2OX0A

Crystal structure of jmjd2a complexed with histone h3 peptide dimethylated at lys9
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
349
structure length
349
Chain Sequence
b'TLNPSARIMTFYPTMEEFRNFSRYIAYIESQGAHRAGLAKVVPPKEWKPRASYDDIDDLVIPAPIQQLVTGQSGLFTQYNIQKKAMTVREFRKIANSDKYCTPRYSEFEELERKYWKNLTFNPPIYGADVNGTLYEKHVDEWNIGRLRTILDLVEKESGITIEGVNTPYLYFGMWKTSFAWHTEDMDLYSINYLHFGEPKSWYSVPPEHGKRLERLAKGFFPGSAQSCEAFLRHKMTLISPLMLKKYGIPFDKVTQEAGEFMITFPYGYHAGFNHGFNCAESTNFATRRWIEYGKQAVLCSCRKDMVKISMDVFVRKFQPERYKLWKAGKDNTVIDHTLPTPEAAEFLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords JmjC domain-containing histone demethylation protein 3A
publication title Crystal structures of histone demethylase JMJD2A reveal basis for substrate specificity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 112
structure length 349
sequence length 349
chains with identical sequence B
ec nomenclature ec 1.14.11.-:
pdb deposition date 2007-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF02375 JmjN jmjN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 2ox0A01
2YBSA 1VRBA 4D6RA 5FZDA 3PUAA 4BISA 5LWBA 5FY5A 5FYSA 3AL6A 3DXUA 3N9PA 5FY9A 5A3TA 5IVEA 3DXTA 3PU3A 5F39A 5FP7A 4V2VA 5FZOA 2YBPA 5IVFA 2WWUA 3AVRA 4HOOA 4IGQA 5A7WB 4DIQA 3KV9A 5FY8A 5FP3A 5FZGA 5F3IA 3KV6A 5FP9A 5FPVA 5CEHA 5IVCA 4LITA 2XDVA 5FY0A 4CCJA 5FZIA 5FZ7A 3PUQA 4URAA 5F2SA 5F37A 5FZLA 2OX0A 4CCNA 5FZ1A 5FPUA 2XXZA 2YU1A 4D6QA 5FZMA 5IVYA 5E6HA 5FYUA 4CUGA 3OPWA 4GD4A 5FYTA 2OQ6A 2PXJA 3K3OA 5A7SA 4V2WA 3ZPOA 4AAPA 4LXLA 5FZOB 4EZHA 2YPDA 5FYBA 4Y3OA 5IVJA 5FY7A 5FZFA 4QXBA 5FJKA 5FZ3A 5FZ8A 5FP4A 5F3GA 5FPLA 5A3NA 4GAZA 5IVBA 3LD8A 3K2OA 5A7OA 2YBKA 4CCKA 3PUSA 5F5AA 5FZ0A 5F5CA 5F32A 5A7PA 3K3NA 4HONA 5FXVA 3N9QA 5FJHA 5FXXA 2P5BA 5FPAA 2OS2A 3PTRB 2XMLA 5FXZA 2VD7A 4QX7A 4UF0A 5A3PA 5F3CA 5FY1A 4GJYA 5FYYA 3AVSA 2YU2A 5FYHA 3UYJA 5LY2A 5FZEA 4BU2A 5FYVA 5FZ4A 5FP8A 4CCLA 5FZKA 2Q8EA 3PU8A 4Y4RA 5FZCA 5F5IA 3NJYA 5LW9A 4QWNA 5FZBA 5FZAA 5IVVA 5KR7A 2GP3A 3PURA 4ASKA 4CSWA 2W2IA 4GJZA 5FUPA 5FPBA 2Q8CA 4DO0A 4EZ4A 3N9NA 4NUBA 5FZHA 5A80A 5FYIA 4E4HA 2GP5A 4BXFA 4CCOA 5FYCA 5A3WA 3U78A 5A1LA 5FBJA 4UF0B 5K4LA 4EYUA 5ISLA 4LIVA 5FXWA 4CCMA 4QU1A 5F2WA 3PDQA 3KVAA 2OT7A 4LIUA 4XDPA 3N9OA 4TN7A 5FWEA 5ANQA 4Y33A 5A7QA 5FZ6A 4QX8A 4IGOA 3N9MA 5IWFA 5FYZA 5A7WA 2Q8DA 3U4SA 3ZLIA 3KV5A 4C8DA 2XUEA 3OPTA 5FV3A 3KV4A 5FYMA 4D6SA 4XDOA 5FWJA 5FZ9A 4IGPA 3AL5A 5LY1A 4QXCA 3LDBA 3N9LA 5IW0A 3RVHA 5A1FA 3KVBA 5F3EA 4QXHA 2OQ7A 5FY4A 5A7NA 2WWJA 4AI9A 5FUNA
chains in the Genus database with same CATH superfamily
3W58A 3AJYA 5E88A 2YBSA 4ZPIA 5LRSA 5FZDA 4WM8C 3R05A 3RQ0A 3KQRA 4XF4A 3I4IA 2FDIA 3MYXA 2P2KA 5F39A 4AEJA 2W1QA 1LEDA 4R9BA 1LOCA 3DPRB 3CQOA 4QGNA 5HCFA 3UKTA 2BWAA 1G9BA 2W1UA 2FQPA 1VAMA 4WZFA 5FTTC 4FTBA 4LITA 1OOPB 3ZSLA 1HXS2 3NVCA 1SFPA 1LOFA 1BVP1 1WGPA 4PDWC 4AF9A 2VUAA 4D94A 1LHUA 5GZCA 4ZHNA 1D4M2 1V9U1 1WW6A 2OZ6A 1PO23 1WD4A 1QIQA 2BV4A 2ZEZA 1OH4A 5H9RA 1CX4A 3AYEA 1QJU3 2CDOA 1YI7A 3FL7A 4PHZA 4LPLA 2QJVA 3CF6E 4E4ZA 3MFCA 1C8M3 3I2DA 3PMSA 1OPMA 4IE5A 1SDWA 4IE6A 2VZSA 2J1EA 4XAEA 5C8CC 4TWTA 2VZ1A 4RS5C 1OD5A 1ND3A 3POGA 4NWVA 2ZHNA 4CYDA 3BIEA 5JI9A 2GN7A 3ABZA 4KWKA 3ZYIB 4URTA 3ZXDA 2Z42A 4C1WA 4ET7A 4RYDA 3H3LA 4R52A 4WZCA 3TNQA 3VKLA 4AWDA 5A6QA 2YBKA 2CGOA 4NRMA 1W3VA 2JG9A 2A3XA 3DF0A 3PUSA 4NR1A 5F5CA 3TAYA 4BIFA 3IT8A 3H7YA 5FKCA 2J1TA 3HT1A 5JPMB 1WW4A 4MO3M 3WNKA 4Q4Y3 3AX4A 1VB4A 5A3OA 3LEKA 1R091 1V00A 2XMLA 3ZSJA 3T0BA 1V6OA 1R1A2 5BNPB 5FREA 2OIIA 4AK3A 3LKJA 4CP2A 2QQIA 3JB8A 3QLQA 1ZRCA 1SHWB 1A8DA 3MGUA 3RG0A 4BU2A 5J3UA 1GLHA 2JDNA 1UX7A 4X8PA 3T08A 4LLFA 4P9YA 1UKGA 5KHHA 2ORZA 5FRAA 1W6MA 2A73B 1OVPA 4N53A 3GJAA 4YZ4A 2VW0A 1H6YA 1BKZA 2VCMA 2QQJA 3N9NA 4M4PA 1YI9A 5FZHA 3VBUC 1FMD3 5LA0A 5FIXA 2JD9A 2VUJA 4FSJA 4OHWA 1H9WA 1K5MC 1JW6A 4IV3C 5CNAA 3TN92 2CV6A 2AC1A 1XYPA 1GQPA 3PDQA 4LBMA 1I5PA 1TNFA 4LIUA 3K48A 1W04A 1GZTA 3NO8A 3IIIA 1V6LA 2ORXA 4GA9A 3RYKA 5IWFA 1AR91 3B93A 3JBG3 4J6GA 4N8MA 1W39A 4B4RA 4DOUA 3KV5A 3LSDA 1CIWA 2ES3A 4R4XA 2CHHA 1HLCA 2K46A 3A0NA 4O9EA 4W6XA 3VKFC 1ZZ8A 1SPPB 3N9LA 1HRI2 4B7KA 2ZACA 5F3EA 3RDIA 4BK4A 4COZA 1ULFA 3AZWA 2HWE3 2HBTA 2XBO2 3JQXA 2ZX3A 2A3YA 4H7LA 1NE4A 3ACLA 4EWEA 1AJOA 4AI9A 2UY8A 4X6QB 1VRBA 4AGGA 2Q5TA 5SV5A 3RJ2X 5AFBA 2Z69A 4FXKB 1COV3 1NXMA 4BH9A 2ZGKA 4ZU4A 2R063 3DXTA 5FLIA 4ZY9A 4CEWB 3OGGA 4GIQA 2NMOA 3N35A 1F5FA 1CQ9A 3WXPA 1SQ4A 3WG3A 1ENXA 1AYN1 4Q4W1 4UW5A 2VMFA 4CXYA 1LECA 3THPA 4Y4YA 5CEHA 3Q8FA 3M3OA 4QD2A 4XTMA 1REDA 1W6QB 1XNKA 3LFMA 3FUQA 4AE2A 3E1F1 4CZSA 4FOWA 5K0UA 4Q29A 3ILFA 2PHLA 5J36A 5T52A 1GANA 1OURA 2I74A 5FYUA 4MGQA 5G04L 1W6NB 1M06G 1Y4WA 3RZGA 1NUKA 3CMGA 3VL9A 5BUVA 4XABA 1CN1A 1H8TC 2KM2A 4Q4V3 4XF9A 5AC91 1OC1A 4V2WA 2ZZQA 3ZVXA 5JWPA 4XTPA 3VBRA 3MICA 5K7PA 1PNGA 1O4YA 1NQJA 2RMU3 4JC1A 3ZFGA 2VTXA 3RWNA 5IFPA 2C6SA 2VVDA 2C5DA 3VDCA 3NJVA 1JYIA 5LA1A 3ZIXA 1ZZ9A 5GZGA 2JG9B 1JTZX 1ZBE2 5F5AA 1QOSA 3OEBA 1L7LA 2A1XA 2BGOA 2WFF1 2YZ4A 3TB0A 3ALQA 1ZRRA 5FJHA 2ZS6B 4YW6A 4LTAA 2D6MA 5JSRA 5JOXA 1ZA4A 1RUG3 1ASJ3 4ZKTB 2XJPA 2XWJB 3TEXA 2RDNA 3AP7A 2NM1A 5JAXA 4OZOA 3N7KA 3IBMA 3ZKUA 2ZMLA 4ZS3A 5FYVA 1VBB1 1CPMA 1GZWA 3PU8A 2QZ2A 1VP6A 1VRH1 4FPHA 4S2HA 4A41A 2PLV2 1SLLA 1B35A 1W6MB 1E57A 4XJZA 1YFUA 4HKOA 4N53B 3NNFA 5CU1A 4BM8A 4CP9A 2JDZA 3HWJA 4K8FA 2GP3A 2NYYA 3ETQA 4GB32 4IE7A 4UFIA 4YPJA 1HRV1 1IG0A 1X36A 4YVSA 3LE0A 1MS0A 1UMHA 1YJKA 2XKPA 4G9SB 3NNLA 2IXKA 4IERA 4BYYA 4R8HA 3ST7A 4HVRA 1QJU2 5ISLA 4QPGA 5LK7B 5DDJ3 4FPKA 1RTVA 4W8JA 5LBEA 4KG8A 5FMBA 1JZ8A 1C28A 3PJYA 5L73A 2R072 3RI9A 3VD4A 4QX8A 3SITA 3Q8CA 2WO2A 1PGSA 4Y5Z0 1W9WA 4JRLA 3U11A 4YSFA 2YFUA 1PZ8A 2CYFA 2HWD3 3ACFA 4DPNA 3HNBM 1LB2A 3KWVA 4YM1A 5JLVA 4RQPB 5JXIA 1CAUA 1CGPA 2P6CA 3RSJA 3VBOC 3VD7A 4NPLA 1UU6A 4MX3A 1US3A 4YG6A 4HG6B 3P3NA 5IAVA 5JMCA 4TZDA 5CA6A 4JHZA 2GDFA 1Y9MA 1C4RA 4HANA 4OHXA 5FUNA 1NA1A 3TRSB 5L7OC 1XU1A 1OVSA 1WZXA 1KJRA 1O5LA 2YXSA 1UPIA 5FK8A 2OUJA 5B4XA 5A3TA 1OBNA 2E7TA 2HWC2 1LAJA 1ND2A 1EV13 4OULA 3B5LB 4XEZA 4WVZA 4ES9A 4QX1A 5JIUA 2HKXA 2FDHA 1PVC3 1L7RA 4KNCA 4QM9A 5LATA 2A6YA 4XUOA 5F3IA 1UY3A 1XNTA 5CFDA 4HT1T 3ZYBA 1RVF2 5HCBA 1DIWA 4BE3A 2NLRA 1DQ6A 4OUMA 5ERLA 5K0UB 4C1XA 1RJ7A 1TME1 1UCXA 4H3WA 3W5MA 1H2MA 3MF9A 4QM8A 4YVWC 5FZ1A 4K1ZA 1V6IA 2WN2A 3I3BA 1SBFA 2Y60A 2R0FA 3APBA 3VZJA 1F15A 5GM0A 4UOJA 2O8OA 1RUD3 3NRUA 3OGSA 3NKGA 1ZVFA 1PO13 1EAH1 2HWF2 4UAPA 4LXLA 1MZ6A 3VHOA 2FMDA 2ZX2A 1EUUA 1RJ8A 1RUH1 3MIFA 1R082 4AVVA 3THTA 4PLOA 5FMOS 1X7NA 2JB8A 2WJSA 1V0AA 1KJLA 1IHMA 1UOBA 2JX9A 3ACHA 2BFUS 1Q3EA 3JBG2 4FOVA 4OQ8A 1S0FA 3HVDA 2AR6A 1EY2A 4XMAA 4UFJA 2VCBA 5FOJB 1F35A 4QB2A 1KEXA 3ZXGA 1L7QA 4MLOA 5DZFA 3GCWA 3DEMA 4UF0A 3ES1A 1FPN3 1Q8QA 2GC3A 2QZ3A 5DAWA 1PMJX 3VHPA 3MIGA 1CX1A 1TZOA 4PI0A 1UXZA 2IXHA 4I02A 3S5AA 1UYPA 5EIYB 1V6KA 3U37A 4Z1VA 4JKKA 1TMF3 2HEWF 1KDMA 2PQQA 1B35B 1MEC1 1AR72 3V56A 3WW3A 5JI7A 4XXAA 3O1MA 2IXLA 2AACA 1H2LA 1MS9A 4UW4A 4FQZA 1XJAA 3KMHA 4CSWA 2VOWA 2VMIA 4CPBA 5JXHA 5KXEA 1WMFA 2EIEA 2VOVA 3AMPA 1XU2A 3VZOA 4LO7A 4DO0A 4FFHA 4NIDA 4QPIB 4WM8A 4V1PA 4XILA 4CU9A 5DPNA 1GFF2 2OYZA 2PTMA 4FP2A 2VUDA 3L2HA 1Q8PA 4I3PA 4CDWC 3E5XA 4AAXA 3U07A 1HN0A 4DXRA 4AQ6A 3B02A 3DV8A 5CFCA 4JTOA 5KHKA 3K77A 2R7EB 2W47A 3O1SA 3FLPA 3TEZA 4PDWA 4YW4A 4UT5A 5IK8A 3BU0A 3H8OA 2XJRA 1ND3C 4MH0E 1IZ3A 3GBFA 4A4AA 3HOBA 5DQ0A 5EPAA 4AHYA 5LY1A 3IM0A 4DUWA 1HQLA 1SEFA 4KBZA 1VPHA 4QKDA 1G86A 4EQVA 2DCZA 1KGYA 1U12A 5BNOB 4Y22A 1BVVA 5C8CA 2WWJA 4BQ3A 2WLQA 1US2A 5FLJA 4LBJA 3I2IA 5GLVA 2ZHKA 3UNPA 2ZOEB 4G4FA 3N9PA 4NVPA 5IVEA 2DUOA 5BNNC 1GQHA 4W50A 2RM23 2GC0A 2WSUA 5FY8A 4DZGA 4HMZA 2JB4A 3O7OA 2I2SA 5IVCA 2WNVA 1NY72 1WMEA 2VTFA 4YZ3A 1N1TA 5ACA3 4GMP1 3K4DA 1IPJA 2EF6A 2FCUA 2QQPA 2WZR1 1ZBA1 2GMEA 2G9ZA 1OF3A 4D6QA 2FZ2A 4N43C 3F2ZA 5IVYA 3RS6A 1E5IA 2ENRA 2ZAAA 4NO4A 1OFSA 1UZYA 1X8MA 5FPXA 1XYOA 1ENQA 2W87A 4IV1B 5KXBA 3VZMA 2BPA2 4MGIE 1A3KA 4DXSA 4HKLA 5FZOB 5T54A 4DB5A 4I3GA 4Q4X2 5A33A 3LF7A 3J7NA 1V9U3 1F31A 2MNGA 5FP4A 1T6GC 2HJIA 2Y34A 4XMIA 3I7DA 1WLCA 2PHDA 2JD4A 3NMBA 4JX0A 3A22A 5EYYA 2RDRA 2BWCA 3AZXA 4K6BA 2WO3A 4YM0A 3JCIA 1K5MA 4IV3A 3SKVA 4Q1PA 1JU3A 3EB7A 4COYA 3AM2A 1YFXA 3GF6A 3RZHA 3PIGA 3IDAA 4JRAA 1CPNA 2J1VA 3HQXA 5A3PA 3WQ1A 4K9SA 3WINE 3KCYA 1WMXA 5FMOL 4CVUA 1H30A 2XJUA 1SFYA 2E51A 4AHZA 1FOD3 2BFUL 1BCXA 2VAUA 3AKQA 5A6ZA 2WSVA 4CDUA 4DMIA 4ATFA 5B2GB 1QNWA 2JDPA 3SISA 4QWNA 5FZBA 2DVFA 3QOPA 2EXIA 3RZJA 2ARBA 4AEDC 1PGW1 1YRZA 2F4LA 3D0SA 3BOWA 4FTEA 5SV8A 4WM8B 1CZVA 5A80A 1JZ6A 3WF0A 1POQA 1GP5A 4JGZB 4OUEA 2ZCWA 3U78A 1NCRC 1BMV1 4HVQA 1RUJ1 4XPVA 2CL2A 5FAXA 2WQZC 4LE3A 4Q0VA 1SBEA 1QJX2 3KHCA 2D6KA 1WKYA 2VZTA 3ASIA 3ZXEA 3N9OA 3P3PA 3BGAA 3OBTA 4CRQA 3ZSKA 3N7LA 2BDRA 4LO8A 5FDBA 2VNVA 3WHTA 1PMIA 5HXVA 3H8XA 2Q0AA 4PDWB 1VBE2 4HLTA 1P8JA 1OUSA 2ZGTA 3I3DA 1F4HA 2LUWA 1C8NA 4RFRB 3ZFEA 3VDBA 1XOYA 3RNSA 1VBD2 3SCGA 3MW2A 4Y5TA 2BVVA 3CJIA 5FCCA 1T6BX 4Y22B 2XONA 4RS5B 1HJFA 3AMMA 3H8UA 1VBC2 4YG3A 1PK6C 4XC9A 1IS4A 1K3IA 3J26N 1AR93 2ZEWA 2D43A 3M1HA 4TSVA 3ZN6A 4CA9A 4HFSA 1PGL2 3KLSA 4KGQA 1SLAA 4XETA 5FYSA 1MS1A 1AX0A 1UN1A 2O1QA 4LK7A 4ONUA 1JYNA 3GBWA 3O1PA 1A6CA 5IYYA 3BUCA 5A3LA 4IGQA 1N1YA 4IE4A 1Q56A 2A6VA 4IETA 4KU7A 1VMJA 1AJKA 4DY3A 1SFNA 1YQCA 1Z0HA 5DUWA 3ZFFC 1VIWB 1SCSA 1VBA1 4D8MA 1N1VA 3E6DA 2C4XA 3LPGA 4JDNA 1ZA7A 2JG8C 1GWLA 3ENRA 5JPNB 2QTWB 3LOIA 4LBLA 3BKZA 1OSGA 1D4VB 2WT2A 1CAXA 4YVSC 1AYN3 1O4ZA 4Q4W3 4LA2A 4U36A 3ZPOA 5C9AB 4BQXA 4CTEA 2B45X 4JVAA 4WM7B 4EZHA 3CHXA 4K8RB 2RS12 5JZGC 3GZEA 4QXBA 5FZFA 3ZXLA 4DRVA 3RZMA 3DYMA 5FZ8A 1DCSA 3SC7X 3TNPB 4RN5A 5HCHA 1XE7A 2ZHMA 5DAPA 3VBUB 4C91A 1JOBA 4RR3B 3ZN4A 5HI0A 4GWJA 4YM2A 3WEZA 3KM5A 1LOAA 5CBLA 4FXGB 5AC93 4FOYA 4IUGA 2JKXA 1JZ7A 1DZQA 5L9VA 2PFWA 3K51A 4B29A 3LOBA 4Y1VA 1ZX5A 1YXWA 3BN6A 5DUXA 3ZXAC 5E8AA 2PQSA 1HV1A 1WBLA 3AC0A 1IG3A 2YROA 2RG4A 1REEA 3BCWA 5C7GA 1UO9A 4O9GA 1AZDA 2WFF3 3PVEA 2XQXA 4QX2A 3UJQA 1POV0 1RUE1 2PAMA 3A4UA 3D4KA 4XZPA 3VBOA 2XHKA 3LSEA 1XE8A 2WS91 3T4HB 4XBQA 1AYM2 1SCRA 1QH7A 2ZX1A 4GWIA 3VBFC 1TVGA 5K9YA 1FATA 3WDXA 5L7OA 2WL1A 4J25A 3IPVA 4MGYE 1BBT2 2Q8OA 1DQ1A 2RDSA 2Y33A 4CDQA 5CFDC 2B8MA 2P3KA 2IZWA 3M2MA 4LKFA 4LBKA 4XUPA 4P9IA 3WDUA 5I0UA 4CDXA 1VBB3 1U5XA 2EAAA 1VRH3 2VVFA 4X6RB 3E6CC 4LBQA 1AL23 3VBSB 4O65A 5FWEA 3WR0A 5KXDA 1Y3TA 2PHUA 3ZDVA 1IOAA 1PIV2 1ZRIA 4E4DX 4A3XA 2X29A 2V5DA 4LULA 1UZZA 4XF1A 4CU6A 5CADA 3KCXA 2BTVC 4YVWA 3S5QA 3W9AA 3RZLA 4XXPA 2QQLA 4DUVA 3AB0A 3LDBA 3T1MA 4WVVA 5IW0A 3JD71 2ZTNA 2W08A 5JSPA 1UY1A 2JDHA 1H8TB 2KR2A 2YUEA 1Z7S1 3ON7A 1S0IA 2VNRA 4W4ZA 3WNPA 5JIAA 3ZN6B 4DINB 1R1ZA 5F1RA 4ARYA 2ERFA 2VW2A 5T50A 3OF1A 1NXD1 3AL6A 1JUHA 4MXWA 4P9LA 2JDYA 2VZVA 2EICA 1AX2A 4LOSA 2DFBA 1H1MA 5IVFA 3KF5A 2XL7A 4QX0A 1C5IA 2W46A 3AMQA 2RR11 2WQ8A 3B9CA 3RGBA 1NLRA 2ZEXA 3ZX7A 3BTXA 1GU3A 4PJYA 4BB3A 3VBHC 2FCVA 3MBWA 1RITA 1J1LA 1LGCA 2E53A 2R041 1R092 4Y1ZA 5H9SA 4F7ZA 3TEYA 1WW7A 1XNBA 1RUF2 1FT9A 4XJWA 5FK7A 3DKWA 4QKBA 3GHMA 2CAVA 2BBVA 4NROA 3LWCA 4MVTA 2B46X 2R16A 1AXYA 5D1IA 2WIIB 3I2FA 2PXJA 5EYXA 3AK0A 4AGRA 1LJ7A 3D5OA 2VG9A 5I91A 4JDOA 1N47A 3FHQA 4EN9B 4Y3OA 2O14A 2DTYA 3ZSMA 3DN7A 1TME3 3LEGA 4AZZA 2QQNA 3S57A 4ASLA 3ES4A 2AEYA 4GAZA 4BQYA 3KGZA 3SKJE 2DDUA 4UFLA 4BJ0A 5CFCC 5IK7A 4AI2A 4CCKA 1Q8OA 2XJVA 2H0VA 2X8KA 2MEV2 3TYJA 4CDWA 1V70A 5FXVA 4HONA 3OUIA 1W0NA 1W90A 3N7JA 1Q43A 4Q5OA 4AFBA 2QE3A 3U75A 1EAH3 4RL7A 4BQ4A 3I3EA 1LHWA 2JECA 2RS51 2PAKA 1RUH3 3AVSA 3A23A 2P1BA 1HDKA 2WZPP 3UYJA 2ZXQA 1UWWA 4UFMA 1IKPA 3A7QA 4NAOA 5C4WC 4Z8BA 1ULGA 1OFNA 1G9AA 4NE9A 2QDNA 3I97A 2QQVA 1LCLA 2WT1A 1RIRA 2ATFA 4IEVA 3ZR6A 1QKQA 4CU8A 1ZZ6A 1CAVA 5C3QA 1A78A 3VBOB 4N7IA 1S0BA 3JU9A 4RFT0 3LEMA 4XIOA 3E5QA 4P9XA 4EWAA 3B01A 1RHI2 3EYPA 1AR81 1G8WA 3O1OA 2PYTA 2WC2A 4QT6A 1FOD1 1X8EA 2ZJCA 4F83A 1RMU2 2VXRA 4CXXA 1YO8A 2WNVC 2J1RA 4FPYA 3I54A 1W8UA 5IK4A 4BXFA 2W52A 1J3PA 3CLPA 5AFEA 5EJ3A 5BNNA 1R64A 2BUKA 2V4VA 2HLEA 2Q1ZB 3OG2A 4EYUA 1OT5A 4CCMA 3IMMA 4JCKA 5F2WA 3MF6A 4LBQB 4ZU5A 3T3YA 4ZZ8A 1MEC3 3EQEA 1LR5A 4ASMB 2WWSA 1OA3A 5A7QA 4F3JA 4META 5FZ6A 3WUDA 1QWRA 4JGYC 3WZ1A 3Q8AA 4AFAA 3LB9A 4L2NA 5FYZA 5A7WA 3ILRA 4BQWA 5KHIA 4A7YA 2DBIA 1GMMA 3HJRA 2V72A 5FO7B 4D6SA 4N43A 1RXFA 2VE1A 3OY8A 2WBKA 4XJAA 2DVBA 5CZKA 1LOBA 4IEZA 4PCRA 4HN0A 3WOGA 5A1FA 1DGLA 4N7UA 1W8OA 4QXHA 2OQ7A 3NKTA 5FY4A 1OLME 1LHVA 2WUHA 2XG3A 3JB4C 3KB5A 4INDA 4L8QA 3OOXA 5A7NA 4LQRA 4B4QA 4BMBA 2HWB1 1DYOA 1A8MA 3V0BA 3DCQA 4CEYC 4C90A 1KRIA 4XFGA 1XB9A 4Q1RA 3B3QE 2LW8A 4QKNA 5AVAA 3BPZA 2X5IA 4QMAA 1W03A 5JXJA 4IESA 1VB2A 1ZM1A 5FP3A 2KA3A 2QQKA 2VH9A 2P37A 3ECQA 3LPFA 3NV1A 5FPVA 1JZ4A 2YHJA 3ETPA 2XL9A 2E26A 5C5TA 3MV01 2ARXA 5FZIA 4D7YA 2G1MA 4URAA 4CDUC 1HXS1 1GNZA 1HB2A 2XXZA 4CP0A 2D98A 2J1SA 4YGEA 5KXCA 5ABJA 2IVJA 2F6BA 2PHFA 2XLGA 1D4M1 4MADA 1RC6A 1ZREA 1KXGA 3AKPA 3LCPA 2WNUB 3USUB 3CL1A 4GD4A 4XIKA 3K3OA 1SACA 1WW5A 3DYPA 3AXDA 1EPWA 3GHNA 4PBOA 4R4ZA 3S0MA 2VCAA 4FAHA 4GMP3 3URFA 3BTZA 3LA3A 3HN3A 4RSUA 1OI6A 4UI9L 2WZR3 3FLTA 1ZBA3 4XURA 4AEDA 4CUCA 2FDFA 3NSTA 2P3YA 4QB6A 4AR2A 1VLNA 5JSOA 1HRV2 1S0GA 2OUHA 1RUNA 4Z07A 3O1UA 1N1SA 3LA7A 4I0WB 1NCRA 1FX5A 3MIBA 2P5BA 1AR62 4JQRA 1ZZ7A 2P6HA 3NAPC 4XF3A 3ZFEC 4QX7A 5F3CA 3NV3A 2C24A 4GJYA 1GSLA 1TNRA 4HZFA 5F9TA 1CIYA 1NCQA 1DDLA 2LALA 3SCFA 2PHXA 3CJIC 3KD4A 2ZGRA 5FZEA 2AYHA 3ZYRA 1MQTA 1ND3B 3O0WA 4UFKA 4C0BA 1W9YA 5DAQA 1QGLA 4XCAA 1WLWA 3ATGA 4YGBA 3CIHA 4P08A 3HEIA 5FUIA 2VOTA 4AI8A 1NLSA 4FT8A 3BYWA 2RV9A 3T1LA 1HN1A 1NAEA 3P1IA 4AVTA 1RINA 1XNAA 2W2IA 1PK6A 3FUOA 4CUBA 1S0EA 2ZX0A 4GH4C 2G9GA 1C1LA 1UZVA 3IKWA 4E4HA 1HJGA 2ID4A 3J8F2 2DU1A 2TBVA 4BPZA 1OLQA 3T0AA 3AP6A 2W94A 5H9PA 3GZUC 1DYPA 4N9IA 2XH6A 4RA0A 4E27A 5I8TA 5C3SA 1OH3A 1YUDA 3HD8B 2Q30A 5GZDA 3ZFFA 1AVBA 4TLGA 1Z78A 4EN6B 3ZLIA 1J83A 2R1DA 3POYA 1KD7A 2BYVE 3HR9A 4C8DA 1TME2 2A71A 1AL21 5FYMA 5FWJA 5LK5A 2QCSB 2JG8A 2VZPA 4BLJA 5D8AC 4KGGA 2VO5A 3D0JA 1RUJ3 3MPPG 2VJXA 5A1AA 2CGPA 1RUC1 1HRI1 5FPZA 2UY9A 2BNNA 4BZ4A 5A6YA 2JEMA 2XBO1 1JN2P 3MZHA 3MI8A 1PO22 1EAH2 3EXUA 4KU8A 2ZPXA 1AF9A 3FJSA 5JZGA 1V6NA 4EE2A 3M4FA 5EJ1B 3IWZA 4A6OA 1C8M2 4IEWA 3WDWA 4D7SA 3TEWA 4XHXA 2E33A 1LKNA 1QEXA 1W6OA 4FTSA 3CBNA 3KV9A 3WUCA 4ZU7A 1YIPA 2GMMA 5FZGA 1W2AX 3FHIB 4YRDA 1V6MA 3G6JB 3DPRC 5FOBB 5CKMA 3TWIA 1JZ3A 2R30A 1JH5A 3VHNA 3B94A 5HV0A 3CKHA 4K3UA 1OOPC 2WFPA 4MGSA 2Z4FA 4HBNA 2FDGA 3P6BA 4AQSA 1DBNA 2XOMA 4QXKA 4Q4Y2 3NW4A 3I2HA 4CDQC 1HKDA 1CZTA 3H42B 2ZGOA 3MHZA 4RGKA 3CJXA 1EP0A 1VBA3 3CNAA 1NQDA 2P34A 1CJPA 1LHOA 1O7FA 4LBOA 4OI4A 4AEDB 4BLIA 4NPMA 5F6LB 3VBFA 4AI1A 2A75A 5F3GA 1QDCA 1W8WA 4BA6A 4PIZA 3MV11 1X33A 2ZGNA 4U2AA 1BK1A 1H8VA 4OFGA 1UU4A 3A21A 2UURA 4UW6A 5FKBA 5FXXA 4CUAA 1AUYA 1QJY1 5FXZA 4AHWA 2VCCA 5IAXA 1FMD2 1YJLA 2NQYA 5IHRA 3ILNA 4MXVA 2VU9A 2Y6FA 1WA4A 3VL8A 1DU3D 2ZGLA 4H2AA 5BNPC 3VBRB 1KS4A 3PVBB 3WP6A 2E63A 2V5YA 2Q8EA 4Y4RA 4CCEA 4LEJA 5T5LA 3ZFGB 2XGXA 5F5IA 4R9AA 3WCSA 1H2NA 1ENRA 1N3OA 1F2NA 1K42A 2WYFA 3D8CA 2PLV1 4A3ZA 2VBBA 1ULOA 3Q8EA 5L36A 5KHGA 1QXRA 2OVUA 3FZ3A 3N3HA 1PK6B 2C9AA 4QDQA 4A42A 4EZ4A 2CGNA 4GB31 2ZEYA 2D40A 3CZUA 2Y26A 5HPOA 4FPJA 4IEXA 5FYCA 5A1LA 2Y38A 1LRHA 4QU2A 4NIIA 2HWE2 4M3CE 2XVGA 1YYNA 2B9UA 3BI3A 4KQ7A 2L9LA 1RUE3 1TE1B 4W6WA 1W2NA 2CU5A 4L92A 2WS93 3VN4A 3ZYGA 4LA3A 2VUCA 3VBHA 3K46A 4FPGA 2XJQA 2Y6LA 5JCTA 1COV2 2AGSA 1GZWB 2R071 2JDAA 2VNGA 4I0AA 4YGCA 2Q8DA 2P3IA 2R062 2CNAA 3AP4A 3H0OA 3HQUA 1H0BA 5CYYA 1G9FA 3KV4A 5CAZA 4UFHA 4W6YA 2ZMKA 2EXKA 3DYOA 4CP9B 2VMDA 3O0XA 2ZBJA 3LEIA 4YG0A 4YVSB 3RJRA 5FLHA 3AZYA 4QPYA 3B7MA 4ISRA 4CP1A 1O59A 4QPGB 4OI2A 5IFTA 1VAKA 4YWAA 2AENA 3DXUA 3RYPA 4J1WA 4AFCA 3GJBA 2VOXA 4Q0UA 4LO5B 3WDYA 2HWC1 4Q4V2 4NHKA 1W0PA 4HOOA 5DMYA 4DIQA 3PVOA 3JD73 3C7EA 5DUUA 2A70A 3O5SA 1O6UA 4JV4A 3AKSA 5FBZA 1Z7S3 4P5YA 3VUOA 3IAPA 1H6XA 5LZ6A 2RMU2 1AL0G 5FZ7A 1EUTA 3AXEA 3PUQA 1JZ5A 1MS8A 1RVF1 2Y6JA 1CAUB 3ZXJA 2OX0A 2WN3A 4IL7A 4LHNA 4AQTA 1W9SA 2R32A 4CCNA 4UXAA 3VLBB 2ZGMA 5C4WA 4MOAA 3VKNA 3OGJA 1NA1B 1C1FA 4E4SA 3G7DA 2W3JA 2DVGA 3ZMOA 2RR13 5JUVA 2OQ6A 1RUG2 4ORFA 1ASJ2 1POV1 3NV2A 1ND2B 3WF3A 4XVHA 2RVAA 5EFUA 1DQ5A 2EVXA 2HWF1 3U14A 2R043 3DL3A 1W6PA 3ACIA 4QQLA 3WG4A 5DG1A 4Y20A 5T55A 4DUXA 3W5NA 3GNEA 3IAQA 1R081 1IQDC 3HN1A 3R4DB 4OYUA 1Q8SA 1GR3A 4JHTA 3K2OA 2YG0A 5A7OA 5CFDB 2P17A 4LUKA 5BNQA 3LDKA 1U5ZA 2TEPA 3K3NA 4MGKE 1YCIA 4PLNA 1KQRA 4B3NA 5JOWA 2TUNA 4CCDA 1BMV2 2QKDA 3POIA 2ZZJA 2WAOA 2VD7A 2YC4A 3ZPYA 2PELA 3C7OA 5JOYA 4XFCA 2R0HA 4JGYA 3LQCA 2VECA 2ZMNA 1PHMA 1U5IA 2Y6KA 4UW3A 1DGRA 1O4TA 1O5UA 1NOVA 5AVPA 4LE4A 5GLUA 2GMPA 2OZJA 2ZKNA 5DDJ2 3WP4A 4YW3A 1XSRA 2AREA 2BVBA 3AZZA 4KWJA 2Z5WA 3NJYA 5LW9A 4XUTA 2X5IC 5CG9A 3VZNA 5J96B 1AR71 2DUQA 2VTXJ 1W99A 3IB3A 2Q1MA 2RS53 4LBNA 4BQ2A 5F7UA 2QBXA 1HIXA 1GWMA 4FVVA 4RHV3 5JDBA 1FYUA 2HWD2 1KITA 3B69A 4CEYA 4EN0A 2XLAA 3S30A 4CCOA 4TXWA 5CB7A 3T30A 3UGGA 5K4LA 4UF0B 1ALYA 1Y7BA 2PAEA 1J3RA 1XYNA 3MLLA 2YGMA 1JOJA 1TG7A 3SQOA 1LEMA 3W21A 5ABJC 1D2SA 1OPOA 2QQUA 1BLZA 2D3RA 1RYYA 4M00A 1FNYA 2WR9A 3U4XA 4R9CA 1AR83 4EWDA 5LASA 2BBAA 1S0CA 2DCYA 2G19A 2W95A 1W3XA 4EV0A 3BTYA 1EV12 3OBZA 4LHKA 4OLLA 2HEVF 1PVC2 4PLMA 3W20A 1G6NA 5J37A 4HK8A 4XFIA 1QJZA 4AEMA 1JODA 3X29B 1Q5OA 2OKXA 1Y43B 1H4GA 3RVHA 3WNOA 2Y6HA 3I2JA 1SMVA 2PA7A 2DVAA 1OKQA 2JWPA 3DGTA 3GCXA 4LJHA 4RQPC 2K0GA 4QHBA 3T09A 3I59A 3IZOA 3PMEA 5JR2A 3CO2A 1BEV1 2XR4A 3UJOA 4HPKA 1FXZA 4TYSA 5FY9A 3TOJA 4NHLA 3T2PA 1PZ7A 1RUD2 3PU3A 5CFCB 2HBUA 1QXPA 3AVRA 1PO12 2HYKA 2OA2A 2VQAA 4NRPA 1NCQC 4AFDA 2E6VA 2G4IA 2E32A 1OF4A 1MQTC 4CCJA 5FO9B 4LHSA 1MVEA 1NY71 3L9JT 1MACA 4PQ9A 3NAPA 2HWB3 2B39A 3KT4A 5F2SA 5IATA 5FZLA 1MZ5A 5IK5A 4QPWA 2QNKA 4DNYA 3V0AA 1BXHA 3ZXKA 4AEKA 4QGMA 1CR7A 5C8CB 1OLRA 4KBBA 4AOCA 4GXLA 3R6SA 1F9KA 3H50A 3KQ4B 3PUHA 5D21A 2J1UA 3HQRA 2D93A 4NN0A 2WA3A 4E8CA 1LOGA 1FPN2 2UWBA 4OQ9A 1RUE2 3WCRA 3GZAA 1RXGA 2FBEA 2YPDA 4FQ4A 5C71A 3QD6A 4P9WA 1HXS3 3VV1A 5FZ3A 5A3NA 3J7MA 1O91A 4Q4X1 2SLIA 2WNVB 3IDEA 3BOPA 3LD8A 4GH4A 1D4M3 1TMF2 2XB6C 3C7FA 4BCUA 2ZX4A 3IMNA 5LRRA 5C70A 4FO9A 3FWEA 4A45A 5FPAA 2OS2A 4XJUA 3FBYA 5F8PA 3U1XA 5HCAA 1QHDA 1KS5A 3WX5A 3B00A 1PMHX 5CIRA 1STMA 4LO6B 2XLFA 2WABA 4NRQA 3MIHA 2VL4A 2O8QA 3BU7A 2K2SA 2RJLA 2VMCA 2K9ZA 1JBCA 1W2TA 3FHAA 2D3PA 3GGLA 4M01A 5A33B 5D8AA 5LEJA 4Q27A 3R4SA 1WLDA 4FFGA 1OD3A 3UESA 2EA7A 3JD72 1QXJA 3EO6A 4JZRA 2DCJA 5FUPA 1K5MB 4IV3B 5GJ6A 5IT6A 2FMYA 4NOTA 2PHRA 3RYRA 1W2OA 4K40A 2X05A 3HMYA 3WNXA 2R1BA 4M0HA 2ZGQA 4I2OA 2FZ1A 4QPIC 2Z2SB 4BQ5A 1SLBA 3TBDA 5CKQA 3WW2A 4MSVA 4TN7A 4YZ1A 3IDCB 5ANQA 4B8EA 1OHFA 3WDTA 4CU7A 2CWMA 3DPRA 2TNFA 3S7EA 3WF4A 4CDUB 1DQ0A 4LOTA 2BOIA 2WZEA 2WKKA 3F95A 1VBE1 3VHRA 2XUEA 2R042 1OOPA 5LA9A 3THCA 1GZ9A 3VKOA 2RM22 3AMHA 4IGPA 3OD0A 4QXCA 3H7JA 4FAGA 1XXNA 3KVBA 4GULA 2D7FA 1WLTA 5ACA2 1VBD1 3OPZA 1LENA 4J1XA 2VW1A 4JKLA 3I59B 2Q4SA 5JMOA 2WAAA 4F8AA 1VBC1 3POWA 2MHFA 1K12A 2QDRA 4K21A 5LWBA 1UY0A 1QQP1 3GXUA 3IIAA 5F5QA 1LGNA 3HNMA 3OBRA 2GNTA 4NHMA 4IXLA 1D0GA 3BODA 3IN9A 3M70A 3MUZ1 2CDPA 3SEPA 2XKOA 1RUC3 1HRI3 2XDVA 3H1WA 4YNIA 2NMNA 4XUQA 1NZIA 4YLZA 5C3OA 2XBO3 4HETA 3ZFEB 1V9U2 5CISA 3T2OA 3OB8A 1YFWA 2VM9A 4PIXA 5DABA 2DV9A 4WV8A 5KHJA 4GMP0 2RS52 3RFRA 3CJIB 1UIKA 2GAUA 2MPFA 2VZUA 3E5UA 5FFOC 3R0RA 5E6HA 1DHKB 4A7KA 2JJ6A 4GQ7A 3H9AA 3T2TA 5BNPA 3QBQA 1OQEA 1YFYA 2EXHA 3ELNA 1DGWA 3EHKA 4HN1A 4N9HA 3WQBA 1F5JA 2VXJA 3SH5A 3KS7A 3M3CA 2QQMA 2IXCA 2VGDA 3WLUA 1RUI1 2Y8KA 5I0TA 3CDZB 2VZ3A 5FJKA 2RS11 4E2QA 3OUHA 1FOD2 3POEA 4HXCA 3HBKA 1VAVA 4GH4B 5T5JA 4OHYA 1WMDA 4A2UA 1K45A 4FP3A 2VOKA 4S2DA 1HB3A 3OYWA 4P00B 5F32A 2IXJA 4MUVA 2IVIB 2J22A 4W65A 1ST8A 3WW4A 1SG3A 3UGHA 1SLTA 3WP3A 5BYNA 2RS31 4AXOA 3GBGA 5J7MA 4JQTA 1X9PA 1YC61 2DWRA 2YC2A 3AJZA 5I0RA 1CAXB 1WBFA 3PJQA 3PLQA 1APNA 5LY2A 4B7EA 2QVSB 4N90A 2O0OA 1CD3G 3NWKA 4YW1A 3N4MA 4PQQA 3USSA 1LTEA 4QX5A 1UU5A 2W92A 3FLRA 4LKDA 5A32A 3KHBA 5GLWA 4I01A 3RZKA 1GP6A 4IEOA 4XYXA 4IW3A 1QJY3 5APAA 2DTWA 3C3VA 1SPPA 3CU7A 4IEQA 4G3YC 2Q8CA 1QNYA 3JXSA 1XRUA 2BQPA 2JICA 3M3IA 3O0VA 2BNOA 5FYIA 1BBT1 3POFA 4DEQA 1PVXA 5LA2A 5LCWL 3LFIA 4YARA 2WYSA 4RHV1 1ZNPA 4JGZC 3MLKA 3BPSA 1NE6A 3CZJA 5FO8B 4MHUA 4QHOA 5T5PA 1UNBA 4CEWA 1AR92 2PLV3 3FBMA 4Y33A 3WQ7A 1O3QA 1ZRFA 1JYTA 3AFKA 3OTFA 4NAMA 4FPLA 1PIV1 3N36A 4GB33 4YGDA 1YEWA 4BQ1A 3OPTA 3POJA 5FV3A 3ZDSA 3NJXA 4IEYA 1W6QA 1WCSA 3OGRA 5J98B 4BIOA 4IE0A 1UZ0A 2NP0A 4S2FA 5L7OB 3IPVB 3UL2A 1ULDA 1M4WA 3WW1A 5KC6A 4CDQB 2AEZA 4XJ8A 4YW7A 3O1RA 2A5ZA 2XVKA 2OT7A 1W6NA 5EHDA 4RGGA 1KFUL 5LBBA 2PHWA 4PF1A 1XBFA 1W2UA 1X82A 2R073 1WWYA 2VMHA 4CDXB 1BQPA 1MZFA 3CEWA 5FY5A 4KH9A 2E7AA 1TQ5A 1AYN2 3ZXFA 5C8WA 4Q4W2 2W5FA 1KFXL 4R9DA 4ES8A 3OD4A 4GZ9A 4A44A 2GC2A 1ZZCA 3FFQA 4HL0A 4YZ2A 2RDQA 4YVWB 5JVVA 1G7YA 4HK9A 1DLCA 3LA2A 2BRTA 2DVDA 2XJTA 4FFIA 1DLLA 1IQAA 2VPVA 2YU1A 1NKGA 4M3CF 2AUYA 3WDVA 3BTAA 4ZONA 3QH6A 3AZVA 2VY0A 1LOEA 5FZMA 5I0DA 1RUF1 2IFWA 3JUUA 3N7MA 3FMGA 2HWC3 4WBBA 1GV9A 5GZEA 2E9QA 5AC92 2J7MA 3QACA 4FI9A 2Q1FA 4GALA 4GWNA 1HB1A 5TSWA 4MXWB 3WF1A 4A7ZA 3THDA 4OCTA 1RVF3 1IPKA 5C9AC 4TTGA 1IS6A 1LGBA 5G05L 4P5HA 3UGFA 2C26A 4WM7C 5IVBA 5D2AA 2PN5A 4NIGA 4ISQA 2WFF2 4XFBA 3OYWB 2VZRA 1JMUB 1GICA 5LBCA 1W0OA 4QQPA 2WT0A 1MR5A 2ZA9A 1S55A 1DG6A 2MEV1 2RE9A 4NMIA 4DY5A 1BHGA 1POV3 3M8LA 4RR3C 3VDDC 3MFAA 3ZN5A 5FR3A 2CY6A 1ZZBA 2HWF3 1JU4A 2Z79A 4HVOA 5KC5A 1UAIA 4L9BA 1UOGA 1HW5A 4Q8KA 2WRAA 1R083 4KMQA 3W59A 3ZOIA 1GWKA 1VBB2 2RJKA 3LIHA 4YFZA 4OI1A 1VRH2 2ARCA 5CKNA 1AX1A 5LEKA 1I9RA 3EMRA 2A6WA 5FZCA 1AL22 1OQ1A 4I0BA 5A32B 4DFSA 2OPKA 3I49A 4AFMA 2YY1A 3SH3A 1X50A 2NPIA 5J1XA 4OI0A 5IVVA 1RUC2 1Y9GA 4RQPA 3SH4A 1RHI1 4CDWB 3M3EA 3UKNA 5KBFA 2JKBA 2RJ2A 4LKSA 3BVCA 1RMU1 4NUBA 5E1RA 1JHJA 1QU0A 3WT3A 2P4EA 1JS9A 2W1WA 4S2GA 1LU2A 1S0DA 4XJ9A 4XQDA 3H1YA 4XE9A 3LGRA 4FBFA 4P9JA 4NJ4A 4P9GA 1R1A1 4XDPA 3WSOA 2YPJA 3WG2A 1AR73 2W0XA 4I30A 1JYWA 1GQGA 4DXTA 1O8PA 1W9FA 3VBSC 1CAVB 1WUVA 3AYAA 4Q0SA 2D97A 3KSCA 2W1SA 2WZ8A 3ACGA 5A6XA 4XDOA 1GKBA 3WP5A 5DZGA 1YQ8A 2JIJA 2H6CA 3ZSEA 1ODNA 3DECA 2J42A 3H3UA 4Y5SA 2BOJA 2DURA 4L11A 4X8NA 3A0KA 5GZFA 5C3PA 4NIHA 5BNNB 1RGSA 4L97A 4WVWA 1EPZA 2CAUA 5DAXA 3K4ZA 3PUAA 3POBA 2NN8A 1XPWA 2DCKA 2IFRA 2WNOA 3DUIA 3QH7A 4LHLA 3NQHA 4QQOA 1JYXA 3TN91 1FV3A 4UBHA 4KI5M 2YBPA 3RMYA 4XW3A 2IXIA 5A7WB 4K1YA 1ACCA 1W9TA 3D6EA 1IPSA 5JOZA 4LK6A 4FPEA 4TLFA 5FP9A 1GBGA 4N43B 4QQ2A 3OY8B 2FDJA 1UY4A 4Q2FA 2D6NA 1QJY2 1BEV3 2P3JA 4EN7B 1W8HA 1YWKA 4AQ2A 4CE8A 1OLMA 3NJZA 3VB9A 3WNNA 4BK5A 1JYCA 1EYBA 2J1AA 3J7LA 3KT1A 2JDUA 4Q26A 4PIYA 4Z2WA 5C3RA 3V0BB 3RI8A 4LT5A 5A7SA 2BJSA 1D7PM 4O61A 4Y1YA 1RUH2 5L9RA 1GNYA 1H1IA 2X5IB 4XBLA 1GZCA 1JHNA 1UYZA 3HAGA 4O7XA 4YW2A 2ARAA 2D6PA 4HKWA 2ZGUA 5EJZB 1UL9A 3T4VA 4COVA 5A70A 2C0ZA 3EBRA 5DAVA 2AZ5A 1IGOA 3VD5A 5ANNA 4MG2A 3C7HA 5CVRA 3HPNA 1ENSA 4QPIA 2YGLA 5ABJB 1OXCA 1AR61 3HT2A 5FMDA 1NX9A 2QQOA 1OA4A 4JDMA 4Q4X3 2JE9A 2C1FA 4QGLA 2OW4A 4Z92B 3ZMNA 1GUIA 5FP8A 3KZ4C 1VR3A 5T3NA 3ZIWA 1MEC2 5EWSA 1F4AA 5LBFA 1UQXA 3AYCA 2D5FA 4XAAA 3T2QA 5I0SA 2JE7A 4E8DA 1MS3A 3UT0A 1YHFA 1N3QA 4RD7A 1UPSA 1YQ5A 3QCWA 2EALA 1NG0A 4GJZA 1NCRB 1ZBE1 2DFCA 2FCTA 1I3HA 2W9XA 5BNOA 5EV7A 4MGTA 5A3WA 2VC9A 4COUA 5JR7B 1OA2A 2UWAA 3I3QA 1UY2A 3J8F1 4OHVA 2WO7A 2EIGA 3PVNA 5FXWA 3LZZA 1NCQB 1UMIA 2YV8A 1UOFA 3VD9A 3J4UH 1MQTB 4GKXA 2D3SA 1QMJA 3AYDA 4LMFA 2D6OX 3N9MA 2GSYA 2BP6A 4ZS2A 1YQ6A 1E5RA 3SHRA 2V4AA 2IC1A 2C9KA 3AP5A 1CAWA 1MS4A 2BW8A 3OEAA 1WCUA 3NNGA 5FZ9A 1J84A 3H8RA 3WHUA 4XQWA 1QY4A 1ODMA 2BZDA 1YLLA 4QX3A 4XFHA 4WVMA 2BGCA 1UD1A 1QJX3 1W8NA 3MDPA 4Q0QA 4GWMA 2VQ0A 2Y6GA 4IV1A 5EQUA 1H9PA 2Y64A 2HEYF 1PO21 4JAAA 1VBE3 4ZXEA 2CWSA 3UK9A 1QJU1 5HBAA 3GM8A 2XUMA 5FP7A 5FZOA 5I8YA 3RPQA 4ZZ5A 3ZFFB 1C8M1 2WWUA 3UV9A 3MW4A 1QF3A 1C5HA 1GOGA 1VBD3 3O12A 4QB1A 4Z82A 3NL1A 2WZR2 5LB6A 1ZBA2 2JG8B 4XZUG 5F37A 3FC0A 1VBC3 1JYVA 5H9QA 3H1MA 1QQP3 1SBDA 4Q0PA 2H0BA 3ZO0B 2W91A 1NZCA 4AYUA 4CUGA 1UYXA 5JZGB 1S0JA 2VMEA 1CVNA 2WDBA 4Q4Y1 2B42B 3LAGA 4AAPA 2WNUC 3JQWA 1GOFA 4XBNA 1BK0A 5E16A 1W28A 1JUIA 5K8SA 1W6OB 4I09A 5JXGA 4C0HA 2B4KA 2LROA 1ULEA 1N3PA 5GALA 1ULPA 1NYWA 2B9VA 4CEWC 4CDXC 3O1VA 1UXXX 2YYOA 3SXWA 1S4CA 2X10A 4M4RA 3J9SA 4D7TA 3WD5A 3FX3A 5A7PA 2BNMA 4BOWA 3VZKA 1WCDJ 3I3MA 3P5BA 1L3JA 2GALA 4LR4A 3MO4A 4JGZA 1LOFC 4P14A 4AVSA 1QDOA 1SLIA 1RUI3 3FN9A 1LU1A 4ITCA 2YU2A 1XC6A 1OUXA 2RS13 4AVCA 4FPOB 1FMD1 5BPXA 1FV2A 2BEOA 1XNDA 1OQDA 1PM4A 1UF2C 1AXZA 1H2KA 5FZ4A 1DZTA 5FZKA 4CCLA 4SLIA 1IS5A 2R6QA 3VBFB 4OHZA 3UETA 2JENA 3I2KA 4Y26A 5CG8A 2IUWA 1DYKA 1HX6A 1W06A 2XQRA 4QAWA 4CPBD 4H7MA 1PGW2 4IDZA 2RS33 4ZXKA 2CSGA 1J58A 2Y0IA 1AXKA 2D44A 1ZYBA 2LM3A 3JBG1 2LRPA 2DUPA 3E6BA 1IS3A 4XFAA 5GKAC 3WG1A 4RS5A 2A6ZA 2JG9C 4JKMA 4BXSV 1BEV2 1RUJ2 1S2BA 1XQNA 2UWCA 5L19A 5FBJA 3ZYJB 4Y24A 1SZBA 3NNMA 4B4PA 5EZWA 3VDAA 3ROUA 2HWE1 4BDVB 1E5HA 2ZABA 2VZQA 4UYBA 2QFEA 1FAYA 3Q9OA 4AG4A 1CZSA 1F8VA 2A3WA 1LNSA 3I2OA 1RB8G 1AYM3 4HSLA 3POSA 3OBAA 1COV1 1CAWB 2F4PA 2HYXA 3BIWE 2NZ9A 2R061 1BBT3 4XCBA 2CTVA 4QKFA 3JZVA 4PI2A 4OZXA 3V64A 5FQ0A 1I6XA 1VE0A 4PT6A 4QDSA 5C33A 2EAKA 3AKTA 1S2KA 5BV6A 5DG2A 1VMFA 3L2YA 3RWKX 4WVMB 1JI6A 2AH2A 4N53C 3MPBA 3SEEA 4ARXA 3OJBA 1DP0A 3WNLA 5DZEA 1LHNA 1WD3A 2LS6A 1FNZA 1T2XA 4K7JA 4M3CA 3ITQA 4D6RA 3E97A 3INAA 1PIV3 3LIGA 4ATEA 4OMCA 5C9AA 2DF7A 4LLOA 3O1TA 1LULA 4LORA 2JE8A 4WM7A 4AHXA 1AHSA 4QDRA 3VBHB 2JIGA 4Y1UA 3VZLA 4JTNA 4AVAA 2LTNA 2ZHLA 1O3SA 1XE0A 1U0AA 3AMNA 4XDQA 4Q4V1 3FE5A 1VBA2 4SBVA 5HV4A 3B9IA 2WA4A 4EN8B 2HH9A 3VBUA 2GNDA 5HXMA 1E5SA 4LNVA 4RR3A 3VDDA 5BY5A 2XPJA 2RMU1 4YW5A 5FPUA 4B1LA 4NWWA 5I93A 3PNAA 3MUY1 2VQTA 1UW8A 3VGIA 3ZM8A 2N7GA 2GU9A 2VVEA 3OPWA 4NHXA 4EROA 2JDKA 3AKRA 4NIAA 3BALA 4M0NA 3S6PA 4AI0A 1GNHA 4FCAA 1RUG1 2ET1A 1ASJ1 5FYBA 4FPCA 1FI2A 1URXA 4UBGA 1D0HA 4AI3A 2FD8A 5FPLA 3C8XA 2DU0A 2OPWA 1R093 1C3HA 1PZ9A 4L0PA 4BMEA 4AGVA 2A6XA 1J1TA 4FOQA 2ET7A 4XUNA 1JZ2A 1RUF3 3M7AA 4XOGA 1DQ4A 1YIFA 3AP9A 2R49A 2X53S 5FZ0A 2EXJA 3N9QA 1SDDB 3C7GA 3KT7A 2VBPA 3MLJA 4OVEA 2FDKA 4Z2AA 5C4WB 1CONA 3MIDA 5K0UC 3BB6A 3EJKA 1REFA 3DKQA 2ADEA 1PM7A 3S7IA 3O14A 1QH6A 3R4UA 3VBSA 3ZYHA 5IUQA 2Y0OA 3PUIA 2WQ4A 4H55A 1W6PB 2WS92 5DDJ1 3RMXA 3U10A 4Y20B 2ILMA 2ZAHA 2MEV3 4IQPA 5A3UA 5KWRA 3VBRC 1I1EA 4UWDA 1HQNA 1UZWA 2W39A 1W8ZA 3PL0A 5FZAA 3UKVA 3ZFGC 3PURA 4ASKA 4IEPA 3ZR5A 2WINB 4LUMA 5FPBA 1DGRN 1UKRA 3MW3A 1H8TA 1O8SA 4COWA 3FFZA 1Q8VA 3RZZA 2BU9A 3NNJA 2HWD1 3SCHA 3ZKYA 4LO4B 3HNYM 4L99A 5M0TA 1GYKA 1VJ2A 2EIDA 1QQP2 3WQ0A 2PHTA 2XVLA 2V09A 1PX3A 1RL3A 4LIVA 4JGYB 2ZGSA 4GKYA 4QU1A 2VR4A 3KVAA 5J48A 2B7YA 2YC0A 3U0ZA 2RHPA 1X9TA 1XSQA 1XNCA 4D3WA 4AL9A 1A34A 1RHI3 4BWOA 2YB7A 3U4SA 3D82A 4KL1A 1LODA 2X09A 5E89A 3SNMA 1DF0A 1RMU3 1CWPA 1EV11 2VULA 3OUJA 5GLZA 1O3TA 5DXDA 3AL5A 2V73A 4H14A 5BXXA 1D2QA 2WLPA 1PVC1 5FQ0B 4DEVA 5C5UA 1G9CA 1UOJA 2BGPA 1Z7S2 1B35C 5F6KA 1IKQA 1R1A3 4PF5A 5IJRA 4CEYB 5I8SA 1QJEA 1NLQA 5FMCA 4BHPA 1B09A 2DYCA 4M3CB 5EP9A 3SLIA 4AW7A 2QQWA 1WCKA 1DQ2A 4BISA 1RUI2 2IWGB 2DBNA 3NV4A 2FHRA 2PMWB 1WCQA 4E2SA 4MV2A 2RR12 4V2VA 4QPGC 1HB4A 1QJX1 1H4HA 1RUD1 1ULCA 1PNFA 1BYHA 1UYYA 4Y1XA 1MS5A 1PO11 2H6BA 2UU8A 2YDEA 3KV6A 4D0QA 2UYBA 4K20A 4KWUA 1CJDA 1DGWX 2E7QA 4PBPA 4YFWA 4NHYA 5FY0A 3VDDB 3M3QA 3VD3A 1SLCA 1C57A 4OUSA 3GYDA 1I5ZA 2RS32 4D69A 1J3QA 1DFQA 2VBDA 3WF2A 3TN93 1YNAA 2EIBA 2SBAA 2B5HA 2D6LX 4DXZA 3Q8BA 4DQAA 5L9BA 2GH8A 2YFZA 1UIJA 5FYTA 4LKEA 1MZEA 3IDBB 4XQ4A 4AVBA 2BERA 5BNOC 4HPKB 3SMHA 4FFFA 1NA1C 3HBZA 1QOOA 1PGL1 1JOPA 1QJFA 1RUOA 4A6SA 5IVJA 1FPN1 2A7AA 4IEUA 5FY7A 1QOTA 2GH2A 5T5OA 2F17A 1MVQA 3I2GA 2GN3A 1ND2C 2E31A 4QHZA 3MEPA 3KGLA 1W8FA 1WA6X 3WY6A 3NAPB 1TMF1 2KXLA 4XFFA 4YYOA 1ONAA 3PHMA 2XHNA 2VNOA 3V0AB 3WVJA 1JXNA 3GZTB 2JDMA 1TEIA 2KD7A 3PIJA 4EJRA 3C2UA 2I45A 4KG0A 3PTRB 4RHV2 3MIEA 4CXWA 2ZKLA 5FY1A 3LDRA 5FYYA 3GALA 4B1MA 3AFGA 1KDKA 5EXOA 5FYHA 1J59A 4E2GA 3KCCA 2JXAA 3T0DA 1BJQA 5DUVA 1CESA 1Y9QA 2QUOA 1V6JA 4QQHA 2XJSA 3PTYA 4MGZE 1S1AA 1HRV3 3ORJA 2I07B 4IV1C 5DN2A 3OCPA 1U5YA 4DS0A 3V65A 3OGVA 1AR82 2VQUA 4DRRA 2GNMA 3GDBA 1H1AA 2YMZA 1AR63 1UX6A 4P02B 5KR7A 2DCTA 3K4AA 2W68A 4HSJA 2OXBA 5GLTA 2ADDA 2VMGA 1VMHA 1DZRA 1HQWA 1NT0A 2ETEA 4FPFA 4MHRA 5A3MA 1ZRDA 3ZYPA 5C6CA 3WV6A 1VALA 1LESA 2GP5A 3H3ZA 4XACA 1G9DA 2UYAA 1K5JA 2VZOA 2XWBB 4NPRA 1W8TA 4LBQD 3WNMA 3ZYFA 4MYEA 5J09A 3K75B 2D5HA 4XHBA 1W05A 4MZUA 1S2EA 1UMZA 4CCCA 4RGAA 1GOHA 1GP4A 1OMIA 2GC1A 2GZWA 3OSDA 4IGOA 3I8TA 1PX4A 4OMDA 4XF0A 3HIFA 2WNEA 5D8AB 5B4NA 1BZWA 1ZBE3 3RRDA 2WO1A 1O3RA 1HV0A 4E9KA 2ZGPA 2GNBA 3KF3A 2G9FA 2RM21 3ME2A 1OKOA 4YZ5A 3J8F3 4KWLA 4YM3A 1AYM1 1YQ2A 3VKMA 2HWB2 3D3AA 3J7HA 5ACA1 3USUA 4Q8LA 2WNUA 1MPXA
chains in the Genus database with same CATH topology
2YBSA 1VRBA 4D6RA 5FZDA 3PUAA 4BISA 5LWBA 5FY5A 5FYSA 3AL6A 3DXUA 3N9PA 5FY9A 5A3TA 5IVEA 3DXTA 3PU3A 5F39A 5FP7A 4V2VA 5FZOA 2YBPA 5IVFA 2WWUA 3AVRA 4HOOA 4IGQA 5A7WB 4DIQA 3KV9A 5FY8A 5FP3A 5FZGA 5F3IA 3KV6A 5FP9A 5FPVA 5CEHA 5IVCA 4LITA 2XDVA 5FY0A 4CCJA 5FZIA 5FZ7A 3PUQA 4URAA 5F2SA 5F37A 5FZLA 2OX0A 4CCNA 5FZ1A 5FPUA 2XXZA 2YU1A 4D6QA 5FZMA 5IVYA 5E6HA 5FYUA 4CUGA 3OPWA 4GD4A 5FYTA 2OQ6A 2PXJA 3K3OA 5A7SA 4V2WA 3ZPOA 4AAPA 4LXLA 5FZOB 4EZHA 2YPDA 5FYBA 4Y3OA 5IVJA 5FY7A 5FZFA 4QXBA 5FJKA 5FZ3A 5FZ8A 5FP4A 5F3GA 5FPLA 5A3NA 4GAZA 5IVBA 3LD8A 3K2OA 5A7OA 2YBKA 4CCKA 3PUSA 5F5AA 5FZ0A 5F5CA 5F32A 5A7PA 3K3NA 4HONA 5FXVA 3N9QA 5FJHA 5FXXA 2P5BA 5FPAA 2OS2A 3PTRB 2XMLA 5FXZA 2VD7A 4QX7A 4UF0A 5A3PA 5F3CA 5FY1A 4GJYA 5FYYA 3AVSA 2YU2A 5FYHA 3UYJA 5LY2A 5FZEA 4BU2A 5FYVA 5FZ4A 5FP8A 4CCLA 5FZKA 2Q8EA 3PU8A 4Y4RA 5FZCA 5F5IA 3NJYA 5LW9A 4QWNA 5FZBA 5FZAA 5IVVA 5KR7A 2GP3A 3PURA 4ASKA 4CSWA 2W2IA 4GJZA 5FUPA 5FPBA 2Q8CA 4DO0A 4EZ4A 3N9NA 4NUBA 5FZHA 5A80A 5FYIA 4E4HA 2GP5A 4BXFA 4CCOA 5FYCA 5A3WA 3U78A 5A1LA 5FBJA 4UF0B 5K4LA 4EYUA 5ISLA 4LIVA 5FXWA 4CCMA 4QU1A 5F2WA 3PDQA 3KVAA 2OT7A 4LIUA 4XDPA 3N9OA 4TN7A 5FWEA 5ANQA 4Y33A 5A7QA 5FZ6A 4QX8A 4IGOA 3N9MA 5IWFA 5FYZA 5A7WA 2Q8DA 3U4SA 3ZLIA 3KV5A 4C8DA 2XUEA 3OPTA 5FV3A 3KV4A 5FYMA 4D6SA 4XDOA 5FWJA 5FZ9A 4IGPA 3AL5A 5LY1A 4QXCA 3LDBA 3N9LA 5IW0A 3RVHA 5A1FA 3KVBA 5F3EA 4QXHA 2OQ7A 5FY4A 5A7NA 2WWJA 4AI9A 5FUNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YBS A;  1VRB A;  4D6R A;  5FZD A;  3PUA A;  4BIS A;  5LWB A;  5FY5 A;  5FYS A;  3AL6 A;  3DXU A;  3N9P A;  5FY9 A;  5A3T A;  5IVE A;  3DXT A;  3PU3 A;  5F39 A;  5FP7 A;  4V2V A;  5FZO A;  2YBP A;  5IVF A;  2WWU A;  3AVR A;  4HOO A;  4IGQ A;  5A7W B;  4DIQ A;  3KV9 A;  5FY8 A;  5FP3 A;  5FZG A;  5F3I A;  3KV6 A;  5FP9 A;  5FPV A;  5CEH A;  5IVC A;  4LIT A;  2XDV A;  5FY0 A;  4CCJ A;  5FZI A;  5FZ7 A;  3PUQ A;  4URA A;  5F2S A;  5F37 A;  5FZL A;  2OX0 A;  4CCN A;  5FZ1 A;  5FPU A;  2XXZ A;  2YU1 A;  4D6Q A;  5FZM A;  5IVY A;  5E6H A;  5FYU A;  4CUG A;  3OPW A;  4GD4 A;  5FYT A;  2OQ6 A;  2PXJ A;  3K3O A;  5A7S A;  4V2W A;  3ZPO A;  4AAP A;  4LXL A;  5FZO B;  4EZH A;  2YPD A;  5FYB A;  4Y3O A;  5IVJ A;  5FY7 A;  5FZF A;  4QXB A;  5FJK A;  5FZ3 A;  5FZ8 A;  5FP4 A;  5F3G A;  5FPL A;  5A3N A;  4GAZ A;  5IVB A;  3LD8 A;  3K2O A;  5A7O A;  2YBK A;  4CCK A;  3PUS A;  5F5A A;  5FZ0 A;  5F5C A;  5F32 A;  5A7P A;  3K3N A;  4HON A;  5FXV A;  3N9Q A;  5FJH A;  5FXX A;  2P5B A;  5FPA A;  2OS2 A;  3PTR B;  2XML A;  5FXZ A;  2VD7 A;  4QX7 A;  4UF0 A;  5A3P A;  5F3C A;  5FY1 A;  4GJY A;  5FYY A;  3AVS A;  2YU2 A;  5FYH A;  3UYJ A;  5LY2 A;  5FZE A;  4BU2 A;  5FYV A;  5FZ4 A;  5FP8 A;  4CCL A;  5FZK A;  2Q8E A;  3PU8 A;  4Y4R A;  5FZC A;  5F5I A;  3NJY A;  5LW9 A;  4QWN A;  5FZB A;  5FZA A;  5IVV A;  5KR7 A;  2GP3 A;  3PUR A;  4ASK A;  4CSW A;  2W2I A;  4GJZ A;  5FUP A;  5FPB A;  2Q8C A;  4DO0 A;  4EZ4 A;  3N9N A;  4NUB A;  5FZH A;  5A80 A;  5FYI A;  4E4H A;  2GP5 A;  4BXF A;  4CCO A;  5FYC A;  5A3W A;  3U78 A;  5A1L A;  5FBJ A;  4UF0 B;  5K4L A;  4EYU A;  5ISL A;  4LIV A;  5FXW A;  4CCM A;  4QU1 A;  5F2W A;  3PDQ A;  3KVA A;  2OT7 A;  4LIU A;  4XDP A;  3N9O A;  4TN7 A;  5FWE A;  5ANQ A;  4Y33 A;  5A7Q A;  5FZ6 A;  4QX8 A;  4IGO A;  3N9M A;  5IWF A;  5FYZ A;  5A7W A;  2Q8D A;  3U4S A;  3ZLI A;  3KV5 A;  4C8D A;  2XUE A;  3OPT A;  5FV3 A;  3KV4 A;  5FYM A;  4D6S A;  4XDO A;  5FWJ A;  5FZ9 A;  4IGP A;  3AL5 A;  5LY1 A;  4QXC A;  3LDB A;  3N9L A;  5IW0 A;  3RVH A;  5A1F A;  3KVB A;  5F3E A;  4QXH A;  2OQ7 A;  5FY4 A;  5A7N A;  2WWJ A;  4AI9 A;  5FUN A; 
#chains in the Genus database with same CATH topology
 3W58 A;  3AJY A;  5E88 A;  2YBS A;  4ZPI A;  5LRS A;  5FZD A;  4WM8 C;  3R05 A;  3RQ0 A;  3KQR A;  4XF4 A;  3I4I A;  2FDI A;  3MYX A;  2P2K A;  5F39 A;  4AEJ A;  2W1Q A;  1LED A;  4R9B A;  1LOC A;  3DPR B;  3CQO A;  4QGN A;  5HCF A;  3UKT A;  2BWA A;  1G9B A;  2W1U A;  2FQP A;  1VAM A;  4WZF A;  5FTT C;  4FTB A;  4LIT A;  1OOP B;  3ZSL A;  1HXS 2;  3NVC A;  1SFP A;  1LOF A;  1BVP 1;  1WGP A;  4PDW C;  4AF9 A;  2VUA A;  4D94 A;  1LHU A;  5GZC A;  4ZHN A;  1D4M 2;  1V9U 1;  1WW6 A;  2OZ6 A;  1PO2 3;  1WD4 A;  1QIQ A;  2BV4 A;  2ZEZ A;  1OH4 A;  5H9R A;  1CX4 A;  3AYE A;  1QJU 3;  2CDO A;  1YI7 A;  3FL7 A;  4PHZ A;  4LPL A;  2QJV A;  3CF6 E;  4E4Z A;  3MFC A;  1C8M 3;  3I2D A;  3PMS A;  1OPM A;  4IE5 A;  1SDW A;  4IE6 A;  2VZS A;  2J1E A;  4XAE A;  5C8C C;  4TWT A;  2VZ1 A;  4RS5 C;  1OD5 A;  1ND3 A;  3POG A;  4NWV A;  2ZHN A;  4CYD A;  3BIE A;  5JI9 A;  2GN7 A;  3ABZ A;  4KWK A;  3ZYI B;  4URT A;  3ZXD A;  2Z42 A;  4C1W A;  4ET7 A;  4RYD A;  3H3L A;  4R52 A;  4WZC A;  3TNQ A;  3VKL A;  4AWD A;  5A6Q A;  2YBK A;  2CGO A;  4NRM A;  1W3V A;  2JG9 A;  2A3X A;  3DF0 A;  3PUS A;  4NR1 A;  5F5C A;  3TAY A;  4BIF A;  3IT8 A;  3H7Y A;  5FKC A;  2J1T A;  3HT1 A;  5JPM B;  1WW4 A;  4MO3 M;  3WNK A;  4Q4Y 3;  3AX4 A;  1VB4 A;  5A3O A;  3LEK A;  1R09 1;  1V00 A;  2XML A;  3ZSJ A;  3T0B A;  1V6O A;  1R1A 2;  5BNP B;  5FRE A;  2OII A;  4AK3 A;  3LKJ A;  4CP2 A;  2QQI A;  3JB8 A;  3QLQ A;  1ZRC A;  1SHW B;  1A8D A;  3MGU A;  3RG0 A;  4BU2 A;  5J3U A;  1GLH A;  2JDN A;  1UX7 A;  4X8P A;  3T08 A;  4LLF A;  4P9Y A;  1UKG A;  5KHH A;  2ORZ A;  5FRA A;  1W6M A;  2A73 B;  1OVP A;  4N53 A;  3GJA A;  4YZ4 A;  2VW0 A;  1H6Y A;  1BKZ A;  2VCM A;  2QQJ A;  3N9N A;  4M4P A;  1YI9 A;  5FZH A;  3VBU C;  1FMD 3;  5LA0 A;  5FIX A;  2JD9 A;  2VUJ A;  4FSJ A;  4OHW A;  1H9W A;  1K5M C;  1JW6 A;  4IV3 C;  5CNA A;  3TN9 2;  2CV6 A;  2AC1 A;  1XYP A;  1GQP A;  3PDQ A;  4LBM A;  1I5P A;  1TNF A;  4LIU A;  3K48 A;  1W04 A;  1GZT A;  3NO8 A;  3III A;  1V6L A;  2ORX A;  4GA9 A;  3RYK A;  5IWF A;  1AR9 1;  3B93 A;  3JBG 3;  4J6G A;  4N8M A;  1W39 A;  4B4R A;  4DOU A;  3KV5 A;  3LSD A;  1CIW A;  2ES3 A;  4R4X A;  2CHH A;  1HLC A;  2K46 A;  3A0N A;  4O9E A;  4W6X A;  3VKF C;  1ZZ8 A;  1SPP B;  3N9L A;  1HRI 2;  4B7K A;  2ZAC A;  5F3E A;  3RDI A;  4BK4 A;  4COZ A;  1ULF A;  3AZW A;  2HWE 3;  2HBT A;  2XBO 2;  3JQX A;  2ZX3 A;  2A3Y A;  4H7L A;  1NE4 A;  3ACL A;  4EWE A;  1AJO A;  4AI9 A;  2UY8 A;  4X6Q B;  1VRB A;  4AGG A;  2Q5T A;  5SV5 A;  3RJ2 X;  5AFB A;  2Z69 A;  4FXK B;  1COV 3;  1NXM A;  4BH9 A;  2ZGK A;  4ZU4 A;  2R06 3;  3DXT A;  5FLI A;  4ZY9 A;  4CEW B;  3OGG A;  4GIQ A;  2NMO A;  3N35 A;  1F5F A;  1CQ9 A;  3WXP A;  1SQ4 A;  3WG3 A;  1ENX A;  1AYN 1;  4Q4W 1;  4UW5 A;  2VMF A;  4CXY A;  1LEC A;  3THP A;  4Y4Y A;  5CEH A;  3Q8F A;  3M3O A;  4QD2 A;  4XTM A;  1RED A;  1W6Q B;  1XNK A;  3LFM A;  3FUQ A;  4AE2 A;  3E1F 1;  4CZS A;  4FOW A;  5K0U A;  4Q29 A;  3ILF A;  2PHL A;  5J36 A;  5T52 A;  1GAN A;  1OUR A;  2I74 A;  5FYU A;  4MGQ A;  5G04 L;  1W6N B;  1M06 G;  1Y4W A;  3RZG A;  1NUK A;  3CMG A;  3VL9 A;  5BUV A;  4XAB A;  1CN1 A;  1H8T C;  2KM2 A;  4Q4V 3;  4XF9 A;  5AC9 1;  1OC1 A;  4V2W A;  2ZZQ A;  3ZVX A;  5JWP A;  4XTP A;  3VBR A;  3MIC A;  5K7P A;  1PNG A;  1O4Y A;  1NQJ A;  2RMU 3;  4JC1 A;  3ZFG A;  2VTX A;  3RWN A;  5IFP A;  2C6S A;  2VVD A;  2C5D A;  3VDC A;  3NJV A;  1JYI A;  5LA1 A;  3ZIX A;  1ZZ9 A;  5GZG A;  2JG9 B;  1JTZ X;  1ZBE 2;  5F5A A;  1QOS A;  3OEB A;  1L7L A;  2A1X A;  2BGO A;  2WFF 1;  2YZ4 A;  3TB0 A;  3ALQ A;  1ZRR A;  5FJH A;  2ZS6 B;  4YW6 A;  4LTA A;  2D6M A;  5JSR A;  5JOX A;  1ZA4 A;  1RUG 3;  1ASJ 3;  4ZKT B;  2XJP A;  2XWJ B;  3TEX A;  2RDN A;  3AP7 A;  2NM1 A;  5JAX A;  4OZO A;  3N7K A;  3IBM A;  3ZKU A;  2ZML A;  4ZS3 A;  5FYV A;  1VBB 1;  1CPM A;  1GZW A;  3PU8 A;  2QZ2 A;  1VP6 A;  1VRH 1;  4FPH A;  4S2H A;  4A41 A;  2PLV 2;  1SLL A;  1B35 A;  1W6M B;  1E57 A;  4XJZ A;  1YFU A;  4HKO A;  4N53 B;  3NNF A;  5CU1 A;  4BM8 A;  4CP9 A;  2JDZ A;  3HWJ A;  4K8F A;  2GP3 A;  2NYY A;  3ETQ A;  4GB3 2;  4IE7 A;  4UFI A;  4YPJ A;  1HRV 1;  1IG0 A;  1X36 A;  4YVS A;  3LE0 A;  1MS0 A;  1UMH A;  1YJK A;  2XKP A;  4G9S B;  3NNL A;  2IXK A;  4IER A;  4BYY A;  4R8H A;  3ST7 A;  4HVR A;  1QJU 2;  5ISL A;  4QPG A;  5LK7 B;  5DDJ 3;  4FPK A;  1RTV A;  4W8J A;  5LBE A;  4KG8 A;  5FMB A;  1JZ8 A;  1C28 A;  3PJY A;  5L73 A;  2R07 2;  3RI9 A;  3VD4 A;  4QX8 A;  3SIT A;  3Q8C A;  2WO2 A;  1PGS A;  4Y5Z 0;  1W9W A;  4JRL A;  3U11 A;  4YSF A;  2YFU A;  1PZ8 A;  2CYF A;  2HWD 3;  3ACF A;  4DPN A;  3HNB M;  1LB2 A;  3KWV A;  4YM1 A;  5JLV A;  4RQP B;  5JXI A;  1CAU A;  1CGP A;  2P6C A;  3RSJ A;  3VBO C;  3VD7 A;  4NPL A;  1UU6 A;  4MX3 A;  1US3 A;  4YG6 A;  4HG6 B;  3P3N A;  5IAV A;  5JMC A;  4TZD A;  5CA6 A;  4JHZ A;  2GDF A;  1Y9M A;  1C4R A;  4HAN A;  4OHX A;  5FUN A;  1NA1 A;  3TRS B;  5L7O C;  1XU1 A;  1OVS A;  1WZX A;  1KJR A;  1O5L A;  2YXS A;  1UPI A;  5FK8 A;  2OUJ A;  5B4X A;  5A3T A;  1OBN A;  2E7T A;  2HWC 2;  1LAJ A;  1ND2 A;  1EV1 3;  4OUL A;  3B5L B;  4XEZ A;  4WVZ A;  4ES9 A;  4QX1 A;  5JIU A;  2HKX A;  2FDH A;  1PVC 3;  1L7R A;  4KNC A;  4QM9 A;  5LAT A;  2A6Y A;  4XUO A;  5F3I A;  1UY3 A;  1XNT A;  5CFD A;  4HT1 T;  3ZYB A;  1RVF 2;  5HCB A;  1DIW A;  4BE3 A;  2NLR A;  1DQ6 A;  4OUM A;  5ERL A;  5K0U B;  4C1X A;  1RJ7 A;  1TME 1;  1UCX A;  4H3W A;  3W5M A;  1H2M A;  3MF9 A;  4QM8 A;  4YVW C;  5FZ1 A;  4K1Z A;  1V6I A;  2WN2 A;  3I3B A;  1SBF A;  2Y60 A;  2R0F A;  3APB A;  3VZJ A;  1F15 A;  5GM0 A;  4UOJ A;  2O8O A;  1RUD 3;  3NRU A;  3OGS A;  3NKG A;  1ZVF A;  1PO1 3;  1EAH 1;  2HWF 2;  4UAP A;  4LXL A;  1MZ6 A;  3VHO A;  2FMD A;  2ZX2 A;  1EUU A;  1RJ8 A;  1RUH 1;  3MIF A;  1R08 2;  4AVV A;  3THT A;  4PLO A;  5FMO S;  1X7N A;  2JB8 A;  2WJS A;  1V0A A;  1KJL A;  1IHM A;  1UOB A;  2JX9 A;  3ACH A;  2BFU S;  1Q3E A;  3JBG 2;  4FOV A;  4OQ8 A;  1S0F A;  3HVD A;  2AR6 A;  1EY2 A;  4XMA A;  4UFJ A;  2VCB A;  5FOJ B;  1F35 A;  4QB2 A;  1KEX A;  3ZXG A;  1L7Q A;  4MLO A;  5DZF A;  3GCW A;  3DEM A;  4UF0 A;  3ES1 A;  1FPN 3;  1Q8Q A;  2GC3 A;  2QZ3 A;  5DAW A;  1PMJ X;  3VHP A;  3MIG A;  1CX1 A;  1TZO A;  4PI0 A;  1UXZ A;  2IXH A;  4I02 A;  3S5A A;  1UYP A;  5EIY B;  1V6K A;  3U37 A;  4Z1V A;  4JKK A;  1TMF 3;  2HEW F;  1KDM A;  2PQQ A;  1B35 B;  1MEC 1;  1AR7 2;  3V56 A;  3WW3 A;  5JI7 A;  4XXA A;  3O1M A;  2IXL A;  2AAC A;  1H2L A;  1MS9 A;  4UW4 A;  4FQZ A;  1XJA A;  3KMH A;  4CSW A;  2VOW A;  2VMI A;  4CPB A;  5JXH A;  5KXE A;  1WMF A;  2EIE A;  2VOV A;  3AMP A;  1XU2 A;  3VZO A;  4LO7 A;  4DO0 A;  4FFH A;  4NID A;  4QPI B;  4WM8 A;  4V1P A;  4XIL A;  4CU9 A;  5DPN A;  1GFF 2;  2OYZ A;  2PTM A;  4FP2 A;  2VUD A;  3L2H A;  1Q8P A;  4I3P A;  4CDW C;  3E5X A;  4AAX A;  3U07 A;  1HN0 A;  4DXR A;  4AQ6 A;  3B02 A;  3DV8 A;  5CFC A;  4JTO A;  5KHK A;  3K77 A;  2R7E B;  2W47 A;  3O1S A;  3FLP A;  3TEZ A;  4PDW A;  4YW4 A;  4UT5 A;  5IK8 A;  3BU0 A;  3H8O A;  2XJR A;  1ND3 C;  4MH0 E;  1IZ3 A;  3GBF A;  4A4A A;  3HOB A;  5DQ0 A;  5EPA A;  4AHY A;  5LY1 A;  3IM0 A;  4DUW A;  1HQL A;  1SEF A;  4KBZ A;  1VPH A;  4QKD A;  1G86 A;  4EQV A;  2DCZ A;  1KGY A;  1U12 A;  5BNO B;  4Y22 A;  1BVV A;  5C8C A;  2WWJ A;  4BQ3 A;  2WLQ A;  1US2 A;  5FLJ A;  4LBJ A;  3I2I A;  5GLV A;  2ZHK A;  3UNP A;  2ZOE B;  4G4F A;  3N9P A;  4NVP A;  5IVE A;  2DUO A;  5BNN C;  1GQH A;  4W50 A;  2RM2 3;  2GC0 A;  2WSU A;  5FY8 A;  4DZG A;  4HMZ A;  2JB4 A;  3O7O A;  2I2S A;  5IVC A;  2WNV A;  1NY7 2;  1WME A;  2VTF A;  4YZ3 A;  1N1T A;  5ACA 3;  4GMP 1;  3K4D A;  1IPJ A;  2EF6 A;  2FCU A;  2QQP A;  2WZR 1;  1ZBA 1;  2GME A;  2G9Z A;  1OF3 A;  4D6Q A;  2FZ2 A;  4N43 C;  3F2Z A;  5IVY A;  3RS6 A;  1E5I A;  2ENR A;  2ZAA A;  4NO4 A;  1OFS A;  1UZY A;  1X8M A;  5FPX A;  1XYO A;  1ENQ A;  2W87 A;  4IV1 B;  5KXB A;  3VZM A;  2BPA 2;  4MGI E;  1A3K A;  4DXS A;  4HKL A;  5FZO B;  5T54 A;  4DB5 A;  4I3G A;  4Q4X 2;  5A33 A;  3LF7 A;  3J7N A;  1V9U 3;  1F31 A;  2MNG A;  5FP4 A;  1T6G C;  2HJI A;  2Y34 A;  4XMI A;  3I7D A;  1WLC A;  2PHD A;  2JD4 A;  3NMB A;  4JX0 A;  3A22 A;  5EYY A;  2RDR A;  2BWC A;  3AZX A;  4K6B A;  2WO3 A;  4YM0 A;  3JCI A;  1K5M A;  4IV3 A;  3SKV A;  4Q1P A;  1JU3 A;  3EB7 A;  4COY A;  3AM2 A;  1YFX A;  3GF6 A;  3RZH A;  3PIG A;  3IDA A;  4JRA A;  1CPN A;  2J1V A;  3HQX A;  5A3P A;  3WQ1 A;  4K9S A;  3WIN E;  3KCY A;  1WMX A;  5FMO L;  4CVU A;  1H30 A;  2XJU A;  1SFY A;  2E51 A;  4AHZ A;  1FOD 3;  2BFU L;  1BCX A;  2VAU A;  3AKQ A;  5A6Z A;  2WSV A;  4CDU A;  4DMI A;  4ATF A;  5B2G B;  1QNW A;  2JDP A;  3SIS A;  4QWN A;  5FZB A;  2DVF A;  3QOP A;  2EXI A;  3RZJ A;  2ARB A;  4AED C;  1PGW 1;  1YRZ A;  2F4L A;  3D0S A;  3BOW A;  4FTE A;  5SV8 A;  4WM8 B;  1CZV A;  5A80 A;  1JZ6 A;  3WF0 A;  1POQ A;  1GP5 A;  4JGZ B;  4OUE A;  2ZCW A;  3U78 A;  1NCR C;  1BMV 1;  4HVQ A;  1RUJ 1;  4XPV A;  2CL2 A;  5FAX A;  2WQZ C;  4LE3 A;  4Q0V A;  1SBE A;  1QJX 2;  3KHC A;  2D6K A;  1WKY A;  2VZT A;  3ASI A;  3ZXE A;  3N9O A;  3P3P A;  3BGA A;  3OBT A;  4CRQ A;  3ZSK A;  3N7L A;  2BDR A;  4LO8 A;  5FDB A;  2VNV A;  3WHT A;  1PMI A;  5HXV A;  3H8X A;  2Q0A A;  4PDW B;  1VBE 2;  4HLT A;  1P8J A;  1OUS A;  2ZGT A;  3I3D A;  1F4H A;  2LUW A;  1C8N A;  4RFR B;  3ZFE A;  3VDB A;  1XOY A;  3RNS A;  1VBD 2;  3SCG A;  3MW2 A;  4Y5T A;  2BVV A;  3CJI A;  5FCC A;  1T6B X;  4Y22 B;  2XON A;  4RS5 B;  1HJF A;  3AMM A;  3H8U A;  1VBC 2;  4YG3 A;  1PK6 C;  4XC9 A;  1IS4 A;  1K3I A;  3J26 N;  1AR9 3;  2ZEW A;  2D43 A;  3M1H A;  4TSV A;  3ZN6 A;  4CA9 A;  4HFS A;  1PGL 2;  3KLS A;  4KGQ A;  1SLA A;  4XET A;  5FYS A;  1MS1 A;  1AX0 A;  1UN1 A;  2O1Q A;  4LK7 A;  4ONU A;  1JYN A;  3GBW A;  3O1P A;  1A6C A;  5IYY A;  3BUC A;  5A3L A;  4IGQ A;  1N1Y A;  4IE4 A;  1Q56 A;  2A6V A;  4IET A;  4KU7 A;  1VMJ A;  1AJK A;  4DY3 A;  1SFN A;  1YQC A;  1Z0H A;  5DUW A;  3ZFF C;  1VIW B;  1SCS A;  1VBA 1;  4D8M A;  1N1V A;  3E6D A;  2C4X A;  3LPG A;  4JDN A;  1ZA7 A;  2JG8 C;  1GWL A;  3ENR A;  5JPN B;  2QTW B;  3LOI A;  4LBL A;  3BKZ A;  1OSG A;  1D4V B;  2WT2 A;  1CAX A;  4YVS C;  1AYN 3;  1O4Z A;  4Q4W 3;  4LA2 A;  4U36 A;  3ZPO A;  5C9A B;  4BQX A;  4CTE A;  2B45 X;  4JVA A;  4WM7 B;  4EZH A;  3CHX A;  4K8R B;  2RS1 2;  5JZG C;  3GZE A;  4QXB A;  5FZF A;  3ZXL A;  4DRV A;  3RZM A;  3DYM A;  5FZ8 A;  1DCS A;  3SC7 X;  3TNP B;  4RN5 A;  5HCH A;  1XE7 A;  2ZHM A;  5DAP A;  3VBU B;  4C91 A;  1JOB A;  4RR3 B;  3ZN4 A;  5HI0 A;  4GWJ A;  4YM2 A;  3WEZ A;  3KM5 A;  1LOA A;  5CBL A;  4FXG B;  5AC9 3;  4FOY A;  4IUG A;  2JKX A;  1JZ7 A;  1DZQ A;  5L9V A;  2PFW A;  3K51 A;  4B29 A;  3LOB A;  4Y1V A;  1ZX5 A;  1YXW A;  3BN6 A;  5DUX A;  3ZXA C;  5E8A A;  2PQS A;  1HV1 A;  1WBL A;  3AC0 A;  1IG3 A;  2YRO A;  2RG4 A;  1REE A;  3BCW A;  5C7G A;  1UO9 A;  4O9G A;  1AZD A;  2WFF 3;  3PVE A;  2XQX A;  4QX2 A;  3UJQ A;  1POV 0;  1RUE 1;  2PAM A;  3A4U A;  3D4K A;  4XZP A;  3VBO A;  2XHK A;  3LSE A;  1XE8 A;  2WS9 1;  3T4H B;  4XBQ A;  1AYM 2;  1SCR A;  1QH7 A;  2ZX1 A;  4GWI A;  3VBF C;  1TVG A;  5K9Y A;  1FAT A;  3WDX A;  5L7O A;  2WL1 A;  4J25 A;  3IPV A;  4MGY E;  1BBT 2;  2Q8O A;  1DQ1 A;  2RDS A;  2Y33 A;  4CDQ A;  5CFD C;  2B8M A;  2P3K A;  2IZW A;  3M2M A;  4LKF A;  4LBK A;  4XUP A;  4P9I A;  3WDU A;  5I0U A;  4CDX A;  1VBB 3;  1U5X A;  2EAA A;  1VRH 3;  2VVF A;  4X6R B;  3E6C C;  4LBQ A;  1AL2 3;  3VBS B;  4O65 A;  5FWE A;  3WR0 A;  5KXD A;  1Y3T A;  2PHU A;  3ZDV A;  1IOA A;  1PIV 2;  1ZRI A;  4E4D X;  4A3X A;  2X29 A;  2V5D A;  4LUL A;  1UZZ A;  4XF1 A;  4CU6 A;  5CAD A;  3KCX A;  2BTV C;  4YVW A;  3S5Q A;  3W9A A;  3RZL A;  4XXP A;  2QQL A;  4DUV A;  3AB0 A;  3LDB A;  3T1M A;  4WVV A;  5IW0 A;  3JD7 1;  2ZTN A;  2W08 A;  5JSP A;  1UY1 A;  2JDH A;  1H8T B;  2KR2 A;  2YUE A;  1Z7S 1;  3ON7 A;  1S0I A;  2VNR A;  4W4Z A;  3WNP A;  5JIA A;  3ZN6 B;  4DIN B;  1R1Z A;  5F1R A;  4ARY A;  2ERF A;  2VW2 A;  5T50 A;  3OF1 A;  1NXD 1;  3AL6 A;  1JUH A;  4MXW A;  4P9L A;  2JDY A;  2VZV A;  2EIC A;  1AX2 A;  4LOS A;  2DFB A;  1H1M A;  5IVF A;  3KF5 A;  2XL7 A;  4QX0 A;  1C5I A;  2W46 A;  3AMQ A;  2RR1 1;  2WQ8 A;  3B9C A;  3RGB A;  1NLR A;  2ZEX A;  3ZX7 A;  3BTX A;  1GU3 A;  4PJY A;  4BB3 A;  3VBH C;  2FCV A;  3MBW A;  1RIT A;  1J1L A;  1LGC A;  2E53 A;  2R04 1;  1R09 2;  4Y1Z A;  5H9S A;  4F7Z A;  3TEY A;  1WW7 A;  1XNB A;  1RUF 2;  1FT9 A;  4XJW A;  5FK7 A;  3DKW A;  4QKB A;  3GHM A;  2CAV A;  2BBV A;  4NRO A;  3LWC A;  4MVT A;  2B46 X;  2R16 A;  1AXY A;  5D1I A;  2WII B;  3I2F A;  2PXJ A;  5EYX A;  3AK0 A;  4AGR A;  1LJ7 A;  3D5O A;  2VG9 A;  5I91 A;  4JDO A;  1N47 A;  3FHQ A;  4EN9 B;  4Y3O A;  2O14 A;  2DTY A;  3ZSM A;  3DN7 A;  1TME 3;  3LEG A;  4AZZ A;  2QQN A;  3S57 A;  4ASL A;  3ES4 A;  2AEY A;  4GAZ A;  4BQY A;  3KGZ A;  3SKJ E;  2DDU A;  4UFL A;  4BJ0 A;  5CFC C;  5IK7 A;  4AI2 A;  4CCK A;  1Q8O A;  2XJV A;  2H0V A;  2X8K A;  2MEV 2;  3TYJ A;  4CDW A;  1V70 A;  5FXV A;  4HON A;  3OUI A;  1W0N A;  1W90 A;  3N7J A;  1Q43 A;  4Q5O A;  4AFB A;  2QE3 A;  3U75 A;  1EAH 3;  4RL7 A;  4BQ4 A;  3I3E A;  1LHW A;  2JEC A;  2RS5 1;  2PAK A;  1RUH 3;  3AVS A;  3A23 A;  2P1B A;  1HDK A;  2WZP P;  3UYJ A;  2ZXQ A;  1UWW A;  4UFM A;  1IKP A;  3A7Q A;  4NAO A;  5C4W C;  4Z8B A;  1ULG A;  1OFN A;  1G9A A;  4NE9 A;  2QDN A;  3I97 A;  2QQV A;  1LCL A;  2WT1 A;  1RIR A;  2ATF A;  4IEV A;  3ZR6 A;  1QKQ A;  4CU8 A;  1ZZ6 A;  1CAV A;  5C3Q A;  1A78 A;  3VBO B;  4N7I A;  1S0B A;  3JU9 A;  4RFT 0;  3LEM A;  4XIO A;  3E5Q A;  4P9X A;  4EWA A;  3B01 A;  1RHI 2;  3EYP A;  1AR8 1;  1G8W A;  3O1O A;  2PYT A;  2WC2 A;  4QT6 A;  1FOD 1;  1X8E A;  2ZJC A;  4F83 A;  1RMU 2;  2VXR A;  4CXX A;  1YO8 A;  2WNV C;  2J1R A;  4FPY A;  3I54 A;  1W8U A;  5IK4 A;  4BXF A;  2W52 A;  1J3P A;  3CLP A;  5AFE A;  5EJ3 A;  5BNN A;  1R64 A;  2BUK A;  2V4V A;  2HLE A;  2Q1Z B;  3OG2 A;  4EYU A;  1OT5 A;  4CCM A;  3IMM A;  4JCK A;  5F2W A;  3MF6 A;  4LBQ B;  4ZU5 A;  3T3Y A;  4ZZ8 A;  1MEC 3;  3EQE A;  1LR5 A;  4ASM B;  2WWS A;  1OA3 A;  5A7Q A;  4F3J A;  4MET A;  5FZ6 A;  3WUD A;  1QWR A;  4JGY C;  3WZ1 A;  3Q8A A;  4AFA A;  3LB9 A;  4L2N A;  5FYZ A;  5A7W A;  3ILR A;  4BQW A;  5KHI A;  4A7Y A;  2DBI A;  1GMM A;  3HJR A;  2V72 A;  5FO7 B;  4D6S A;  4N43 A;  1RXF A;  2VE1 A;  3OY8 A;  2WBK A;  4XJA A;  2DVB A;  5CZK A;  1LOB A;  4IEZ A;  4PCR A;  4HN0 A;  3WOG A;  5A1F A;  1DGL A;  4N7U A;  1W8O A;  4QXH A;  2OQ7 A;  3NKT A;  5FY4 A;  1OLM E;  1LHV A;  2WUH A;  2XG3 A;  3JB4 C;  3KB5 A;  4IND A;  4L8Q A;  3OOX A;  5A7N A;  4LQR A;  4B4Q A;  4BMB A;  2HWB 1;  1DYO A;  1A8M A;  3V0B A;  3DCQ A;  4CEY C;  4C90 A;  1KRI A;  4XFG A;  1XB9 A;  4Q1R A;  3B3Q E;  2LW8 A;  4QKN A;  5AVA A;  3BPZ A;  2X5I A;  4QMA A;  1W03 A;  5JXJ A;  4IES A;  1VB2 A;  1ZM1 A;  5FP3 A;  2KA3 A;  2QQK A;  2VH9 A;  2P37 A;  3ECQ A;  3LPF A;  3NV1 A;  5FPV A;  1JZ4 A;  2YHJ A;  3ETP A;  2XL9 A;  2E26 A;  5C5T A;  3MV0 1;  2ARX A;  5FZI A;  4D7Y A;  2G1M A;  4URA A;  4CDU C;  1HXS 1;  1GNZ A;  1HB2 A;  2XXZ A;  4CP0 A;  2D98 A;  2J1S A;  4YGE A;  5KXC A;  5ABJ A;  2IVJ A;  2F6B A;  2PHF A;  2XLG A;  1D4M 1;  4MAD A;  1RC6 A;  1ZRE A;  1KXG A;  3AKP A;  3LCP A;  2WNU B;  3USU B;  3CL1 A;  4GD4 A;  4XIK A;  3K3O A;  1SAC A;  1WW5 A;  3DYP A;  3AXD A;  1EPW A;  3GHN A;  4PBO A;  4R4Z A;  3S0M A;  2VCA A;  4FAH A;  4GMP 3;  3URF A;  3BTZ A;  3LA3 A;  3HN3 A;  4RSU A;  1OI6 A;  4UI9 L;  2WZR 3;  3FLT A;  1ZBA 3;  4XUR A;  4AED A;  4CUC A;  2FDF A;  3NST A;  2P3Y A;  4QB6 A;  4AR2 A;  1VLN A;  5JSO A;  1HRV 2;  1S0G A;  2OUH A;  1RUN A;  4Z07 A;  3O1U A;  1N1S A;  3LA7 A;  4I0W B;  1NCR A;  1FX5 A;  3MIB A;  2P5B A;  1AR6 2;  4JQR A;  1ZZ7 A;  2P6H A;  3NAP C;  4XF3 A;  3ZFE C;  4QX7 A;  5F3C A;  3NV3 A;  2C24 A;  4GJY A;  1GSL A;  1TNR A;  4HZF A;  5F9T A;  1CIY A;  1NCQ A;  1DDL A;  2LAL A;  3SCF A;  2PHX A;  3CJI C;  3KD4 A;  2ZGR A;  5FZE A;  2AYH A;  3ZYR A;  1MQT A;  1ND3 B;  3O0W A;  4UFK A;  4C0B A;  1W9Y A;  5DAQ A;  1QGL A;  4XCA A;  1WLW A;  3ATG A;  4YGB A;  3CIH A;  4P08 A;  3HEI A;  5FUI A;  2VOT A;  4AI8 A;  1NLS A;  4FT8 A;  3BYW A;  2RV9 A;  3T1L A;  1HN1 A;  1NAE A;  3P1I A;  4AVT A;  1RIN A;  1XNA A;  2W2I A;  1PK6 A;  3FUO A;  4CUB A;  1S0E A;  2ZX0 A;  4GH4 C;  2G9G A;  1C1L A;  1UZV A;  3IKW A;  4E4H A;  1HJG A;  2ID4 A;  3J8F 2;  2DU1 A;  2TBV A;  4BPZ A;  1OLQ A;  3T0A A;  3AP6 A;  2W94 A;  5H9P A;  3GZU C;  1DYP A;  4N9I A;  2XH6 A;  4RA0 A;  4E27 A;  5I8T A;  5C3S A;  1OH3 A;  1YUD A;  3HD8 B;  2Q30 A;  5GZD A;  3ZFF A;  1AVB A;  4TLG A;  1Z78 A;  4EN6 B;  3ZLI A;  1J83 A;  2R1D A;  3POY A;  1KD7 A;  2BYV E;  3HR9 A;  4C8D A;  1TME 2;  2A71 A;  1AL2 1;  5FYM A;  5FWJ A;  5LK5 A;  2QCS B;  2JG8 A;  2VZP A;  4BLJ A;  5D8A C;  4KGG A;  2VO5 A;  3D0J A;  1RUJ 3;  3MPP G;  2VJX A;  5A1A A;  2CGP A;  1RUC 1;  1HRI 1;  5FPZ A;  2UY9 A;  2BNN A;  4BZ4 A;  5A6Y A;  2JEM A;  2XBO 1;  1JN2 P;  3MZH A;  3MI8 A;  1PO2 2;  1EAH 2;  3EXU A;  4KU8 A;  2ZPX A;  1AF9 A;  3FJS A;  5JZG A;  1V6N A;  4EE2 A;  3M4F A;  5EJ1 B;  3IWZ A;  4A6O A;  1C8M 2;  4IEW A;  3WDW A;  4D7S A;  3TEW A;  4XHX A;  2E33 A;  1LKN A;  1QEX A;  1W6O A;  4FTS A;  3CBN A;  3KV9 A;  3WUC A;  4ZU7 A;  1YIP A;  2GMM A;  5FZG A;  1W2A X;  3FHI B;  4YRD A;  1V6M A;  3G6J B;  3DPR C;  5FOB B;  5CKM A;  3TWI A;  1JZ3 A;  2R30 A;  1JH5 A;  3VHN A;  3B94 A;  5HV0 A;  3CKH A;  4K3U A;  1OOP C;  2WFP A;  4MGS A;  2Z4F A;  4HBN A;  2FDG A;  3P6B A;  4AQS A;  1DBN A;  2XOM A;  4QXK A;  4Q4Y 2;  3NW4 A;  3I2H A;  4CDQ C;  1HKD A;  1CZT A;  3H42 B;  2ZGO A;  3MHZ A;  4RGK A;  3CJX A;  1EP0 A;  1VBA 3;  3CNA A;  1NQD A;  2P34 A;  1CJP A;  1LHO A;  1O7F A;  4LBO A;  4OI4 A;  4AED B;  4BLI A;  4NPM A;  5F6L B;  3VBF A;  4AI1 A;  2A75 A;  5F3G A;  1QDC A;  1W8W A;  4BA6 A;  4PIZ A;  3MV1 1;  1X33 A;  2ZGN A;  4U2A A;  1BK1 A;  1H8V A;  4OFG A;  1UU4 A;  3A21 A;  2UUR A;  4UW6 A;  5FKB A;  5FXX A;  4CUA A;  1AUY A;  1QJY 1;  5FXZ A;  4AHW A;  2VCC A;  5IAX A;  1FMD 2;  1YJL A;  2NQY A;  5IHR A;  3ILN A;  4MXV A;  2VU9 A;  2Y6F A;  1WA4 A;  3VL8 A;  1DU3 D;  2ZGL A;  4H2A A;  5BNP C;  3VBR B;  1KS4 A;  3PVB B;  3WP6 A;  2E63 A;  2V5Y A;  2Q8E A;  4Y4R A;  4CCE A;  4LEJ A;  5T5L A;  3ZFG B;  2XGX A;  5F5I A;  4R9A A;  3WCS A;  1H2N A;  1ENR A;  1N3O A;  1F2N A;  1K42 A;  2WYF A;  3D8C A;  2PLV 1;  4A3Z A;  2VBB A;  1ULO A;  3Q8E A;  5L36 A;  5KHG A;  1QXR A;  2OVU A;  3FZ3 A;  3N3H A;  1PK6 B;  2C9A A;  4QDQ A;  4A42 A;  4EZ4 A;  2CGN A;  4GB3 1;  2ZEY A;  2D40 A;  3CZU A;  2Y26 A;  5HPO A;  4FPJ A;  4IEX A;  5FYC A;  5A1L A;  2Y38 A;  1LRH A;  4QU2 A;  4NII A;  2HWE 2;  4M3C E;  2XVG A;  1YYN A;  2B9U A;  3BI3 A;  4KQ7 A;  2L9L A;  1RUE 3;  1TE1 B;  4W6W A;  1W2N A;  2CU5 A;  4L92 A;  2WS9 3;  3VN4 A;  3ZYG A;  4LA3 A;  2VUC A;  3VBH A;  3K46 A;  4FPG A;  2XJQ A;  2Y6L A;  5JCT A;  1COV 2;  2AGS A;  1GZW B;  2R07 1;  2JDA A;  2VNG A;  4I0A A;  4YGC A;  2Q8D A;  2P3I A;  2R06 2;  2CNA A;  3AP4 A;  3H0O A;  3HQU A;  1H0B A;  5CYY A;  1G9F A;  3KV4 A;  5CAZ A;  4UFH A;  4W6Y A;  2ZMK A;  2EXK A;  3DYO A;  4CP9 B;  2VMD A;  3O0X A;  2ZBJ A;  3LEI A;  4YG0 A;  4YVS B;  3RJR A;  5FLH A;  3AZY A;  4QPY A;  3B7M A;  4ISR A;  4CP1 A;  1O59 A;  4QPG B;  4OI2 A;  5IFT A;  1VAK A;  4YWA A;  2AEN A;  3DXU A;  3RYP A;  4J1W A;  4AFC A;  3GJB A;  2VOX A;  4Q0U A;  4LO5 B;  3WDY A;  2HWC 1;  4Q4V 2;  4NHK A;  1W0P A;  4HOO A;  5DMY A;  4DIQ A;  3PVO A;  3JD7 3;  3C7E A;  5DUU A;  2A70 A;  3O5S A;  1O6U A;  4JV4 A;  3AKS A;  5FBZ A;  1Z7S 3;  4P5Y A;  3VUO A;  3IAP A;  1H6X A;  5LZ6 A;  2RMU 2;  1AL0 G;  5FZ7 A;  1EUT A;  3AXE A;  3PUQ A;  1JZ5 A;  1MS8 A;  1RVF 1;  2Y6J A;  1CAU B;  3ZXJ A;  2OX0 A;  2WN3 A;  4IL7 A;  4LHN A;  4AQT A;  1W9S A;  2R32 A;  4CCN A;  4UXA A;  3VLB B;  2ZGM A;  5C4W A;  4MOA A;  3VKN A;  3OGJ A;  1NA1 B;  1C1F A;  4E4S A;  3G7D A;  2W3J A;  2DVG A;  3ZMO A;  2RR1 3;  5JUV A;  2OQ6 A;  1RUG 2;  4ORF A;  1ASJ 2;  1POV 1;  3NV2 A;  1ND2 B;  3WF3 A;  4XVH A;  2RVA A;  5EFU A;  1DQ5 A;  2EVX A;  2HWF 1;  3U14 A;  2R04 3;  3DL3 A;  1W6P A;  3ACI A;  4QQL A;  3WG4 A;  5DG1 A;  4Y20 A;  5T55 A;  4DUX A;  3W5N A;  3GNE A;  3IAQ A;  1R08 1;  1IQD C;  3HN1 A;  3R4D B;  4OYU A;  1Q8S A;  1GR3 A;  4JHT A;  3K2O A;  2YG0 A;  5A7O A;  5CFD B;  2P17 A;  4LUK A;  5BNQ A;  3LDK A;  1U5Z A;  2TEP A;  3K3N A;  4MGK E;  1YCI A;  4PLN A;  1KQR A;  4B3N A;  5JOW A;  2TUN A;  4CCD A;  1BMV 2;  2QKD A;  3POI A;  2ZZJ A;  2WAO A;  2VD7 A;  2YC4 A;  3ZPY A;  2PEL A;  3C7O A;  5JOY A;  4XFC A;  2R0H A;  4JGY A;  3LQC A;  2VEC A;  2ZMN A;  1PHM A;  1U5I A;  2Y6K A;  4UW3 A;  1DGR A;  1O4T A;  1O5U A;  1NOV A;  5AVP A;  4LE4 A;  5GLU A;  2GMP A;  2OZJ A;  2ZKN A;  5DDJ 2;  3WP4 A;  4YW3 A;  1XSR A;  2ARE A;  2BVB A;  3AZZ A;  4KWJ A;  2Z5W A;  3NJY A;  5LW9 A;  4XUT A;  2X5I C;  5CG9 A;  3VZN A;  5J96 B;  1AR7 1;  2DUQ A;  2VTX J;  1W99 A;  3IB3 A;  2Q1M A;  2RS5 3;  4LBN A;  4BQ2 A;  5F7U A;  2QBX A;  1HIX A;  1GWM A;  4FVV A;  4RHV 3;  5JDB A;  1FYU A;  2HWD 2;  1KIT A;  3B69 A;  4CEY A;  4EN0 A;  2XLA A;  3S30 A;  4CCO A;  4TXW A;  5CB7 A;  3T30 A;  3UGG A;  5K4L A;  4UF0 B;  1ALY A;  1Y7B A;  2PAE A;  1J3R A;  1XYN A;  3MLL A;  2YGM A;  1JOJ A;  1TG7 A;  3SQO A;  1LEM A;  3W21 A;  5ABJ C;  1D2S A;  1OPO A;  2QQU A;  1BLZ A;  2D3R A;  1RYY A;  4M00 A;  1FNY A;  2WR9 A;  3U4X A;  4R9C A;  1AR8 3;  4EWD A;  5LAS A;  2BBA A;  1S0C A;  2DCY A;  2G19 A;  2W95 A;  1W3X A;  4EV0 A;  3BTY A;  1EV1 2;  3OBZ A;  4LHK A;  4OLL A;  2HEV F;  1PVC 2;  4PLM A;  3W20 A;  1G6N A;  5J37 A;  4HK8 A;  4XFI A;  1QJZ A;  4AEM A;  1JOD A;  3X29 B;  1Q5O A;  2OKX A;  1Y43 B;  1H4G A;  3RVH A;  3WNO A;  2Y6H A;  3I2J A;  1SMV A;  2PA7 A;  2DVA A;  1OKQ A;  2JWP A;  3DGT A;  3GCX A;  4LJH A;  4RQP C;  2K0G A;  4QHB A;  3T09 A;  3I59 A;  3IZO A;  3PME A;  5JR2 A;  3CO2 A;  1BEV 1;  2XR4 A;  3UJO A;  4HPK A;  1FXZ A;  4TYS A;  5FY9 A;  3TOJ A;  4NHL A;  3T2P A;  1PZ7 A;  1RUD 2;  3PU3 A;  5CFC B;  2HBU A;  1QXP A;  3AVR A;  1PO1 2;  2HYK A;  2OA2 A;  2VQA A;  4NRP A;  1NCQ C;  4AFD A;  2E6V A;  2G4I A;  2E32 A;  1OF4 A;  1MQT C;  4CCJ A;  5FO9 B;  4LHS A;  1MVE A;  1NY7 1;  3L9J T;  1MAC A;  4PQ9 A;  3NAP A;  2HWB 3;  2B39 A;  3KT4 A;  5F2S A;  5IAT A;  5FZL A;  1MZ5 A;  5IK5 A;  4QPW A;  2QNK A;  4DNY A;  3V0A A;  1BXH A;  3ZXK A;  4AEK A;  4QGM A;  1CR7 A;  5C8C B;  1OLR A;  4KBB A;  4AOC A;  4GXL A;  3R6S A;  1F9K A;  3H50 A;  3KQ4 B;  3PUH A;  5D21 A;  2J1U A;  3HQR A;  2D93 A;  4NN0 A;  2WA3 A;  4E8C A;  1LOG A;  1FPN 2;  2UWB A;  4OQ9 A;  1RUE 2;  3WCR A;  3GZA A;  1RXG A;  2FBE A;  2YPD A;  4FQ4 A;  5C71 A;  3QD6 A;  4P9W A;  1HXS 3;  3VV1 A;  5FZ3 A;  5A3N A;  3J7M A;  1O91 A;  4Q4X 1;  2SLI A;  2WNV B;  3IDE A;  3BOP A;  3LD8 A;  4GH4 A;  1D4M 3;  1TMF 2;  2XB6 C;  3C7F A;  4BCU A;  2ZX4 A;  3IMN A;  5LRR A;  5C70 A;  4FO9 A;  3FWE A;  4A45 A;  5FPA A;  2OS2 A;  4XJU A;  3FBY A;  5F8P A;  3U1X A;  5HCA A;  1QHD A;  1KS5 A;  3WX5 A;  3B00 A;  1PMH X;  5CIR A;  1STM A;  4LO6 B;  2XLF A;  2WAB A;  4NRQ A;  3MIH A;  2VL4 A;  2O8Q A;  3BU7 A;  2K2S A;  2RJL A;  2VMC A;  2K9Z A;  1JBC A;  1W2T A;  3FHA A;  2D3P A;  3GGL A;  4M01 A;  5A33 B;  5D8A A;  5LEJ A;  4Q27 A;  3R4S A;  1WLD A;  4FFG A;  1OD3 A;  3UES A;  2EA7 A;  3JD7 2;  1QXJ A;  3EO6 A;  4JZR A;  2DCJ A;  5FUP A;  1K5M B;  4IV3 B;  5GJ6 A;  5IT6 A;  2FMY A;  4NOT A;  2PHR A;  3RYR A;  1W2O A;  4K40 A;  2X05 A;  3HMY A;  3WNX A;  2R1B A;  4M0H A;  2ZGQ A;  4I2O A;  2FZ1 A;  4QPI C;  2Z2S B;  4BQ5 A;  1SLB A;  3TBD A;  5CKQ A;  3WW2 A;  4MSV A;  4TN7 A;  4YZ1 A;  3IDC B;  5ANQ A;  4B8E A;  1OHF A;  3WDT A;  4CU7 A;  2CWM A;  3DPR A;  2TNF A;  3S7E A;  3WF4 A;  4CDU B;  1DQ0 A;  4LOT A;  2BOI A;  2WZE A;  2WKK A;  3F95 A;  1VBE 1;  3VHR A;  2XUE A;  2R04 2;  1OOP A;  5LA9 A;  3THC A;  1GZ9 A;  3VKO A;  2RM2 2;  3AMH A;  4IGP A;  3OD0 A;  4QXC A;  3H7J A;  4FAG A;  1XXN A;  3KVB A;  4GUL A;  2D7F A;  1WLT A;  5ACA 2;  1VBD 1;  3OPZ A;  1LEN A;  4J1X A;  2VW1 A;  4JKL A;  3I59 B;  2Q4S A;  5JMO A;  2WAA A;  4F8A A;  1VBC 1;  3POW A;  2MHF A;  1K12 A;  2QDR A;  4K21 A;  5LWB A;  1UY0 A;  1QQP 1;  3GXU A;  3IIA A;  5F5Q A;  1LGN A;  3HNM A;  3OBR A;  2GNT A;  4NHM A;  4IXL A;  1D0G A;  3BOD A;  3IN9 A;  3M70 A;  3MUZ 1;  2CDP A;  3SEP A;  2XKO A;  1RUC 3;  1HRI 3;  2XDV A;  3H1W A;  4YNI A;  2NMN A;  4XUQ A;  1NZI A;  4YLZ A;  5C3O A;  2XBO 3;  4HET A;  3ZFE B;  1V9U 2;  5CIS A;  3T2O A;  3OB8 A;  1YFW A;  2VM9 A;  4PIX A;  5DAB A;  2DV9 A;  4WV8 A;  5KHJ A;  4GMP 0;  2RS5 2;  3RFR A;  3CJI B;  1UIK A;  2GAU A;  2MPF A;  2VZU A;  3E5U A;  5FFO C;  3R0R A;  5E6H A;  1DHK B;  4A7K A;  2JJ6 A;  4GQ7 A;  3H9A A;  3T2T A;  5BNP A;  3QBQ A;  1OQE A;  1YFY A;  2EXH A;  3ELN A;  1DGW A;  3EHK A;  4HN1 A;  4N9H A;  3WQB A;  1F5J A;  2VXJ A;  3SH5 A;  3KS7 A;  3M3C A;  2QQM A;  2IXC A;  2VGD A;  3WLU A;  1RUI 1;  2Y8K A;  5I0T A;  3CDZ B;  2VZ3 A;  5FJK A;  2RS1 1;  4E2Q A;  3OUH A;  1FOD 2;  3POE A;  4HXC A;  3HBK A;  1VAV A;  4GH4 B;  5T5J A;  4OHY A;  1WMD A;  4A2U A;  1K45 A;  4FP3 A;  2VOK A;  4S2D A;  1HB3 A;  3OYW A;  4P00 B;  5F32 A;  2IXJ A;  4MUV A;  2IVI B;  2J22 A;  4W65 A;  1ST8 A;  3WW4 A;  1SG3 A;  3UGH A;  1SLT A;  3WP3 A;  5BYN A;  2RS3 1;  4AXO A;  3GBG A;  5J7M A;  4JQT A;  1X9P A;  1YC6 1;  2DWR A;  2YC2 A;  3AJZ A;  5I0R A;  1CAX B;  1WBF A;  3PJQ A;  3PLQ A;  1APN A;  5LY2 A;  4B7E A;  2QVS B;  4N90 A;  2O0O A;  1CD3 G;  3NWK A;  4YW1 A;  3N4M A;  4PQQ A;  3USS A;  1LTE A;  4QX5 A;  1UU5 A;  2W92 A;  3FLR A;  4LKD A;  5A32 A;  3KHB A;  5GLW A;  4I01 A;  3RZK A;  1GP6 A;  4IEO A;  4XYX A;  4IW3 A;  1QJY 3;  5APA A;  2DTW A;  3C3V A;  1SPP A;  3CU7 A;  4IEQ A;  4G3Y C;  2Q8C A;  1QNY A;  3JXS A;  1XRU A;  2BQP A;  2JIC A;  3M3I A;  3O0V A;  2BNO A;  5FYI A;  1BBT 1;  3POF A;  4DEQ A;  1PVX A;  5LA2 A;  5LCW L;  3LFI A;  4YAR A;  2WYS A;  4RHV 1;  1ZNP A;  4JGZ C;  3MLK A;  3BPS A;  1NE6 A;  3CZJ A;  5FO8 B;  4MHU A;  4QHO A;  5T5P A;  1UNB A;  4CEW A;  1AR9 2;  2PLV 3;  3FBM A;  4Y33 A;  3WQ7 A;  1O3Q A;  1ZRF A;  1JYT A;  3AFK A;  3OTF A;  4NAM A;  4FPL A;  1PIV 1;  3N36 A;  4GB3 3;  4YGD A;  1YEW A;  4BQ1 A;  3OPT A;  3POJ A;  5FV3 A;  3ZDS A;  3NJX A;  4IEY A;  1W6Q A;  1WCS A;  3OGR A;  5J98 B;  4BIO A;  4IE0 A;  1UZ0 A;  2NP0 A;  4S2F A;  5L7O B;  3IPV B;  3UL2 A;  1ULD A;  1M4W A;  3WW1 A;  5KC6 A;  4CDQ B;  2AEZ A;  4XJ8 A;  4YW7 A;  3O1R A;  2A5Z A;  2XVK A;  2OT7 A;  1W6N A;  5EHD A;  4RGG A;  1KFU L;  5LBB A;  2PHW A;  4PF1 A;  1XBF A;  1W2U A;  1X82 A;  2R07 3;  1WWY A;  2VMH A;  4CDX B;  1BQP A;  1MZF A;  3CEW A;  5FY5 A;  4KH9 A;  2E7A A;  1TQ5 A;  1AYN 2;  3ZXF A;  5C8W A;  4Q4W 2;  2W5F A;  1KFX L;  4R9D A;  4ES8 A;  3OD4 A;  4GZ9 A;  4A44 A;  2GC2 A;  1ZZC A;  3FFQ A;  4HL0 A;  4YZ2 A;  2RDQ A;  4YVW B;  5JVV A;  1G7Y A;  4HK9 A;  1DLC A;  3LA2 A;  2BRT A;  2DVD A;  2XJT A;  4FFI A;  1DLL A;  1IQA A;  2VPV A;  2YU1 A;  1NKG A;  4M3C F;  2AUY A;  3WDV A;  3BTA A;  4ZON A;  3QH6 A;  3AZV A;  2VY0 A;  1LOE A;  5FZM A;  5I0D A;  1RUF 1;  2IFW A;  3JUU A;  3N7M A;  3FMG A;  2HWC 3;  4WBB A;  1GV9 A;  5GZE A;  2E9Q A;  5AC9 2;  2J7M A;  3QAC A;  4FI9 A;  2Q1F A;  4GAL A;  4GWN A;  1HB1 A;  5TSW A;  4MXW B;  3WF1 A;  4A7Z A;  3THD A;  4OCT A;  1RVF 3;  1IPK A;  5C9A C;  4TTG A;  1IS6 A;  1LGB A;  5G05 L;  4P5H A;  3UGF A;  2C26 A;  4WM7 C;  5IVB A;  5D2A A;  2PN5 A;  4NIG A;  4ISQ A;  2WFF 2;  4XFB A;  3OYW B;  2VZR A;  1JMU B;  1GIC A;  5LBC A;  1W0O A;  4QQP A;  2WT0 A;  1MR5 A;  2ZA9 A;  1S55 A;  1DG6 A;  2MEV 1;  2RE9 A;  4NMI A;  4DY5 A;  1BHG A;  1POV 3;  3M8L A;  4RR3 C;  3VDD C;  3MFA A;  3ZN5 A;  5FR3 A;  2CY6 A;  1ZZB A;  2HWF 3;  1JU4 A;  2Z79 A;  4HVO A;  5KC5 A;  1UAI A;  4L9B A;  1UOG A;  1HW5 A;  4Q8K A;  2WRA A;  1R08 3;  4KMQ A;  3W59 A;  3ZOI A;  1GWK A;  1VBB 2;  2RJK A;  3LIH A;  4YFZ A;  4OI1 A;  1VRH 2;  2ARC A;  5CKN A;  1AX1 A;  5LEK A;  1I9R A;  3EMR A;  2A6W A;  5FZC A;  1AL2 2;  1OQ1 A;  4I0B A;  5A32 B;  4DFS A;  2OPK A;  3I49 A;  4AFM A;  2YY1 A;  3SH3 A;  1X50 A;  2NPI A;  5J1X A;  4OI0 A;  5IVV A;  1RUC 2;  1Y9G A;  4RQP A;  3SH4 A;  1RHI 1;  4CDW B;  3M3E A;  3UKN A;  5KBF A;  2JKB A;  2RJ2 A;  4LKS A;  3BVC A;  1RMU 1;  4NUB A;  5E1R A;  1JHJ A;  1QU0 A;  3WT3 A;  2P4E A;  1JS9 A;  2W1W A;  4S2G A;  1LU2 A;  1S0D A;  4XJ9 A;  4XQD A;  3H1Y A;  4XE9 A;  3LGR A;  4FBF A;  4P9J A;  4NJ4 A;  4P9G A;  1R1A 1;  4XDP A;  3WSO A;  2YPJ A;  3WG2 A;  1AR7 3;  2W0X A;  4I30 A;  1JYW A;  1GQG A;  4DXT A;  1O8P A;  1W9F A;  3VBS C;  1CAV B;  1WUV A;  3AYA A;  4Q0S A;  2D97 A;  3KSC A;  2W1S A;  2WZ8 A;  3ACG A;  5A6X A;  4XDO A;  1GKB A;  3WP5 A;  5DZG A;  1YQ8 A;  2JIJ A;  2H6C A;  3ZSE A;  1ODN A;  3DEC A;  2J42 A;  3H3U A;  4Y5S A;  2BOJ A;  2DUR A;  4L11 A;  4X8N A;  3A0K A;  5GZF A;  5C3P A;  4NIH A;  5BNN B;  1RGS A;  4L97 A;  4WVW A;  1EPZ A;  2CAU A;  5DAX A;  3K4Z A;  3PUA A;  3POB A;  2NN8 A;  1XPW A;  2DCK A;  2IFR A;  2WNO A;  3DUI A;  3QH7 A;  4LHL A;  3NQH A;  4QQO A;  1JYX A;  3TN9 1;  1FV3 A;  4UBH A;  4KI5 M;  2YBP A;  3RMY A;  4XW3 A;  2IXI A;  5A7W B;  4K1Y A;  1ACC A;  1W9T A;  3D6E A;  1IPS A;  5JOZ A;  4LK6 A;  4FPE A;  4TLF A;  5FP9 A;  1GBG A;  4N43 B;  4QQ2 A;  3OY8 B;  2FDJ A;  1UY4 A;  4Q2F A;  2D6N A;  1QJY 2;  1BEV 3;  2P3J A;  4EN7 B;  1W8H A;  1YWK A;  4AQ2 A;  4CE8 A;  1OLM A;  3NJZ A;  3VB9 A;  3WNN A;  4BK5 A;  1JYC A;  1EYB A;  2J1A A;  3J7L A;  3KT1 A;  2JDU A;  4Q26 A;  4PIY A;  4Z2W A;  5C3R A;  3V0B B;  3RI8 A;  4LT5 A;  5A7S A;  2BJS A;  1D7P M;  4O61 A;  4Y1Y A;  1RUH 2;  5L9R A;  1GNY A;  1H1I A;  2X5I B;  4XBL A;  1GZC A;  1JHN A;  1UYZ A;  3HAG A;  4O7X A;  4YW2 A;  2ARA A;  2D6P A;  4HKW A;  2ZGU A;  5EJZ B;  1UL9 A;  3T4V A;  4COV A;  5A70 A;  2C0Z A;  3EBR A;  5DAV A;  2AZ5 A;  1IGO A;  3VD5 A;  5ANN A;  4MG2 A;  3C7H A;  5CVR A;  3HPN A;  1ENS A;  4QPI A;  2YGL A;  5ABJ B;  1OXC A;  1AR6 1;  3HT2 A;  5FMD A;  1NX9 A;  2QQO A;  1OA4 A;  4JDM A;  4Q4X 3;  2JE9 A;  2C1F A;  4QGL A;  2OW4 A;  4Z92 B;  3ZMN A;  1GUI A;  5FP8 A;  3KZ4 C;  1VR3 A;  5T3N A;  3ZIW A;  1MEC 2;  5EWS A;  1F4A A;  5LBF A;  1UQX A;  3AYC A;  2D5F A;  4XAA A;  3T2Q A;  5I0S A;  2JE7 A;  4E8D A;  1MS3 A;  3UT0 A;  1YHF A;  1N3Q A;  4RD7 A;  1UPS A;  1YQ5 A;  3QCW A;  2EAL A;  1NG0 A;  4GJZ A;  1NCR B;  1ZBE 1;  2DFC A;  2FCT A;  1I3H A;  2W9X A;  5BNO A;  5EV7 A;  4MGT A;  5A3W A;  2VC9 A;  4COU A;  5JR7 B;  1OA2 A;  2UWA A;  3I3Q A;  1UY2 A;  3J8F 1;  4OHV A;  2WO7 A;  2EIG A;  3PVN A;  5FXW A;  3LZZ A;  1NCQ B;  1UMI A;  2YV8 A;  1UOF A;  3VD9 A;  3J4U H;  1MQT B;  4GKX A;  2D3S A;  1QMJ A;  3AYD A;  4LMF A;  2D6O X;  3N9M A;  2GSY A;  2BP6 A;  4ZS2 A;  1YQ6 A;  1E5R A;  3SHR A;  2V4A A;  2IC1 A;  2C9K A;  3AP5 A;  1CAW A;  1MS4 A;  2BW8 A;  3OEA A;  1WCU A;  3NNG A;  5FZ9 A;  1J84 A;  3H8R A;  3WHU A;  4XQW A;  1QY4 A;  1ODM A;  2BZD A;  1YLL A;  4QX3 A;  4XFH A;  4WVM A;  2BGC A;  1UD1 A;  1QJX 3;  1W8N A;  3MDP A;  4Q0Q A;  4GWM A;  2VQ0 A;  2Y6G A;  4IV1 A;  5EQU A;  1H9P A;  2Y64 A;  2HEY F;  1PO2 1;  4JAA A;  1VBE 3;  4ZXE A;  2CWS A;  3UK9 A;  1QJU 1;  5HBA A;  3GM8 A;  2XUM A;  5FP7 A;  5FZO A;  5I8Y A;  3RPQ A;  4ZZ5 A;  3ZFF B;  1C8M 1;  2WWU A;  3UV9 A;  3MW4 A;  1QF3 A;  1C5H A;  1GOG A;  1VBD 3;  3O12 A;  4QB1 A;  4Z82 A;  3NL1 A;  2WZR 2;  5LB6 A;  1ZBA 2;  2JG8 B;  4XZU G;  5F37 A;  3FC0 A;  1VBC 3;  1JYV A;  5H9Q A;  3H1M A;  1QQP 3;  1SBD A;  4Q0P A;  2H0B A;  3ZO0 B;  2W91 A;  1NZC A;  4AYU A;  4CUG A;  1UYX A;  5JZG B;  1S0J A;  2VME A;  1CVN A;  2WDB A;  4Q4Y 1;  2B42 B;  3LAG A;  4AAP A;  2WNU C;  3JQW A;  1GOF A;  4XBN A;  1BK0 A;  5E16 A;  1W28 A;  1JUI A;  5K8S A;  1W6O B;  4I09 A;  5JXG A;  4C0H A;  2B4K A;  2LRO A;  1ULE A;  1N3P A;  5GAL A;  1ULP A;  1NYW A;  2B9V A;  4CEW C;  4CDX C;  3O1V A;  1UXX X;  2YYO A;  3SXW A;  1S4C A;  2X10 A;  4M4R A;  3J9S A;  4D7T A;  3WD5 A;  3FX3 A;  5A7P A;  2BNM A;  4BOW A;  3VZK A;  1WCD J;  3I3M A;  3P5B A;  1L3J A;  2GAL A;  4LR4 A;  3MO4 A;  4JGZ A;  1LOF C;  4P14 A;  4AVS A;  1QDO A;  1SLI A;  1RUI 3;  3FN9 A;  1LU1 A;  4ITC A;  2YU2 A;  1XC6 A;  1OUX A;  2RS1 3;  4AVC A;  4FPO B;  1FMD 1;  5BPX A;  1FV2 A;  2BEO A;  1XND A;  1OQD A;  1PM4 A;  1UF2 C;  1AXZ A;  1H2K A;  5FZ4 A;  1DZT A;  5FZK A;  4CCL A;  4SLI A;  1IS5 A;  2R6Q A;  3VBF B;  4OHZ A;  3UET A;  2JEN A;  3I2K A;  4Y26 A;  5CG8 A;  2IUW A;  1DYK A;  1HX6 A;  1W06 A;  2XQR A;  4QAW A;  4CPB D;  4H7M A;  1PGW 2;  4IDZ A;  2RS3 3;  4ZXK A;  2CSG A;  1J58 A;  2Y0I A;  1AXK A;  2D44 A;  1ZYB A;  2LM3 A;  3JBG 1;  2LRP A;  2DUP A;  3E6B A;  1IS3 A;  4XFA A;  5GKA C;  3WG1 A;  4RS5 A;  2A6Z A;  2JG9 C;  4JKM A;  4BXS V;  1BEV 2;  1RUJ 2;  1S2B A;  1XQN A;  2UWC A;  5L19 A;  5FBJ A;  3ZYJ B;  4Y24 A;  1SZB A;  3NNM A;  4B4P A;  5EZW A;  3VDA A;  3ROU A;  2HWE 1;  4BDV B;  1E5H A;  2ZAB A;  2VZQ A;  4UYB A;  2QFE A;  1FAY A;  3Q9O A;  4AG4 A;  1CZS A;  1F8V A;  2A3W A;  1LNS A;  3I2O A;  1RB8 G;  1AYM 3;  4HSL A;  3POS A;  3OBA A;  1COV 1;  1CAW B;  2F4P A;  2HYX A;  3BIW E;  2NZ9 A;  2R06 1;  1BBT 3;  4XCB A;  2CTV A;  4QKF A;  3JZV A;  4PI2 A;  4OZX A;  3V64 A;  5FQ0 A;  1I6X A;  1VE0 A;  4PT6 A;  4QDS A;  5C33 A;  2EAK A;  3AKT A;  1S2K A;  5BV6 A;  5DG2 A;  1VMF A;  3L2Y A;  3RWK X;  4WVM B;  1JI6 A;  2AH2 A;  4N53 C;  3MPB A;  3SEE A;  4ARX A;  3OJB A;  1DP0 A;  3WNL A;  5DZE A;  1LHN A;  1WD3 A;  2LS6 A;  1FNZ A;  1T2X A;  4K7J A;  4M3C A;  3ITQ A;  4D6R A;  3E97 A;  3INA A;  1PIV 3;  3LIG A;  4ATE A;  4OMC A;  5C9A A;  2DF7 A;  4LLO A;  3O1T A;  1LUL A;  4LOR A;  2JE8 A;  4WM7 A;  4AHX A;  1AHS A;  4QDR A;  3VBH B;  2JIG A;  4Y1U A;  3VZL A;  4JTN A;  4AVA A;  2LTN A;  2ZHL A;  1O3S A;  1XE0 A;  1U0A A;  3AMN A;  4XDQ A;  4Q4V 1;  3FE5 A;  1VBA 2;  4SBV A;  5HV4 A;  3B9I A;  2WA4 A;  4EN8 B;  2HH9 A;  3VBU A;  2GND A;  5HXM A;  1E5S A;  4LNV A;  4RR3 A;  3VDD A;  5BY5 A;  2XPJ A;  2RMU 1;  4YW5 A;  5FPU A;  4B1L A;  4NWW A;  5I93 A;  3PNA A;  3MUY 1;  2VQT A;  1UW8 A;  3VGI A;  3ZM8 A;  2N7G A;  2GU9 A;  2VVE A;  3OPW A;  4NHX A;  4ERO A;  2JDK A;  3AKR A;  4NIA A;  3BAL A;  4M0N A;  3S6P A;  4AI0 A;  1GNH A;  4FCA A;  1RUG 1;  2ET1 A;  1ASJ 1;  5FYB A;  4FPC A;  1FI2 A;  1URX A;  4UBG A;  1D0H A;  4AI3 A;  2FD8 A;  5FPL A;  3C8X A;  2DU0 A;  2OPW A;  1R09 3;  1C3H A;  1PZ9 A;  4L0P A;  4BME A;  4AGV A;  2A6X A;  1J1T A;  4FOQ A;  2ET7 A;  4XUN A;  1JZ2 A;  1RUF 3;  3M7A A;  4XOG A;  1DQ4 A;  1YIF A;  3AP9 A;  2R49 A;  2X53 S;  5FZ0 A;  2EXJ A;  3N9Q A;  1SDD B;  3C7G A;  3KT7 A;  2VBP A;  3MLJ A;  4OVE A;  2FDK A;  4Z2A A;  5C4W B;  1CON A;  3MID A;  5K0U C;  3BB6 A;  3EJK A;  1REF A;  3DKQ A;  2ADE A;  1PM7 A;  3S7I A;  3O14 A;  1QH6 A;  3R4U A;  3VBS A;  3ZYH A;  5IUQ A;  2Y0O A;  3PUI A;  2WQ4 A;  4H55 A;  1W6P B;  2WS9 2;  5DDJ 1;  3RMX A;  3U10 A;  4Y20 B;  2ILM A;  2ZAH A;  2MEV 3;  4IQP A;  5A3U A;  5KWR A;  3VBR C;  1I1E A;  4UWD A;  1HQN A;  1UZW A;  2W39 A;  1W8Z A;  3PL0 A;  5FZA A;  3UKV A;  3ZFG C;  3PUR A;  4ASK A;  4IEP A;  3ZR5 A;  2WIN B;  4LUM A;  5FPB A;  1DGR N;  1UKR A;  3MW3 A;  1H8T A;  1O8S A;  4COW A;  3FFZ A;  1Q8V A;  3RZZ A;  2BU9 A;  3NNJ A;  2HWD 1;  3SCH A;  3ZKY A;  4LO4 B;  3HNY M;  4L99 A;  5M0T A;  1GYK A;  1VJ2 A;  2EID A;  1QQP 2;  3WQ0 A;  2PHT A;  2XVL A;  2V09 A;  1PX3 A;  1RL3 A;  4LIV A;  4JGY B;  2ZGS A;  4GKY A;  4QU1 A;  2VR4 A;  3KVA A;  5J48 A;  2B7Y A;  2YC0 A;  3U0Z A;  2RHP A;  1X9T A;  1XSQ A;  1XNC A;  4D3W A;  4AL9 A;  1A34 A;  1RHI 3;  4BWO A;  2YB7 A;  3U4S A;  3D82 A;  4KL1 A;  1LOD A;  2X09 A;  5E89 A;  3SNM A;  1DF0 A;  1RMU 3;  1CWP A;  1EV1 1;  2VUL A;  3OUJ A;  5GLZ A;  1O3T A;  5DXD A;  3AL5 A;  2V73 A;  4H14 A;  5BXX A;  1D2Q A;  2WLP A;  1PVC 1;  5FQ0 B;  4DEV A;  5C5U A;  1G9C A;  1UOJ A;  2BGP A;  1Z7S 2;  1B35 C;  5F6K A;  1IKQ A;  1R1A 3;  4PF5 A;  5IJR A;  4CEY B;  5I8S A;  1QJE A;  1NLQ A;  5FMC A;  4BHP A;  1B09 A;  2DYC A;  4M3C B;  5EP9 A;  3SLI A;  4AW7 A;  2QQW A;  1WCK A;  1DQ2 A;  4BIS A;  1RUI 2;  2IWG B;  2DBN A;  3NV4 A;  2FHR A;  2PMW B;  1WCQ A;  4E2S A;  4MV2 A;  2RR1 2;  4V2V A;  4QPG C;  1HB4 A;  1QJX 1;  1H4H A;  1RUD 1;  1ULC A;  1PNF A;  1BYH A;  1UYY A;  4Y1X A;  1MS5 A;  1PO1 1;  2H6B A;  2UU8 A;  2YDE A;  3KV6 A;  4D0Q A;  2UYB A;  4K20 A;  4KWU A;  1CJD A;  1DGW X;  2E7Q A;  4PBP A;  4YFW A;  4NHY A;  5FY0 A;  3VDD B;  3M3Q A;  3VD3 A;  1SLC A;  1C57 A;  4OUS A;  3GYD A;  1I5Z A;  2RS3 2;  4D69 A;  1J3Q A;  1DFQ A;  2VBD A;  3WF2 A;  3TN9 3;  1YNA A;  2EIB A;  2SBA A;  2B5H A;  2D6L X;  4DXZ A;  3Q8B A;  4DQA A;  5L9B A;  2GH8 A;  2YFZ A;  1UIJ A;  5FYT A;  4LKE A;  1MZE A;  3IDB B;  4XQ4 A;  4AVB A;  2BER A;  5BNO C;  4HPK B;  3SMH A;  4FFF A;  1NA1 C;  3HBZ A;  1QOO A;  1PGL 1;  1JOP A;  1QJF A;  1RUO A;  4A6S A;  5IVJ A;  1FPN 1;  2A7A A;  4IEU A;  5FY7 A;  1QOT A;  2GH2 A;  5T5O A;  2F17 A;  1MVQ A;  3I2G A;  2GN3 A;  1ND2 C;  2E31 A;  4QHZ A;  3MEP A;  3KGL A;  1W8F A;  1WA6 X;  3WY6 A;  3NAP B;  1TMF 1;  2KXL A;  4XFF A;  4YYO A;  1ONA A;  3PHM A;  2XHN A;  2VNO A;  3V0A B;  3WVJ A;  1JXN A;  3GZT B;  2JDM A;  1TEI A;  2KD7 A;  3PIJ A;  4EJR A;  3C2U A;  2I45 A;  4KG0 A;  3PTR B;  4RHV 2;  3MIE A;  4CXW A;  2ZKL A;  5FY1 A;  3LDR A;  5FYY A;  3GAL A;  4B1M A;  3AFG A;  1KDK A;  5EXO A;  5FYH A;  1J59 A;  4E2G A;  3KCC A;  2JXA A;  3T0D A;  1BJQ A;  5DUV A;  1CES A;  1Y9Q A;  2QUO A;  1V6J A;  4QQH A;  2XJS A;  3PTY A;  4MGZ E;  1S1A A;  1HRV 3;  3ORJ A;  2I07 B;  4IV1 C;  5DN2 A;  3OCP A;  1U5Y A;  4DS0 A;  3V65 A;  3OGV A;  1AR8 2;  2VQU A;  4DRR A;  2GNM A;  3GDB A;  1H1A A;  2YMZ A;  1AR6 3;  1UX6 A;  4P02 B;  5KR7 A;  2DCT A;  3K4A A;  2W68 A;  4HSJ A;  2OXB A;  5GLT A;  2ADD A;  2VMG A;  1VMH A;  1DZR A;  1HQW A;  1NT0 A;  2ETE A;  4FPF A;  4MHR A;  5A3M A;  1ZRD A;  3ZYP A;  5C6C A;  3WV6 A;  1VAL A;  1LES A;  2GP5 A;  3H3Z A;  4XAC A;  1G9D A;  2UYA A;  1K5J A;  2VZO A;  2XWB B;  4NPR A;  1W8T A;  4LBQ D;  3WNM A;  3ZYF A;  4MYE A;  5J09 A;  3K75 B;  2D5H A;  4XHB A;  1W05 A;  4MZU A;  1S2E A;  1UMZ A;  4CCC A;  4RGA A;  1GOH A;  1GP4 A;  1OMI A;  2GC1 A;  2GZW A;  3OSD A;  4IGO A;  3I8T A;  1PX4 A;  4OMD A;  4XF0 A;  3HIF A;  2WNE A;  5D8A B;  5B4N A;  1BZW A;  1ZBE 3;  3RRD A;  2WO1 A;  1O3R A;  1HV0 A;  4E9K A;  2ZGP A;  2GNB A;  3KF3 A;  2G9F A;  2RM2 1;  3ME2 A;  1OKO A;  4YZ5 A;  3J8F 3;  4KWL A;  4YM3 A;  1AYM 1;  1YQ2 A;  3VKM A;  2HWB 2;  3D3A A;  3J7H A;  5ACA 1;  3USU A;  4Q8L A;  2WNU A;  1MPX A; 
#chains in the Genus database with same CATH homology
 2YBS A;  1VRB A;  4D6R A;  5FZD A;  3PUA A;  4BIS A;  5LWB A;  5FY5 A;  5FYS A;  3AL6 A;  3DXU A;  3N9P A;  5FY9 A;  5A3T A;  5IVE A;  3DXT A;  3PU3 A;  5F39 A;  5FP7 A;  4V2V A;  5FZO A;  2YBP A;  5IVF A;  2WWU A;  3AVR A;  4HOO A;  4IGQ A;  5A7W B;  4DIQ A;  3KV9 A;  5FY8 A;  5FP3 A;  5FZG A;  5F3I A;  3KV6 A;  5FP9 A;  5FPV A;  5CEH A;  5IVC A;  4LIT A;  2XDV A;  5FY0 A;  4CCJ A;  5FZI A;  5FZ7 A;  3PUQ A;  4URA A;  5F2S A;  5F37 A;  5FZL A;  2OX0 A;  4CCN A;  5FZ1 A;  5FPU A;  2XXZ A;  2YU1 A;  4D6Q A;  5FZM A;  5IVY A;  5E6H A;  5FYU A;  4CUG A;  3OPW A;  4GD4 A;  5FYT A;  2OQ6 A;  2PXJ A;  3K3O A;  5A7S A;  4V2W A;  3ZPO A;  4AAP A;  4LXL A;  5FZO B;  4EZH A;  2YPD A;  5FYB A;  4Y3O A;  5IVJ A;  5FY7 A;  5FZF A;  4QXB A;  5FJK A;  5FZ3 A;  5FZ8 A;  5FP4 A;  5F3G A;  5FPL A;  5A3N A;  4GAZ A;  5IVB A;  3LD8 A;  3K2O A;  5A7O A;  2YBK A;  4CCK A;  3PUS A;  5F5A A;  5FZ0 A;  5F5C A;  5F32 A;  5A7P A;  3K3N A;  4HON A;  5FXV A;  3N9Q A;  5FJH A;  5FXX A;  2P5B A;  5FPA A;  2OS2 A;  3PTR B;  2XML A;  5FXZ A;  2VD7 A;  4QX7 A;  4UF0 A;  5A3P A;  5F3C A;  5FY1 A;  4GJY A;  5FYY A;  3AVS A;  2YU2 A;  5FYH A;  3UYJ A;  5LY2 A;  5FZE A;  4BU2 A;  5FYV A;  5FZ4 A;  5FP8 A;  4CCL A;  5FZK A;  2Q8E A;  3PU8 A;  4Y4R A;  5FZC A;  5F5I A;  3NJY A;  5LW9 A;  4QWN A;  5FZB A;  5FZA A;  5IVV A;  5KR7 A;  2GP3 A;  3PUR A;  4ASK A;  4CSW A;  2W2I A;  4GJZ A;  5FUP A;  5FPB A;  2Q8C A;  4DO0 A;  4EZ4 A;  3N9N A;  4NUB A;  5FZH A;  5A80 A;  5FYI A;  4E4H A;  2GP5 A;  4BXF A;  4CCO A;  5FYC A;  5A3W A;  3U78 A;  5A1L A;  5FBJ A;  4UF0 B;  5K4L A;  4EYU A;  5ISL A;  4LIV A;  5FXW A;  4CCM A;  4QU1 A;  5F2W A;  3PDQ A;  3KVA A;  2OT7 A;  4LIU A;  4XDP A;  3N9O A;  4TN7 A;  5FWE A;  5ANQ A;  4Y33 A;  5A7Q A;  5FZ6 A;  4QX8 A;  4IGO A;  3N9M A;  5IWF A;  5FYZ A;  5A7W A;  2Q8D A;  3U4S A;  3ZLI A;  3KV5 A;  4C8D A;  2XUE A;  3OPT A;  5FV3 A;  3KV4 A;  5FYM A;  4D6S A;  4XDO A;  5FWJ A;  5FZ9 A;  4IGP A;  3AL5 A;  5LY1 A;  4QXC A;  3LDB A;  3N9L A;  5IW0 A;  3RVH A;  5A1F A;  3KVB A;  5F3E A;  4QXH A;  2OQ7 A;  5FY4 A;  5A7N A;  2WWJ A;  4AI9 A;  5FUN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...