4LO4 B;  3VBU C;  2BVV A;  1ND3 A;  4Q8L A;  2DFB A;  2GN3 A;  2JG9 C;  1QJZ A;  4XTM A;  3AJZ A;  1UIJ A;  3I2D A;  5KHI A;  1OI6 A;  5C70 A;  4CU7 A;  1G9C A;  4L92 A;  2W47 A;  1UOB A;  2D6N A;  4FXG B;  2VZV A;  1MZE A;  5FYZ A;  2ZA9 A;  4QB6 A;  5FY0 A;  4ES9 A;  2FCT A;  5D2A A;  1UYY A;  2VZT A;  1DLL A;  1QJU 1;  1J3P A;  1W8N A;  5F7U A;  3FUO A;  2QDR A;  4H7L A;  1C8N A;  1W6N B;  3RYK A;  4BXF A;  2DWR A;  2EAA A;  3LA2 A;  5CIR A;  2LS6 A;  1PM7 A;  3HWJ A;  3H1Y A;  3B3Q E;  3GYD A;  4Q5O A;  4YGD A;  5SV8 A;  1ZZ8 A;  3R6S A;  3WQ0 A;  4BQ2 A;  2X05 A;  4XF3 A;  4DIQ A;  1YJL A;  2RS5 2;  1DYP A;  1ZZB A;  1NLS A;  4OZX A;  2VCM A;  4Y5T A;  1UOG A;  2D6L X;  2WQ4 A;  3MFC A;  4XPV A;  3ZFE B;  4IUG A;  3I59 A;  4Q26 A;  1OLM A;  2WT0 A;  4HT1 T;  1STM A;  5C8C C;  3SEP A;  3WCR A;  3MF6 A;  3AKQ A;  5FK7 A;  3RDI A;  4CRQ A;  4EN8 B;  1SQ4 A;  5HXM A;  4JGZ B;  3RPQ A;  1X8E A;  1QJU 3;  1LB2 A;  5FP7 A;  2ZGS A;  1JS9 A;  2RHP A;  4K40 A;  1FPN 2;  2PLV 1;  3H0O A;  3Q8A A;  4YW7 A;  1KJL A;  4EJR A;  5EJ3 A;  2VTF A;  2R6Q A;  3CO2 A;  2X5I A;  3VZK A;  2QQK A;  2W39 A;  4JGZ C;  3ABZ A;  4DXZ A;  2ZS6 B;  3SHR A;  5I0T A;  4CEY B;  1XC6 A;  1BCX A;  3ZSM A;  4FPY A;  1W6M A;  5ISL A;  2P4E A;  1X82 A;  3KV4 A;  1JYI A;  3RMY A;  4CEW A;  4LO6 B;  1AVB A;  2WZ8 A;  1ULO A;  1W9Y A;  3OOX A;  4IEY A;  4WVV A;  4Y1Y A;  3ZXE A;  4BYY A;  5JWP A;  2CDO A;  5F5Q A;  3ZR5 A;  4V1P A;  4AGR A;  2XXZ A;  3MHZ A;  1RIN A;  2Y60 A;  4MZU A;  4P5H A;  1WW5 A;  2WNU B;  1HN0 A;  1ENQ A;  4WM7 B;  1HV1 A;  2NMO A;  1VIW B;  3P3N A;  2PLV 3;  5CB7 A;  1KGY A;  2ORX A;  5JOZ A;  5FRA A;  3VZN A;  4HL0 A;  5FPZ A;  1XNA A;  4M00 A;  2ZMK A;  4XFF A;  2Z2S B;  5HCB A;  4YZ2 A;  1VRH 2;  4CP1 A;  2YB7 A;  1FYU A;  3BTZ A;  3QBQ A;  1CGP A;  2Y0O A;  2AEZ A;  4JCK A;  1UX6 A;  1CIW A;  3OJB A;  2Q8D A;  3TBD A;  3AYA A;  4YYO A;  3RZM A;  4LNV A;  5GLZ A;  3B7M A;  3BU7 A;  5J7M A;  3KGZ A;  3FJS A;  2YU1 A;  4NAM A;  1XU2 A;  2WFF 1;  4Q0U A;  1XOY A;  1S4C A;  1WWY A;  4JV4 A;  4ES8 A;  2C0Z A;  1UN1 A;  1YUD A;  3HQX A;  1AR9 1;  1FV3 A;  5LA9 A;  2Z42 A;  5JMO A;  2CSG A;  2QQP A;  3WUD A;  4LHL A;  4NAO A;  3I2G A;  1QXJ A;  2JKB A;  1PNF A;  3AXD A;  3WNO A;  3O0W A;  4I3P A;  5EHD A;  3R4U A;  2VOX A;  4B1L A;  4IEV A;  2ADD A;  4AFD A;  5F8P A;  3JU9 A;  4OI4 A;  3VBF B;  1UYX A;  3NNL A;  5JCT A;  1OH4 A;  3NJZ A;  2FDI A;  5CFD A;  1MQT B;  3FBY A;  4AXO A;  1O91 A;  1R08 1;  3O1P A;  1H6Y A;  2V5D A;  1A78 A;  3GZE A;  1L7L A;  1V70 A;  3DN7 A;  1IKQ A;  2MEV 1;  2HWD 1;  1CZV A;  2XJP A;  3B02 A;  3BTA A;  2HWF 1;  2FMD A;  3T1L A;  5C71 A;  3R4D B;  3ZXD A;  5EFU A;  2WFF 3;  2ZGO A;  1FI2 A;  5ACA 1;  4XCB A;  1QJY 1;  2AEY A;  3OY8 A;  4EWE A;  2P3I A;  2X8K A;  3HAG A;  1TE1 B;  1AR9 3;  1YWK A;  3WF0 A;  5L7O B;  1XRU A;  3S7I A;  3OTF A;  2WSU A;  3DPR C;  5CFD B;  4BM8 A;  3I4I A;  1OLQ A;  2RMU 1;  2VMD A;  4AFB A;  3VKO A;  4HON A;  4WVW A;  4TZD A;  2E7T A;  1BLZ A;  4HAN A;  1LES A;  2VW0 A;  1C5H A;  1K5M B;  2OPK A;  4XUO A;  4E2S A;  5CFC B;  3T0D A;  2JB4 A;  2VXJ A;  3I2O A;  5DAV A;  1XBF A;  3DYM A;  2BQP A;  3LDR A;  5DG2 A;  3U4X A;  1W2A X;  5FXW A;  3IWZ A;  2QQJ A;  5F3E A;  1R08 3;  4U2A A;  1MS4 A;  1F4A A;  1W2U A;  1NYW A;  2HWD 3;  2MEV 3;  4JAA A;  1IHM A;  1K5M C;  2HWF 3;  4O9E A;  4XJZ A;  5I0R A;  3EMR A;  1JZ7 A;  1GP5 A;  3RG0 A;  5ACA 3;  1RUG 2;  5FLI A;  1NQD A;  1QJY 3;  3T4H B;  1S0D A;  3W58 A;  2HWB 1;  1GQH A;  4Y3O A;  2Q8O A;  4XHX A;  4MHR A;  4EWA A;  2BFU L;  3FBM A;  1NA1 C;  1CAV A;  2RMU 3;  5FZK A;  1ZNP A;  4AI2 A;  1XSR A;  2QTW B;  3SKV A;  4CCK A;  3CEW A;  1QY4 A;  2ZZJ A;  3M3I A;  4LIU A;  3WNX A;  2ATF A;  4BIO A;  4Q8K A;  4B29 A;  1NT0 A;  1LHW A;  2J7M A;  1CAU B;  2NQY A;  2PEL A;  2ZX4 A;  2BZD A;  1W8T A;  3AP6 A;  1BXH A;  3M3E A;  3O1S A;  2ILM A;  3E5Q A;  4IL7 A;  3VBH A;  4AHW A;  2WNV A;  5IW0 A;  4WBB A;  3T08 A;  1HLC A;  1S2K A;  4XFC A;  1G9B A;  2D5F A;  2JDH A;  1JHN A;  1OMI A;  1WCD J;  1XND A;  2KA3 A;  3I3E A;  4IE4 A;  4J1W A;  2HWB 3;  4CU9 A;  2DU0 A;  4BCU A;  4PCR A;  2ZJC A;  4Z1V A;  1VBE 1;  3ZYF A;  1PGW 1;  1D2S A;  1PZ7 A;  4OQ9 A;  5HBA A;  1ZZ6 A;  1LOF A;  4IW3 A;  2JX9 A;  2W52 A;  4GAZ A;  5JXJ A;  3AP7 A;  4H55 A;  2R06 2;  2YUE A;  3C7G A;  3MFA A;  1OBN A;  3WDY A;  2QQU A;  4CUC A;  1EPW A;  5JXH A;  5J36 A;  3IAP A;  1POQ A;  3N7M A;  5KHJ A;  2D93 A;  4YGC A;  4BLJ A;  4IE6 A;  4S2F A;  2P6C A;  4AL9 A;  5G05 L;  1PMI A;  1NUK A;  2NYY A;  2WQZ C;  4ZKT B;  3ZMN A;  1F9K A;  1BKZ A;  2DVD A;  4QX1 A;  5LEK A;  3CJX A;  3T1M A;  4AFC A;  2EF6 A;  1YQ6 A;  1MPX A;  1VBB 1;  4NR1 A;  4WM8 A;  3HVD A;  4N53 C;  4C0H A;  1SG3 A;  2O14 A;  3CBN A;  2YG0 A;  4L8Q A;  1O4Z A;  4CPB D;  4COW A;  4P9G A;  3LCP A;  3SNM A;  1WGP A;  3B00 A;  4H14 A;  5BNP A;  1VBE 3;  3GM8 A;  4A2U A;  1GLH A;  4M3C F;  1AR6 2;  5JI7 A;  1RJ8 A;  3AMH A;  4NWV A;  4DY5 A;  3AL5 A;  5LW9 A;  3FLP A;  1BMV 1;  5DAQ A;  5DG1 A;  4LA2 A;  4TWT A;  5IK8 A;  5FV3 A;  1S0J A;  2W94 A;  4CDU A;  1H30 A;  4ZU5 A;  1UZV A;  4AQ6 A;  3H9A A;  4D69 A;  1P8J A;  1ZRF A;  3RS6 A;  2YPJ A;  4YZ3 A;  5ABJ A;  4FFF A;  4L2N A;  5F2W A;  4B4Q A;  4Q4Y 2;  1IPJ A;  3RZJ A;  1VBB 3;  3IDA A;  2W46 A;  4RA0 A;  1W6O B;  1AL2 1;  1OPO A;  4LIV A;  1AF9 A;  2X53 S;  1RHI 2;  3H3U A;  3WNN A;  4DEQ A;  4BMB A;  2HEV F;  2ZOE B;  4OQ8 A;  3OSD A;  1VBA 2;  3K48 A;  3PUQ A;  3EHK A;  1LGN A;  3WF1 A;  4W6Y A;  5C3R A;  3BAL A;  4MGI E;  2WIN B;  4QX2 A;  5FPX A;  5H9R A;  2R30 A;  2B7Y A;  3WDX A;  2RJK A;  4BQ5 A;  5D8A B;  2ZAA A;  2ZML A;  4AI8 A;  2Y33 A;  4LBQ B;  1RUF 1;  4K8F A;  1XSQ A;  2WO3 A;  2K9Z A;  1M06 G;  4ARX A;  2ZTN A;  4LOT A;  3WQ7 A;  4CDW A;  1V6L A;  4KNC A;  1DZR A;  1PGS A;  5FZ3 A;  1AL2 3;  3VGI A;  5JSR A;  1RIT A;  4XEZ A;  3GGL A;  3OPT A;  2WAB A;  4L97 A;  4D6S A;  5KXC A;  4DQA A;  1GAN A;  1AR8 2;  1APN A;  5FPB A;  1PIV 1;  3IAQ A;  1RUD 2;  3III A;  2FD8 A;  5C6C A;  1LEC A;  2NMN A;  1WMD A;  2XWJ B;  4Y1V A;  2WZE A;  3ENR A;  4R52 A;  2ZGK A;  1VR3 A;  3M2M A;  1G6N A;  2UYB A;  4LQR A;  1KEX A;  4XF0 A;  4S2G A;  3QAC A;  5A80 A;  1XNB A;  5A3U A;  3ELN A;  1RUF 3;  3QCW A;  5I8Y A;  5BNN B;  2OA2 A;  3H8O A;  1MS0 A;  1QKQ A;  1MS8 A;  2VMC A;  1DLC A;  1JU4 A;  1H9W A;  2RS1 1;  3LWC A;  4QPI C;  4QX8 A;  4XMA A;  5FP8 A;  4A3X A;  2H0B A;  3BIE A;  1SLA A;  3AB0 A;  4XC9 A;  2OT7 A;  1POV 0;  3MUY 1;  5IVB A;  1W9T A;  4ISQ A;  1W03 A;  1PIV 3;  1PX4 A;  2H0V A;  4MH0 E;  5FO8 B;  4W50 A;  4XF1 A;  4XQW A;  3EXU A;  3TN9 2;  1C4R A;  3BPZ A;  5C3P A;  3LOB A;  3E97 A;  5CAD A;  1K5J A;  2D7F A;  5L73 A;  4B7E A;  2VOW A;  2LUW A;  1COV 1;  1H1A A;  3M3C A;  3OGS A;  1J3R A;  1XU1 A;  2C24 A;  2VBB A;  2EIB A;  3I3Q A;  2DYC A;  4IV3 C;  4PHZ A;  3KM5 A;  4AG4 A;  3VBO C;  1VB2 A;  3Q8F A;  4XBN A;  5JZG C;  3ORJ A;  2RS1 3;  1QXR A;  1D0G A;  2VY0 A;  2EXH A;  1HDK A;  4LMF A;  1OPM A;  2Z69 A;  4ZXK A;  5A6Q A;  4FPG A;  2BNN A;  3IDC B;  1YIP A;  3I3B A;  1X9T A;  1H2L A;  4BA6 A;  1MAC A;  2G9G A;  1OVS A;  2GND A;  2ZGU A;  3AYE A;  1DBN A;  2VBD A;  1VE0 A;  2GNM A;  4AED B;  3PJQ A;  4JQT A;  2VUL A;  1Q8O A;  4YW1 A;  3MF9 A;  1COV 3;  3V0A B;  1OF3 A;  4E4H A;  2XOM A;  1U12 A;  1ZRC A;  4RGA A;  3S5A A;  1OA4 A;  4BLI A;  4LUM A;  5KWR A;  2XQX A;  4XBL A;  2VME A;  5FZ9 A;  5A7S A;  1Z7S 1;  4QGN A;  5A7W B;  3ZIW A;  3ZX7 A;  1GP4 A;  1UCX A;  4Y4Y A;  2QKD A;  5FMC A;  2Y0I A;  3NQH A;  4YVW B;  1UY1 A;  4UFL A;  5IVY A;  3MDP A;  5GZC A;  3ECQ A;  4TYS A;  3OBT A;  1RXF A;  2VE1 A;  1C28 A;  3SMH A;  2WAA A;  5C3S A;  2JG8 B;  4HKL A;  4FXK B;  4TN7 A;  3J7M A;  4C0B A;  2ZKL A;  1U0A A;  5C4W A;  1RUC 1;  1PGL 1;  3K4Z A;  2P3Y A;  4XJA A;  1H4G A;  4GIQ A;  3ZXL A;  1KS4 A;  5DUU A;  4QKB A;  3CMG A;  3MIH A;  3VBS B;  1W2O A;  2R0F A;  3ME2 A;  1Z7S 3;  3WF4 A;  2A6W A;  1HRI 2;  4MLO A;  2QQO A;  2EA7 A;  5FO9 B;  5K0U B;  3UGG A;  2BBA A;  3AMN A;  3NAP B;  1E57 A;  1VJ2 A;  3K46 A;  1OFS A;  3WIN E;  5HCA A;  5A3L A;  2IXH A;  4KBB A;  4RQP B;  5A33 B;  4FPL A;  5AFB A;  2A1X A;  1G86 A;  3KV6 A;  3DL3 A;  4JGY A;  1ALY A;  4LR4 A;  4QX0 A;  2K0G A;  4GH4 C;  3VL8 A;  4M3C A;  1AHS A;  1LHV A;  5GLU A;  4P9I A;  2HWE 2;  1OC1 A;  1H8T C;  1RUC 3;  2HWC 2;  3A0N A;  5FP3 A;  1A8M A;  2OX0 A;  3H1M A;  5FZ0 A;  4AQS A;  3WDV A;  2WAO A;  1SDD B;  4IGP A;  4RQP C;  2XON A;  3NJV A;  4HZF A;  4Y26 A;  3KLS A;  4HKW A;  2XPJ A;  1HIX A;  1LHO A;  1AUY A;  4EE2 A;  4DXS A;  4GWJ A;  3LPF A;  1ND2 A;  3D82 A;  5FZ7 A;  2FDH A;  1IOA A;  4GA9 A;  2WA3 A;  2FDF A;  2JWP A;  2OXB A;  1SMV A;  2I2S A;  2W92 A;  4AVT A;  1V6J A;  4UFI A;  3AFK A;  1JZ4 A;  2ET1 A;  1CX4 A;  2O1Q A;  1JYV A;  2EXK A;  4CCE A;  1RUH 1;  2JB8 A;  1N47 A;  1AYM 2;  2HYX A;  3ACF A;  1CON A;  4UW3 A;  3WW1 A;  2DFC A;  4LBL A;  1CJD A;  3DV8 A;  1DQ6 A;  3JBG 1;  4RGG A;  2A6X A;  4QPG C;  3BIW E;  5DDJ 2;  3TAY A;  4BZ4 A;  2RDR A;  1A34 A;  1G9D A;  1QIQ A;  1YFY A;  2E33 A;  4P9Y A;  3RSJ A;  3AK0 A;  3VHR A;  1SZB A;  2ARB A;  2RR1 1;  1C8M 2;  4CP9 A;  4A7Y A;  4IEZ A;  1DCS A;  5A6X A;  5BNQ A;  5CAZ A;  2D6O X;  4Q4X 1;  1F5J A;  1WZX A;  2A6V A;  2AUY A;  2RS3 1;  3OGJ A;  4FQZ A;  4WVM A;  2OQ6 A;  4YW2 A;  2Y34 A;  4Q4V 1;  3ZYH A;  1ODN A;  1WLC A;  3IMN A;  4XE9 A;  4BIS A;  4DPN A;  3AVS A;  4B1M A;  5FDB A;  1PM4 A;  2JE9 A;  3UGH A;  4Z2W A;  4B4P A;  2WA4 A;  4IEW A;  1UWW A;  2XLA A;  1G7Y A;  1RUH 3;  3GJB A;  2B42 B;  5DMY A;  3GNE A;  2KD7 A;  4G3Y C;  1J3Q A;  1WCK A;  2E53 A;  2QQV A;  2DUR A;  5IHR A;  3CJI B;  5ANN A;  3KT7 A;  3KHC A;  1IS3 A;  2A3W A;  3CU7 A;  4OI2 A;  1OOP C;  3WR0 A;  2P3J A;  3MIC A;  4A4A A;  1RIR A;  1Y9M A;  1UX7 A;  2RR1 3;  1FOD 2;  3MEP A;  1JW6 A;  2XBO 1;  1EAH 1;  4Q4X 3;  4XIO A;  3THT A;  4AEM A;  2RS3 3;  4YG6 A;  5CKM A;  4Q4V 3;  5J1X A;  3MLJ A;  5I0S A;  1B35 C;  1YC6 1;  2J1R A;  4KWK A;  3LSE A;  4UBH A;  1NCR A;  1SFN A;  1GSL A;  4YPJ A;  4J6G A;  2DCT A;  4NJ4 A;  1XNT A;  2KR2 A;  3A0K A;  2UWC A;  3FN9 A;  4IV1 A;  4FPE A;  4TSV A;  2J1T A;  5LRS A;  2VPV A;  4IE7 A;  3OYW A;  5CYY A;  3ZKU A;  1NCQ C;  2WR9 A;  5CG8 A;  1GR3 A;  3EO6 A;  3SIS A;  2GC2 A;  4LXL A;  3D6E A;  3SC7 X;  5C9A A;  1UMI A;  3WZ1 A;  3N9P A;  3INA A;  2DDU A;  1RUN A;  2GNB A;  2W87 A;  2HH9 A;  1XYN A;  3C7F A;  1KIT A;  1EAH 3;  1W90 A;  2XBO 3;  4GKY A;  4JDM A;  4UFM A;  1PK6 B;  4OUL A;  3NJY A;  1MZ6 A;  5ANQ A;  1NXM A;  3ZFG C;  2B9U A;  2GP5 A;  2RDN A;  4RHV 2;  2DTY A;  1N1T A;  4PDW B;  5BYN A;  5C9A B;  5IFT A;  1G9A A;  2VUA A;  5JOW A;  1PO1 2;  4OVE A;  3ZFF C;  3KCC A;  4XIK A;  4AYU A;  1SLL A;  1VBD 2;  2BJS A;  3OUJ A;  1CD3 G;  2GC0 A;  4XJU A;  3BPS A;  4LOS A;  1FT9 A;  3H50 A;  1W99 A;  1YNA A;  1AX2 A;  1PVC 1;  4YVS B;  5A32 B;  4HOO A;  5EYY A;  2VG9 A;  2P37 A;  2YC4 A;  5T5P A;  2A3X A;  1HJF A;  1C1F A;  1QQP 1;  5FZO A;  3N9L A;  1O3R A;  4QDS A;  1RVF 1;  1H2N A;  1ULF A;  3B9C A;  5F5I A;  2MNG A;  3N7K A;  2BFU S;  1MS5 A;  3JD7 1;  2JD4 A;  4MXW A;  1US3 A;  4YFZ A;  4GMP 0;  4FOQ A;  4N7U A;  3FLR A;  4YWA A;  1YQ5 A;  4ATE A;  4BHP A;  3HN1 A;  1HV0 A;  1ZA7 A;  1Y9G A;  3HPN A;  5A6Y A;  1GZW A;  4LPL A;  1SPP B;  1UAI A;  1IQD C;  1RL3 A;  2GH2 A;  3T09 A;  2UWA A;  4GB3 1;  3VDA A;  1W6P A;  2ZAH A;  4GUL A;  2C5D A;  1QOS A;  2DCY A;  1EYB A;  2WO2 A;  2XR4 A;  5FP4 A;  3VDD A;  3ZIX A;  4HLT A;  3GDB A;  1ENX A;  1PVC 3;  3K2O A;  4N43 A;  4A6O A;  4NIH A;  2CU5 A;  4ZS3 A;  2DVG A;  3E6C C;  5FQ0 A;  1QQP 3;  3ZLI A;  4CA9 A;  4MSV A;  2XJT A;  4KWU A;  4XJ8 A;  2Z79 A;  4GD4 A;  1PO2 2;  4FPJ A;  2XQR A;  4XBQ A;  1RVF 3;  2XG3 A;  4QXB A;  1K3I A;  2YDE A;  4M01 A;  3JD7 3;  3VD3 A;  5E6H A;  4IE5 A;  5F39 A;  1X9P A;  3POE A;  4D7T A;  5BV6 A;  4XTP A;  2YFU A;  4RR3 B;  1O7F A;  3POJ A;  1V0A A;  3AX4 A;  3U75 A;  1VBC 2;  4XFA A;  5GJ6 A;  2PMW B;  2ZGR A;  3PU8 A;  4HFS A;  3VB9 A;  3J8F 1;  1RGS A;  5HCF A;  4GB3 3;  1CAX A;  1EPZ A;  5FYH A;  2J22 A;  2MHF A;  3K75 B;  4CDQ B;  4DXR A;  1LGC A;  5FYS A;  5HCH A;  1JH5 A;  5A6Z A;  2CGO A;  3F95 A;  1HKD A;  3MYX A;  4AQ2 A;  5EXO A;  1VLN A;  3ZYR A;  2V5Y A;  1OD5 A;  2E26 A;  3RI8 A;  2QUO A;  1MZ5 A;  3H3L A;  1J84 A;  3BKZ A;  4QU1 A;  2XJU A;  2B5H A;  1H8V A;  2RS5 1;  2W95 A;  1GQP A;  1RUJ 2;  3I2I A;  4UF0 B;  3UL2 A;  1QXP A;  4CCC A;  1F5F A;  3OGG A;  3VDB A;  1JTZ X;  3U37 A;  3BI3 A;  3VBR C;  3S30 A;  3VZL A;  2OYZ A;  2JKX A;  1PZ9 A;  1YFW A;  1V6N A;  3C2U A;  4UXA A;  3CKH A;  5FZB A;  5BNO A;  3BTY A;  3RGB A;  1JOD A;  5I91 A;  3J8F 3;  4G9S B;  3MPP G;  3VD7 A;  5T52 A;  1R09 2;  1CPN A;  1FPN 1;  2ZGT A;  4Y20 A;  5DQ0 A;  3VBU A;  2ETE A;  2NZ9 A;  3LEI A;  2JG9 A;  4BQY A;  1W6Q B;  2ZGM A;  1ZYB A;  1RUE 1;  1GZ9 A;  4LKF A;  5HV0 A;  1Y3T A;  3ZMO A;  3IT8 A;  3RMX A;  2RS5 3;  3THC A;  4CP0 A;  2DCJ A;  3IN9 A;  2RG4 A;  3WSO A;  4LBM A;  4ZPI A;  3NNG A;  4ZHN A;  3FZ3 A;  4Y20 B;  1UY3 A;  5LAS A;  3UES A;  4AI1 A;  2BER A;  4BH9 A;  3PVB B;  3P6B A;  4R4Z A;  4O7X A;  4QDQ A;  3U10 A;  2X29 A;  1ND3 B;  1SLI A;  3NKT A;  2BGO A;  3ZN4 A;  2G1M A;  4QPY A;  1DU3 D;  1FPN 3;  2OPW A;  2HJI A;  3P5B A;  2VXR A;  3AM2 A;  4TTG A;  4D8M A;  4IEP A;  5A7Q A;  2WRA A;  3MO4 A;  4AVS A;  2HEY F;  3HNB M;  1VRH 1;  1ND3 C;  4MAD A;  3ZSL A;  1BYH A;  1RUE 3;  3D0J A;  4Q4W 2;  4QQH A;  4AAX A;  4BQ4 A;  4OMD A;  1ULC A;  1H1I A;  4LBJ A;  3UYJ A;  3ZYB A;  1DGW X;  5C8C A;  5IWF A;  4FO9 A;  1IG3 A;  2UUR A;  2WL1 A;  5F1R A;  3LKJ A;  3WVJ A;  2C9A A;  2ARX A;  5IT6 A;  1UPI A;  5DN2 A;  1UF2 C;  1JOP A;  4NHL A;  5FWE A;  2WS9 1;  2XB6 C;  4QHB A;  1B09 A;  4XZU G;  3VN4 A;  5J48 A;  1YQC A; 
#chains in the Genus database with same CATH homology
 5A7O A;  4CCL A;  2OQ7 A;  5FPA A;  4UF0 A;  5A3W A;  2OT7 A;  2Q8C A;  4CCN A;  4CCM A;  5CEH A;  5A7W A;  5IVB A;  2P5B A;  5FZ6 A;  5FP4 A;  4GAZ A;  4V2V A;  4V2W A;  5A1L A;  3K2O A;  5IVV A;  5A1F A;  5FZM A;  5FPU A;  5IVJ A;  4AAP A;  5F37 A;  5FZE A;  3U78 A;  3ZLI A;  4CCO A;  5F2S A;  5A7P A;  4GD4 A;  4GJY A;  5FJK A;  2Q8D A;  4QXB A;  3LDB A;  5FYU A;  4EZ4 A;  5IVC A;  2OQ6 A;  5E6H A;  2YU1 A;  5F5C A;  3OPW A;  5F39 A;  5IVE A;  4D6R A;  5A3N A;  4BIS A;  5FZ8 A;  3AVS A;  5FY9 A;  2PXJ A;  3AL6 A;  4XDO A;  2Q8E A;  5FZO B;  3PU8 A;  4QWN A;  3KVA A;  5F3G A;  5FUN A;  5FYH A;  2XUE A;  5FZF A;  4CCJ A;  3AL5 A;  5F3C A;  5LW9 A;  2W2I A;  5FZG A;  5LY2 A;  5FYS A;  5FV3 A;  3KV9 A;  5F3I A;  5IVF A;  4E4H A;  5F5A A;  5K4L A;  4ASK A;  4QU1 A;  5FY1 A;  4Y4R A;  5F2W A;  2XDV A;  4UF0 B;  5FY4 A;  5FYV A;  5FYB A;  5FZ9 A;  3DXU A;  3N9M A;  5FZC A;  5A7S A;  5A7W B;  3N9Q A;  5FYZ A;  5FY0 A;  3N9N A;  3PUA A;  4LIV A;  5FZB A;  5IVY A;  1VRB A;  4QX7 A;  5FZH A;  5FXV A;  5A3P A;  3AVR A;  5FUP A;  3RVH A;  5FYY A;  4HON A;  4BXF A;  3KV5 A;  5F32 A;  4TN7 A;  4BU2 A;  3PUQ A;  3PU3 A;  4AI9 A;  4LXL A;  3N9P A;  4CUG A;  4DIQ A;  5FXW A;  5FPL A;  5F3E A;  5LWB A;  2VD7 A;  5FYT A;  5FXX A;  4CSW A;  2OS2 A;  4IGO A;  3ZPO A;  2XML A;  3K3O A;  5FPV A;  2YPD A;  5FZD A;  4DO0 A;  3NJY A;  5ANQ A;  4GJZ A;  3PTR B;  5FP9 A;  2GP5 A;  5FZA A;  4C8D A;  5KR7 A;  5FZ3 A;  3PDQ A;  5FJH A;  5FZ4 A;  5FXZ A;  4IGQ A;  3OPT A;  4Y3O A;  3LD8 A;  4D6S A;  5FP7 A;  5FWJ A;  5FZK A;  3KVB A;  2YBP A;  5FPB A;  4CCK A;  4QXH A;  3KV6 A;  4LIU A;  5FYM A;  5FYI A;  4HOO A;  3PUR A;  4LIT A;  5A7Q A;  2YU2 A;  4Y33 A;  5FZO A;  3DXT A;  5FBJ A;  3N9L A;  5FY7 A;  5FZ0 A;  3U4S A;  3PUS A;  5FP3 A;  2OX0 A;  2YBK A;  2WWU A;  4NUB A;  5FYC A;  5LY1 A;  4EZH A;  5A3T A;  4IGP A;  5A80 A;  4QXC A;  5ISL A;  5F5I A;  2GP3 A;  3KV4 A;  3N9O A;  5IW0 A;  4XDP A;  3UYJ A;  5IWF A;  5FZL A;  2YBS A;  5FY8 A;  5FZ7 A;  4QX8 A;  2WWJ A;  3K3N A;  5FP8 A;  5FZ1 A;  5FWE A;  4D6Q A;  4EYU A;  5A7N A;  5FZI A;  5FY5 A;  2XXZ A;  4URA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...