2OX0A

Crystal structure of jmjd2a complexed with histone h3 peptide dimethylated at lys9
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
349
structure length
349
Chain Sequence
TLNPSARIMTFYPTMEEFRNFSRYIAYIESQGAHRAGLAKVVPPKEWKPRASYDDIDDLVIPAPIQQLVTGQSGLFTQYNIQKKAMTVREFRKIANSDKYCTPRYSEFEELERKYWKNLTFNPPIYGADVNGTLYEKHVDEWNIGRLRTILDLVEKESGITIEGVNTPYLYFGMWKTSFAWHTEDMDLYSINYLHFGEPKSWYSVPPEHGKRLERLAKGFFPGSAQSCEAFLRHKMTLISPLMLKKYGIPFDKVTQEAGEFMITFPYGYHAGFNHGFNCAESTNFATRRWIEYGKQAVLCSCRKDMVKISMDVFVRKFQPERYKLWKAGKDNTVIDHTLPTPEAAEFLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of histone demethylase JMJD2A reveal basis for substrate specificity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords JmjC domain-containing histone demethylation protein 3A
total genus 112
structure length 349
sequence length 349
chains with identical sequence B
ec nomenclature ec 1.14.11.-:
pdb deposition date 2007-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF02375 JmjN jmjN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 2ox0A01
5FJKA 4LITA 4UF0A 3KV5A 5FZDA 2XXZA 2OS2A 2XDVA 4GJYA 5FWJA 3AVRA 2Q8CA 2XUEA 5FZLA 5FY1A 5IWFA 5FYMA 4QX7A 3K3OA 4EZHA 2VD7A 5F2SA 2YBPA 4CCOA 3PDQA 5E6HA 5FZ9A 5A7PA 5A7WB 5FZ6A 5FPLA 4TN7A 5A7NA 5FZOB 4Y3OA 5F3GA 4XDOA 2GP5A 2YU2A 3U4SA 4ASKA 2P5BA 2YBKA 2OX0A 3DXUA 5FZGA 4D6RA 3N9PA 3PUSA 5FY0A 4NUBA 4Y33A 5FZ3A 3ZPOA 3N9LA 5A80A 5LY1A 5FZKA 3KV4A 3PUAA 2OQ7A 4LXLA 5F3IA 4Y4RA 5A3WA 4D6QA 3OPWA 4UF0B 3PU8A 5A3TA 5F3CA 5FYTA 5FZHA 2YU1A 3LDBA 3AL5A 4CCLA 5FY7A 5IVJA 3NJYA 3KV9A 5FXVA 5A7SA 5K4LA 5FP3A 4IGQA 5CEHA 5IVYA 3K2OA 5FPAA 5FPVA 5FZ8A 1VRBA 4GD4A 3PURA 5FBJA 4LIUA 5FYYA 4CCJA 5FZEA 5FZMA 4EZ4A 5IVFA 5FV3A 5F2WA 4CCNA 4BXFA 4QXCA 3U78A 4E4HA 5FXXA 3UYJA 4QWNA 5FZAA 4CSWA 5A7OA 5FJHA 5F39A 5F5AA 4BU2A 4QXHA 5FXWA 5A7QA 4CCMA 5FYSA 4CUGA 5F3EA 4AAPA 3AVSA 5FP4A 5FP8A 4C8DA 5FXZA 3RVHA 4IGPA 5FY8A 4GAZA 5FYIA 2XMLA 4QXBA 4QU1A 5FZCA 5FWEA 5FY9A 2PXJA 5A7WA 5IVBA 5FYUA 4XDPA 2YPDA 3N9QA 3PTRB 5FZOA 5IVCA 5FYZA 5FY5A 5FZFA 5A3PA 2WWJA 3PUQA 3AL6A 2Q8EA 5FZ0A 5IW0A 5A1LA 5IVVA 5FZ1A 5LY2A 3N9MA 5FYBA 4URAA 5A3NA 4EYUA 5ISLA 4D6SA 3OPTA 4HONA 5FP7A 4DO0A 4V2VA 2OT7A 5F5IA 2GP3A 5FYHA 5KR7A 4IGOA 4LIVA 3KVBA 5FYVA 4V2WA 5ANQA 5FP9A 3PU3A 5FPBA 2YBSA 5FUNA 5FZIA 5F37A 5F5CA 5IVEA 4BISA 4CCKA 3KVAA 5LW9A 5FZBA 4DIQA 3ZLIA 4QX8A 3LD8A 3KV6A 2WWUA 3DXTA 5FZ7A 4HOOA 3N9OA 2OQ6A 5A1FA 4GJZA 5FY4A 5FZ4A 5F32A 4AI9A 5FPUA 2W2IA 3N9NA 5LWBA 5FUPA 5FYCA 3K3NA 2Q8DA
chains in the Genus database with same CATH superfamily
1PM4A 5I91A 4YVWA 2HWD1 2UWAA 4BIFA 4DB5A 5FZDA 5CADA 1ENRA 4HN0A 1W2TA 1F15A 1UKGA 3IDBB 4L0PA 2WN2A 3LFMA 4AI3A 5A6YA 4XFGA 4QPIB 2XUEA 1IOAA 4AQSA 1QDCA 3ZR5A 1YI9A 3T0AA 5JSPA 2IXHA 3ETQA 5CIRA 3WF1A 3WNKA 4IE5A 2EA7A 4AI1A 1H8TA 5T5OA 3HN3A 1QJU2 1M06G 1WBLA 1H2MA 2JD9A 2ZX4A 4R9AA 2YBKA 3HBKA 2G1MA 3OBZA 2R063 1LHNA 3PUSA 3VZJA 4HMZA 1A34A 5DUXA 3N9LA 1S0FA 2RM23 4ZS2A 2X5IA 1E57A 3R05A 1AXKA 5EXOA 1V00A 3IDEA 4IXLA 3VBHB 2DVAA 1JU4A 1YFYA 3OGSA 5FKBA 2XJRA 3QCWA 1W8HA 4Q4V3 2P6CA 3I54A 1GNZA 4AFCA 1RVF2 2Y6JA 1EV13 3IDAA 5FBZA 3PU8A 4BQ4A 3KGZA 1OT5A 1VMHA 4FFIA 4GH4B 1TMF1 3I49A 2NYYA 3K51A 1PX3A 3NJYA 1OD5A 1WW7A 1HN1A 1NT0A 4ITCA 3HIFA 4ATFA 1VRH3 4E4ZA 4LHLA 1BZWA 3ZIWA 1PGL2 5FYYA 3JB8A 5FR3A 2RS12 2SLIA 1W6MB 4N8MA 2RMU3 3RSJA 5JMOA 2AEZA 2FDKA 5HXVA 1JN2P 4XAAA 3PMEA 4WVZA 3POFA 1TEIA 1FPN2 3B9IA 1SQ4A 5F39A 1JOPA 4IEWA 2E7TA 3VKOA 1BVVA 1YQ2A 3WCRA 1Y9GA 3IKWA 1C28A 4PBOA 1OVPA 4QPIA 5L7OC 1X36A 2ES3A 2XVLA 4Q8KA 4MXWA 1NZIA 1YC61 2LROA 1QOSA 4Z1VA 1LJ7A 1OKQA 4NAMA 3U10A 3GZAA 3LA2A 1RTVA 3ACHA 3I8TA 3KLSA 2RM21 2PXJA 3BTZA 3CJIC 4WVVA 4D7TA 4ONUA 1OLMA 1GWMA 2XUMA 3KF5A 2TBVA 4IE7A 1NCQA 4EN6B 5JUVA 1H0BA 2CGOA 4C90A 5IW0A 1XSRA 1D4M3 2VH9A 1OFNA 2Q1ZB 3ZXDA 4EQVA 1VIWB 3M1HA 1R093 2ZAHA 2HWF3 1HW5A 5HCFA 4BWOA 1DLLA 5F5IA 1X9PA 1VAMA 3TNQA 1POV1 2CYFA 3EXUA 4PJYA 2JDHA 5GZDA 4OMDA 3TNPB 1DQ5A 1AR61 2UU8A 1YIFA 2NMNA 2AC1A 4MLOA 3W21A 5C8CB 1B35B 4LHSA 4W50A 1QQP3 2D3RA 4HXCA 3LPGA 4FPHA 4AGRA 3PUHA 1W9WA 3FLTA 5DZGA 3NNFA 2P34A 2W0XA 3DYPA 4JDNA 4KBBA 4RSUA 4RN5A 5FLHA 4UFMA 1MS1A 3OB8A 3KQ4B 4I09A 2PHWA 1OC1A 3HR9A 1LU1A 4JZRA 3JQWA 3USSA 3IIIA 5KXCA 4MGKE 5FTTC 4BIOA 2JDPA 3L9JT 2RDQA 3VKNA 4MG2A 4QX3A 1W3XA 2Y64A 2OVUA 1DG6A 1LHOA 2XJQA 5FMCA 1JZ5A 2XBO1 2A3WA 2D6OX 4LMFA 4BDVB 1YEWA 2XDVA 2EXJA 4CP1A 5FWJA 5C9AB 1W6OA 1A6CA 3V0BA 1C1LA 1CPMA 3ZFEC 3WNOA 2ZEYA 4FOYA 1UYZA 3NW4A 4Y22B 2WFF1 1UWWA 4QX7A 4XCAA 4FTEA 4EZHA 4PCRA 2ARXA 4HANA 4AEMA 3FFZA 1FI2A 5FAXA 1G6NA 3J8F3 2NM1A 5LEJA 1ZBA1 5A7NA 3U1XA 5LK7B 2W9XA 1MEC2 2WO7A 3RZJA 2V4AA 2VQUA 2BBAA 3NJVA 4R9BA 4XCBA 1AJKA 3AYEA 4Y33A 4AOCA 4YW3A 5IT6A 4FTSA 1ULCA 4E2GA 5K0UC 1BEV1 4LBJA 4QGLA 2PHLA 4O61A 3PUAA 1L7RA 1ZBE1 2LS6A 4Q0QA 2QZ2A 3ZVXA 1PVC2 2ZBJA 4HKLA 4XE9A 1YNAA 1UL9A 3VZNA 1RJ7A 3OEBA 4UF0B 2X5IC 3ACLA 3M3CA 4XMIA 3GDBA 1D0GA 1SLCA 3MIBA 4D3WA 2DU1A 3ILFA 4HLTA 2PLV2 4JGZB 3SEPA 1YIPA 1EAH2 3AFKA 4DXRA 1GOHA 1KGYA 1W6PA 4GD4A 3OF1A 4PQ9A 5KHKA 1H6YA 4KNCA 1COV1 2WA3A 4M3CB 5FZEA 4PLOA 4QPIC 4GMP1 3VZKA 4AHYA 3EJKA 3KF3A 1PVC1 4FPOB 2VBPA 4QXCA 3WDYA 3H8OA 2X29A 3NAPC 4G4FA 5FZAA 3QOPA 3E5UA 2A7AA 4N9HA 5M0TA 1DYPA 1RUG3 2P3JA 3ZYBA 1NAEA 4CDUC 2H0VA 5FYSA 3WNLA 1APNA 1GNYA 3ATGA 3ORJA 5GALA 1MZFA 4XBQA 2YDEA 2YY1A 4IE4A 2CAUA 4KWUA 3VZOA 1PO13 1MZEA 2ZGSA 4WM8A 5I0UA 4Z8BA 5FWEA 5BNQA 5IVBA 2A6YA 4IERA 1LR5A 3LCPA 4XFBA 1ND2C 2IVIB 1FYUA 5GZEA 2JDYA 4NVPA 3RZMA 2F6BA 4Q4V1 3ZFGC 5A1LA 2RS32 2VJXA 2Y6HA 3N9MA 1OI6A 4I3PA 4KWLA 1H1AA 5BNPA 4C0HA 1GP5A 1AR83 4AVTA 3CO2A 2D6MA 2XJVA 4FP2A 5KHHA 2V4VA 4DPNA 4DEQA 1IG3A 4IEQA 3CJIB 3IAQA 2ZGNA 2VCBA 1LB2A 1PGW1 2GP3A 1SCSA 5FYHA 2VCCA 2IUWA 4BQ3A 2GMPA 3WQ1A 4AI8A 3E6DA 1GBGA 2A75A 5C5TA 2R1DA 3V64A 5IUQA 3UNPA 3MLLA 3C8XA 2VG9A 3O1RA 3THPA 5I8SA 5FO8B 1G9FA 1TE1B 1GWLA 3OUHA 3P5BA 4OYUA 4PDWB 4BQYA 5A32A 5LRSA 4MHRA 2JXAA 4MSVA 4A6SA 3NAPB 3LEGA 3DYMA 2ATFA 5A1FA 2HWD3 4XZUG 4QPGC 1LOCA 2BV4A 5C71A 3POWA 1XYPA 2FCTA 2FD8A 3ZYFA 4ES9A 4JGYB 1ND3B 4ATEA 1IS5A 2WT1A 4XIKA 2VZSA 2NLRA 2DCJA 2ZMNA 1WWYA 1BYHA 3N4MA 4Z2AA 1LEDA 1KS5A 2WNUA 3B5LB 4RFT0 2QQLA 4PI2A 1WCQA 2EF6A 2QQMA 3SC7X 1PK6C 3SNMA 4Q4X3 3O1PA 3ME2A 5IHRA 2O0OA 3LDKA 4P9YA 4M00A 2RG4A 3OTFA 2JG9A 3PDQA 4TZDA 3O1VA 5A7PA 4XJ8A 3CZJA 3W5NA 1OQ1A 5D8AB 2Z79A 3HJRA 4TN7A 5BNPB 5FZOB 5C3SA 3M3IA 4XDOA 1JZ6A 2YU2A 4NIGA 5T52A 4CYDA 4DY3A 1DQ1A 4D6RA 4NRQA 2A6VA 5JXGA 3THTA 5IATA 2DCZA 3K75B 4Y1XA 1O3QA 3DYOA 4P9IA 4MXWB 4E9KA 1QY4A 1FPN1 5D2AA 3NV4A 4P5HA 1RUG1 3Q8AA 1UY2A 1AYN3 3D4KA 4LXLA 1TMF2 3KSCA 4WVMB 4COVA 1U5XA 4BJ0A 4CEWA 1ZZBA 5C9AC 3VUOA 2IZWA 3S6PA 1Q56A 4IV1B 4QPGB 1PGL1 1HB4A 3JXSA 4CTEA 1RUE1 2D97A 4KWJA 4PDWA 4ISQA 1HRI3 5LASA 1O4YA 4HSJA 5K4LA 3ZSLA 3K46A 5C4WB 2OPWA 4QM9A 1S0JA 4IL7A 3HT2A 2OYZA 4BMBA 1W6NB 4COZA 3WNMA 4JVAA 1YO8A 1YWKA 2ZHNA 1N47A 4Y1VA 4XQWA 1A8DA 2WLQA 4JGZC 3CL1A 1UZ0A 4UFKA 2HBUA 4YW4A 5F8PA 2OA2A 4RGGA 2E6VA 2E31A 4GALA 4OUEA 1NUKA 4Y20B 2QKDA 4IDZA 5AC92 1UX6A 1H2KA 3J7MA 4LTAA 3AXDA 3DN7A 2VZUA 2Q5TA 1AHSA 5IVVA 1GV9A 4YGDA 1N1SA 1JYIA 3TAYA 4DOUA 1DZQA 1O5UA 4OVEA 2LRPA 1K42A 1UQXA 1KD7A 3MBWA 1JYTA 3HNMA 2WO2A 1A8MA 1NLSA 3IMMA 4IV1A 2X53S 3K4DA 4IGOA 2P37A 2RS51 3VB9A 4V2WA 3MFAA 5CFDA 3VDBA 1MZ5A 1W39A 5GLWA 3FBYA 1OHFA 1R1A2 4ZONA 1VJ2A 3KVAA 4MGYE 4CCKA 2CWSA 2HWE1 1ZRFA 5J48A 1QWRA 1J1LA 3V56A 4N43B 3RI9A 2NP0A 1WBFA 2CDPA 2WINB 2OQ6A 4B1LA 1JMUB 1K3IA 3S0MA 3DECA 5FPUA 2XBO3 1L7QA 4LEJA 2Y26A 1AL21 2W1WA 2PQSA 5HV4A 2BU9A 4NPRA 5HV0A 3H3LA 1CAXA 3DPRA 2ERFA 4UF0A 1I5PA 5EV7A 2YGMA 5HBAA 2BP6A 4P5YA 3IPVA 4OI2A 4IEXA 4BQ2A 4LR4A 4BQ1A 2WT0A 1XE7A 3USUB 2IXJA 4FTBA 4DUWA 1VBB3 4EV0A 4COUA 2PHTA 5FZLA 5ACA3 2YUEA 1W6PB 1HRI1 4QPWA 4M3CA 5EJ1B 4BK5A 2W3JA 3I97A 4TTGA 1CJDA 1BXHA 1ZX5A 3M2MA 3PL0A 1XNKA 5JIAA 1WLCA 1H4HA 1E5RA 2IWGB 2ZGTA 2ZZJA 4B7KA 1PX4A 4E2QA 4Z92B 1PO22 1KFUL 1ASJ1 1NA1A 4P08A 1ZNPA 3AP6A 2VTXJ 5FDBA 4I3GA 5L36A 5LY1A 3KCCA 4CUBA 1BMV2 2JB8A 1CAVA 2KM2A 5T3NA 1V9U3 3ABZA 3MV11 1QJY2 5FK7A 3ZMOA 1WGPA 5DPNA 4FPKA 4ZY9A 5CB7A 1GP6A 3GBFA 3FHQA 1PGW2 1KFXL 2D44A 3MV01 4QXKA 5DQ0A 3O1TA 1RC6A 5DAVA 3RRDA 3ZFGA 4N43A 1RUD2 4R8HA 2Y0IA 3L2YA 1RMU3 1NXMA 1Z0HA 2BNOA 3HAGA 1OA4A 3M3OA 5CVRA 5A7SA 2ZGUA 5CEHA 5FQ0A 1LOFC 2RS31 2C9AA 3NNJA 1LEMA 4ZU4A 5JAXA 1UXXX 5F2WA 1IG0A 1XB9A 1UPIA 1W3VA 2EVXA 2YC0A 1XE8A 2YHJA 5FXXA 4H2AA 2CU5A 3ES1A 1RB8G 1BJQA 4AFDA 2V09A 3OD4A 4B4QA 5A1AA 4MX3A 4FPYA 4WZCA 1K12A 1RXGA 2FQPA 2ET1A 3NNGA 4CUGA 3GM8A 1XYNA 3WVJA 4NWWA 1CWPA 1ODNA 1POV0 1H2LA 2VOXA 3I3DA 4KU7A 3NAPA 4WM7A 4IEPA 5K0UB 2WRAA 1JHJA 3N9QA 1EPZA 3VBOC 2CV6A 3ZDSA 2HBTA 5FZFA 1T6BX 1S0GA 2VTXA 4L92A 1COV2 4XFAA 1HX6A 5H9QA 5A3PA 5J36A 4IV1C 4KG0A 2WFPA 1DF0A 1SBEA 2A6ZA 2QQOA 3OPTA 4QDSA 2WO1A 1REDA 1W2AX 4NHXA 4QX5A 5FP7A 4AWDA 4AW7A 5C8CA 3B02A 2AZ5A 1KXGA 5JXIA 1X82A 1K5MB 3K4ZA 4UBGA 1LGCA 3I2HA 2XLGA 3I2GA 4K21A 1RUF3 5JLVA 4BXSV 4OLLA 4CUAA 2J7MA 3VBFC 1TZOA 2JG8B 3O0VA 4OI1A 1S0DA 2R1BA 3PLQA 1ZYBA 2WNVB 4LORA 3I2IA 1NLRA 4XUQA 3E5QA 4CU6A 5FUNA 2A70A 3SLIA 4DIQA 1ST8A 5HXMA 5LZ6A 4J25A 1W06A 2R6QA 2YMZA 2WR9A 1MEC1 5J37A 1VBE2 4YM2A 3G6JB 1JZ8A 2QDRA 5APAA 1QOTA 3B9CA 4FFHA 2A6WA 3GBGA 1JS9A 2WLPA 1PNGA 2BDRA 3HT1A 4I0BA 4CDQA 1UXZA 2QNKA 3HMYA 3ZSMA 1ULOA 1X8EA 1NCRB 3W59A 4WBBA 1B35C 2BUKA 2XBO2 2R16A 1J58A 4RL7A 3J7NA 4FAHA 5JOYA 3AP5A 5F2SA 2D7FA 1OD3A 2WYFA 4MGTA 4GIQA 4AEDA 4Y5SA 5KHJA 1V70A 4UXAA 5IK7A 2QQNA 1E5SA 4XF0A 4PQQA 1O5LA 2P5BA 1RYYA 2JECA 4NIIA 2QQJA 3WP6A 2E7AA 3I3EA 2W08A 3D3AA 4AFBA 1HIXA 4NUBA 4Y5Z0 1CX4A 1SDWA 1WA4A 3WX5A 2HH9A 2RE9A 1O6UA 1ODMA 1WD4A 3SCGA 1PK6B 4PBPA 2OKXA 2WNVA 3CJXA 5DDJ3 4NRMA 2P2KA 2XJSA 4A4AA 4FXGB 1RUF1 3OPWA 3DF0A 5LBFA 5DDJ2 4DXSA 5A3TA 4FSJA 2DURA 3TWIA 4UOJA 4D7SA 3KM5A 4K1YA 1GQGA 4MADA 2ZGQA 3HNBM 4PF5A 2NZ9A 5K9YA 5LA2A 4QHZA 4N53A 5FPAA 5FPVA 5LBEA 1MS0A 5A3LA 5DAWA 4CCJA 4LIUA 4D0QA 1F2NA 3M4FA 5IFPA 3H3UA 5LBBA 4BXFA 4RHV2 4Y4YA 3AFGA 3AMQA 3WCSA 3DGTA 5GKAC 1TME1 3O14A 4Q0VA 5FJHA 2VU9A 5T5JA 4BU2A 3MIHA 2VVEA 1NCQB 1XXNA 4JQRA 3IZOA 4LUMA 4K6BA 1QJFA 3RZZA 3SXWA 3AVSA 2UY9A 4QQOA 2BRTA 2VBDA 1HV0A 1W8ZA 1FNZA 2XHKA 5FY8A 3H7YA 3RVHA 5J3UA 5FZCA 2ZEXA 3LDRA 4O7XA 1TNFA 3ZSEA 4LQRA 3VKLA 2WJSA 5A6XA 5DXDA 3ZFFA 1ENSA 2JKBA 2VULA 4FVVA 2WYSA 5IK4A 1ULPA 2VZ3A 3B00A 5J98B 4J1WA 3PVNA 1NY72 1RUI3 4LK7A 3VBOA 1QXRA 1GQHA 1Q8PA 2ZMLA 2XJUA 2QBXA 4AR2A 1LOBA 1F35A 5CG9A 2OZJA 2ZX1A 1O4TA 2PYTA 4RQPC 1BBT2 2WNUC 4CA9A 4CDXB 2PFWA 1ENQA 2OUHA 2EIBA 1CESA 1PMJX 2O1QA 2VNRA 4R52A 4S2FA 1BBT3 2DCYA 1UY1A 2VVFA 1LKNA 2Z2SB 1GOFA 5FYVA 4ASMB 5EYYA 2H6CA 1HRV2 3N7MA 3SCHA 2ZGOA 1RXFA 2D6KA 1A3KA 3OY8A 4QX8A 5F7UA 1VAVA 4OI0A 1ASJ3 1GZCA 3Q9OA 1W6OB 4CDQC 2R062 5E16A 1QJU1 3I2OA 1UZYA 2QTWB 2Y6LA 2PQQA 1XNCA 3B94A 2RS13 4I0AA 4ZXEA 5T5PA 1B35A 2W2IA 4JTNA 3HN1A 4JKLA 2W95A 3OGVA 2AEYA 4IEZA 4XXAA 4AHWA 4D7YA 2DU0A 4YSFA 2WNUB 4ZU5A 3VD9A 1J1TA 3WDUA 4WZFA 3K3NA 2C4XA 5ACA1 5JR2A 2QDNA 4GULA 4PIZA 3JD72 4EROA 2GC1A 2HWD2 2AENA 2QJVA 1JXNA 4QPYA 5IWFA 4Q2FA 2F4PA 2ZGMA 4CXWA 4L9BA 2B4KA 3ZXAC 1HV1A 2EXKA 1GYKA 2VZRA 2LW8A 5JMCA 4YYOA 3H42B 4IW3A 3IWZA 3ZO0B 1MPXA 2BYVE 2K46A 1XOYA 1AX1A 2W52A 3T2PA 1FX5A 1NA1C 1OKOA 1E5HA 2DUOA 2BJSA 5J7MA 5AFBA 3ZOIA 2RS53 2ZXQA 2DFBA 3N9PA 1NKGA 4AGVA 1JW6A 1W0PA 1J3PA 1OF3A 4HVRA 4LNVA 3VBSB 1WKYA 1Q43A 4PIXA 3WF2A 1JOJA 2FCUA 1GSLA 4DRRA 1AZDA 4EWAA 2RDRA 3MIEA 2HKXA 4UAPA 1NY71 1N1VA 1RUNA 4AQTA 3SEEA 4AFAA 2W68A 1AR63 4HK9A 3GYDA 2BNNA 1AYM1 1WLWA 2ZKLA 4RGAA 2EXHA 4K20A 1VBA1 3VBHA 3OY8B 4YW1A 5FPXA 2AREA 1LGNA 4JV4A 2YXSA 1AUYA 4CEYC 2ZMKA 1GOGA 1SLAA 1AR72 5FV3A 3WF0A 3ILNA 2VO5A 2W46A 2ZX3A 1EY2A 1UU4A 4YGBA 3WV6A 1O8SA 2WT2A 4D69A 1QEXA 3RWKX 1O91A 3C7EA 1BK1A 4Y20A 3WOGA 4OHXA 1JUHA 1LOFA 1WW5A 2WUHA 3I3BA 3OJBA 4XF3A 4Q4Y2 3ZXJA 3V0AB 1KDKA 2LUWA 2Q1MA 2XPJA 4CRQA 4LPLA 2PTMA 1RHI2 4YW5A 1FNYA 3K77A 4IGPA 3WDXA 2C9KA 4YFWA 1DDLA 1UYYA 2VOVA 1SDDB 5A7WA 3TN91 5JI7A 2Z42A 1W99A 2AYHA 2BOIA 3SKJE 1NX9A 4FO9A 1MS9A 5CG8A 5DDJ1 4WVWA 2E9QA 2E32A 1RUH3 4ZU7A 2A71A 4C1XA 3MDPA 4W65A 5L9BA 1VE0A 2PHUA 4FOWA 1BKZA 5CFDB 4GKYA 3RZGA 5L73A 1SZBA 4AZZA 1KITA 3NNMA 1LAJA 1DFQA 2JX9A 2UYAA 4UWDA 4DEVA 4RYDA 4NHYA 5FPBA 4YGEA 1OOPC 4ZZ5A 5FUIA 3H8XA 2FDGA 2VQ0A 3LKJA 2R0FA 3SCFA 3VKMA 5JXHA 3ASIA 2J22A 1CVNA 2VXJA 1TQ5A 5FZ4A 1MS3A 3ST7A 3OPZA 3USUA 2LALA 4AQ6A 3CZUA 2RDNA 3EQEA 4FPCA 3ZXEA 2CY6A 4RS5A 5CKMA 3IMNA 3N7LA 3LIHA 4LITA 4ARYA 4XACA 1S0IA 3P3NA 4Q4X2 5IJRA 1AYM2 4LE3A 3KD4A 1GP4A 1JYNA 1HKDA 3M8LA 2C0ZA 4KGGA 1AYM3 4ZPIA 4AEKA 2XL7A 5FYMA 4ES8A 3S57A 1BEV3 1GWKA 1FAYA 4OZXA 3TBDA 1UYXA 3A23A 4CCDA 4A41A 1FMD2 1EP0A 1FXZA 3NVCA 3RJRA 4OHYA 3R6SA 5FZ9A 2GNMA 1J84A 3TN93 2G4IA 2ORXA 3NNLA 3MF6A 1MR5A 1CJPA 3I2FA 1CAVB 4AVBA 2Y60A 4PLNA 4LO8A 3QH7A 3NJZA 4Q4Y3 1OPOA 1BHGA 1H1IA 2HLEA 5FY0A 2DUQA 5EYXA 2ZKNA 5AFEA 1PHMA 4XF9A 3WDTA 3FZ3A 2B8MA 2GH8A 5CZKA 1BEV2 4PLMA 5BYNA 1HB1A 3TB0A 3WQBA 3MW4A 3KCXA 1I3HA 4XF1A 3JD71 2H6BA 4WM7C 3U07A 1TNRA 3ZN4A 4RA0A 3VBSC 3PNAA 4FT8A 5FXVA 5FP3A 5AC93 3I4IA 3E6BA 1V6OA 1W90A 3LIGA 4NPLA 3FX3A 4CCNA 1N1TA 3P6BA 1HLCA 1UOFA 2Q4SA 3BGAA 3ES4A 3WD5A 2GC3A 4J1XA 5HPOA 4OZOA 4WVMA 2WFF2 5CU1A 4XC9A 1JUIA 2ADDA 4LK6A 1CZTA 1IPKA 1W6QA 4QPGA 2YC2A 1OMIA 3MW3A 3U4XA 1UY3A 4KG8A 3I2JA 1Z78A 1D7PM 3WEZA 1HRV1 2VW2A 5FXWA 1QQP1 4M0NA 1VBB2 4JDOA 3RYRA 5DZFA 1QJEA 4UT5A 5FP8A 4AXOA 1J59A 4BB3A 4QXBA 1MQTA 3JU9A 4UI9L 2VAUA 3D82A 1VRH2 5EQUA 4R4XA 3FFQA 4Y1YA 1JYCA 3O1OA 2TUNA 3R4UA 3W5MA 1OUXA 4UBHA 4YZ4A 3AL6A 3B69A 4HVOA 5BXXA 2YG0A 2ZABA 4NHMA 4Q4W2 5LATA 4EYUA 2ZGKA 2GNBA 5FMOS 3K4AA 4E4SA 1QH6A 3PMSA 4DO0A 4I01A 2IXKA 3WZ1A 1CN1A 4XOGA 4Y1UA 4UW4A 3T1LA 4UFIA 2BEOA 3OUIA 1FT9A 5LB6A 1F9KA 4R9DA 5BPXA 4O9GA 4QAWA 1PO21 3G7DA 4CDXC 1AXYA 1W8OA 4Q26A 1S2KA 2B45X 5ABJC 2D6PA 3SHRA 2DCKA 2JG9C 1G8WA 2WL1A 3C3VA 4FPLA 5EZWA 5F5CA 3UESA 5IVEA 1W8TA 2W91A 4YG3A 3ZPYA 1HRI2 1UZWA 1KJLA 2LM3A 4MH0E 3LD8A 5EJZB 5CBLA 2PMWB 5LA0A 3RZLA 1ULEA 1WLTA 3NV3A 3MI8A 4YG0A 3I3QA 5FY4A 5F32A 4Q0SA 3IN9A 2DVDA 3U37A 4OFGA 2CAVA 4ISRA 5DG2A 4CEWC 3BCWA 3VBHC 3LWCA 1QJX2 2WBKA 3C7HA 3POSA 2Y34A 4Z2WA 4Q8LA 3KB5A 3ENRA 1LOEA 5FY1A 2BGCA 3VBUC 4XJUA 2XJTA 3VDCA 4XDQA 3BTAA 3T2TA 3GJBA 4AAXA 3VD4A 1UY0A 2J1RA 1PO12 2VNGA 5F3GA 1F5FA 1ULDA 4ASKA 2A1XA 3BKZA 2V73A 1S2EA 3AYAA 1N1YA 3EHKA 3MLKA 2Q1FA 1RVF1 3WP4A 4XF4A 1REEA 4GKXA 2RVAA 4QGMA 5A33A 1LODA 1AR82 1W8FA 1XNDA 2JDAA 5F3IA 3SH4A 4PT6A 3WW1A 2VMDA 3WNXA 4EJRA 3AK0A 4XUPA 1PZ7A 1T2XA 2JDZA 2DBNA 3VL9A 5FOBB 5FY7A 4B3NA 3PJQA 4YW7A 4IGQA 2GC2A 1VB4A 3ZFFC 5BNNA 5B2GB 3SITA 1JZ3A 1PMHX 2HWF2 1G9DA 1CGPA 1H4GA 4M3CF 3ILRA 1RUI2 3THCA 4DNYA 2JDUA 1DQ2A 1DQ4A 1PZ8A 4QKDA 1SEFA 2IC1A 2DVGA 3U78A 3WQ0A 4H14A 5JCTA 3UJOA 5JOXA 5CA6A 3GF6A 2XWBB 2W1QA 2VY0A 4YPJA 4SBVA 3MPPG 3WF3A 3POJA 3RS6A 4CU8A 2IFRA 3JB4C 4CCMA 2WC2A 2WNEA 3ZFEB 2GC0A 4GH4C 5FQ0B 4A7ZA 3Q8EA 4YZ5A 3LFIA 4AAPA 3FUQA 3UKTA 3OYWA 3AYCA 4C8DA 1N3QA 2GNTA 4GAZA 1H6XA 1OVSA 1EAH3 3AZZA 3BOWA 3E97A 4TYSA 2PLV3 2X10A 1WCUA 5JR7B 3WQ7A 2VMFA 4S2HA 1UKRA 5IVCA 2FDIA 1RITA 3VBOB 1HB3A 4BZ4A 2BZDA 1HXS3 2UWCA 4GWJA 2A3YA 1Y9QA 1IKPA 3TOJA 2A5ZA 3E6CC 4ZXKA 1AVBA 4R9CA 4CEYB 5LY2A 3TEWA 5ISLA 4YM3A 3JD73 2GU9A 4YM1A 2VUDA 4XHXA 3ZX7A 1RUG2 2GALA 4RR3B 3ZIXA 3GNEA 3E5XA 1DU3D 5CYYA 4QQ2A 4XJWA 5JSOA 5E89A 1OBNA 4OQ9A 5HI0A 3K48A 4QM8A 4OUMA 4Q4X1 4FAGA 3JBG1 2G19A 3ZYHA 1OH3A 1WW4A 3IBMA 1W9SA 2VZPA 1VBE3 3R4SA 1YLLA 2JE9A 2VZ1A 3H0OA 3WDVA 1GICA 4E2SA 3H1YA 3BIWE 4M4PA 5F5QA 3WG4A 2R0HA 4LBKA 1YFUA 5EPAA 1K45A 3QACA 4M01A 1NCRA 3BPZA 1LHUA 4MYEA 3H8RA 2VZOA 5T50A 4OCTA 5CKQA 4BM8A 3BU7A 1YFXA 2R043 2E53A 3QD6A 4AL9A 3D0JA 1BVP1 2XQRA 1S0CA 1ZZCA 1D4M1 4JRAA 4H55A 1ENXA 4HFSA 3U11A 4AEDB 2VNOA 3TEZA 3J8F2 4P9WA 1GZWA 4E8CA 2ET7A 4KH9A 3WHTA 1N3OA 4K1ZA 2VR4A 2YC4A 1R092 1RIRA 3UL2A 1MEC3 4EN0A 1V6LA 1CAXB 1LOGA 1UOGA 1W9YA 1MS4A 3IPVB 3A4UA 3B3QE 2C24A 4NWVA 3AKTA 4LT5A 1YQ5A 1V6IA 5JVVA 4CEYA 3AZWA 1YQ6A 3BALA 4CDQB 3AKPA 5ABJB 2R073 4COYA 2NPIA 5KWRA 1O59A 4QB2A 4LKSA 3PJYA 4F83A 1QOOA 1YXWA 5FZ3A 3S7IA 5A70A 3PVEA 2TEPA 3T2QA 1W2UA 2RR13 2H0BA 1O8PA 1H8VA 3AZXA 1DQ0A 2J1TA 4AI2A 3J8F1 5DUVA 1FOD2 4UFJA 4YW2A 1H1MA 4A45A 4D6QA 3ON7A 1W0OA 4Q4V2 4COWA 1UOJA 4Q0UA 3ZN5A 3AL5A 3HOBA 2ZPXA 3JCIA 1REFA 5DZEA 4EN8B 2GSYA 1V0AA 2WZPP 3CBNA 3ZYGA 2JEMA 2JB4A 3HVDA 2WS91 5FBJA 2WQ8A 5IVFA 1AL22 2BWCA 3ZFGB 3VGIA 3NWKA 1B09A 4XURA 3TEYA 1ZBA3 3KS7A 5DAQA 1DGWX 2JENA 1I9RA 3GZEA 2VBBA 1BQPA 3VBFA 4XPVA 4CDWA 2KD7A 2MPFA 5A7QA 3THDA 2Y8KA 2D93A 2PELA 4IEVA 3SISA 3GHMA 3MIFA 2QE3A 4QU1A 3V0BB 5D21A 2UY8A 5FMDA 3RG0A 1H8TB 4LO4B 2A3XA 5FYUA 2E26A 3AZYA 4A3ZA 3MICA 4MGIE 3OSDA 1ZREA 1F5JA 1W0NA 1DBNA 4H3WA 5FFOC 3VD5A 2EIDA 2FDJA 1UAIA 2X8KA 1SLIA 3NL1A 2FZ2A 5FZ1A 3D0SA 4XBNA 4YWAA 4CVUA 2MEV1 5A3NA 1F8VA 4KL1A 1LGBA 3F2ZA 1GANA 1HJFA 1GU3A 4DUXA 1WMEA 4ZHNA 1SFPA 2XLAA 2D3SA 4FPEA 1SBDA 3KGLA 3LAGA 4MUVA 4XXPA 5G04L 3S7EA 3O7OA 3UJQA 4AYUA 1QKQA 3ZXLA 2W92A 1HN0A 4Z82A 4F8AA 4XETA 2JICA 1KS4A 2FHRA 4WM8C 2E7QA 3D6EA 2HWF1 3KT1A 4Y26A 3VHPA 1YQCA 1C8M2 1XNTA 2K2SA 3DV8A 3KV6A 3VHOA 4CCEA 2XKPA 4KQ7A 1O3TA 3ACGA 2OUJA 2QUOA 4AQ2A 4YVWC 2DBIA 2D6LX 1BLZA 1NXD1 3T09A 3RWNA 4H7LA 3VBFB 1PIV1 4MV2A 3RYPA 4XQ4A 2Q8DA 1AR81 5FJKA 2PAMA 4JCKA 3VD7A 3ZR6A 1JODA 3J26N 3W20A 1UO9A 3O1SA 3KMHA 3ROUA 4X6RB 1M4WA 3NV2A 2PN5A 1QGLA 4S2GA 1LNSA 4JC1A 4FCAA 3VBSA 1U0AA 3LA3A 1ZA4A 3MFCA 1PO11 5C3OA 1UIJA 4WM8B 2VW0A 3GZUC 4B4RA 3OBAA 4YNIA 3OG2A 4G9SB 5DAPA 1IGOA 4A3XA 4SLIA 1J3QA 4JKKA 5AVPA 3O0WA 2Q8OA 2XR4A 1QJX3 1D2QA 2WO3A 5FLJA 4FPJA 4FI9A 3ZXGA 5A80A 4I02A 2ZAAA 4OMCA 5JIUA 1V9U1 2QFEA 5GZGA 4K7JA 3LOBA 4O9EA 1VBD2 2ZZQA 3EMRA 1OF4A 5FLIA 2FDHA 5LEKA 3T0BA 4NAOA 1G9AA 2V5YA 2P3YA 4Q4W3 1NE4A 1WMDA 2JJ6A 3V65A 2FZ1A 1ULFA 1RINA 1RMU1 3LDBA 1VBD1 3OUJA 5A3OA 1PK6A 1TME2 1HB2A 3BVCA 4HL0A 5DAXA 1CZSA 2VQTA 3UGHA 2RM22 3PHMA 4CDUA 1D0HA 1CR7A 1QMJA 3R0RA 4RHV1 1RMU2 5IAVA 2BWAA 5FZ8A 3V0AA 1SBFA 3IM0A 1WD3A 3O1UA 4CE8A 3D5OA 1RGSA 1XYOA 1QU0A 2AACA 2JKXA 2GN7A 4HSLA 3UYJA 3J7LA 4TLFA 4L11A 5A7OA 1YYNA 3HPNA 1QXJA 1V9U2 2JDMA 2WIIB 4MZUA 2YYOA 4N53C 4MXVA 4N7UA 3WINE 4CP9B 3WUCA 2ZCWA 5L9RA 1IS4A 4NIAA 5H9PA 1XNAA 2NQYA 2WFF3 4LUKA 3ETPA 1WA6X 4OHVA 2DYCA 4PI0A 3WG3A 4MGZE 1W9TA 1CAWA 2XMLA 2ZACA 3OD0A 3TEXA 4DY5A 2B42B 1UOBA 2A73B 4TWTA 1Z7S2 4C0BA 2W5FA 1VMFA 3O5SA 1US2A 1UF2C 2B46X 2J1UA 3B93A 4FXKB 3T4VA 4AHZA 4DMIA 2FCVA 2JG9B 5H9SA 3P3PA 4YFZA 4ZZ8A 5FMOL 1H2NA 1YJLA 1UN1A 2DF7A 2W94A 3GCWA 4Q27A 3ZKYA 1SLLA 3CU7A 1VBC2 1GZWB 3J7HA 1Q8VA 3VN4A 2OT7A 3FUOA 1CIWA 1AJOA 1PIV2 4AVCA 4H7MA 4N90A 3UV9A 4XAEA 5J96B 3A0KA 3CEWA 2VUAA 3FE5A 3PVBB 4K3UA 2DUPA 3VBUA 4HETA 1OUSA 2YBSA 3GXUA 2VC9A 1C8M1 1DZRA 4RS5B 5B4NA 1JYWA 1RUE3 2R7EB 2HWC2 2CDOA 4PF1A 3AKRA 2R49A 4DXZA 1J83A 1ZRRA 3MW2A 3FN9A 2W39A 4N9IA 2BFUL 2FMDA 4LKEA 1Y43B 1OA3A 3BN6A 1CIYA 2EXIA 4AVAA 4UFLA 1WCKA 2AH2A 5LA1A 1EAH1 4CDWC 5CFCA 5KR7A 3WY6A 2R041 3PTYA 3WW2A 2JIGA 3JUUA 2Y6KA 1SHWB 2C5DA 1DGRA 1QXPA 2RJKA 2XB6C 1W8UA 1NCRC 1PO23 4XFIA 3AMHA 1W05A 4Q5OA 3UT0A 1SACA 2OXBA 3JQXA 1VBD3 3N7KA 1PMIA 2JG8A 1JYVA 3KCYA 3CQOA 4CCOA 1TG7A 2HWC3 1ACCA 3MGUA 4FFFA 3BTXA 1CQ9A 1FMD1 4LOSA 3DXUA 1ULGA 1DCSA 1RL3A 4LA2A 1X7NA 5C4WC 2VTFA 3ZPOA 4ZKTB 1I5ZA 4QT6A 3VDDC 5C3RA 3JZVA 4I0WB 3ALQA 2BERA 2PAKA 1C8NA 3CKHA 4BHPA 4CUCA 3OGJA 1OLRA 2OPKA 2HWB3 5C3QA 4B7EA 2JDKA 2D43A 3I7DA 2D5HA 4XVHA 1TMF3 1UW8A 2WAOA 1K5MC 4XYXA 2WS92 2QCSB 4LKFA 4IE0A 4YVSC 5GLVA 3KV9A 1UYPA 2Q0AA 2VW1A 1SG3A 3FHAA 2HEWF 3IAPA 4XEZA 4B8EA 2BGOA 2VVDA 3FLPA 4DUVA 2F17A 3L2HA 3ZXFA 4L8QA 3LZZA 1RUC3 2CGNA 4AVVA 3S30A 1LOAA 1S2BA 4LLOA 5BY5A 4BMEA 3DUIA 5FIXA 1RHI3 3RGBA 4DS0A 4MHUA 2WKKA 4CSWA 1MQTB 5SV8A 4A7YA 1UIKA 3IIAA 4CPBA 1NE6A 5TSWA 5JZGC 5A3UA 1OPMA 1O3SA 2ARAA 2VOWA 3FHIB 1XU1A 4KU8A 2SBAA 1I1EA 3MHZA 5FYIA 1AX0A 4QDQA 4YGCA 4XUOA 1JHNA 1U5ZA 5BNPC 4N43C 2JD4A 1RUJ3 3ECQA 1UCXA 5FZOA 4OULA 1XNBA 3U0ZA 3GALA 2QQUA 1U5YA 4QQLA 1KEXA 1OOPB 4IV3B 4DQAA 4GA9A 2WSUA 4FBFA 2ETEA 1R091 1S55A 4D6SA 2PHRA 2WNOA 1FOD3 4P00B 4LKDA 2N7GA 4JQTA 5J09A 1NOVA 1SPPA 2HJIA 3CDZB 1CAUB 2MEV3 4Q0PA 3H7JA 3UGFA 4W6WA 3PIGA 4XBLA 1YHFA 1ZZ7A 5C8CC 4A7KA 3ZSJA 3KVBA 1S0EA 2R072 5FP9A 3PU3A 5F37A 2ZX2A 2DCTA 3DKWA 1ALYA 3EYPA 3I2DA 3DPRC 1RUOA 2YGLA 5FZBA 3M3QA 3VBRB 3ITQA 3LEIA 1HRV3 3KT4A 4MGSA 2D3PA 1DGRN 3IT8A 5E88A 1C4RA 1G86A 3UK9A 4YVWB 1RUC1 3WG2A 1DYOA 4JAAA 2ZTNA 1L3JA 5KXBA 3LF7A 1PZ9A 2GH2A 2E63A 2RS11 1F4AA 4NMIA 1CPNA 2HWE2 4YG6A 3ZFFB 1NG0A 1XJAA 3ZN6A 4PIYA 2RHPA 5EJ3A 3PVOA 3POBA 5FYCA 4KMQA 4UW6A 4JKMA 3DKQA 5EHDA 5FREA 4U2AA 1OLME 2XXZA 2BTVC 4QB1A 5FKCA 2HWB1 2R042 2GMEA 4CDUB 1V6MA 4Y24A 2ZGLA 3O1MA 3BYWA 4NN0A 4DINB 2C26A 3Q8FA 5JSRA 2EAKA 3DEMA 5ERLA 1OOPA 2RJLA 4QU2A 3N35A 2J1SA 1DGWA 4OHWA 3T1MA 1RUJ1 5FPLA 4HPKA 4O65A 4XFFA 4XHBA 1GLHA 4QQPA 1JZ2A 2ARCA 5B4XA 1IKQA 4AF9A 2JG8C 2CWMA 2Z5WA 2XVKA 5J1XA 2HWC1 4BYYA 5DUWA 4QX0A 2RR11 5AC91 1PIV3 2AGSA 2ZHLA 3AMMA 4NIHA 3HQUA 2WZEA 4W8JA 5EWSA 5FZKA 2JDNA 2VUCA 5ACA2 3GBWA 4AK3A 3BIEA 4XJAA 3ZDVA 1TVGA 1RUI1 3X29B 4RHV3 2O8QA 4LE4A 1ONAA 4XABA 1VLNA 1DP0A 3NJXA 2RMU1 4B4PA 1UZVA 3W9AA 5I93A 4CPBD 1VBC1 4IESA 3A0NA 4JRLA 3OOXA 3I59A 1GMMA 5JZGA 1VRBA 3EO6A 3KHCA 3BPSA 3PURA 2K0GA 2YZ4A 5HCAA 1Z7S1 1EV11 3NKTA 1LHVA 4HN1A 4ARXA 4X6QB 1SCRA 3VBRC 1RUE2 1N3PA 5F5AA 2P17A 3HD8B 4Z07A 3MUZ1 1Q3EA 5LBCA 1JTZX 1R1A3 1JBCA 4CU7A 4OQ8A 1QH7A 2XKOA 3AM2A 2ADEA 2KA3A 2P3KA 1WZXA 3LEMA 3NV1A 2QQVA 3C7GA 4RGKA 3D8CA 3LGRA 4HBNA 4QD2A 2UWBA 4AEJA 5GM0A 1YUDA 4UW5A 1T6GC 4EN7B 4XILA 5FY9A 1TME3 4XDPA 3POEA 1MZ6A 1QDOA 4NHKA 4HKWA 5FYZA 5FY5A 4FPFA 3PUQA 4P9JA 2Q8EA 3WNNA 1H9PA 3WT3A 3ZXKA 4EN9B 4HVQA 2JE7A 1LU2A 1NQDA 1VR3A 4D8MA 1ND3A 2WSVA 4IE6A 4F3JA 3S5AA 3GGLA 3RMYA 4LHKA 1RUH1 4XQDA 4EWEA 2WZR2 2XQXA 1R081 3SKVA 1WCSA 3FBMA 4V2VA 4L99A 4IQPA 3OBTA 2D6NA 4UYBA 3WG1A 4JX0A 3WW4A 2XJPA 5I0SA 3RJ2X 4XZPA 3H1MA 4YRDA 1FV2A 1R082 5D1IA 5LK5A 4CZSA 5ANQA 3QLQA 1NZCA 3POYA 2VQAA 4A42A 2QQWA 3SQOA 3RQ0A 1FMD3 5JZGB 1PNFA 3AKQA 4XTPA 4BLJA 1WW6A 3GHNA 4KI5M 3ZLIA 4RR3A 1VBC3 1PM7A 1MQTC 3QBQA 4HOOA 1XU2A 3FC0A 1UMZA 5FZ7A 4ASLA 2VNVA 4LBMA 2ID4A 3POIA 5EP9A 1AXZA 1QF3A 4Q4W1 2O14A 2CL2A 5CFCC 1S0BA 2YV8A 4J6GA 4IETA 1RUF2 2PA7A 2IXLA 4CEWB 1C1FA 1Q8OA 4CP2A 5BNOB 1L7LA 4FOQA 1V6KA 3AVRA 3WF4A 1BCXA 1EV12 5C70A 3KT7A 3MIGA 4F7ZA 1VBB1 2BGPA 3K3OA 4M4RA 1QJY3 2B9UA 2EIEA 3P1IA 4FQZA 3ELNA 4AFMA 2IFWA 5KXEA 5E6HA 4UW3A 5GJ6A 5C6CA 5DUUA 3EB7A 3PIJA 3U4SA 5EIYB 2RMU2 3DCQA 5GLZA 1XSQA 1O3RA 3HNYM 1DZTA 1I6XA 1QJU3 3GJAA 2BPA2 1C8M3 3RFRA 5L9VA 2BVVA 2KR2A 3CLPA 3QH6A 4X8PA 4BLIA 4C91A 1FPN3 2E33A 3RPQA 4BQWA 3I3MA 3PUIA 1ZRDA 3WHUA 4EWDA 5A3WA 2CTVA 1MVEA 3SMHA 1LENA 1PVXA 3AXEA 1VAKA 2NMOA 1HQWA 1RJ8A 5FYTA 3T4HB 1X33A 5FZHA 3S5QA 5F3CA 5A33B 1IPJA 2VMIA 1COV3 4W6YA 2LTNA 4CCLA 5CNAA 5IVJA 1HXS2 2YFUA 1VBE1 4CDWB 2DVBA 4GB32 5IVYA 1RUJ2 2L9LA 3K2OA 1P8JA 3UKVA 4INDA 5I8YA 4WV8A 1XC6A 4QB6A 5L7OA 3AX4A 5GLTA 1ND2B 1W8NA 4GWIA 2XVGA 1KJRA 3O0XA 4K9SA 4LBNA 4ET7A 1UD1A 1C57A 4YVSA 5DG1A 3O12A 4ZS3A 2GNDA 3B7MA 3M7AA 2HEYF 2J1AA 5F3EA 5I0DA 3NO8A 5FMBA 4RFRB 3E1F1 1S1AA 5KHGA 2XL9A 3VHNA 1IQAA 3VBRA 1AR91 5FXZA 4GMP3 4URTA 2Y0OA 1RUC2 3MPBA 1ZZ8A 1W03A 1YRZA 4DXTA 3PTRB 1GUIA 5DABA 4AE2A 1ZVFA 3R4DB 5GZCA 1U12A 2WWJA 1EYBA 3U75A 2E51A 1KDMA 1XBFA 1H30A 3AMNA 2B5HA 1ZBA2 4GXLA 2BBVA 3SH3A 4QX1A 5IYYA 5E8AA 3A21A 1W2OA 2HYXA 2Z69A 4Q29A 4OI4A 1ZBE3 4TLGA 3MZHA 1YJKA 4IUGA 1GZTA 4QX2A 1W6QB 1FATA 1H9WA 1LCLA 1IS6A 2VZVA 1ZZ9A 4CCCA 1KRIA 3HBZA 4GZ9A 3MUY1 1GKBA 3KWVA 5FO7B 5BUVA 1JZ7A 1NLQA 2P3IA 1SFYA 1C3HA 1CONA 2ZS6B 3MYXA 4N53B 3ZYRA 4AEDC 1X50A 1AYN1 3HQXA 3HWJA 2C1FA 3UGGA 1ZRCA 2VOTA 3DXTA 3MEPA 1R64A 3N9OA 1AL0G 1Y4WA 1VALA 1NQJA 1ND2A 3F95A 4NOTA 3Q8CA 2Q30A 4AI9A 1AL23 4LBOA 1QJZA 2EALA 1ZA7A 5L7OB 3N9NA 3INAA 2B39A 5FPZA 3LQCA 1XPWA 3N36A 1CX1A 1JU3A 1WCDJ 4IEOA 1DIWA 1WMFA 5JXJA 4K8FA 4P14A 2VECA 4XIOA 4C1WA 2PAEA 3VKFC 5GLUA 4GJYA 3VDDB 1AR62 4W4ZA 3WW3A 1SMVA 4OHZA 1ASJ2 5AVAA 4GWMA 2WZ8A 4A2UA 5CAZA 3AB0A 1AYN2 1POQA 5T55A 2VD7A 1LESA 2YBPA 4RQPA 1YI7A 4DRVA 3KHBA 4CP0A 4P02B 5A7WB 2GMMA 3T2OA 3IDCB 2HWE3 2ZHMA 4QDRA 5DN2A 3OBRA 2IXIA 4Q4Y1 1AR71 2YPJA 5C9AA 1URXA 2P4EA 3J4UH 2DDUA 1W2NA 5D8AC 3VLBB 4BPZA 2WABA 2FDFA 2XHNA 4Y22A 2ZGRA 5LCWL 2VOKA 3U14A 3KV4A 3JBG2 3NKGA 5HCBA 4KBZA 1MS5A 4RD7A 2OQ7A 2G9ZA 4IEUA 4P9GA 3OEAA 4Y4RA 3MF9A 1Y7BA 4YZ3A 1AR93 2XWJB 3H8UA 3ZYJB 1R1ZA 3RZHA 5A6ZA 3CNAA 1ND3C 3APBA 4CP9A 2Y33A 4HT1T 1QNYA 1Z7S3 1EUUA 5LA9A 1VBA2 2YROA 4LOTA 3H3ZA 2W87A 3CF6E 2C6SA 1IPSA 4NPMA 4Q1RA 4YZ2A 5FZMA 4EZ4A 1R083 1DHKB 2DWRA 1YCIA 4AVSA 1CAWB 1G9BA 4JTOA 3J9SA 4QWNA 4R4ZA 2ENRA 3ZKUA 1IHMA 1MS8A 5KC6A 1WMXA 2VPVA 1W6MA 1PGSA 5LRRA 1QIQA 1UY4A 2WZR3 1O4ZA 4P9XA 1WLDA 4Q1PA 5GZFA 2Y6GA 5IFTA 3WSOA 4JHTA 4QGNA 1OH4A 2I2SA 2BW8A 3VL8A 5C8WA 1GQPA 2J1VA 1IZ3A 4RQPB 2D40A 3H9AA 4Y1ZA 4IV3C 1UX7A 4GB31 4NJ4A 1NYWA 1HXS1 2YPDA 3CHXA 2QQPA 4FFGA 1LTEA 2Y6FA 4I30A 5KBFA 3LSDA 4URAA 4LBLA 5K7PA 2JIJA 4HONA 5BNNB 2B7YA 5A32B 3NMBA 5BNOA 2WWSA 1GFF2 2R30A 3CMGA 5KC5A 2EAAA 2BQPA 4E4DX 3AZVA 2ILMA 5IK8A 2VE1A 3A22A 2RV9A 2WS93 4LIVA 2VM9A 2R061 2XG3A 2BNMA 5JWPA 1ZZ6A 5K8SA 5SV5A 1GZ9A 3DL3A 5FZIA 3FMGA 1BBT1 4K8RB 1UU5A 4LHNA 3TYJA 2V5DA 1BK0A 4JGYA 4QKBA 3OGGA 2DV9A 3N7JA 3WUDA 2W1UA 3LB9A 4MGQA 3CJIA 2V72A 2CGPA 2WDBA 2WWUA 1JYXA 3DPRB 1SLTA 3WR0A 1E5IA 4D94A 1Q8QA 5I8TA 1US3A 3OCPA 2X05A 5LWBA 4K40A 4TXWA 5FUPA 1OA2A 2ZJCA 5I0TA 2DVFA 1Y9MA 4JDMA 4XJZA 4NRPA 3LA7A 1GNHA 2OS2A 5C5UA 2W47A 4OUSA 4FQ4A 2RDSA 4YARA 1QJX1 2Q8CA 2WQZC 4HPKB 3ACIA 4LBQB 2QQKA 3RI8A 4LO7A 3N3HA 1V6NA 1YFWA 1STMA 4L97A 5CFDC 1Q5OA 2TNFA 3BTYA 4YZ1A 2KXLA 3I2KA 5CFCB 3AP7A 1G9CA 5JPMB 1IS3A 2IVJA 3POGA 4Y3OA 3GZTB 3VV1A 4BK4A 5FOJB 2MNGA 2RJ2A 5FZGA 1LRHA 5KHIA 2VMCA 1FV3A 3AJYA 2PHFA 4Y5TA 3NSTA 4LA3A 4HZFA 2QVSB 4W6XA 2JWPA 2OZ6A 5C4WA 4MOAA 3H1WA 2VZQA 3OGRA 2WZR1 4B1MA 2I07B 3RMXA 1XE0A 5D8AA 1GR3A 4META 2CHHA 3LE0A 5A3MA 2YU1A 2A6XA 3AYDA 5T54A 1X9TA 2YB7A 3EBRA 3BODA 1VB2A 2ZHKA 3T30A 3WP3A 2Z4FA 4LO5B 4NO4A 2CSGA 2VMGA 5IK5A 4QMAA 2BOJA 3LSEA 4HKOA 5CISA 1UZZA 4JGZA 1VRH1 1D4VB 1PVC3 3RYKA 3SH5A 2O8OA 4XMAA 3NRUA 2G9GA 4NROA 5ABJA 1S4CA 2F4LA 5FO9B 1F4HA 1POV3 4LJHA 3BU0A 3ZYPA 1YQ8A 4L2NA 1W04A 4NHLA 2RS33 1QQP2 3URFA 5FP4A 3AKSA 1AR73 4XTMA 3BI3A 4QHOA 5H9RA 4FOVA 2VGDA 3WLUA 1SPPB 2PHDA 3NQHA 4RR3C 4KGQA 4HG6B 1RUD3 1XQNA 3CIHA 5T5LA 2FMYA 5F6LB 2ZEZA 2EICA 1SLBA 2XONA 2CNAA 2HYKA 2D5FA 5FZ0A 2P1BA 2P6HA 5FYBA 4A44A 1LHWA 3FWEA 2BVBA 1OSGA 2UYBA 1HQNA 3TRSB 3VDDA 2VL4A 3RDIA 1SFNA 4U36A 4XFCA 2RR12 4QHBA 4QKNA 4LLFA 2XH6A 5JI9A 1C5HA 5FRAA 1QNWA 2ZOEB 4XUNA 1AR92 1D2SA 3AP9A 3C7OA 3VZMA 1DYKA 2G9FA 4HK8A 2OW4A 1CZVA 1OQEA 2MEV2 4BCUA 1UU6A 4FPGA 4LULA 1K5JA 5LW9A 1ZRIA 3WP5A 1HQLA 4NIDA 1W9FA 2GN3A 2VZTA 3ZSKA 2ZA9A 3VBUB 1CAUA 2PLV1 4QQHA 4I2OA 4RS5C 5CKNA 5DMYA 4MVTA 1UMIA 2HWB2 3FJSA 1VP6A 3MO4A 2VMHA 2JE8A 1OQDA 2OIIA 5HCHA 1W8WA 1ZBE2 3MLJA 4AG4A 3KV5A 2D98A 2WN3A 5E1RA 5A6QA 3BOPA 1J3RA 1VPHA 2I74A 1CD3G 4AGGA 4YW6A 3C7FA 4N7IA 2VXRA 5BNNC 2MHFA 2J42A 3C2UA 5F1RA 3ACFA 1DGLA 4S2DA 4BQ5A 3OYWB 3ZMNA 2GAUA 1JZ4A 1LULA 4G3YC 3ZN6B 1Y3TA 5IAXA 2DFCA 5JPNB 4LO6B 1WUVA 1C5IA 1LECA 5FZ6A 2R071 3FLRA 2GP5A 1ZM1A 4NE9A 3UETA 1UNBA 2WNVC 2OX0A 4TSVA 3WXPA 1HDKA 2VUJA 3KQRA 3M3EA 4KWKA 3ZYIB 5F9TA 4CXXA 2ORZA 4A6OA 5BNOC 1JI6A 4FP3A 2ARBA 1FOD1 3I59B 1OXCA 4V1PA 5C3PA 1H8TC 2BFUS 4X8NA 1XRUA 3AC0A 1OFSA 4BA6A 4XUTA 2FBEA 4GMP0 2I45A 3MIDA 4ORFA 2J1EA 1DLCA 2XLFA 5ANNA 5KXDA 3IB3A 2YFZA 4PHZA 3W58A 1EUTA 2VMEA 5BV6A 3JBG3 1NA1B 2K9ZA 1QJY1 5I0RA 4CXYA 1VBA3 3T3YA 2DTWA 2DTYA 2EIGA 3H50A 4NR1A 1RUD1 5EFUA 5FK8A 2VCMA 1MACA 2X09A 2GZWA 4P9LA 1QHDA 3BB6A 4YVSB 3B01A 5FCCA 2NN8A 2UURA 1F31A 4WM7B 4E4HA 5C7GA 1HJGA 3TN92 4BH9A 1A78A 5L19A 1JH5A 4M0HA 3VD3A 3LPFA 1BMV1 5G05L 1G7YA 4M3CE 3HQRA 5JOWA 3KZ4C 1W6NA 1RHI1 4QXHA 3BUCA 3A7QA 1UPSA 2AUYA 1Q8SA 4IEYA 1D4M2 1V6JA 4GWNA 2PHXA 2XOMA 4XW3A 2QQIA 5JOZA 3Q8BA 2WA4A 3LEKA 4QKFA 1U5IA 1EPWA 3ZM8A 5C33A 1AF9A 2WAAA 4PDWC 1K5MA 4DZGA 3HEIA 3T0DA 2ZX0A 1RUH2 4UFHA 3WDWA 4BE3A 5JDBA 2VCAA 3VHRA 4CU9A 2W1SA 3AP4A 1VMJA 4BQXA 2Y38A 2R32A 3UKNA 4CDXA 2AR6A 4LBQD 2XGXA 4XJ9A 4GQ7A 1KQRA 4IV3A 3RZKA 4XFHA 1O7FA 1NCQC 5K0UA 2X5IB 4LBQA 1UMHA 4E27A 3RNSA 2WQ4A 3LOIA 4YLZA 4AHXA 3M70A 5F6KA 4YM0A 3VDAA 2IXCA 4BISA 4GB33 3WNPA 2GDFA 4B29A 4GH4A 3AMPA 1AX2A 1R1A1 1X8MA 2ZGPA 2B9VA 1OLQA 3AJZA 2RS52 4JHZA 1RVF3 2QZ3A 4GJZA 3GCXA 3VZLA 4BOWA 2HEVF 1DQ6A 1W28A 1JOBA 2ZEWA 4DFSA 4E8DA 1MVQA 4EE2A 1OURA 3T08A 3FL7A 3ZFEA 4AI0A 4MO3M 4JGYC 1IQDC
chains in the Genus database with same CATH topology
5FJKA 4LITA 4UF0A 3KV5A 5FZDA 2XXZA 2OS2A 2XDVA 4GJYA 5FWJA 3AVRA 2Q8CA 2XUEA 5FZLA 5FY1A 5IWFA 5FYMA 4QX7A 3K3OA 4EZHA 2VD7A 5F2SA 2YBPA 4CCOA 3PDQA 5E6HA 5FZ9A 5A7PA 5A7WB 5FZ6A 5FPLA 4TN7A 5A7NA 5FZOB 4Y3OA 5F3GA 4XDOA 2GP5A 2YU2A 3U4SA 4ASKA 2P5BA 2YBKA 2OX0A 3DXUA 5FZGA 4D6RA 3N9PA 3PUSA 5FY0A 4NUBA 4Y33A 5FZ3A 3ZPOA 3N9LA 5A80A 5LY1A 5FZKA 3KV4A 3PUAA 2OQ7A 4LXLA 5F3IA 4Y4RA 5A3WA 4D6QA 3OPWA 4UF0B 3PU8A 5A3TA 5F3CA 5FYTA 5FZHA 2YU1A 3LDBA 3AL5A 4CCLA 5FY7A 5IVJA 3NJYA 3KV9A 5FXVA 5A7SA 5K4LA 5FP3A 4IGQA 5CEHA 5IVYA 3K2OA 5FPAA 5FPVA 5FZ8A 1VRBA 4GD4A 3PURA 5FBJA 4LIUA 5FYYA 4CCJA 5FZEA 5FZMA 4EZ4A 5IVFA 5FV3A 5F2WA 4CCNA 4BXFA 4QXCA 3U78A 4E4HA 5FXXA 3UYJA 4QWNA 5FZAA 4CSWA 5A7OA 5FJHA 5F39A 5F5AA 4BU2A 4QXHA 5FXWA 5A7QA 4CCMA 5FYSA 4CUGA 5F3EA 4AAPA 3AVSA 5FP4A 5FP8A 4C8DA 5FXZA 3RVHA 4IGPA 5FY8A 4GAZA 5FYIA 2XMLA 4QXBA 4QU1A 5FZCA 5FWEA 5FY9A 2PXJA 5A7WA 5IVBA 5FYUA 4XDPA 2YPDA 3N9QA 3PTRB 5FZOA 5IVCA 5FYZA 5FY5A 5FZFA 5A3PA 2WWJA 3PUQA 3AL6A 2Q8EA 5FZ0A 5IW0A 5A1LA 5IVVA 5FZ1A 5LY2A 3N9MA 5FYBA 4URAA 5A3NA 4EYUA 5ISLA 4D6SA 3OPTA 4HONA 5FP7A 4DO0A 4V2VA 2OT7A 5F5IA 2GP3A 5FYHA 5KR7A 4IGOA 4LIVA 3KVBA 5FYVA 4V2WA 5ANQA 5FP9A 3PU3A 5FPBA 2YBSA 5FUNA 5FZIA 5F37A 5F5CA 5IVEA 4BISA 4CCKA 3KVAA 5LW9A 5FZBA 4DIQA 3ZLIA 4QX8A 3LD8A 3KV6A 2WWUA 3DXTA 5FZ7A 4HOOA 3N9OA 2OQ6A 5A1FA 4GJZA 5FY4A 5FZ4A 5F32A 4AI9A 5FPUA 2W2IA 3N9NA 5LWBA 5FUPA 5FYCA 3K3NA 2Q8DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FJK A;  4LIT A;  4UF0 A;  3KV5 A;  5FZD A;  2XXZ A;  2OS2 A;  2XDV A;  4GJY A;  5FWJ A;  3AVR A;  2Q8C A;  2XUE A;  5FZL A;  5FY1 A;  5IWF A;  5FYM A;  4QX7 A;  3K3O A;  4EZH A;  2VD7 A;  5F2S A;  2YBP A;  4CCO A;  3PDQ A;  5E6H A;  5FZ9 A;  5A7P A;  5A7W B;  5FZ6 A;  5FPL A;  4TN7 A;  5A7N A;  5FZO B;  4Y3O A;  5F3G A;  4XDO A;  2GP5 A;  2YU2 A;  3U4S A;  4ASK A;  2P5B A;  2YBK A;  2OX0 A;  3DXU A;  5FZG A;  4D6R A;  3N9P A;  3PUS A;  5FY0 A;  4NUB A;  4Y33 A;  5FZ3 A;  3ZPO A;  3N9L A;  5A80 A;  5LY1 A;  5FZK A;  3KV4 A;  3PUA A;  2OQ7 A;  4LXL A;  5F3I A;  4Y4R A;  5A3W A;  4D6Q A;  3OPW A;  4UF0 B;  3PU8 A;  5A3T A;  5F3C A;  5FYT A;  5FZH A;  2YU1 A;  3LDB A;  3AL5 A;  4CCL A;  5FY7 A;  5IVJ A;  3NJY A;  3KV9 A;  5FXV A;  5A7S A;  5K4L A;  5FP3 A;  4IGQ A;  5CEH A;  5IVY A;  3K2O A;  5FPA A;  5FPV A;  5FZ8 A;  1VRB A;  4GD4 A;  3PUR A;  5FBJ A;  4LIU A;  5FYY A;  4CCJ A;  5FZE A;  5FZM A;  4EZ4 A;  5IVF A;  5FV3 A;  5F2W A;  4CCN A;  4BXF A;  4QXC A;  3U78 A;  4E4H A;  5FXX A;  3UYJ A;  4QWN A;  5FZA A;  4CSW A;  5A7O A;  5FJH A;  5F39 A;  5F5A A;  4BU2 A;  4QXH A;  5FXW A;  5A7Q A;  4CCM A;  5FYS A;  4CUG A;  5F3E A;  4AAP A;  3AVS A;  5FP4 A;  5FP8 A;  4C8D A;  5FXZ A;  3RVH A;  4IGP A;  5FY8 A;  4GAZ A;  5FYI A;  2XML A;  4QXB A;  4QU1 A;  5FZC A;  5FWE A;  5FY9 A;  2PXJ A;  5A7W A;  5IVB A;  5FYU A;  4XDP A;  2YPD A;  3N9Q A;  3PTR B;  5FZO A;  5IVC A;  5FYZ A;  5FY5 A;  5FZF A;  5A3P A;  2WWJ A;  3PUQ A;  3AL6 A;  2Q8E A;  5FZ0 A;  5IW0 A;  5A1L A;  5IVV A;  5FZ1 A;  5LY2 A;  3N9M A;  5FYB A;  4URA A;  5A3N A;  4EYU A;  5ISL A;  4D6S A;  3OPT A;  4HON A;  5FP7 A;  4DO0 A;  4V2V A;  2OT7 A;  5F5I A;  2GP3 A;  5FYH A;  5KR7 A;  4IGO A;  4LIV A;  3KVB A;  5FYV A;  4V2W A;  5ANQ A;  5FP9 A;  3PU3 A;  5FPB A;  2YBS A;  5FUN A;  5FZI A;  5F37 A;  5F5C A;  5IVE A;  4BIS A;  4CCK A;  3KVA A;  5LW9 A;  5FZB A;  4DIQ A;  3ZLI A;  4QX8 A;  3LD8 A;  3KV6 A;  2WWU A;  3DXT A;  5FZ7 A;  4HOO A;  3N9O A;  2OQ6 A;  5A1F A;  4GJZ A;  5FY4 A;  5FZ4 A;  5F32 A;  4AI9 A;  5FPU A;  2W2I A;  3N9N A;  5LWB A;  5FUP A;  5FYC A;  3K3N A;  2Q8D A; 
#chains in the Genus database with same CATH topology
 1PM4 A;  5I91 A;  4YVW A;  2HWD 1;  2UWA A;  4BIF A;  4DB5 A;  5FZD A;  5CAD A;  1ENR A;  4HN0 A;  1W2T A;  1F15 A;  1UKG A;  3IDB B;  4L0P A;  2WN2 A;  3LFM A;  4AI3 A;  5A6Y A;  4XFG A;  4QPI B;  2XUE A;  1IOA A;  4AQS A;  1QDC A;  3ZR5 A;  1YI9 A;  3T0A A;  5JSP A;  2IXH A;  3ETQ A;  5CIR A;  3WF1 A;  3WNK A;  4IE5 A;  2EA7 A;  4AI1 A;  1H8T A;  5T5O A;  3HN3 A;  1QJU 2;  1M06 G;  1WBL A;  1H2M A;  2JD9 A;  2ZX4 A;  4R9A A;  2YBK A;  3HBK A;  2G1M A;  3OBZ A;  2R06 3;  1LHN A;  3PUS A;  3VZJ A;  4HMZ A;  1A34 A;  5DUX A;  3N9L A;  1S0F A;  2RM2 3;  4ZS2 A;  2X5I A;  1E57 A;  3R05 A;  1AXK A;  5EXO A;  1V00 A;  3IDE A;  4IXL A;  3VBH B;  2DVA A;  1JU4 A;  1YFY A;  3OGS A;  5FKB A;  2XJR A;  3QCW A;  1W8H A;  4Q4V 3;  2P6C A;  3I54 A;  1GNZ A;  4AFC A;  1RVF 2;  2Y6J A;  1EV1 3;  3IDA A;  5FBZ A;  3PU8 A;  4BQ4 A;  3KGZ A;  1OT5 A;  1VMH A;  4FFI A;  4GH4 B;  1TMF 1;  3I49 A;  2NYY A;  3K51 A;  1PX3 A;  3NJY A;  1OD5 A;  1WW7 A;  1HN1 A;  1NT0 A;  4ITC A;  3HIF A;  4ATF A;  1VRH 3;  4E4Z A;  4LHL A;  1BZW A;  3ZIW A;  1PGL 2;  5FYY A;  3JB8 A;  5FR3 A;  2RS1 2;  2SLI A;  1W6M B;  4N8M A;  2RMU 3;  3RSJ A;  5JMO A;  2AEZ A;  2FDK A;  5HXV A;  1JN2 P;  4XAA A;  3PME A;  4WVZ A;  3POF A;  1TEI A;  1FPN 2;  3B9I A;  1SQ4 A;  5F39 A;  1JOP A;  4IEW A;  2E7T A;  3VKO A;  1BVV A;  1YQ2 A;  3WCR A;  1Y9G A;  3IKW A;  1C28 A;  4PBO A;  1OVP A;  4QPI A;  5L7O C;  1X36 A;  2ES3 A;  2XVL A;  4Q8K A;  4MXW A;  1NZI A;  1YC6 1;  2LRO A;  1QOS A;  4Z1V A;  1LJ7 A;  1OKQ A;  4NAM A;  3U10 A;  3GZA A;  3LA2 A;  1RTV A;  3ACH A;  3I8T A;  3KLS A;  2RM2 1;  2PXJ A;  3BTZ A;  3CJI C;  4WVV A;  4D7T A;  4ONU A;  1OLM A;  1GWM A;  2XUM A;  3KF5 A;  2TBV A;  4IE7 A;  1NCQ A;  4EN6 B;  5JUV A;  1H0B A;  2CGO A;  4C90 A;  5IW0 A;  1XSR A;  1D4M 3;  2VH9 A;  1OFN A;  2Q1Z B;  3ZXD A;  4EQV A;  1VIW B;  3M1H A;  1R09 3;  2ZAH A;  2HWF 3;  1HW5 A;  5HCF A;  4BWO A;  1DLL A;  5F5I A;  1X9P A;  1VAM A;  3TNQ A;  1POV 1;  2CYF A;  3EXU A;  4PJY A;  2JDH A;  5GZD A;  4OMD A;  3TNP B;  1DQ5 A;  1AR6 1;  2UU8 A;  1YIF A;  2NMN A;  2AC1 A;  4MLO A;  3W21 A;  5C8C B;  1B35 B;  4LHS A;  4W50 A;  1QQP 3;  2D3R A;  4HXC A;  3LPG A;  4FPH A;  4AGR A;  3PUH A;  1W9W A;  3FLT A;  5DZG A;  3NNF A;  2P34 A;  2W0X A;  3DYP A;  4JDN A;  4KBB A;  4RSU A;  4RN5 A;  5FLH A;  4UFM A;  1MS1 A;  3OB8 A;  3KQ4 B;  4I09 A;  2PHW A;  1OC1 A;  3HR9 A;  1LU1 A;  4JZR A;  3JQW A;  3USS A;  3III A;  5KXC A;  4MGK E;  5FTT C;  4BIO A;  2JDP A;  3L9J T;  2RDQ A;  3VKN A;  4MG2 A;  4QX3 A;  1W3X A;  2Y64 A;  2OVU A;  1DG6 A;  1LHO A;  2XJQ A;  5FMC A;  1JZ5 A;  2XBO 1;  2A3W A;  2D6O X;  4LMF A;  4BDV B;  1YEW A;  2XDV A;  2EXJ A;  4CP1 A;  5FWJ A;  5C9A B;  1W6O A;  1A6C A;  3V0B A;  1C1L A;  1CPM A;  3ZFE C;  3WNO A;  2ZEY A;  4FOY A;  1UYZ A;  3NW4 A;  4Y22 B;  2WFF 1;  1UWW A;  4QX7 A;  4XCA A;  4FTE A;  4EZH A;  4PCR A;  2ARX A;  4HAN A;  4AEM A;  3FFZ A;  1FI2 A;  5FAX A;  1G6N A;  3J8F 3;  2NM1 A;  5LEJ A;  1ZBA 1;  5A7N A;  3U1X A;  5LK7 B;  2W9X A;  1MEC 2;  2WO7 A;  3RZJ A;  2V4A A;  2VQU A;  2BBA A;  3NJV A;  4R9B A;  4XCB A;  1AJK A;  3AYE A;  4Y33 A;  4AOC A;  4YW3 A;  5IT6 A;  4FTS A;  1ULC A;  4E2G A;  5K0U C;  1BEV 1;  4LBJ A;  4QGL A;  2PHL A;  4O61 A;  3PUA A;  1L7R A;  1ZBE 1;  2LS6 A;  4Q0Q A;  2QZ2 A;  3ZVX A;  1PVC 2;  2ZBJ A;  4HKL A;  4XE9 A;  1YNA A;  1UL9 A;  3VZN A;  1RJ7 A;  3OEB A;  4UF0 B;  2X5I C;  3ACL A;  3M3C A;  4XMI A;  3GDB A;  1D0G A;  1SLC A;  3MIB A;  4D3W A;  2DU1 A;  3ILF A;  4HLT A;  2PLV 2;  4JGZ B;  3SEP A;  1YIP A;  1EAH 2;  3AFK A;  4DXR A;  1GOH A;  1KGY A;  1W6P A;  4GD4 A;  3OF1 A;  4PQ9 A;  5KHK A;  1H6Y A;  4KNC A;  1COV 1;  2WA3 A;  4M3C B;  5FZE A;  4PLO A;  4QPI C;  4GMP 1;  3VZK A;  4AHY A;  3EJK A;  3KF3 A;  1PVC 1;  4FPO B;  2VBP A;  4QXC A;  3WDY A;  3H8O A;  2X29 A;  3NAP C;  4G4F A;  5FZA A;  3QOP A;  3E5U A;  2A7A A;  4N9H A;  5M0T A;  1DYP A;  1RUG 3;  2P3J A;  3ZYB A;  1NAE A;  4CDU C;  2H0V A;  5FYS A;  3WNL A;  1APN A;  1GNY A;  3ATG A;  3ORJ A;  5GAL A;  1MZF A;  4XBQ A;  2YDE A;  2YY1 A;  4IE4 A;  2CAU A;  4KWU A;  3VZO A;  1PO1 3;  1MZE A;  2ZGS A;  4WM8 A;  5I0U A;  4Z8B A;  5FWE A;  5BNQ A;  5IVB A;  2A6Y A;  4IER A;  1LR5 A;  3LCP A;  4XFB A;  1ND2 C;  2IVI B;  1FYU A;  5GZE A;  2JDY A;  4NVP A;  3RZM A;  2F6B A;  4Q4V 1;  3ZFG C;  5A1L A;  2RS3 2;  2VJX A;  2Y6H A;  3N9M A;  1OI6 A;  4I3P A;  4KWL A;  1H1A A;  5BNP A;  4C0H A;  1GP5 A;  1AR8 3;  4AVT A;  3CO2 A;  2D6M A;  2XJV A;  4FP2 A;  5KHH A;  2V4V A;  4DPN A;  4DEQ A;  1IG3 A;  4IEQ A;  3CJI B;  3IAQ A;  2ZGN A;  2VCB A;  1LB2 A;  1PGW 1;  2GP3 A;  1SCS A;  5FYH A;  2VCC A;  2IUW A;  4BQ3 A;  2GMP A;  3WQ1 A;  4AI8 A;  3E6D A;  1GBG A;  2A75 A;  5C5T A;  2R1D A;  3V64 A;  5IUQ A;  3UNP A;  3MLL A;  3C8X A;  2VG9 A;  3O1R A;  3THP A;  5I8S A;  5FO8 B;  1G9F A;  1TE1 B;  1GWL A;  3OUH A;  3P5B A;  4OYU A;  4PDW B;  4BQY A;  5A32 A;  5LRS A;  4MHR A;  2JXA A;  4MSV A;  4A6S A;  3NAP B;  3LEG A;  3DYM A;  2ATF A;  5A1F A;  2HWD 3;  4XZU G;  4QPG C;  1LOC A;  2BV4 A;  5C71 A;  3POW A;  1XYP A;  2FCT A;  2FD8 A;  3ZYF A;  4ES9 A;  4JGY B;  1ND3 B;  4ATE A;  1IS5 A;  2WT1 A;  4XIK A;  2VZS A;  2NLR A;  2DCJ A;  2ZMN A;  1WWY A;  1BYH A;  3N4M A;  4Z2A A;  1LED A;  1KS5 A;  2WNU A;  3B5L B;  4RFT 0;  2QQL A;  4PI2 A;  1WCQ A;  2EF6 A;  2QQM A;  3SC7 X;  1PK6 C;  3SNM A;  4Q4X 3;  3O1P A;  3ME2 A;  5IHR A;  2O0O A;  3LDK A;  4P9Y A;  4M00 A;  2RG4 A;  3OTF A;  2JG9 A;  3PDQ A;  4TZD A;  3O1V A;  5A7P A;  4XJ8 A;  3CZJ A;  3W5N A;  1OQ1 A;  5D8A B;  2Z79 A;  3HJR A;  4TN7 A;  5BNP B;  5FZO B;  5C3S A;  3M3I A;  4XDO A;  1JZ6 A;  2YU2 A;  4NIG A;  5T52 A;  4CYD A;  4DY3 A;  1DQ1 A;  4D6R A;  4NRQ A;  2A6V A;  5JXG A;  3THT A;  5IAT A;  2DCZ A;  3K75 B;  4Y1X A;  1O3Q A;  3DYO A;  4P9I A;  4MXW B;  4E9K A;  1QY4 A;  1FPN 1;  5D2A A;  3NV4 A;  4P5H A;  1RUG 1;  3Q8A A;  1UY2 A;  1AYN 3;  3D4K A;  4LXL A;  1TMF 2;  3KSC A;  4WVM B;  4COV A;  1U5X A;  4BJ0 A;  4CEW A;  1ZZB A;  5C9A C;  3VUO A;  2IZW A;  3S6P A;  1Q56 A;  4IV1 B;  4QPG B;  1PGL 1;  1HB4 A;  3JXS A;  4CTE A;  1RUE 1;  2D97 A;  4KWJ A;  4PDW A;  4ISQ A;  1HRI 3;  5LAS A;  1O4Y A;  4HSJ A;  5K4L A;  3ZSL A;  3K46 A;  5C4W B;  2OPW A;  4QM9 A;  1S0J A;  4IL7 A;  3HT2 A;  2OYZ A;  4BMB A;  1W6N B;  4COZ A;  3WNM A;  4JVA A;  1YO8 A;  1YWK A;  2ZHN A;  1N47 A;  4Y1V A;  4XQW A;  1A8D A;  2WLQ A;  4JGZ C;  3CL1 A;  1UZ0 A;  4UFK A;  2HBU A;  4YW4 A;  5F8P A;  2OA2 A;  4RGG A;  2E6V A;  2E31 A;  4GAL A;  4OUE A;  1NUK A;  4Y20 B;  2QKD A;  4IDZ A;  5AC9 2;  1UX6 A;  1H2K A;  3J7M A;  4LTA A;  3AXD A;  3DN7 A;  2VZU A;  2Q5T A;  1AHS A;  5IVV A;  1GV9 A;  4YGD A;  1N1S A;  1JYI A;  3TAY A;  4DOU A;  1DZQ A;  1O5U A;  4OVE A;  2LRP A;  1K42 A;  1UQX A;  1KD7 A;  3MBW A;  1JYT A;  3HNM A;  2WO2 A;  1A8M A;  1NLS A;  3IMM A;  4IV1 A;  2X53 S;  3K4D A;  4IGO A;  2P37 A;  2RS5 1;  3VB9 A;  4V2W A;  3MFA A;  5CFD A;  3VDB A;  1MZ5 A;  1W39 A;  5GLW A;  3FBY A;  1OHF A;  1R1A 2;  4ZON A;  1VJ2 A;  3KVA A;  4MGY E;  4CCK A;  2CWS A;  2HWE 1;  1ZRF A;  5J48 A;  1QWR A;  1J1L A;  3V56 A;  4N43 B;  3RI9 A;  2NP0 A;  1WBF A;  2CDP A;  2WIN B;  2OQ6 A;  4B1L A;  1JMU B;  1K3I A;  3S0M A;  3DEC A;  5FPU A;  2XBO 3;  1L7Q A;  4LEJ A;  2Y26 A;  1AL2 1;  2W1W A;  2PQS A;  5HV4 A;  2BU9 A;  4NPR A;  5HV0 A;  3H3L A;  1CAX A;  3DPR A;  2ERF A;  4UF0 A;  1I5P A;  5EV7 A;  2YGM A;  5HBA A;  2BP6 A;  4P5Y A;  3IPV A;  4OI2 A;  4IEX A;  4BQ2 A;  4LR4 A;  4BQ1 A;  2WT0 A;  1XE7 A;  3USU B;  2IXJ A;  4FTB A;  4DUW A;  1VBB 3;  4EV0 A;  4COU A;  2PHT A;  5FZL A;  5ACA 3;  2YUE A;  1W6P B;  1HRI 1;  4QPW A;  4M3C A;  5EJ1 B;  4BK5 A;  2W3J A;  3I97 A;  4TTG A;  1CJD A;  1BXH A;  1ZX5 A;  3M2M A;  3PL0 A;  1XNK A;  5JIA A;  1WLC A;  1H4H A;  1E5R A;  2IWG B;  2ZGT A;  2ZZJ A;  4B7K A;  1PX4 A;  4E2Q A;  4Z92 B;  1PO2 2;  1KFU L;  1ASJ 1;  1NA1 A;  4P08 A;  1ZNP A;  3AP6 A;  2VTX J;  5FDB A;  4I3G A;  5L36 A;  5LY1 A;  3KCC A;  4CUB A;  1BMV 2;  2JB8 A;  1CAV A;  2KM2 A;  5T3N A;  1V9U 3;  3ABZ A;  3MV1 1;  1QJY 2;  5FK7 A;  3ZMO A;  1WGP A;  5DPN A;  4FPK A;  4ZY9 A;  5CB7 A;  1GP6 A;  3GBF A;  3FHQ A;  1PGW 2;  1KFX L;  2D44 A;  3MV0 1;  4QXK A;  5DQ0 A;  3O1T A;  1RC6 A;  5DAV A;  3RRD A;  3ZFG A;  4N43 A;  1RUD 2;  4R8H A;  2Y0I A;  3L2Y A;  1RMU 3;  1NXM A;  1Z0H A;  2BNO A;  3HAG A;  1OA4 A;  3M3O A;  5CVR A;  5A7S A;  2ZGU A;  5CEH A;  5FQ0 A;  1LOF C;  2RS3 1;  2C9A A;  3NNJ A;  1LEM A;  4ZU4 A;  5JAX A;  1UXX X;  5F2W A;  1IG0 A;  1XB9 A;  1UPI A;  1W3V A;  2EVX A;  2YC0 A;  1XE8 A;  2YHJ A;  5FXX A;  4H2A A;  2CU5 A;  3ES1 A;  1RB8 G;  1BJQ A;  4AFD A;  2V09 A;  3OD4 A;  4B4Q A;  5A1A A;  4MX3 A;  4FPY A;  4WZC A;  1K12 A;  1RXG A;  2FQP A;  2ET1 A;  3NNG A;  4CUG A;  3GM8 A;  1XYN A;  3WVJ A;  4NWW A;  1CWP A;  1ODN A;  1POV 0;  1H2L A;  2VOX A;  3I3D A;  4KU7 A;  3NAP A;  4WM7 A;  4IEP A;  5K0U B;  2WRA A;  1JHJ A;  3N9Q A;  1EPZ A;  3VBO C;  2CV6 A;  3ZDS A;  2HBT A;  5FZF A;  1T6B X;  1S0G A;  2VTX A;  4L92 A;  1COV 2;  4XFA A;  1HX6 A;  5H9Q A;  5A3P A;  5J36 A;  4IV1 C;  4KG0 A;  2WFP A;  1DF0 A;  1SBE A;  2A6Z A;  2QQO A;  3OPT A;  4QDS A;  2WO1 A;  1RED A;  1W2A X;  4NHX A;  4QX5 A;  5FP7 A;  4AWD A;  4AW7 A;  5C8C A;  3B02 A;  2AZ5 A;  1KXG A;  5JXI A;  1X82 A;  1K5M B;  3K4Z A;  4UBG A;  1LGC A;  3I2H A;  2XLG A;  3I2G A;  4K21 A;  1RUF 3;  5JLV A;  4BXS V;  4OLL A;  4CUA A;  2J7M A;  3VBF C;  1TZO A;  2JG8 B;  3O0V A;  4OI1 A;  1S0D A;  2R1B A;  3PLQ A;  1ZYB A;  2WNV B;  4LOR A;  3I2I A;  1NLR A;  4XUQ A;  3E5Q A;  4CU6 A;  5FUN A;  2A70 A;  3SLI A;  4DIQ A;  1ST8 A;  5HXM A;  5LZ6 A;  4J25 A;  1W06 A;  2R6Q A;  2YMZ A;  2WR9 A;  1MEC 1;  5J37 A;  1VBE 2;  4YM2 A;  3G6J B;  1JZ8 A;  2QDR A;  5APA A;  1QOT A;  3B9C A;  4FFH A;  2A6W A;  3GBG A;  1JS9 A;  2WLP A;  1PNG A;  2BDR A;  3HT1 A;  4I0B A;  4CDQ A;  1UXZ A;  2QNK A;  3HMY A;  3ZSM A;  1ULO A;  1X8E A;  1NCR B;  3W59 A;  4WBB A;  1B35 C;  2BUK A;  2XBO 2;  2R16 A;  1J58 A;  4RL7 A;  3J7N A;  4FAH A;  5JOY A;  3AP5 A;  5F2S A;  2D7F A;  1OD3 A;  2WYF A;  4MGT A;  4GIQ A;  4AED A;  4Y5S A;  5KHJ A;  1V70 A;  4UXA A;  5IK7 A;  2QQN A;  1E5S A;  4XF0 A;  4PQQ A;  1O5L A;  2P5B A;  1RYY A;  2JEC A;  4NII A;  2QQJ A;  3WP6 A;  2E7A A;  3I3E A;  2W08 A;  3D3A A;  4AFB A;  1HIX A;  4NUB A;  4Y5Z 0;  1CX4 A;  1SDW A;  1WA4 A;  3WX5 A;  2HH9 A;  2RE9 A;  1O6U A;  1ODM A;  1WD4 A;  3SCG A;  1PK6 B;  4PBP A;  2OKX A;  2WNV A;  3CJX A;  5DDJ 3;  4NRM A;  2P2K A;  2XJS A;  4A4A A;  4FXG B;  1RUF 1;  3OPW A;  3DF0 A;  5LBF A;  5DDJ 2;  4DXS A;  5A3T A;  4FSJ A;  2DUR A;  3TWI A;  4UOJ A;  4D7S A;  3KM5 A;  4K1Y A;  1GQG A;  4MAD A;  2ZGQ A;  3HNB M;  4PF5 A;  2NZ9 A;  5K9Y A;  5LA2 A;  4QHZ A;  4N53 A;  5FPA A;  5FPV A;  5LBE A;  1MS0 A;  5A3L A;  5DAW A;  4CCJ A;  4LIU A;  4D0Q A;  1F2N A;  3M4F A;  5IFP A;  3H3U A;  5LBB A;  4BXF A;  4RHV 2;  4Y4Y A;  3AFG A;  3AMQ A;  3WCS A;  3DGT A;  5GKA C;  1TME 1;  3O14 A;  4Q0V A;  5FJH A;  2VU9 A;  5T5J A;  4BU2 A;  3MIH A;  2VVE A;  1NCQ B;  1XXN A;  4JQR A;  3IZO A;  4LUM A;  4K6B A;  1QJF A;  3RZZ A;  3SXW A;  3AVS A;  2UY9 A;  4QQO A;  2BRT A;  2VBD A;  1HV0 A;  1W8Z A;  1FNZ A;  2XHK A;  5FY8 A;  3H7Y A;  3RVH A;  5J3U A;  5FZC A;  2ZEX A;  3LDR A;  4O7X A;  1TNF A;  3ZSE A;  4LQR A;  3VKL A;  2WJS A;  5A6X A;  5DXD A;  3ZFF A;  1ENS A;  2JKB A;  2VUL A;  4FVV A;  2WYS A;  5IK4 A;  1ULP A;  2VZ3 A;  3B00 A;  5J98 B;  4J1W A;  3PVN A;  1NY7 2;  1RUI 3;  4LK7 A;  3VBO A;  1QXR A;  1GQH A;  1Q8P A;  2ZML A;  2XJU A;  2QBX A;  4AR2 A;  1LOB A;  1F35 A;  5CG9 A;  2OZJ A;  2ZX1 A;  1O4T A;  2PYT A;  4RQP C;  1BBT 2;  2WNU C;  4CA9 A;  4CDX B;  2PFW A;  1ENQ A;  2OUH A;  2EIB A;  1CES A;  1PMJ X;  2O1Q A;  2VNR A;  4R52 A;  4S2F A;  1BBT 3;  2DCY A;  1UY1 A;  2VVF A;  1LKN A;  2Z2S B;  1GOF A;  5FYV A;  4ASM B;  5EYY A;  2H6C A;  1HRV 2;  3N7M A;  3SCH A;  2ZGO A;  1RXF A;  2D6K A;  1A3K A;  3OY8 A;  4QX8 A;  5F7U A;  1VAV A;  4OI0 A;  1ASJ 3;  1GZC A;  3Q9O A;  1W6O B;  4CDQ C;  2R06 2;  5E16 A;  1QJU 1;  3I2O A;  1UZY A;  2QTW B;  2Y6L A;  2PQQ A;  1XNC A;  3B94 A;  2RS1 3;  4I0A A;  4ZXE A;  5T5P A;  1B35 A;  2W2I A;  4JTN A;  3HN1 A;  4JKL A;  2W95 A;  3OGV A;  2AEY A;  4IEZ A;  4XXA A;  4AHW A;  4D7Y A;  2DU0 A;  4YSF A;  2WNU B;  4ZU5 A;  3VD9 A;  1J1T A;  3WDU A;  4WZF A;  3K3N A;  2C4X A;  5ACA 1;  5JR2 A;  2QDN A;  4GUL A;  4PIZ A;  3JD7 2;  4ERO A;  2GC1 A;  2HWD 2;  2AEN A;  2QJV A;  1JXN A;  4QPY A;  5IWF A;  4Q2F A;  2F4P A;  2ZGM A;  4CXW A;  4L9B A;  2B4K A;  3ZXA C;  1HV1 A;  2EXK A;  1GYK A;  2VZR A;  2LW8 A;  5JMC A;  4YYO A;  3H42 B;  4IW3 A;  3IWZ A;  3ZO0 B;  1MPX A;  2BYV E;  2K46 A;  1XOY A;  1AX1 A;  2W52 A;  3T2P A;  1FX5 A;  1NA1 C;  1OKO A;  1E5H A;  2DUO A;  2BJS A;  5J7M A;  5AFB A;  3ZOI A;  2RS5 3;  2ZXQ A;  2DFB A;  3N9P A;  1NKG A;  4AGV A;  1JW6 A;  1W0P A;  1J3P A;  1OF3 A;  4HVR A;  4LNV A;  3VBS B;  1WKY A;  1Q43 A;  4PIX A;  3WF2 A;  1JOJ A;  2FCU A;  1GSL A;  4DRR A;  1AZD A;  4EWA A;  2RDR A;  3MIE A;  2HKX A;  4UAP A;  1NY7 1;  1N1V A;  1RUN A;  4AQT A;  3SEE A;  4AFA A;  2W68 A;  1AR6 3;  4HK9 A;  3GYD A;  2BNN A;  1AYM 1;  1WLW A;  2ZKL A;  4RGA A;  2EXH A;  4K20 A;  1VBA 1;  3VBH A;  3OY8 B;  4YW1 A;  5FPX A;  2ARE A;  1LGN A;  4JV4 A;  2YXS A;  1AUY A;  4CEY C;  2ZMK A;  1GOG A;  1SLA A;  1AR7 2;  5FV3 A;  3WF0 A;  3ILN A;  2VO5 A;  2W46 A;  2ZX3 A;  1EY2 A;  1UU4 A;  4YGB A;  3WV6 A;  1O8S A;  2WT2 A;  4D69 A;  1QEX A;  3RWK X;  1O91 A;  3C7E A;  1BK1 A;  4Y20 A;  3WOG A;  4OHX A;  1JUH A;  1LOF A;  1WW5 A;  2WUH A;  3I3B A;  3OJB A;  4XF3 A;  4Q4Y 2;  3ZXJ A;  3V0A B;  1KDK A;  2LUW A;  2Q1M A;  2XPJ A;  4CRQ A;  4LPL A;  2PTM A;  1RHI 2;  4YW5 A;  1FNY A;  3K77 A;  4IGP A;  3WDX A;  2C9K A;  4YFW A;  1DDL A;  1UYY A;  2VOV A;  1SDD B;  5A7W A;  3TN9 1;  5JI7 A;  2Z42 A;  1W99 A;  2AYH A;  2BOI A;  3SKJ E;  1NX9 A;  4FO9 A;  1MS9 A;  5CG8 A;  5DDJ 1;  4WVW A;  2E9Q A;  2E32 A;  1RUH 3;  4ZU7 A;  2A71 A;  4C1X A;  3MDP A;  4W65 A;  5L9B A;  1VE0 A;  2PHU A;  4FOW A;  1BKZ A;  5CFD B;  4GKY A;  3RZG A;  5L73 A;  1SZB A;  4AZZ A;  1KIT A;  3NNM A;  1LAJ A;  1DFQ A;  2JX9 A;  2UYA A;  4UWD A;  4DEV A;  4RYD A;  4NHY A;  5FPB A;  4YGE A;  1OOP C;  4ZZ5 A;  5FUI A;  3H8X A;  2FDG A;  2VQ0 A;  3LKJ A;  2R0F A;  3SCF A;  3VKM A;  5JXH A;  3ASI A;  2J22 A;  1CVN A;  2VXJ A;  1TQ5 A;  5FZ4 A;  1MS3 A;  3ST7 A;  3OPZ A;  3USU A;  2LAL A;  4AQ6 A;  3CZU A;  2RDN A;  3EQE A;  4FPC A;  3ZXE A;  2CY6 A;  4RS5 A;  5CKM A;  3IMN A;  3N7L A;  3LIH A;  4LIT A;  4ARY A;  4XAC A;  1S0I A;  3P3N A;  4Q4X 2;  5IJR A;  1AYM 2;  4LE3 A;  3KD4 A;  1GP4 A;  1JYN A;  1HKD A;  3M8L A;  2C0Z A;  4KGG A;  1AYM 3;  4ZPI A;  4AEK A;  2XL7 A;  5FYM A;  4ES8 A;  3S57 A;  1BEV 3;  1GWK A;  1FAY A;  4OZX A;  3TBD A;  1UYX A;  3A23 A;  4CCD A;  4A41 A;  1FMD 2;  1EP0 A;  1FXZ A;  3NVC A;  3RJR A;  4OHY A;  3R6S A;  5FZ9 A;  2GNM A;  1J84 A;  3TN9 3;  2G4I A;  2ORX A;  3NNL A;  3MF6 A;  1MR5 A;  1CJP A;  3I2F A;  1CAV B;  4AVB A;  2Y60 A;  4PLN A;  4LO8 A;  3QH7 A;  3NJZ A;  4Q4Y 3;  1OPO A;  1BHG A;  1H1I A;  2HLE A;  5FY0 A;  2DUQ A;  5EYX A;  2ZKN A;  5AFE A;  1PHM A;  4XF9 A;  3WDT A;  3FZ3 A;  2B8M A;  2GH8 A;  5CZK A;  1BEV 2;  4PLM A;  5BYN A;  1HB1 A;  3TB0 A;  3WQB A;  3MW4 A;  3KCX A;  1I3H A;  4XF1 A;  3JD7 1;  2H6B A;  4WM7 C;  3U07 A;  1TNR A;  3ZN4 A;  4RA0 A;  3VBS C;  3PNA A;  4FT8 A;  5FXV A;  5FP3 A;  5AC9 3;  3I4I A;  3E6B A;  1V6O A;  1W90 A;  3LIG A;  4NPL A;  3FX3 A;  4CCN A;  1N1T A;  3P6B A;  1HLC A;  1UOF A;  2Q4S A;  3BGA A;  3ES4 A;  3WD5 A;  2GC3 A;  4J1X A;  5HPO A;  4OZO A;  4WVM A;  2WFF 2;  5CU1 A;  4XC9 A;  1JUI A;  2ADD A;  4LK6 A;  1CZT A;  1IPK A;  1W6Q A;  4QPG A;  2YC2 A;  1OMI A;  3MW3 A;  3U4X A;  1UY3 A;  4KG8 A;  3I2J A;  1Z78 A;  1D7P M;  3WEZ A;  1HRV 1;  2VW2 A;  5FXW A;  1QQP 1;  4M0N A;  1VBB 2;  4JDO A;  3RYR A;  5DZF A;  1QJE A;  4UT5 A;  5FP8 A;  4AXO A;  1J59 A;  4BB3 A;  4QXB A;  1MQT A;  3JU9 A;  4UI9 L;  2VAU A;  3D82 A;  1VRH 2;  5EQU A;  4R4X A;  3FFQ A;  4Y1Y A;  1JYC A;  3O1O A;  2TUN A;  3R4U A;  3W5M A;  1OUX A;  4UBH A;  4YZ4 A;  3AL6 A;  3B69 A;  4HVO A;  5BXX A;  2YG0 A;  2ZAB A;  4NHM A;  4Q4W 2;  5LAT A;  4EYU A;  2ZGK A;  2GNB A;  5FMO S;  3K4A A;  4E4S A;  1QH6 A;  3PMS A;  4DO0 A;  4I01 A;  2IXK A;  3WZ1 A;  1CN1 A;  4XOG A;  4Y1U A;  4UW4 A;  3T1L A;  4UFI A;  2BEO A;  3OUI A;  1FT9 A;  5LB6 A;  1F9K A;  4R9D A;  5BPX A;  4O9G A;  4QAW A;  1PO2 1;  3G7D A;  4CDX C;  1AXY A;  1W8O A;  4Q26 A;  1S2K A;  2B45 X;  5ABJ C;  2D6P A;  3SHR A;  2DCK A;  2JG9 C;  1G8W A;  2WL1 A;  3C3V A;  4FPL A;  5EZW A;  5F5C A;  3UES A;  5IVE A;  1W8T A;  2W91 A;  4YG3 A;  3ZPY A;  1HRI 2;  1UZW A;  1KJL A;  2LM3 A;  4MH0 E;  3LD8 A;  5EJZ B;  5CBL A;  2PMW B;  5LA0 A;  3RZL A;  1ULE A;  1WLT A;  3NV3 A;  3MI8 A;  4YG0 A;  3I3Q A;  5FY4 A;  5F32 A;  4Q0S A;  3IN9 A;  2DVD A;  3U37 A;  4OFG A;  2CAV A;  4ISR A;  5DG2 A;  4CEW C;  3BCW A;  3VBH C;  3LWC A;  1QJX 2;  2WBK A;  3C7H A;  3POS A;  2Y34 A;  4Z2W A;  4Q8L A;  3KB5 A;  3ENR A;  1LOE A;  5FY1 A;  2BGC A;  3VBU C;  4XJU A;  2XJT A;  3VDC A;  4XDQ A;  3BTA A;  3T2T A;  3GJB A;  4AAX A;  3VD4 A;  1UY0 A;  2J1R A;  1PO1 2;  2VNG A;  5F3G A;  1F5F A;  1ULD A;  4ASK A;  2A1X A;  3BKZ A;  2V73 A;  1S2E A;  3AYA A;  1N1Y A;  3EHK A;  3MLK A;  2Q1F A;  1RVF 1;  3WP4 A;  4XF4 A;  1REE A;  4GKX A;  2RVA A;  4QGM A;  5A33 A;  1LOD A;  1AR8 2;  1W8F A;  1XND A;  2JDA A;  5F3I A;  3SH4 A;  4PT6 A;  3WW1 A;  2VMD A;  3WNX A;  4EJR A;  3AK0 A;  4XUP A;  1PZ7 A;  1T2X A;  2JDZ A;  2DBN A;  3VL9 A;  5FOB B;  5FY7 A;  4B3N A;  3PJQ A;  4YW7 A;  4IGQ A;  2GC2 A;  1VB4 A;  3ZFF C;  5BNN A;  5B2G B;  3SIT A;  1JZ3 A;  1PMH X;  2HWF 2;  1G9D A;  1CGP A;  1H4G A;  4M3C F;  3ILR A;  1RUI 2;  3THC A;  4DNY A;  2JDU A;  1DQ2 A;  1DQ4 A;  1PZ8 A;  4QKD A;  1SEF A;  2IC1 A;  2DVG A;  3U78 A;  3WQ0 A;  4H14 A;  5JCT A;  3UJO A;  5JOX A;  5CA6 A;  3GF6 A;  2XWB B;  2W1Q A;  2VY0 A;  4YPJ A;  4SBV A;  3MPP G;  3WF3 A;  3POJ A;  3RS6 A;  4CU8 A;  2IFR A;  3JB4 C;  4CCM A;  2WC2 A;  2WNE A;  3ZFE B;  2GC0 A;  4GH4 C;  5FQ0 B;  4A7Z A;  3Q8E A;  4YZ5 A;  3LFI A;  4AAP A;  3FUQ A;  3UKT A;  3OYW A;  3AYC A;  4C8D A;  1N3Q A;  2GNT A;  4GAZ A;  1H6X A;  1OVS A;  1EAH 3;  3AZZ A;  3BOW A;  3E97 A;  4TYS A;  2PLV 3;  2X10 A;  1WCU A;  5JR7 B;  3WQ7 A;  2VMF A;  4S2H A;  1UKR A;  5IVC A;  2FDI A;  1RIT A;  3VBO B;  1HB3 A;  4BZ4 A;  2BZD A;  1HXS 3;  2UWC A;  4GWJ A;  2A3Y A;  1Y9Q A;  1IKP A;  3TOJ A;  2A5Z A;  3E6C C;  4ZXK A;  1AVB A;  4R9C A;  4CEY B;  5LY2 A;  3TEW A;  5ISL A;  4YM3 A;  3JD7 3;  2GU9 A;  4YM1 A;  2VUD A;  4XHX A;  3ZX7 A;  1RUG 2;  2GAL A;  4RR3 B;  3ZIX A;  3GNE A;  3E5X A;  1DU3 D;  5CYY A;  4QQ2 A;  4XJW A;  5JSO A;  5E89 A;  1OBN A;  4OQ9 A;  5HI0 A;  3K48 A;  4QM8 A;  4OUM A;  4Q4X 1;  4FAG A;  3JBG 1;  2G19 A;  3ZYH A;  1OH3 A;  1WW4 A;  3IBM A;  1W9S A;  2VZP A;  1VBE 3;  3R4S A;  1YLL A;  2JE9 A;  2VZ1 A;  3H0O A;  3WDV A;  1GIC A;  4E2S A;  3H1Y A;  3BIW E;  4M4P A;  5F5Q A;  3WG4 A;  2R0H A;  4LBK A;  1YFU A;  5EPA A;  1K45 A;  3QAC A;  4M01 A;  1NCR A;  3BPZ A;  1LHU A;  4MYE A;  3H8R A;  2VZO A;  5T50 A;  4OCT A;  5CKQ A;  4BM8 A;  3BU7 A;  1YFX A;  2R04 3;  2E53 A;  3QD6 A;  4AL9 A;  3D0J A;  1BVP 1;  2XQR A;  1S0C A;  1ZZC A;  1D4M 1;  4JRA A;  4H55 A;  1ENX A;  4HFS A;  3U11 A;  4AED B;  2VNO A;  3TEZ A;  3J8F 2;  4P9W A;  1GZW A;  4E8C A;  2ET7 A;  4KH9 A;  3WHT A;  1N3O A;  4K1Z A;  2VR4 A;  2YC4 A;  1R09 2;  1RIR A;  3UL2 A;  1MEC 3;  4EN0 A;  1V6L A;  1CAX B;  1LOG A;  1UOG A;  1W9Y A;  1MS4 A;  3IPV B;  3A4U A;  3B3Q E;  2C24 A;  4NWV A;  3AKT A;  4LT5 A;  1YQ5 A;  1V6I A;  5JVV A;  4CEY A;  3AZW A;  1YQ6 A;  3BAL A;  4CDQ B;  3AKP A;  5ABJ B;  2R07 3;  4COY A;  2NPI A;  5KWR A;  1O59 A;  4QB2 A;  4LKS A;  3PJY A;  4F83 A;  1QOO A;  1YXW A;  5FZ3 A;  3S7I A;  5A70 A;  3PVE A;  2TEP A;  3T2Q A;  1W2U A;  2RR1 3;  2H0B A;  1O8P A;  1H8V A;  3AZX A;  1DQ0 A;  2J1T A;  4AI2 A;  3J8F 1;  5DUV A;  1FOD 2;  4UFJ A;  4YW2 A;  1H1M A;  4A45 A;  4D6Q A;  3ON7 A;  1W0O A;  4Q4V 2;  4COW A;  1UOJ A;  4Q0U A;  3ZN5 A;  3AL5 A;  3HOB A;  2ZPX A;  3JCI A;  1REF A;  5DZE A;  4EN8 B;  2GSY A;  1V0A A;  2WZP P;  3CBN A;  3ZYG A;  2JEM A;  2JB4 A;  3HVD A;  2WS9 1;  5FBJ A;  2WQ8 A;  5IVF A;  1AL2 2;  2BWC A;  3ZFG B;  3VGI A;  3NWK A;  1B09 A;  4XUR A;  3TEY A;  1ZBA 3;  3KS7 A;  5DAQ A;  1DGW X;  2JEN A;  1I9R A;  3GZE A;  2VBB A;  1BQP A;  3VBF A;  4XPV A;  4CDW A;  2KD7 A;  2MPF A;  5A7Q A;  3THD A;  2Y8K A;  2D93 A;  2PEL A;  4IEV A;  3SIS A;  3GHM A;  3MIF A;  2QE3 A;  4QU1 A;  3V0B B;  5D21 A;  2UY8 A;  5FMD A;  3RG0 A;  1H8T B;  4LO4 B;  2A3X A;  5FYU A;  2E26 A;  3AZY A;  4A3Z A;  3MIC A;  4MGI E;  3OSD A;  1ZRE A;  1F5J A;  1W0N A;  1DBN A;  4H3W A;  5FFO C;  3VD5 A;  2EID A;  2FDJ A;  1UAI A;  2X8K A;  1SLI A;  3NL1 A;  2FZ2 A;  5FZ1 A;  3D0S A;  4XBN A;  4YWA A;  4CVU A;  2MEV 1;  5A3N A;  1F8V A;  4KL1 A;  1LGB A;  3F2Z A;  1GAN A;  1HJF A;  1GU3 A;  4DUX A;  1WME A;  4ZHN A;  1SFP A;  2XLA A;  2D3S A;  4FPE A;  1SBD A;  3KGL A;  3LAG A;  4MUV A;  4XXP A;  5G04 L;  3S7E A;  3O7O A;  3UJQ A;  4AYU A;  1QKQ A;  3ZXL A;  2W92 A;  1HN0 A;  4Z82 A;  4F8A A;  4XET A;  2JIC A;  1KS4 A;  2FHR A;  4WM8 C;  2E7Q A;  3D6E A;  2HWF 1;  3KT1 A;  4Y26 A;  3VHP A;  1YQC A;  1C8M 2;  1XNT A;  2K2S A;  3DV8 A;  3KV6 A;  3VHO A;  4CCE A;  2XKP A;  4KQ7 A;  1O3T A;  3ACG A;  2OUJ A;  2QUO A;  4AQ2 A;  4YVW C;  2DBI A;  2D6L X;  1BLZ A;  1NXD 1;  3T09 A;  3RWN A;  4H7L A;  3VBF B;  1PIV 1;  4MV2 A;  3RYP A;  4XQ4 A;  2Q8D A;  1AR8 1;  5FJK A;  2PAM A;  4JCK A;  3VD7 A;  3ZR6 A;  1JOD A;  3J26 N;  3W20 A;  1UO9 A;  3O1S A;  3KMH A;  3ROU A;  4X6R B;  1M4W A;  3NV2 A;  2PN5 A;  1QGL A;  4S2G A;  1LNS A;  4JC1 A;  4FCA A;  3VBS A;  1U0A A;  3LA3 A;  1ZA4 A;  3MFC A;  1PO1 1;  5C3O A;  1UIJ A;  4WM8 B;  2VW0 A;  3GZU C;  4B4R A;  3OBA A;  4YNI A;  3OG2 A;  4G9S B;  5DAP A;  1IGO A;  4A3X A;  4SLI A;  1J3Q A;  4JKK A;  5AVP A;  3O0W A;  2Q8O A;  2XR4 A;  1QJX 3;  1D2Q A;  2WO3 A;  5FLJ A;  4FPJ A;  4FI9 A;  3ZXG A;  5A80 A;  4I02 A;  2ZAA A;  4OMC A;  5JIU A;  1V9U 1;  2QFE A;  5GZG A;  4K7J A;  3LOB A;  4O9E A;  1VBD 2;  2ZZQ A;  3EMR A;  1OF4 A;  5FLI A;  2FDH A;  5LEK A;  3T0B A;  4NAO A;  1G9A A;  2V5Y A;  2P3Y A;  4Q4W 3;  1NE4 A;  1WMD A;  2JJ6 A;  3V65 A;  2FZ1 A;  1ULF A;  1RIN A;  1RMU 1;  3LDB A;  1VBD 1;  3OUJ A;  5A3O A;  1PK6 A;  1TME 2;  1HB2 A;  3BVC A;  4HL0 A;  5DAX A;  1CZS A;  2VQT A;  3UGH A;  2RM2 2;  3PHM A;  4CDU A;  1D0H A;  1CR7 A;  1QMJ A;  3R0R A;  4RHV 1;  1RMU 2;  5IAV A;  2BWA A;  5FZ8 A;  3V0A A;  1SBF A;  3IM0 A;  1WD3 A;  3O1U A;  4CE8 A;  3D5O A;  1RGS A;  1XYO A;  1QU0 A;  2AAC A;  2JKX A;  2GN7 A;  4HSL A;  3UYJ A;  3J7L A;  4TLF A;  4L11 A;  5A7O A;  1YYN A;  3HPN A;  1QXJ A;  1V9U 2;  2JDM A;  2WII B;  4MZU A;  2YYO A;  4N53 C;  4MXV A;  4N7U A;  3WIN E;  4CP9 B;  3WUC A;  2ZCW A;  5L9R A;  1IS4 A;  4NIA A;  5H9P A;  1XNA A;  2NQY A;  2WFF 3;  4LUK A;  3ETP A;  1WA6 X;  4OHV A;  2DYC A;  4PI0 A;  3WG3 A;  4MGZ E;  1W9T A;  1CAW A;  2XML A;  2ZAC A;  3OD0 A;  3TEX A;  4DY5 A;  2B42 B;  1UOB A;  2A73 B;  4TWT A;  1Z7S 2;  4C0B A;  2W5F A;  1VMF A;  3O5S A;  1US2 A;  1UF2 C;  2B46 X;  2J1U A;  3B93 A;  4FXK B;  3T4V A;  4AHZ A;  4DMI A;  2FCV A;  2JG9 B;  5H9S A;  3P3P A;  4YFZ A;  4ZZ8 A;  5FMO L;  1H2N A;  1YJL A;  1UN1 A;  2DF7 A;  2W94 A;  3GCW A;  4Q27 A;  3ZKY A;  1SLL A;  3CU7 A;  1VBC 2;  1GZW B;  3J7H A;  1Q8V A;  3VN4 A;  2OT7 A;  3FUO A;  1CIW A;  1AJO A;  1PIV 2;  4AVC A;  4H7M A;  4N90 A;  3UV9 A;  4XAE A;  5J96 B;  3A0K A;  3CEW A;  2VUA A;  3FE5 A;  3PVB B;  4K3U A;  2DUP A;  3VBU A;  4HET A;  1OUS A;  2YBS A;  3GXU A;  2VC9 A;  1C8M 1;  1DZR A;  4RS5 B;  5B4N A;  1JYW A;  1RUE 3;  2R7E B;  2HWC 2;  2CDO A;  4PF1 A;  3AKR A;  2R49 A;  4DXZ A;  1J83 A;  1ZRR A;  3MW2 A;  3FN9 A;  2W39 A;  4N9I A;  2BFU L;  2FMD A;  4LKE A;  1Y43 B;  1OA3 A;  3BN6 A;  1CIY A;  2EXI A;  4AVA A;  4UFL A;  1WCK A;  2AH2 A;  5LA1 A;  1EAH 1;  4CDW C;  5CFC A;  5KR7 A;  3WY6 A;  2R04 1;  3PTY A;  3WW2 A;  2JIG A;  3JUU A;  2Y6K A;  1SHW B;  2C5D A;  1DGR A;  1QXP A;  2RJK A;  2XB6 C;  1W8U A;  1NCR C;  1PO2 3;  4XFI A;  3AMH A;  1W05 A;  4Q5O A;  3UT0 A;  1SAC A;  2OXB A;  3JQX A;  1VBD 3;  3N7K A;  1PMI A;  2JG8 A;  1JYV A;  3KCY A;  3CQO A;  4CCO A;  1TG7 A;  2HWC 3;  1ACC A;  3MGU A;  4FFF A;  3BTX A;  1CQ9 A;  1FMD 1;  4LOS A;  3DXU A;  1ULG A;  1DCS A;  1RL3 A;  4LA2 A;  1X7N A;  5C4W C;  2VTF A;  3ZPO A;  4ZKT B;  1I5Z A;  4QT6 A;  3VDD C;  5C3R A;  3JZV A;  4I0W B;  3ALQ A;  2BER A;  2PAK A;  1C8N A;  3CKH A;  4BHP A;  4CUC A;  3OGJ A;  1OLR A;  2OPK A;  2HWB 3;  5C3Q A;  4B7E A;  2JDK A;  2D43 A;  3I7D A;  2D5H A;  4XVH A;  1TMF 3;  1UW8 A;  2WAO A;  1K5M C;  4XYX A;  2WS9 2;  2QCS B;  4LKF A;  4IE0 A;  4YVS C;  5GLV A;  3KV9 A;  1UYP A;  2Q0A A;  2VW1 A;  1SG3 A;  3FHA A;  2HEW F;  3IAP A;  4XEZ A;  4B8E A;  2BGO A;  2VVD A;  3FLP A;  4DUV A;  2F17 A;  3L2H A;  3ZXF A;  4L8Q A;  3LZZ A;  1RUC 3;  2CGN A;  4AVV A;  3S30 A;  1LOA A;  1S2B A;  4LLO A;  5BY5 A;  4BME A;  3DUI A;  5FIX A;  1RHI 3;  3RGB A;  4DS0 A;  4MHU A;  2WKK A;  4CSW A;  1MQT B;  5SV8 A;  4A7Y A;  1UIK A;  3IIA A;  4CPB A;  1NE6 A;  5TSW A;  5JZG C;  5A3U A;  1OPM A;  1O3S A;  2ARA A;  2VOW A;  3FHI B;  1XU1 A;  4KU8 A;  2SBA A;  1I1E A;  3MHZ A;  5FYI A;  1AX0 A;  4QDQ A;  4YGC A;  4XUO A;  1JHN A;  1U5Z A;  5BNP C;  4N43 C;  2JD4 A;  1RUJ 3;  3ECQ A;  1UCX A;  5FZO A;  4OUL A;  1XNB A;  3U0Z A;  3GAL A;  2QQU A;  1U5Y A;  4QQL A;  1KEX A;  1OOP B;  4IV3 B;  4DQA A;  4GA9 A;  2WSU A;  4FBF A;  2ETE A;  1R09 1;  1S55 A;  4D6S A;  2PHR A;  2WNO A;  1FOD 3;  4P00 B;  4LKD A;  2N7G A;  4JQT A;  5J09 A;  1NOV A;  1SPP A;  2HJI A;  3CDZ B;  1CAU B;  2MEV 3;  4Q0P A;  3H7J A;  3UGF A;  4W6W A;  3PIG A;  4XBL A;  1YHF A;  1ZZ7 A;  5C8C C;  4A7K A;  3ZSJ A;  3KVB A;  1S0E A;  2R07 2;  5FP9 A;  3PU3 A;  5F37 A;  2ZX2 A;  2DCT A;  3DKW A;  1ALY A;  3EYP A;  3I2D A;  3DPR C;  1RUO A;  2YGL A;  5FZB A;  3M3Q A;  3VBR B;  3ITQ A;  3LEI A;  1HRV 3;  3KT4 A;  4MGS A;  2D3P A;  1DGR N;  3IT8 A;  5E88 A;  1C4R A;  1G86 A;  3UK9 A;  4YVW B;  1RUC 1;  3WG2 A;  1DYO A;  4JAA A;  2ZTN A;  1L3J A;  5KXB A;  3LF7 A;  1PZ9 A;  2GH2 A;  2E63 A;  2RS1 1;  1F4A A;  4NMI A;  1CPN A;  2HWE 2;  4YG6 A;  3ZFF B;  1NG0 A;  1XJA A;  3ZN6 A;  4PIY A;  2RHP A;  5EJ3 A;  3PVO A;  3POB A;  5FYC A;  4KMQ A;  4UW6 A;  4JKM A;  3DKQ A;  5EHD A;  5FRE A;  4U2A A;  1OLM E;  2XXZ A;  2BTV C;  4QB1 A;  5FKC A;  2HWB 1;  2R04 2;  2GME A;  4CDU B;  1V6M A;  4Y24 A;  2ZGL A;  3O1M A;  3BYW A;  4NN0 A;  4DIN B;  2C26 A;  3Q8F A;  5JSR A;  2EAK A;  3DEM A;  5ERL A;  1OOP A;  2RJL A;  4QU2 A;  3N35 A;  2J1S A;  1DGW A;  4OHW A;  3T1M A;  1RUJ 1;  5FPL A;  4HPK A;  4O65 A;  4XFF A;  4XHB A;  1GLH A;  4QQP A;  1JZ2 A;  2ARC A;  5B4X A;  1IKQ A;  4AF9 A;  2JG8 C;  2CWM A;  2Z5W A;  2XVK A;  5J1X A;  2HWC 1;  4BYY A;  5DUW A;  4QX0 A;  2RR1 1;  5AC9 1;  1PIV 3;  2AGS A;  2ZHL A;  3AMM A;  4NIH A;  3HQU A;  2WZE A;  4W8J A;  5EWS A;  5FZK A;  2JDN A;  2VUC A;  5ACA 2;  3GBW A;  4AK3 A;  3BIE A;  4XJA A;  3ZDV A;  1TVG A;  1RUI 1;  3X29 B;  4RHV 3;  2O8Q A;  4LE4 A;  1ONA A;  4XAB A;  1VLN A;  1DP0 A;  3NJX A;  2RMU 1;  4B4P A;  1UZV A;  3W9A A;  5I93 A;  4CPB D;  1VBC 1;  4IES A;  3A0N A;  4JRL A;  3OOX A;  3I59 A;  1GMM A;  5JZG A;  1VRB A;  3EO6 A;  3KHC A;  3BPS A;  3PUR A;  2K0G A;  2YZ4 A;  5HCA A;  1Z7S 1;  1EV1 1;  3NKT A;  1LHV A;  4HN1 A;  4ARX A;  4X6Q B;  1SCR A;  3VBR C;  1RUE 2;  1N3P A;  5F5A A;  2P17 A;  3HD8 B;  4Z07 A;  3MUZ 1;  1Q3E A;  5LBC A;  1JTZ X;  1R1A 3;  1JBC A;  4CU7 A;  4OQ8 A;  1QH7 A;  2XKO A;  3AM2 A;  2ADE A;  2KA3 A;  2P3K A;  1WZX A;  3LEM A;  3NV1 A;  2QQV A;  3C7G A;  4RGK A;  3D8C A;  3LGR A;  4HBN A;  4QD2 A;  2UWB A;  4AEJ A;  5GM0 A;  1YUD A;  4UW5 A;  1T6G C;  4EN7 B;  4XIL A;  5FY9 A;  1TME 3;  4XDP A;  3POE A;  1MZ6 A;  1QDO A;  4NHK A;  4HKW A;  5FYZ A;  5FY5 A;  4FPF A;  3PUQ A;  4P9J A;  2Q8E A;  3WNN A;  1H9P A;  3WT3 A;  3ZXK A;  4EN9 B;  4HVQ A;  2JE7 A;  1LU2 A;  1NQD A;  1VR3 A;  4D8M A;  1ND3 A;  2WSV A;  4IE6 A;  4F3J A;  3S5A A;  3GGL A;  3RMY A;  4LHK A;  1RUH 1;  4XQD A;  4EWE A;  2WZR 2;  2XQX A;  1R08 1;  3SKV A;  1WCS A;  3FBM A;  4V2V A;  4L99 A;  4IQP A;  3OBT A;  2D6N A;  4UYB A;  3WG1 A;  4JX0 A;  3WW4 A;  2XJP A;  5I0S A;  3RJ2 X;  4XZP A;  3H1M A;  4YRD A;  1FV2 A;  1R08 2;  5D1I A;  5LK5 A;  4CZS A;  5ANQ A;  3QLQ A;  1NZC A;  3POY A;  2VQA A;  4A42 A;  2QQW A;  3SQO A;  3RQ0 A;  1FMD 3;  5JZG B;  1PNF A;  3AKQ A;  4XTP A;  4BLJ A;  1WW6 A;  3GHN A;  4KI5 M;  3ZLI A;  4RR3 A;  1VBC 3;  1PM7 A;  1MQT C;  3QBQ A;  4HOO A;  1XU2 A;  3FC0 A;  1UMZ A;  5FZ7 A;  4ASL A;  2VNV A;  4LBM A;  2ID4 A;  3POI A;  5EP9 A;  1AXZ A;  1QF3 A;  4Q4W 1;  2O14 A;  2CL2 A;  5CFC C;  1S0B A;  2YV8 A;  4J6G A;  4IET A;  1RUF 2;  2PA7 A;  2IXL A;  4CEW B;  1C1F A;  1Q8O A;  4CP2 A;  5BNO B;  1L7L A;  4FOQ A;  1V6K A;  3AVR A;  3WF4 A;  1BCX A;  1EV1 2;  5C70 A;  3KT7 A;  3MIG A;  4F7Z A;  1VBB 1;  2BGP A;  3K3O A;  4M4R A;  1QJY 3;  2B9U A;  2EIE A;  3P1I A;  4FQZ A;  3ELN A;  4AFM A;  2IFW A;  5KXE A;  5E6H A;  4UW3 A;  5GJ6 A;  5C6C A;  5DUU A;  3EB7 A;  3PIJ A;  3U4S A;  5EIY B;  2RMU 2;  3DCQ A;  5GLZ A;  1XSQ A;  1O3R A;  3HNY M;  1DZT A;  1I6X A;  1QJU 3;  3GJA A;  2BPA 2;  1C8M 3;  3RFR A;  5L9V A;  2BVV A;  2KR2 A;  3CLP A;  3QH6 A;  4X8P A;  4BLI A;  4C91 A;  1FPN 3;  2E33 A;  3RPQ A;  4BQW A;  3I3M A;  3PUI A;  1ZRD A;  3WHU A;  4EWD A;  5A3W A;  2CTV A;  1MVE A;  3SMH A;  1LEN A;  1PVX A;  3AXE A;  1VAK A;  2NMO A;  1HQW A;  1RJ8 A;  5FYT A;  3T4H B;  1X33 A;  5FZH A;  3S5Q A;  5F3C A;  5A33 B;  1IPJ A;  2VMI A;  1COV 3;  4W6Y A;  2LTN A;  4CCL A;  5CNA A;  5IVJ A;  1HXS 2;  2YFU A;  1VBE 1;  4CDW B;  2DVB A;  4GB3 2;  5IVY A;  1RUJ 2;  2L9L A;  3K2O A;  1P8J A;  3UKV A;  4IND A;  5I8Y A;  4WV8 A;  1XC6 A;  4QB6 A;  5L7O A;  3AX4 A;  5GLT A;  1ND2 B;  1W8N A;  4GWI A;  2XVG A;  1KJR A;  3O0X A;  4K9S A;  4LBN A;  4ET7 A;  1UD1 A;  1C57 A;  4YVS A;  5DG1 A;  3O12 A;  4ZS3 A;  2GND A;  3B7M A;  3M7A A;  2HEY F;  2J1A A;  5F3E A;  5I0D A;  3NO8 A;  5FMB A;  4RFR B;  3E1F 1;  1S1A A;  5KHG A;  2XL9 A;  3VHN A;  1IQA A;  3VBR A;  1AR9 1;  5FXZ A;  4GMP 3;  4URT A;  2Y0O A;  1RUC 2;  3MPB A;  1ZZ8 A;  1W03 A;  1YRZ A;  4DXT A;  3PTR B;  1GUI A;  5DAB A;  4AE2 A;  1ZVF A;  3R4D B;  5GZC A;  1U12 A;  2WWJ A;  1EYB A;  3U75 A;  2E51 A;  1KDM A;  1XBF A;  1H30 A;  3AMN A;  2B5H A;  1ZBA 2;  4GXL A;  2BBV A;  3SH3 A;  4QX1 A;  5IYY A;  5E8A A;  3A21 A;  1W2O A;  2HYX A;  2Z69 A;  4Q29 A;  4OI4 A;  1ZBE 3;  4TLG A;  3MZH A;  1YJK A;  4IUG A;  1GZT A;  4QX2 A;  1W6Q B;  1FAT A;  1H9W A;  1LCL A;  1IS6 A;  2VZV A;  1ZZ9 A;  4CCC A;  1KRI A;  3HBZ A;  4GZ9 A;  3MUY 1;  1GKB A;  3KWV A;  5FO7 B;  5BUV A;  1JZ7 A;  1NLQ A;  2P3I A;  1SFY A;  1C3H A;  1CON A;  2ZS6 B;  3MYX A;  4N53 B;  3ZYR A;  4AED C;  1X50 A;  1AYN 1;  3HQX A;  3HWJ A;  2C1F A;  3UGG A;  1ZRC A;  2VOT A;  3DXT A;  3MEP A;  1R64 A;  3N9O A;  1AL0 G;  1Y4W A;  1VAL A;  1NQJ A;  1ND2 A;  3F95 A;  4NOT A;  3Q8C A;  2Q30 A;  4AI9 A;  1AL2 3;  4LBO A;  1QJZ A;  2EAL A;  1ZA7 A;  5L7O B;  3N9N A;  3INA A;  2B39 A;  5FPZ A;  3LQC A;  1XPW A;  3N36 A;  1CX1 A;  1JU3 A;  1WCD J;  4IEO A;  1DIW A;  1WMF A;  5JXJ A;  4K8F A;  4P14 A;  2VEC A;  4XIO A;  4C1W A;  2PAE A;  3VKF C;  5GLU A;  4GJY A;  3VDD B;  1AR6 2;  4W4Z A;  3WW3 A;  1SMV A;  4OHZ A;  1ASJ 2;  5AVA A;  4GWM A;  2WZ8 A;  4A2U A;  5CAZ A;  3AB0 A;  1AYN 2;  1POQ A;  5T55 A;  2VD7 A;  1LES A;  2YBP A;  4RQP A;  1YI7 A;  4DRV A;  3KHB A;  4CP0 A;  4P02 B;  5A7W B;  2GMM A;  3T2O A;  3IDC B;  2HWE 3;  2ZHM A;  4QDR A;  5DN2 A;  3OBR A;  2IXI A;  4Q4Y 1;  1AR7 1;  2YPJ A;  5C9A A;  1URX A;  2P4E A;  3J4U H;  2DDU A;  1W2N A;  5D8A C;  3VLB B;  4BPZ A;  2WAB A;  2FDF A;  2XHN A;  4Y22 A;  2ZGR A;  5LCW L;  2VOK A;  3U14 A;  3KV4 A;  3JBG 2;  3NKG A;  5HCB A;  4KBZ A;  1MS5 A;  4RD7 A;  2OQ7 A;  2G9Z A;  4IEU A;  4P9G A;  3OEA A;  4Y4R A;  3MF9 A;  1Y7B A;  4YZ3 A;  1AR9 3;  2XWJ B;  3H8U A;  3ZYJ B;  1R1Z A;  3RZH A;  5A6Z A;  3CNA A;  1ND3 C;  3APB A;  4CP9 A;  2Y33 A;  4HT1 T;  1QNY A;  1Z7S 3;  1EUU A;  5LA9 A;  1VBA 2;  2YRO A;  4LOT A;  3H3Z A;  2W87 A;  3CF6 E;  2C6S A;  1IPS A;  4NPM A;  4Q1R A;  4YZ2 A;  5FZM A;  4EZ4 A;  1R08 3;  1DHK B;  2DWR A;  1YCI A;  4AVS A;  1CAW B;  1G9B A;  4JTO A;  3J9S A;  4QWN A;  4R4Z A;  2ENR A;  3ZKU A;  1IHM A;  1MS8 A;  5KC6 A;  1WMX A;  2VPV A;  1W6M A;  1PGS A;  5LRR A;  1QIQ A;  1UY4 A;  2WZR 3;  1O4Z A;  4P9X A;  1WLD A;  4Q1P A;  5GZF A;  2Y6G A;  5IFT A;  3WSO A;  4JHT A;  4QGN A;  1OH4 A;  2I2S A;  2BW8 A;  3VL8 A;  5C8W A;  1GQP A;  2J1V A;  1IZ3 A;  4RQP B;  2D40 A;  3H9A A;  4Y1Z A;  4IV3 C;  1UX7 A;  4GB3 1;  4NJ4 A;  1NYW A;  1HXS 1;  2YPD A;  3CHX A;  2QQP A;  4FFG A;  1LTE A;  2Y6F A;  4I30 A;  5KBF A;  3LSD A;  4URA A;  4LBL A;  5K7P A;  2JIJ A;  4HON A;  5BNN B;  2B7Y A;  5A32 B;  3NMB A;  5BNO A;  2WWS A;  1GFF 2;  2R30 A;  3CMG A;  5KC5 A;  2EAA A;  2BQP A;  4E4D X;  3AZV A;  2ILM A;  5IK8 A;  2VE1 A;  3A22 A;  2RV9 A;  2WS9 3;  4LIV A;  2VM9 A;  2R06 1;  2XG3 A;  2BNM A;  5JWP A;  1ZZ6 A;  5K8S A;  5SV5 A;  1GZ9 A;  3DL3 A;  5FZI A;  3FMG A;  1BBT 1;  4K8R B;  1UU5 A;  4LHN A;  3TYJ A;  2V5D A;  1BK0 A;  4JGY A;  4QKB A;  3OGG A;  2DV9 A;  3N7J A;  3WUD A;  2W1U A;  3LB9 A;  4MGQ A;  3CJI A;  2V72 A;  2CGP A;  2WDB A;  2WWU A;  1JYX A;  3DPR B;  1SLT A;  3WR0 A;  1E5I A;  4D94 A;  1Q8Q A;  5I8T A;  1US3 A;  3OCP A;  2X05 A;  5LWB A;  4K40 A;  4TXW A;  5FUP A;  1OA2 A;  2ZJC A;  5I0T A;  2DVF A;  1Y9M A;  4JDM A;  4XJZ A;  4NRP A;  3LA7 A;  1GNH A;  2OS2 A;  5C5U A;  2W47 A;  4OUS A;  4FQ4 A;  2RDS A;  4YAR A;  1QJX 1;  2Q8C A;  2WQZ C;  4HPK B;  3ACI A;  4LBQ B;  2QQK A;  3RI8 A;  4LO7 A;  3N3H A;  1V6N A;  1YFW A;  1STM A;  4L97 A;  5CFD C;  1Q5O A;  2TNF A;  3BTY A;  4YZ1 A;  2KXL A;  3I2K A;  5CFC B;  3AP7 A;  1G9C A;  5JPM B;  1IS3 A;  2IVJ A;  3POG A;  4Y3O A;  3GZT B;  3VV1 A;  4BK4 A;  5FOJ B;  2MNG A;  2RJ2 A;  5FZG A;  1LRH A;  5KHI A;  2VMC A;  1FV3 A;  3AJY A;  2PHF A;  4Y5T A;  3NST A;  4LA3 A;  4HZF A;  2QVS B;  4W6X A;  2JWP A;  2OZ6 A;  5C4W A;  4MOA A;  3H1W A;  2VZQ A;  3OGR A;  2WZR 1;  4B1M A;  2I07 B;  3RMX A;  1XE0 A;  5D8A A;  1GR3 A;  4MET A;  2CHH A;  3LE0 A;  5A3M A;  2YU1 A;  2A6X A;  3AYD A;  5T54 A;  1X9T A;  2YB7 A;  3EBR A;  3BOD A;  1VB2 A;  2ZHK A;  3T30 A;  3WP3 A;  2Z4F A;  4LO5 B;  4NO4 A;  2CSG A;  2VMG A;  5IK5 A;  4QMA A;  2BOJ A;  3LSE A;  4HKO A;  5CIS A;  1UZZ A;  4JGZ A;  1VRH 1;  1D4V B;  1PVC 3;  3RYK A;  3SH5 A;  2O8O A;  4XMA A;  3NRU A;  2G9G A;  4NRO A;  5ABJ A;  1S4C A;  2F4L A;  5FO9 B;  1F4H A;  1POV 3;  4LJH A;  3BU0 A;  3ZYP A;  1YQ8 A;  4L2N A;  1W04 A;  4NHL A;  2RS3 3;  1QQP 2;  3URF A;  5FP4 A;  3AKS A;  1AR7 3;  4XTM A;  3BI3 A;  4QHO A;  5H9R A;  4FOV A;  2VGD A;  3WLU A;  1SPP B;  2PHD A;  3NQH A;  4RR3 C;  4KGQ A;  4HG6 B;  1RUD 3;  1XQN A;  3CIH A;  5T5L A;  2FMY A;  5F6L B;  2ZEZ A;  2EIC A;  1SLB A;  2XON A;  2CNA A;  2HYK A;  2D5F A;  5FZ0 A;  2P1B A;  2P6H A;  5FYB A;  4A44 A;  1LHW A;  3FWE A;  2BVB A;  1OSG A;  2UYB A;  1HQN A;  3TRS B;  3VDD A;  2VL4 A;  3RDI A;  1SFN A;  4U36 A;  4XFC A;  2RR1 2;  4QHB A;  4QKN A;  4LLF A;  2XH6 A;  5JI9 A;  1C5H A;  5FRA A;  1QNW A;  2ZOE B;  4XUN A;  1AR9 2;  1D2S A;  3AP9 A;  3C7O A;  3VZM A;  1DYK A;  2G9F A;  4HK8 A;  2OW4 A;  1CZV A;  1OQE A;  2MEV 2;  4BCU A;  1UU6 A;  4FPG A;  4LUL A;  1K5J A;  5LW9 A;  1ZRI A;  3WP5 A;  1HQL A;  4NID A;  1W9F A;  2GN3 A;  2VZT A;  3ZSK A;  2ZA9 A;  3VBU B;  1CAU A;  2PLV 1;  4QQH A;  4I2O A;  4RS5 C;  5CKN A;  5DMY A;  4MVT A;  1UMI A;  2HWB 2;  3FJS A;  1VP6 A;  3MO4 A;  2VMH A;  2JE8 A;  1OQD A;  2OII A;  5HCH A;  1W8W A;  1ZBE 2;  3MLJ A;  4AG4 A;  3KV5 A;  2D98 A;  2WN3 A;  5E1R A;  5A6Q A;  3BOP A;  1J3R A;  1VPH A;  2I74 A;  1CD3 G;  4AGG A;  4YW6 A;  3C7F A;  4N7I A;  2VXR A;  5BNN C;  2MHF A;  2J42 A;  3C2U A;  5F1R A;  3ACF A;  1DGL A;  4S2D A;  4BQ5 A;  3OYW B;  3ZMN A;  2GAU A;  1JZ4 A;  1LUL A;  4G3Y C;  3ZN6 B;  1Y3T A;  5IAX A;  2DFC A;  5JPN B;  4LO6 B;  1WUV A;  1C5I A;  1LEC A;  5FZ6 A;  2R07 1;  3FLR A;  2GP5 A;  1ZM1 A;  4NE9 A;  3UET A;  1UNB A;  2WNV C;  2OX0 A;  4TSV A;  3WXP A;  1HDK A;  2VUJ A;  3KQR A;  3M3E A;  4KWK A;  3ZYI B;  5F9T A;  4CXX A;  2ORZ A;  4A6O A;  5BNO C;  1JI6 A;  4FP3 A;  2ARB A;  1FOD 1;  3I59 B;  1OXC A;  4V1P A;  5C3P A;  1H8T C;  2BFU S;  4X8N A;  1XRU A;  3AC0 A;  1OFS A;  4BA6 A;  4XUT A;  2FBE A;  4GMP 0;  2I45 A;  3MID A;  4ORF A;  2J1E A;  1DLC A;  2XLF A;  5ANN A;  5KXD A;  3IB3 A;  2YFZ A;  4PHZ A;  3W58 A;  1EUT A;  2VME A;  5BV6 A;  3JBG 3;  1NA1 B;  2K9Z A;  1QJY 1;  5I0R A;  4CXY A;  1VBA 3;  3T3Y A;  2DTW A;  2DTY A;  2EIG A;  3H50 A;  4NR1 A;  1RUD 1;  5EFU A;  5FK8 A;  2VCM A;  1MAC A;  2X09 A;  2GZW A;  4P9L A;  1QHD A;  3BB6 A;  4YVS B;  3B01 A;  5FCC A;  2NN8 A;  2UUR A;  1F31 A;  4WM7 B;  4E4H A;  5C7G A;  1HJG A;  3TN9 2;  4BH9 A;  1A78 A;  5L19 A;  1JH5 A;  4M0H A;  3VD3 A;  3LPF A;  1BMV 1;  5G05 L;  1G7Y A;  4M3C E;  3HQR A;  5JOW A;  3KZ4 C;  1W6N A;  1RHI 1;  4QXH A;  3BUC A;  3A7Q A;  1UPS A;  2AUY A;  1Q8S A;  4IEY A;  1D4M 2;  1V6J A;  4GWN A;  2PHX A;  2XOM A;  4XW3 A;  2QQI A;  5JOZ A;  3Q8B A;  2WA4 A;  3LEK A;  4QKF A;  1U5I A;  1EPW A;  3ZM8 A;  5C33 A;  1AF9 A;  2WAA A;  4PDW C;  1K5M A;  4DZG A;  3HEI A;  3T0D A;  2ZX0 A;  1RUH 2;  4UFH A;  3WDW A;  4BE3 A;  5JDB A;  2VCA A;  3VHR A;  4CU9 A;  2W1S A;  3AP4 A;  1VMJ A;  4BQX A;  2Y38 A;  2R32 A;  3UKN A;  4CDX A;  2AR6 A;  4LBQ D;  2XGX A;  4XJ9 A;  4GQ7 A;  1KQR A;  4IV3 A;  3RZK A;  4XFH A;  1O7F A;  1NCQ C;  5K0U A;  2X5I B;  4LBQ A;  1UMH A;  4E27 A;  3RNS A;  2WQ4 A;  3LOI A;  4YLZ A;  4AHX A;  3M70 A;  5F6K A;  4YM0 A;  3VDA A;  2IXC A;  4BIS A;  4GB3 3;  3WNP A;  2GDF A;  4B29 A;  4GH4 A;  3AMP A;  1AX2 A;  1R1A 1;  1X8M A;  2ZGP A;  2B9V A;  1OLQ A;  3AJZ A;  2RS5 2;  4JHZ A;  1RVF 3;  2QZ3 A;  4GJZ A;  3GCX A;  3VZL A;  4BOW A;  2HEV F;  1DQ6 A;  1W28 A;  1JOB A;  2ZEW A;  4DFS A;  4E8D A;  1MVQ A;  4EE2 A;  1OUR A;  3T08 A;  3FL7 A;  3ZFE A;  4AI0 A;  4MO3 M;  4JGY C;  1IQD C; 
#chains in the Genus database with same CATH homology
 5FJK A;  4LIT A;  4UF0 A;  3KV5 A;  5FZD A;  2XXZ A;  2OS2 A;  2XDV A;  4GJY A;  5FWJ A;  3AVR A;  2Q8C A;  2XUE A;  5FZL A;  5FY1 A;  5IWF A;  5FYM A;  4QX7 A;  3K3O A;  4EZH A;  2VD7 A;  5F2S A;  2YBP A;  4CCO A;  3PDQ A;  5E6H A;  5FZ9 A;  5A7P A;  5A7W B;  5FZ6 A;  5FPL A;  4TN7 A;  5A7N A;  5FZO B;  4Y3O A;  5F3G A;  4XDO A;  2GP5 A;  2YU2 A;  3U4S A;  4ASK A;  2P5B A;  2YBK A;  2OX0 A;  3DXU A;  5FZG A;  4D6R A;  3N9P A;  3PUS A;  5FY0 A;  4NUB A;  4Y33 A;  5FZ3 A;  3ZPO A;  3N9L A;  5A80 A;  5LY1 A;  5FZK A;  3KV4 A;  3PUA A;  2OQ7 A;  4LXL A;  5F3I A;  4Y4R A;  5A3W A;  4D6Q A;  3OPW A;  4UF0 B;  3PU8 A;  5A3T A;  5F3C A;  5FYT A;  5FZH A;  2YU1 A;  3LDB A;  3AL5 A;  4CCL A;  5FY7 A;  5IVJ A;  3NJY A;  3KV9 A;  5FXV A;  5A7S A;  5K4L A;  5FP3 A;  4IGQ A;  5CEH A;  5IVY A;  3K2O A;  5FPA A;  5FPV A;  5FZ8 A;  1VRB A;  4GD4 A;  3PUR A;  5FBJ A;  4LIU A;  5FYY A;  4CCJ A;  5FZE A;  5FZM A;  4EZ4 A;  5IVF A;  5FV3 A;  5F2W A;  4CCN A;  4BXF A;  4QXC A;  3U78 A;  4E4H A;  5FXX A;  3UYJ A;  4QWN A;  5FZA A;  4CSW A;  5A7O A;  5FJH A;  5F39 A;  5F5A A;  4BU2 A;  4QXH A;  5FXW A;  5A7Q A;  4CCM A;  5FYS A;  4CUG A;  5F3E A;  4AAP A;  3AVS A;  5FP4 A;  5FP8 A;  4C8D A;  5FXZ A;  3RVH A;  4IGP A;  5FY8 A;  4GAZ A;  5FYI A;  2XML A;  4QXB A;  4QU1 A;  5FZC A;  5FWE A;  5FY9 A;  2PXJ A;  5A7W A;  5IVB A;  5FYU A;  4XDP A;  2YPD A;  3N9Q A;  3PTR B;  5FZO A;  5IVC A;  5FYZ A;  5FY5 A;  5FZF A;  5A3P A;  2WWJ A;  3PUQ A;  3AL6 A;  2Q8E A;  5FZ0 A;  5IW0 A;  5A1L A;  5IVV A;  5FZ1 A;  5LY2 A;  3N9M A;  5FYB A;  4URA A;  5A3N A;  4EYU A;  5ISL A;  4D6S A;  3OPT A;  4HON A;  5FP7 A;  4DO0 A;  4V2V A;  2OT7 A;  5F5I A;  2GP3 A;  5FYH A;  5KR7 A;  4IGO A;  4LIV A;  3KVB A;  5FYV A;  4V2W A;  5ANQ A;  5FP9 A;  3PU3 A;  5FPB A;  2YBS A;  5FUN A;  5FZI A;  5F37 A;  5F5C A;  5IVE A;  4BIS A;  4CCK A;  3KVA A;  5LW9 A;  5FZB A;  4DIQ A;  3ZLI A;  4QX8 A;  3LD8 A;  3KV6 A;  2WWU A;  3DXT A;  5FZ7 A;  4HOO A;  3N9O A;  2OQ6 A;  5A1F A;  4GJZ A;  5FY4 A;  5FZ4 A;  5F32 A;  4AI9 A;  5FPU A;  2W2I A;  3N9N A;  5LWB A;  5FUP A;  5FYC A;  3K3N A;  2Q8D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...