2OX5A

The soxyz complex of paracoccus pantotrophus
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
108
structure length
108
Chain Sequence
b'ADDAKPRVKVPSSAKAGETVTVKALISHKMESGQRKDADGKLIPRSIINRFTCELNGVNVVDVAIDPAVSTNPYFEFDAKVDAAGEFKFTWYDDDGSVYEDVKPIAVA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SoxZ protein
publication title The SoxYZ Complex Carries Sulfur Cycle Intermediates on a Peptide Swinging Arm.
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Transport protein
total genus 19
structure length 108
sequence length 108
chains with identical sequence C, E, Z
ec nomenclature
pdb deposition date 2007-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08770 SoxZ Sulphur oxidation protein SoxZ
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ox5A00
2GJJA 4YHZH 5BV7C 5KTEL 3CFEA 3W82A 4M62H 1IQWH 1Z3GL 4N8VA 3FONA 1V7ML 2YSSA 2NY2D 4KI5D 1PW3A 4FFWC 1IJ9A 2ID5A 3RVWD 4CJ0A 4PJEA 1F2XK 1QKZL 2BOCA 3TZVC 3FHQA 2Y1VA 3EFFB 5D5MA 1II4E 3CCHA 4Y4FD 1CLYL 3BKYL 3F6LA 1YECL 1BJ8A 3UTQA 2F19L 3D0VB 2YD9A 5GGUA 3RGVC 1C5CH 2DF3A 4Z7WA 3FQUA 5C0GB 1QR4A 4YHLL 2HN7A 5K9JL 5DHVB 2J6EL 4XMKL 4KI5F 4PTTB 5DXWA 3WKML 3L5XL 2XPGB 3HUJF 3GSUB 5DJAB 5I1CH 1I1FA 3V2AR 4WEBL 1CGVA 4LVHB 4EDXB 1A1OB 4GG6A 1AQKH 2RJMA 4GW4B 3FO0L 3MRHA 1KTRL 3G5VA 2VDMH 1MOEA 2Y9RT 2X9WA 4JKPH 2XQBH 2A0LC 3BMWA 4PJGE 4W4OA 2VZVA 4TTDC 4XCEB 5KSAC 4FZEL 5FUZL 5KVEL 1PVHA 3ZE1F 3T8XA 3MLSH 4N5ED 5E94B 2DQEH 2NY1B 4YXHL 3L7EA 2F53E 5F71A 4RA0C 3GI8L 1Y0LA 4MJIE 1TVDA 4C55A 4EVNA 3OKOB 4WU7B 1NANH 1CVSC 2QL1A 2BVPB 2X4NA 3FRPG 1EH9A 4X5WB 1GGIL 2VR9A 4L8BA 1C16A 5EULV 1YUHA 1I7RB 1BJ1J 2OL3H 2CDGA 5EUOA 4NUJB 3SPVB 3EJYC 3I02A 5CIPB 1ZS8A 4R8WL 1AGCA 2EC9U 2FHCA 3TO4B 3QEHB 5JPNA 5DEGB 1M71A 4KUZH 5EU3B 3LD8B 4HKBA 4XP6H 2RAMA 4L4TA 3MXVH 2FJFB 1FIEA 1HHHB 4WFHD 3L3HA 2V9TA 3LEVH 4LLMA 4A2MA 1ZA3A 2DQGL 3DV4A 4B50A 3IDUA 1FSKC 2Q3AA 4BQ6A 3CFKB 3B9DA 1INQB 5DRZB 4FFWD 2VZ1A 3VXSB 2X1OA 1WF5A 4G7YH 4FOMA 1IC1A 5T5FH 3TZVD 4DOHE 5DD1H 3F7YA 3RIFK 4WWKB 2C3GA 3GSVB 2NW3B 4MXWL 5FM5M 4CVZA 1BVKA 4NQDB 4ODUA 1J0IA 3GGWA 1FNSL 1AR2A 5GJSL 4GQ9L 2Q8AH 4IHOA 4X9BA 3LRGA 4EKXA 8FABB 3B3IA 5C0BB 2PYEE 3VDAA 2DQCL 3G5YA 1VGEL 1D7FA 4XNMB 4HWEL 3QUMH 3T0XA 1OY3B 2W07A 4BZ1H 1AXIB 1UZ8B 4YR6B 2OBGA 1UYWH 2C3XA 2R56H 2P8PB 2R23A 1BAFH 3BGFB 2WQRA 4FABH 1NQBA 3VI3E 3QG6B 4ZFOL 4J1UB 1PYWA 5FOJA 4Y19A 4OLUH 1KTKE 4HDIA 1T20B 2MQ0A 4HWBH 2ICCA 2GYSA 2X40A 4PGJA 5EU6E 1GAFL 4R0LC 5ITBL 4TTDD 5C2BH 1T04B 3QDJE 2P5WD 2Z4QB 4HGKC 1A7RH 5GGRB 1MEXH 3BEWA 1LD9A 2E5EA 2VLKA 3ESVF 1K3ZA 4G6KL 3VWKB 5FK9A 4GG8A 1KB5L 3IAQA 5LVEA 4PLJC 3RP1A 2IAND 1R3LB 3BO8A 3QUMA 4NDMB 3AY4A 4YAQA 1A7OH 1J86A 1T66D 3CH1B 3PF2A 2H26B 5EA0L 1YEFL 3UTSA 4JZOB 3DRTA 3FB5A 3MV01 2EDJA 3BQUA 1CDGA 2IBBA 4NNPH 3K80A 2FZ3A 3FQTA 4LQFL 4KRLB 5GGRY 5C09E 3VFOB 1LK2A 5GZOC 1A9BB 2R0LL 5J8OA 4HWBA 3MJ7B 2BSRB 1JTTA 1FRGL 2EKSA 2X7LB 1NBVL 1B0RB 2G75A 4JAMA 4EQ2A 5KAQG 4PY8J 2HLFC 4U0QB 1J05B 4XH2B 1T7ZA 4MGXA 4TRPL 5F89B 5JUEH 2CRIA 4HUWA 5ISZB 4EUPB 3SJVB 4ZPVA 1EHXA 4OM1H 4GOSA 1KIRB 1IKFL 1QPPA 1K4CA 1PY4A 1MWAL 3MPCA 4WI2A 5ICZA 1IGIL 3IJSA 1V8HA 4WU5A 4H5SB 4IIQA 5GGSA 3SO5A 3TIEA 1D6VH 4JFQB 1B4RA 3UBXG 1MFAH 3C6SB 1NAMH 3NCMA 4JQIH 5EO1A 4PRHB 3MLVL 4LCWD 4YEFA 3QIWB 1AJ7H 2Y06H 1KPUA 4S1QL 5HHMB 5TDOA 4E41D 4K3EL 5T1DL 4XC1H 1NLDH 3MRIB 4Q9RL 3OAUH 1M7DB 1I8LA 5TF1H 5E8OB 1UG9A 5D93B 3QHFL 1P2CB 4XPAH 5BO1L 1DQQA 4Y4FA 3BKMH 3MV8D 4OLZH 2E7MA 5I73C 5DQ9A 1NH6A 1JZ5A 4KRPC 35C8L 2IPTL 3ILQC 4X4YA 3HZMA 1E27B 1YEEL 1X5KA 3RU8H 5DJ6B 2VXTH 4TULH 4JM2A 5FF6A 1F8TH 3GSRB 3HI6L 2JLLA 3FB7A 2HKFH 5AZEH 4G8GE 3V5DB 4H1LB 5MP6H 4X6FB 1TVHB 1OSZB 5E2UH 1R3IH 4JFED 3KYOB 5DA4A 2V5RA 3S35H 2VIRB 4HGMA 4PLJD 1HHKA 1NAMA 1DFBH 1YEJL 3TFKC 4I2XA 5HHVL 4UDUA 2UUDK 4I3RL 5IFHH 4H8WH 2IG2H 4RMWA 5FM8A 4JDZB 3V5KA 5FGSA 5CJ5A 1L0YA 2BHYA 3O81A 1TZIB 3CZFA 5CEXA 5FO9A 3OR6A 1OAYH 1XGPA 5CEYB 4KKLD 3FZUC 2VUYA 5EN2B 5ADPH 4EDWH 4JR9L 1AGFB 3EOAA 1BREA 3IAPA 3VXRE 1MCWM 3O4OC 4NHUB 5HGHA 4NQTA 4YDJB 2I5YH 3QZWG 2IGFL 4LEXL 5F7YC 5IFAH 2HJKA 4DUXA 4YDKL 3MUZ1 3QR2A 3TN0A 3VGGA 3D85B 5T1MB 2AJSH 1OGAA 2IALB 1GGUA 2YA2A 1XGUA 5DMIL 1JK8A 4XWOC 3B83A 1JIBA 3D69A 3X14B 5HI4C 5C0IA 3MRRB 4TSAH 5GHWH 2QSCH 3F6IA 4Q58C 3B2VH 1NKRA 4D9RE 2E7LC 1FZKB 3T3PE 1MRDL 4EI5B 1OD7A 1QRNA 4LQ1A 4WUKL 4FQXB 4PG2C 4XNYL 4P2QE 4I9WD 4O00A 1ZGLM 4QY8A 2V5SA 5DRNB 4HIIA 5EFIA 3BH9B 3DECA 4XNQA 3KR3L 1A14L 5F7EL 4QO1A 3EYVA 1DDHA 3THML 5ENWB 1MAJA 4GBXD 2Z0BA 4LGPB 3GM0A 3TNNB 3ZL4L 2X05A 2IH3B 5FECA 1Y6NR 1MHCB 1VCAA 2DQTH 4HKZB 3TZVA 5FGBC 3VMNA 4LCUA 3W81A 3I75B 3NAAL 1JNLH 4MA3A 3T0DA 4KJYB 5JW4Q 4LFHD 3QDMB 3NPSB 4NKOA 1FVDB 3X12B 3HHRB 4TPRL 2PR4L 4R97C 2OTUA 5E5RB 1W72B 1OTUD 2FJGB 4HC1L 4QRTA 3WS6C 2CLVA 4XT1C 1TJIL 3H42H 1YEDB 2AKRA 5F7UA 2IMMA 3FQRA 2FX7L 3V7AG 1JFQH 3WV0A 2WP3T 4PJ9B 1U3HB 1ZLVH 3S98A 1IEBA 3LQAL 4N0UE 4NN6B 2VXSL 3A67L 4XBGA 5CEZE 4Q9QH 1IFHH 3O2WL 1OP9A 3EOBB 4MA1C 5AEAA 1ZT1B 1XR9B 5TGBA 5IB1B 1EVUA 1KJ2B 3OKMA 3KPSB 2VISB 1X6NA 3MBEC 3NCJL 4QWWD 4R90H 5D2LA 5HJ3B 3QCUH 4GQPH 2ERJC 3TBTB 3FZUD 1XCTA 4EEEA 3VI3F 4R7NA 4FZ8L 3UDWC 3QQ3A 4RGND 4DZBB 2V2WB 4NO5A 4CW1B 4ZSOB 1OVZA 4XNZB 3H6JA 3I50L 5FIEA 3SDDC 4M7JL 1IT9H 3GNML 4QHUB 2UVFA 4OTXL 2IANA 5E1HB 4JG1L 3CC5A 2X4OB 1V3MA 2B5IC 4XWOD 1NCAL 2ZUYA 1NFDB 2Q6WA 4P9HH 2AJ3B 5GISH 2DQJL 4RNRB 3RWFB 3T65A 1OAZL 1S9YA 5F1SA 2W9LA 1V3JA 4NKDB 3Q6FB 4ISVA 4OZIA 6FABL 5C0FA 4NP4H 2FEEL 1N4XH 4N9GB 4JN1L 4ETYA 4WDIA 1NJ9B 1NGYA 3NN8A 5A2LH 1A2YA 2W0LA 2VE6B 2V6HA 4Z18A 1UZ6E 4I18B 4KHXH 1BVZA 4N5UA 2EH7L 3WXVH 4S1RH 3ME0A 1CZ8H 2MHAA 3JZ7A 3ZKQD 3UTTA 3IS0X 2OXGA 3LQZB 1AHWB 1HIML 3RVXC 3VRJA 1FGVL 4K71C 5CZXD 2Z31B 3WIHL 5FA3A 1LO0L 1QSEB 1RUAL 1QQDA 5TDPB 3U30B 5DJ0A 5KVFL 5TE6H 4AMKL 2Z8VC 3NOIA 4YHYB 1MH5A 43CAB 1UM5H 4M8QB 3C8KA 4RIRA 5AZ2L 5FYLD 3TV3H 4LLDB 3OXSB 4QXUH 1KPVA 4G8EB 2PTTB 5I76B 3REWB 4QHMB 5KVDH 2FHFA 1FP5A 3DO7B 3KPTA 5DVNA 3CVHB 3JVGC 1PY9A 3LS4L 4LCWA 5EB9A 2V7NA 1LEGB 4PRPE 5GSVB 4E41A 3KS0J 5DHXB 1WZMA 4HIEA 1WIPA 4K3HA 4I8DA 1NEZG 4IJ3B 4XRCB 5A2IH 1X5IA 2UWEF 5BVJB 4N8VG 1D5MA 3MV8A 2R29H 4L9DA 4KMLB 3KXFE 3JV4B 3VFVB 4QHLB 5EZJA 3FOMB 1QBLH 2J8UE 1A7QL 4M6OL 1NMCC 3WYRA 1S9XA 2X70B 4WW2A 1NGQH 1HOCB 4XMPL 1WTGT 3BN9D 1K4DA 2UVEA 3SDCC 3ZO0A 3EO9L 3WS3B 4FTVD 3ILPB 1X5YA 3QEUA 4NZTH 3EFDL 5B3JF 5F7HA 1C5BL 4JFEA 3SDDD 4G9FE 4I13B 4X4XA 5FDYA 5B4MD 4ZUUB 3MRDA 5D96B 2UYLB 1KIQA 4NZRL 5DT1H 3AFLA 4NGHL 5DUPL 2JELL 2W60B 1XZ0A 3I84A 3NCYP 1IGFH 3P0YH 1KCVL 2O61A 3MACH 1KJVA 5C07D 4KK9C 3ALPA 1JWSA 1ZOXA 3BP7A 4OCRH 2VOTA 5HGAA 1RIVL 1G6RH 2XG4A 1YNKH 2BSSB 1AP2B 2YD1A 1X9QA 4HF5L 5ITFA 4IOSD 4OGXH 1KG0B 3G6JF 2HAZA 3RX5A 1QSVA 4YBLC 4H0HB 2JB6B 5A2JH 1XGYL 4PJ7E 5CJ8A 4N8CL 2JK5A 2XZQH 2W9EH 4C58B 1BVLB 1A6VL 4U6YB 3S7GA 4P46C 4U6VL 4UOW1 5A1AA 4XBEH 4JFPA 4BKLA 1JN6B 2Y07L 3EGSA 1TVBA 3RVXD 4EI6B 3FAWA 5I8OL 2VL4A 4WWID 2I07A 2AXFA 2VMFA 4YE4L 4YXLL 4MNQD 3BH8A 3QI9A 2DI7A 5F93C 1JPTL 3QJFA 2IPKB 3NH7L 1G7LA 4O9HH 3SDYL 4IDJL 4KVNL 2VTFA 1MFEL 5FV1L 1XGTB 4QTIH 4ZYKB 5K9KB 3MV9B 3ZMRA 3U7AA 4W70A 1EEZB 5I1GH 4J4PA 2XG5A 1G6RA 1GOHA 5IK3B 1NL0H 4WJ5B 2QR0B 3AREC 5ESVA 5FB8A 5KJRH 1MLBA 2NLJA 1JGDB 2NY6B 2OR7A 5K9QG 3T3PF 4GBXA 1OF2B 1FH5H 3VFNA 1QFPA 3L7FB 3HNVL 3IKCA 4NBZB 3QNZB 2FNBA 1QHOA 5I1JL 5IG7B 5INCB 4V1DA 2VH5H 4HUUB 1LVEA 2YKLL 4NRYB 2EXWC 5E4EB 4JRXB 4KHTH 5T3XL 3ARDA 1CDUA 3MRNB 1INEL 3DX6B 1D5XA 3EDKA 2FYYA 1MJUH 2VR4A 3BPNB 2NXZD 3LKQB 4OT1H 3QT2A 4QHKI 5J9PA 2GI7A 1MRFH 2VZOA 4P4KD 3C87A 3FQXB 4AL8L 4Z7VA 3VXPA 3NFSL 1SVZA 1FL6B 1ED3A 2VZ3A 1DLFL 3EYQC 3ARWA 4HKXB 4ZTPL 1F02I 1FVEB 3DXAD 2AV1A 4YWGL 5GRUH 4F15C 3MGOA 2GCYB 5I16B 1GHFL 5LWYL 1YN7B 4M1CC 5J6GA 2H9GB 4PJBF 2QHRL 2A9NL 4NM8H 5IW1B 1BZ7B 4KK9D 3RIAK 3UBXB 5H8DA 4M43L 3SOBL 1XGQB 2YD4A 1SYVA 2DLFL 4YGAB 3JSSA 1MHEB 5D72L 3OJ2C 2UUDH 5ERWA 1RZFH 3CDFA 3TWCL 5HXMA 5EIIA 3UTPD 3ARBB 3SGJC 5TH2A 5DWUL 3HC4H 1I9RH 4YXKL 4XHJC 1FZMA 3FO9A 3MRMA 4HWZB 4IM8A 3C60B 4K94H 3REVA 3MV7A 4Q6IA 2F5AH 4HIHA 4X6DE 3E6HA 2OX5A 5FYJD 2M26A 1LO3H 5GS0L 1UWGH 4M6NH 4PS4L 3AU1B 2A1WL 4PRAA 1QP1A 4ZG1A 2BVQA 4UQ3A 1NPUA 3FRUB 1DBJH 1DE4B 3WUWB 2CDEB 2WBJB 4LDEB 4M48L 4AT6B 4UT6H 1GZQB 5CP3H 4MQSB 1YNLH 2ADFH 1T0MA 2DWEB 3LY6A 2K7PA 2R0WH 3KPPB 4MMXC 1CU4H 5JZ7C 2VDRH 4UI2A 4GRWB 1FNEA 5DUML 1HDMB 3B9AA 3ARED 5IHUL 4L4VB 2AK1H 3D3VD 1XF4B 4XGZB 1ND0A 2FR4A 1RIHL 4OUUA 3SQOH 2CRMA 4ZUTA 3DX8A 2V2TB 3JWDC 2IPUG 3VRIA 3LKRA 3OBAA 4F3FB 5F7DB 2XTJB 1I75A 5CGYC 3VXUB 5FKAA 5E9DB 4LVOB 3BXNA 1UB5A 4NQXB 3N9GH 1HSAB 4LL9A 1S7QA 1G7PB 5EOCH 1UACL 4E42A 1FL3A 2CMRL 4PJXE 3PP3H 3EHBC 2ARJQ 2HTLC 2AK4E 4MQXC 1WAAF 4YFLF 5TFSL 1EEYB 1JNNH 5GJTH 1W8OA 3Q3GB 3MNVA 4CNIA 1WT5A 5BQ7A 5D7SL 4S0SD 4JFDD 5EIQA 2W0KA 3B5GA 1RU9L 4X8JA 4X80H 4BYHA 4FQHB 2X4PB 4JPWL 1GGCL 3T2QA 4F57L 2CO6B 1LNUA 1T21B 4Y16C 5CINL 4RSVA 4JPVH 4GKNA 3LH2H 1A3LL 5I1LB 1T80A 3O41A 4JHBA 4R2GB 3NA9L 2ICWI 1TITA 1G84A 4QOKD 1K5NB 3RFZC 2PXYB 1CTNA 4LSDA 1GC1C 4DUVA 1G9ML 2XT1B 4JRYD 3HMXL 3MRPB 1QBMH 1AKJA 3ZT5A 1WUNT 5C6TL 5C9JA 3G6JA 4J3OC 3ZTNL 2Y6SC 2FBJL 4AIZA 1DN0B 3B5TA 4K3DH 1NCCH 4YDLB 4PJCE 4QF1B 4B5EA 3QCTH 4Z7QF 4QXGH 5C07A 2ITDA 4U4BA 5T3XE 4X98B 4JO3L 3LN5A 3KPRB 3QFDA 3W0WB 1IGYB 4QLRA 4YHZL 2I24N 1W0VA 2UV3A 3GMNB 3UTOA 4M62L 1Q9LB 1I3VA 3MOBH 2W38A 1J10A 3PWPB 5E8PB 1VGKB 3V95A 5IVXA 4RAHA 5HHQB 1XCQB 3T1FA 3IDGA 5JZ7D 3L6FA 1CF8L 4QNPF 32C2B 2EDEA 3MNWA 2OTWA 4WI3A 4ODHH 4HG4K 1MCRA 2BVYA 1WLHA 1FFOA 5AAWA 5E08H 1LO5B 1EVTC 3VFUA 4PJHA 1KEGH 3GSOA 3LMJL 1HXMA 2VAAA 5DMGC 5E2TH 3U0TB 1HNGA 5BZDB 2JJVA 4RBPH 4MNQA 3S5LA 3MQIA 1FYTD 1P7HL 4UV4H 3RZCC 3IB4A 2FIRT 5LGJB 2ZSVB 1O7SA 3HC0B 4AIXA 3NZ8A 2VYRE 5DRXA 4OFDA 3AB0B 4PD4J 4FP8H 1MNUL 3DX9B 3O2VL 3EHBD 4KQ4L 5D7LD 1SJHA 1KELL 5C0EB 2Z93A 2YUWA 1T5WB 1PZ5A 4ZO8A 3B43A 5HGDA 3JVGA 1FCGA 3FL7A 3EO0B 2KQMA 1Q0YL 5IB4B 4DW2H 2XQBL 3OGCA 2GFBA 3I9GH 3HRZA 4Y16D 3IU4H 3OF6D 5F88B 4Y5XB 1B0GB 3WFHA 4M4RA 4KROD 2DQEL 3LV3B 2I26N 4C54A 2OP4L 4Q97A 5IOPB 4IS6A 1MAMH 4XP4L 4OZFH 2YPLB 3KLDA 4K9EH 3IDJA 3GO1H 1Q94B 2P8MA 4Z7OF 4MYWB 4GRLB 1NBZB 3GUTA 2FIKA 4AY0A 3AXLA 1T7WA 3GSNH 3CD4A 4P4KA 4NZDA 3ULSA 5FYJH 1JF1A 2XXMB 4GRMA 4JDTL 1OTSC 2OL3L 5IB2A 5MEOB 2IH1A 1NGZB 5IMKA 3WHXA 4U7KA 5KG9A 4D0CB 4GH7B 1VFOA 1MQ8A 3PABB 5DC0A 5B38B 3DXAA 1KIPA 3ULVL 2C3WA 4AH2B 4MVBD 4IRJB 4LLYB 4RGMC 3ZKMC 4LHQB 4JFFE 4FFYL 4KUZL 1CBVH 1FDLL 4BQ8A 1N64H 2IADB 4XP6L 3ZDXE 5EBLB 3O6MH 5LXGH 2MTPA 1C12B 2NR6C 4TNWF 4AJ0A 1EAPB 1KNOA 4MJ4A 3PJSA 2YD6A 5J1AB 5I19H 1M05A 2DM2A 2FH6A 4MB5A 4OZGF 5CJOH 3MXWL 1A64A 5DVLA 4YQXH 4LU5L 4XMLL 3SE8L 4P2OB 1IEAB 4OF0A 1CGYA 4OZFA 3RDTC 3A0OA 3DPBA 1NEZB 3S36X 1S8DB 5F1OB 1CFSB 3RWHA 3VE0A 5L8KB 3ECBB 1F11B 5FO7B 3FONB 4L5FL 2JKXA 5DS8B 1NGPL 3GSNA 3BPCA 4PBXA 5FUOH 3DETD 4U7MA 3RY4A 3T1WA 5LAXA 3AUVA 5DMGD 3SDXA 4MSWA 1LP9A 2X89D 4M5YL 5D5MB 4LPXA 4PLNC 1T3FB 2Q8AL 1WWWX 2Z91A 5DJDA 3P4MA 4OQ1A 3UTQB 4LRNL 4X6DF 4ZPTB 3G5XA 1ZHKA 5JIPA 4WFFD 1UYWL 2BXYA 5D2NB 2R56L 2BCKA 1MRCL 1IAOA 3FQWB 1J8KA 3D3VA 5BZWA 2ICWA 3BGAA 1I1FB 2BC4A 5GRJH 3WN5A 2FX8L 4X4ZA 4OLUL 4OZ4A 4UB0L 4WFEE 1WCBB 5E6IC 3GJFK 3MRHB 1PKQA 5C2BL 1U41A 1IGMH 1A7RL 1MEXL 4JZJA 4I0CC 3F5WA 2HVKB 4JFHD 5C7XH 1TQCC 1U8KA 3VD9A 4XWGL 5JIKA 3TJEH 4GAYA 1A9EA 3UX9B 3F7PC 4L29B 1MCFA 1MJJB 4Z6AT 3QPQC 2F58H 3L7EB 4D8PA 1OWRM 2R2CA 2CGRH 1F4AA 1Y0LB 3P9LB 5JPMB 3GEWB 1U6AH 2IBGA 2P43B 4HEPG 1J0YA 4J7RA 3TYGL 4XCFL 1EMTH 5CBEA 4JFDA 2PCPA 1JHKL 1X4YA 1DVFB 3WFBH 1XIWC 4NNPL 1RZJH 3D0LB 5IMOB 1UENA 1HEZA 4YHOH 1YUHB 2PTVA 4CN4A 1TPXB 3FCTA 7FABH 3P73A 4NZUL 1QEWB 5HDQH 4E0RA 2WQ8A 3L3GB 3N1GC 2JCCA 2NR6D 2QHLA 1ZWIB 1G9NH 4TUKH 1PJ9A 1KB9K 2DWDA 1ITBB 4HKBB 3T0ED 4XHQA 2AXHA 1QA9A 4JRYA 4GW5A 1MCPH 1OL0A 1RUQH 4LLQB 3H9SD 5JUEL 4LPTA 2QSTA 3ZSTA 1CFTB 3RDTD 1OW0A 1L9MA 3ZKXB 2C1PA 3P4OB 3PWVA 1LE5A 5FO8A 4JANA 4OGYH 4DCQA 2CKBA 5JXAL 5D1QD 2P7TA 4TYUA 2GJ6D 2NY3C 3KPOB 3MBXL 2ZZUT 5J13C 1QLEL 5JMOC 3QDHA 2PW2B 1Z6JT 3CFBA 3VXSE 1UH2A 4XVTH 5KN5A 3F7YB 2NZIA 3K2UL 5DR5H 3C5JB 2DYPD 3QA3B 4KZDL 2P48B 3N1QC 3BKCH 4YC2C 3M1BA 3GGWB 4NQDE 3OX8A 5C9KA 1UM6H 4XC1L 1NLDL 1HH6A 2EIDA 4CGTA 4MNGB 3QEQE 1I1YA 1MHPH 3EBAA 3JV0A 3OAUL 3RAJL 3UO1L 3HZVB 1Z9LA 5I74C 4U0RC 3KPMA 2EDQA 5F7NC 5HGBB 5C0BE 5KS9E 3ULVE 1CYGA 1MVUA 1MVFA 5IF0A 1GSMA 4TVPD 5E7FA 3P30H 4XPAL 2A2QT 3BKML 1UA6H 2KL6A 4JGUA 2ENSA 1YY9C 1QSFD 1ONQB 1D5BA 3RU8L 3WDIA 2YC1A 3RTQC 4TULL 1F8TL 5E6ID 3VH8B 1PYWB 4Y19B 1D6EA 2HKFL 3IF1B 1FYTA 3H9YA 5AZEL 4HDIB 1U8LB 1K85A 1IC7H 3CFDB 3ARQA 2QQNH 2E7CA 5I1HH 5T33L 2VERN 3OAZH 5E2UL 3BT2H 3S35L 1NGWA 1LD9B 4JFYA 4LPYA 5L88L 1MIML 2VLKB 4OI7A 2H32B 5FK9B 3H9ZA 4GG8B 1FO0H 3KNBA 2IG2L 4H8WL 4EXPX 2JJSC 3MGTB 5IT2H 5H37H 5I1KH 4Q9CA 1WBYB 2Q3ZA 1AD9B 3D48R 1UH3A 3DSNA 3OPZH 4I0PD 4PJAF 1EA9C 5EBWB 1LEKB 2OJEA 1S7SA 1B3JA 4MJ6A 5HY9B 2G60H 4EDWL 2BSTB 2MOVA 4XXDA 3LKOA 3PWLA 7CGTA 5GS2H 5LBSH 1EIBA 4JQVC 2EDFA 2DQIH 1LK2B 1PBYA 5DK3A 1AGEA 2CUHA 2I5YL 3EJJX 1BIIA 5IFAL 3S96B 1WC7A 5IWLC 2R2EB 5IVOA 1DBKH 5BS0B 3MCG1 4WI7A 3V0WH 2AJSL 2EKSB 1M7IA 4JAMB 2E9IA 1EHLL 2X09A 1T4KA 4TSAL 2BX5A 1O7VA 3DTXB 3NFPB 3NTCH 1XFPA 1UB6A 4FXGB 5FCSH 3TBSB 4JKLA 5CHNB 1T1YA 2NY3D 3GMPB 2OSLA 3CFCL 3LD8C 5ISZE 5KSUB 2KPNA 4LASH 4OQTA 3STLA 1M7XA 2OZ4H 4TSBH 3SJVE 1K4CB 2LQRA 2A6KA 3RX7A 1U8PB 4ZS7H 5ICZB 4Z7UF 2A83A 1AXSA 4N0YH 5HHNA 4IIQB 5GGSB 3RPKA 2C9AA 5K93A 1C7SA 3M07A 1KJ2L 3HKFA 3OB8A 4NQSA 1DEEA 1J1XL 4W6XB 1JVKA 3DYPA 3FOLB 5EO1B 1JL8A 3SGKA 4HX1A 3VCLA 4PRHE 1Z9MA 2NY2B 1U8JA 2EDKA 2YUXA 5HHME 4Z8FH 1ETZB 3LAFA 3ZHKA 1H5BC 2UY6A 2ICES 1JNLL 1I4FA 1TJHH 2N4IA 2VITB 5L8LB 3U2SB 3RTQD 2X89A 1B4JH 1G7QB 5C08A 1IQDB 5DJ8A 4Y4FB 1MPAL 1OAKH 2ESVA 3I6KA 4X4YB 4LP5A 5CUSH 5C6WH 2GJZA 3B9EA 4C56B 3FN0H 2NY5C 1FBIH 1U8OB 3FB7B 1JFQL 1RULH 4HPYH 1EERB 4J3TA 3RWJB 3GKZA 3QPXH 3UXFA 4Z7NE 4MD5B 3ZT7A 4QRRD 5SWSD 1L7TH 3GMMA 4Q9QL 1I3UA 1AE6H 2Z9TA 4K7PH 1BOGA 2RR3A 3VJ6A 1CFBA 3X13B 1SJXA 4UDUB 2F53D 1EO8H 4R7DA 1J0KA 2JJTC 4KTDH 4RFNC 3BW9A 3P4NA 2NTFB 5F70A 5MI0B 3KPLB 3CZFB 4FXLA 4CDHA 5CEXB 1VDGA 1QFHA 5I18H 4KKAC 5FDWA 2DKMA 1XGPB 4JVPA 1LO4H 2IC2A 3P11L 3DGGB 5BV7H 3QUYC 4ZD3L 5HSFA 4O51A 3CVIL 1IT9L 4ETQA 2XICA 4X83A 4RDQF 2QKIB 3OR7A 3PIQA 4ZTOH 2Q20A 3QIBA 5D7IF 3OXRB 4ENEC 5DQJB 5E8DH 1W0WA 4PRIA 4NOFA 5AD0A 2HJKB 4GUPA 1KTLA 2BNRD 3QIUC 3DUSB 4ALAH 4NQVB 1X5XA 3CGTA 3TBWA 4NHCL 2HFEB 2NY0C 3D69B 1WVZA 2AS5M 5C0CB 1M4KA 1N4XL 4WNQA 5EO0B 4KAQH 3D9AH 3LPWA 4LAQH 5LCVH 5JNYA 4GMSL 1CGSH 2P46B 4KHXL 5EORL 3T0EA 4WGVB 1QVOA 1GGBH 4TVPH 1BFVL 3PWJB 1CZ8L 3LVEA 5M94B 2IF7A 1J5OH 4HIJA 3H9SA 4XNQB 3X11A 4YZFE 2AXGB 2GK2A 2EDHA 4R4BA 3P4LA 1DDHB 2CK0L 1PKOA 3IXAA 4DK6A 1CQKA 3RWEB 4NNXA 3O6FD 4MX7A 1TIUA 2MKLC 5D1QA 4RMQA 1UM5L 2E9WA 2GJ6A 4JLRA 2AABL 2ZUUA 5IHZB 4RRPA 5HDLA 4HLJA 3QUXC 3TV3L 1X4XA 3C6LD 3QDGE 4K7PY 3TZVB 4LCUB 3V4UL 5KVDL 5EU4B 1ROWA 2DYPA 4XC3H 4Y8DC 3T77A 3JWOC 5ANME 2FHBA 4NCDA 3QDME 3BDXA 2FLBT 2OTUB 4BFBD 3V8CA 2CLVB 1KJMB 3U9UB 4RMUA 5GGVH 1BJ1H 1MCHA 4TSCL 4LSPH 1F3JB 2VLMD 1U36A 3IDXL 1JHTA 5EU6D 1CDCA 1DJSA 5HHOA 1HHGA 2R29L 4JREC 2IAMD 3QDJD 1IEBB 1QSFA 5L2JA 4N1EA 4MAUL 2V5YA 3ARTA 1CLOH 4XBGB 5CWSA 1BLNA 1HH9A 4MA8L 4AYFA 1MCIA 4WI8A 1QBBA 5E8NB 4NO2A 4PJAA 1K8IB 3OKMB 2YD5A 3RL1B 5B8CA 3KPSE 2R2BB 4KI1A 3UAJD 1JGVH 4KKAD 3OKEA 5KSAB 4H20H 2P5WB 4HMDA 1BQHB 3HAEH 3I6GA 3QUYD 5JR1L 3MJGX 4R7NB 3S5LG 3QQ3B 1CDIA 4Y4KA 5EU5A 3ARGC 4XBPB 2D7MA 3MLUH 4FFZH 3IJYB 3P0YL 3E6FA 4NYLA 3MACL 5C09D 4JN2B 1HKLH 3QIUD 4BH7A 3ZKND 5A2KH 3WD5H 4JY4B 5IW6A 3SO3C 3IFNH 3CC5B 3R1GL 4I0PA 2FO4B 4OCRL 2YR3A 2NY0D 4HK3N 4HK0B 1RURL 2Q6WB 5CLTA 4NPYA 3OWEA 2GTWB 3T65B 1NFDE 2Z35A 4M5ZL 3KHQA 1H3XA 3RY6A 4HXBL 1FJ1A 5D7KE 5BCAA 3N1FC 3IRPX 2ITCA 3BDYH 1RFDH 4GKZB 4ZDHB 2YOCA 4LLUA 4KDVA 5DEFA 3NN8B 2A6DB 3QDAA 4XBEL 2VQUA 1Q72L 3HAEA 1BFOA 5JQ6H 2MHAB 5GGVY 1F6FB 1FSKB 3GJFB 2FGZA 5IVZA 3RNKA 5F7LB 3PDGA 3N06B 4NT6A 3VRJB 4OKVA 3DROA 4O9HL 3MRQA 4K8RL 3FAXA 3QUXD 1CR9H 3ARSA 3EYUL 4QGTA 5DHYA 1QSEE 5DJ0B 2OJZL 4UU9A 3C8KB 5I1GL 3FQNB 4Z77B 1NL0L 1OAQH 3RWGA 3HI1B 4WO4D 3QUZD 3IVKA 3F58L 1KC5H 1A02N 1EJOL 3OKKB 1Y18A 2E8ZA 3T09A 1JBJA 3MYJA 4OD2B 4R3SA 1F90H 4OF3A 4HKJA 2F8OA 4HJGA 1AGBA 2ADJB 1IGJB 1A6WL 2VH5L 4DVBA 3W11C 4B53A 1OCWH 4OZFG 1U58B 1S9VB 4G8GD 3ARVA 4Q74A 3OKNB 4C83A 1VFMA 2GAZA 4AEIH 2YUVA 3MV8B 1PG7H 4LP4A 2EE6A 3PDOB 1MJUL 4OT1L 4XCYB 5EZJB 1XEDA 5ETUA 1MRFL 1U8NA 3DOSA 3OJMB 3LIZH 3M8OL 1K4DB 4Z95L 4YDVA 3O9WA 2XKNA 4GS7C 3MLTA 3QEUB 4L3EB 4KKBC 5CJQL 4PJGA 2ZJSH 3BVNA 3TGXA 4M7KH 2XA3A 4JFEB 3GSXA 1FAIH 4FQLH 1RI8A 3IFOA 4NM8L 1DQTA 5FYKU 2NMSA 2F53A 5GGTH 5JW4N 1RHFA 4MJIA 4C59B 5JOEA 3STZB 2O61B 1QR1B 5H94A 4P57A 1GPOH 3QRGH 2WINA 3JV6A 2V7HB 1MFDL 1EGJH 5D8JH 1K3IA 5HGAB 1XF2B 4XNZC 4G9DA 2A77H 4K94L 3MROA 3BP5B 3MMEA 1DLHA 2D0FA 1L0QA 4RGOH 4BM7A 1KULA 3HC3H 3VG9B 2VLRB 4LLAA 1KXQE 1K6QL 1UKQA 4M6NL 4D9RD 3GMLA 2C1OB 1I8KA 2OS7A 4XCCH 1XR8A 1FG9C 2MWCA 5JW3L 4JFPB 2NCMA 2HTKC 1OGTB 1BPVA 1P7KA 4UT6L 1TVBB 4YH6A 5DYOA 2ADFL 3EZ8A 2I07B 1A6ZB 2R0WL 3BH8B 1CU4L 5GGTA 2JIXD 4OI8A 3QJFB 2VDRL 4NQEB 15C8H 2YN5A 3TBVB 5DZOA 3O3EA 4QHNB 4U1IA 3MOAH 4MXQD 5HYSA 1YEIL 1OAUL 4KKNA 1EGJA 4EIZC 3SE4C 1TTFA 2VQ1A 3MV9E 5L2KD 1NC2D 1I3GL 1FIGL 5T3ZD 1Z3GH 1T0NB 3C5SB 3U30C 4OCYL 4F7EA 3O6FA 4WI9A 1U8QA 2HYMA 4JDVB 4X6CF 1IC5H 1H5BA 1AGDA 3V52H 1QKZH 2PO6D 3C6LA 5EOCL 3TVMD 3T4AB 1EDQA 1FNAA 3C9NB 4CVWA 4HBQA 1CLYH 3TNMA 3BKYH 4QRPD 5I73B 2EE2A 1JNNL 3MRJA 1F5WA 5E00B 5FHBH 3SE3C 1KACB 1Q9WA 4MQ7A 2WW8A 5M95B 1VPOH 4W81A 3CSYB 2BZDA 4YHLH 1BQSA 4S1DC 5HHPA 1D5XB 4M9OA 2O5XL 2ZCHL 5K9JH 2J6EH 4XMKH 3L5XH 3W2DH 1I8IB 4Z7VB 1JZ7A 3LH2L 4WFGE 5EU6A 1ED3B 5CD3B 4IMKA 4WEBH 2IAMA 3QDJA 3WJLA 2KH2B 4M3JA 3HPJA 5EWIH 3FO0H 2VLLA 3CPLA 2W91A 2JJTA 4BQCA 3S3SA 2VN7A 5AUMA 5J6GB 4KQ3H 3U0PA 3BWAA 3GKWH 3UTZB 3UZVB 1BEYL 1QBML 4PTUB 1EPFA 4FZEH 1U3JA 3QWRA 1F6AA 5E1AA 1X7QA 4WUUE 1A21A 4XNUL 1FFPA 3IGAA 5EIIB 5IHLB 3GI8H 4U1KA 4K3DL 3O4OB 5F9DC 1NCCL 2P42B 3MRMB 3QCTL 3REVB 3S8WA 4U6XA 1K2DB 1SQ2N 4QXGL 5C09A 2FSEA 3QIUA 4HIHB 5F7FA 2NZ9D 5E7BA 1QSZA 5FV2A 3E6HB 2J6EA 1F6LL 3K8KA 3MA7A 2DQFA 4UT9H 3EO1B 3G08A 3DARA 2HTKD 3LKSA 1ZLUK 4QTHA 2D0HA 5DF0A 4PRAB 5EH1A 2BVQB 2VL5B 2IBZY 4R8WH 1HNFA 3FMGL 4Z78A 3KDMB 1KXVC 5CLWA 1A3RH 5HDOA 1IL1A 2ADGA 4TNWK 1DUYB 1SHMA 3OB0K 1RK0A 3TPKA 5E08L 4LSQH 2GW5A 1KEGL 1EBAA 2LTQC 5IR1A 3VFRA 4GRWE 3SDAD 2DQGH 3QXAB 1NDGA 2YHGA 5IBUG 2DTSA 1E4WL 4OUUB 1RZIA 3TA3A 1ZT4A 4CMMB 4XB8A 3P3YA 4LBEB 4CADA 2YRZA 3H3PH 2AJXL 3LKRB 2VABA 2DMBA 4XAKE 4ZOBA 4G6AC 2XTJE 1OD9A 3BXNB 3VXUE 2ZSWA 5E9DE 2Y23A 3E3QE 3DYMA 1KEML 3MUY1 2A6JA 1K8DA 1DBBL 3DYOA 1C5DA 2BJML 2VZSA 4WO4A 1FL3B 5H37G 4ZFGH 5GJSH 2EDNA 3QUZA 4GQ9H 4R97B 5DFTA 5AWNH 2B4CC 4XX1G 3V79C 1CG9B 4S1DD 1XF3A 2DQCH 3VGFA 3FB8B 2EICA 1VGEH 4XTRD 4APQD 5C92A 4HWEH 4CNIB 4TTGA 5BQ7B 3IU4L 1C7TA 3SGEI 5CAYB 1S9WA 2XWTA 4F2MA 4KV5F 4X6BB 5E95B 1R5WA 2X1XR 1CDHA 4G8GA 4GKNB 4XXCA 5EZIL 1MAML 5CD5C 5T1KB 4MA1B 5ID0B 2H8PA 3GO1L 1E28B 4X7SL 4MJ5B 4G9FD 2NW2A 3HTLX 2EDTA 4S2SA 4F8TA 2J2ZA 1U92B 3WNNA 4EN3D 5D7JA 2VKWA 2JB5L 3CDCA 3OKDA 1FLRH 4FTVB 4ONFL 3R06A 5C9JB 1TJGH 1QFWM 3G6JB 1OSPL 4OF5A 3SDDB 4AIZB 4POUB 3VI4E 3WE6A 1C08B 1N64L 2SEBB 4U1LA 3GMRB 2EIBA 4MWFA 3O6ML 4X7TB 5J6HB 5LXGL 4BSVB 1HZHH 1RHHB 4IOIB 3VXRA 3K7UA 3QNYB 5DURB 3KAAA 4ZFZB 1YEFH 2B5IB 1HSBA 4YBQC 1B9ZA 1TLKA 2BNQE 1REIA 2CLRA 5CJOL 4I48B 1G9EA 3DVFA 2WWKO 3LN5B 5E4IA 3KS0H 5EIVA 4ZFOA 1FE8H 2R0LH 1H15B 3KPRE 4P59H 3W0WE 1FGNL 2R4SH 2ZG1A 3AC0A 1R3HB 3HZYA 4ZXBC 5BW7A 5HI3D 1FRGH 1NBVH 3UJTL 2C7UA 2VR5A 3PWPE 3V6OC 3L6FB 1E6OH 2PYFA 4P23C 2OTWB 3EOTH 4I77H 1FFOB 4TRPH 1IARB 3VFSB 1AO7D 4P2QA 1F4XH 1HXMB 2VAAB 1KB5A 5KSBF 4X6CA 3TC9A 1NFIA 5ALBL 4U1MA 2DAVA 3EYOA 4K71B 5H2BB 4MNQB 5DO2D 1MWAH 5CEZH 3HE6C 1UKTA 2JIXA 3TYFA 3RPIA 1FV1A 1IGIH 3R0NA 4Y88A 4PJDF 2MCPL 3G5ZA 4QCIA 5DRXB 1RZ8A 1WIOA 3M45A 4FQ1L 3CJJA 3S3PA 1MHHA 1YJDC 4JY6A 5GRJL 1SJHB 5L2KA 1NC2A 5E2VH 1A0QL 3MLVH 3BP6A 4S1QH 4G7VL 3MA9L 5GRXG 3DV6A 2HMID 4LVOC 2F74B 1IGML 4ZOAA 4MAYC 3TH2T 5AYQA 3CFJB 1RUML 3PXHA 4O2EB 1GZPB 3SKNB 2PO6A 1XAUA 4M7LH 2LVCA 3TVMA 5BO1H 3AM8C 5KVGL 1A1NA 1UJ3A 4QRSA 4G80A 5ALCL 4JHZA 35C8H 2IPTH 1KLFA 4Z9KB 4F33B 3C09B 2X4RA 4PJBB 1RZKC 4RRPG 3CH8A 3RVTD 5EO9A 4N0UA 4IS6B 1NMCB 1MWAA 2YZ1A 3IDJB 4Z0XB 3B5HA 5INDA 1EMTL 1ZEAH 3CIQA 3RUGF 4OD1H 3RHWF 5HYJD 3EYSH 2NXZB 3LKPA 2H45A 1RZJL 3B9KA 3MRBB 4GRMB 4YHOL 1LEIA 4FQJH 1YMHB 5EC1A 5IQ9A 5IB2B 2IH1B 4QRQA 3WHXB 1I3RB 4R2GC 4TUOA 5KAQF 1S78D 3D6GA 3DXAB 1KIPB 1YEJH 12E8L 5HHVH 1IM9D 3ULUL 4F7TA 2A9ML 1N59B 4HFUL 1T2QH 2PXYC 1QO3A 4OFKA 1YY8B 3MJ6A 5DSCA 1Z2KA 2I60H 1RUQL 5C0DA 1T2XA 4RMRA 3MJ8B 5MHSE 3C5ZA 4JR9H 3ZTJH 1CICC 1CGUA 4FS0A 5J11C 1JF6A 1WBZB 4ZXBD 5IMLA 4YBLB 5EUKB 5GPRA 5FM5O 4LEXH 4M6ML 2X1WL 5EDXA 4PLKC 4XVTL 1ZANL 3BPCB 4NO0D 4P46B 3VRLF 4ZOEA 2O93L 3TJHD 1T7VA 4JFXB 1P4IL 3SDXB 4N1CA 2YZ8A 4MSWB 5IKCA 2XA8H 1A47A 2FH8A 5FGRA 5LKNA 1LE9B 2ARJB 2LV4A 1P84J 4OZHF 1MRDH 5EU7C 4MCYA 1R3KA 3MCKA 4WUKH 3MLWL 5CSZB 1WWCA 3P30L 1ZHBB 1ZHKB 5DD6B 3W39A 4IMLB 2O5YL 4X6EA 3T2PA 4ONHB 1F58H 3KR3H 1A14H 4I5BA 5D2NE 3AREB 4LLVA 3HPLA 1S7UA 3SDAA 5F7EH 5T1LB 4HHAB 5BZWB 3THMH 1EK3A 4ZFFB 1UWEL 3S4SB 2BC4B 2FECI 1BD2D 1U95B 4LARH 5IROA 4OZ4B 1FN4A 4QGYA 4MAYD 4QHKJ 1RQ5A 2GITA 1IC7L 1XF5A 4HIXH 2AK4D 3HAEG 3LRHA 3NIGE 3D18B 4HZAA 4MMZC 4GRWF 4PRPA 1U8KB 3NAAH 1I1AA 4KWUA 4F7PA 1EAJA 5A16B 1A9EB 4TPRH 1FO0L 2PR4H 2VC2H 3SE3A 1H3TA 4IDLA 1DP0A 1XF1A 1BOYA 4HC1H 4JHAL 4J3VA 5I1KL 3TCLA 5LGKA 4B0MM 2GT9B 3CAFA 1SJEA 2AAVA 3OPZL 4JQXA 3KXFA 4PY7B 4RCAA 4APQA 4MQTB 3BZFA 2VJXA 3S97C 2J8UA 1PQZA 2DIJA 2PCPB 2G60L 2AEPL 1GYAA 3LQAH 4O02L 2VXSH 1KJ3L 2DQIL 2DJUA 4BSWA 1T89A 4F15B 3O2WH 4HJ0C 3FCTB 3WLBA 3ZHLA 5SWZE 4HJJL 1T22B 4PR5B 4GRLC 2UZXB 3ROLA 3RWIB 4E0RB 4G9FA 3K4AA 2ZPKL 4XNXH 2DWDB 4EN3A 4QOKB 4NIKB 1NGXA 4FZ8H 3WUZA 1QA9B 1AQDA 5I8EA 3GK8L 4JRYB 4KKCC 3SKOA 3V6FA 1CICD 3JWDH 1L6XA 1BZQK 2D7QA 3I50H 5T3XD 4M7JH 4HC1A 3GNMH 2PKDA 2EYRB 3BISA 3PWVB 1KENL 2OZ4L 4TSBL 3S3JA 4KUCF 2J8OA 4JANB 4KJWC 4A6YH 4ERSH 1R24B 5FO8B 2CKBB 4JB9L 2P7TB 2VXUL 1NCAH 1IKNC 2DQJH 3CFBB 2HT4C 3V8OA 3ARFD 4PJ7A 4Z5RB 4X9IA 3KYNA 2P1YA 4BJLA 4P2OC 1MCSA 4NQUA 3ZSSA 4HUXA 1BGXL 3IFLL 1VA9A 1OARL 4JN1H 4HAFA 1G1YA 5BMFL 1ZLUH 4Z8FL 4DQOL 1YDPB 5FOBB 4MNGE 3FT4A 2EH7H 1G9MC 3ULUE 1B4JL 3QULB 4XVUC 4OLVL 5I1EH 2XWBA 3U82B 1OAKL 1AO7A 1D5BB 2XWJA 3OB0H 5DRWB 5CUSL 1BBJB 1Q9OA 3WIHH 1LO0H 3WFDH 4LKCB 4HD9A 1FBIL 6CGTA 5KVFH 5KANG 4AMKH 1RULL 2NNAB 3TT1H 3RWDA 5J3HC 5GS0D 3AS2A 5AZ2H 1KUMA 4KTEH 5IB3A 3GHEH 1AE6L 2OTPA 3FT2B 3QXVA 5FA4B 2R69L 4U6HA 3LB6C 4K7PL 5D7LB 4OIBA 1CDBA 3FTGB 5DI8A 3LS4H 1VFAA 1MCWW 1EV2E 1EO8L 2VLKE 3KNBB 3BGMA 1JZ8A 5HYSG 4KTDL 4XZUA 3HLAA 1P7QA 4W4OC 4LLWA 5I18L 4Y16B 4LGRB 3AAZA 2OJEB 1S7VA 5MEQA 4BH8B 1S7SB 1UEMA 4R4FH 4NN7C 2BOBB 3OG6B 5BV7L 2M8XA 2CIIB 4KROB 3FO1B 4HQQL 4Z76A 3RVVD 2VQTA 3OKLA 2Y72A 4XXDB 2W59A 4ZTOL 3CDYA 3WIHA 2FLRT 1A7QH 1AGEB 2QADD 5CP7B 1QFUL 4JKMA 4TN9A 4XMPH 1BIIB 1FPTL 1WC7B 1TENA 3MO1A 4ALAL 4ZUSA 5DFVC 3EO9H 4OZGB 5BS0E 2CO7B 3EFDH 3QQ9C 4PG9B 1DANT 1UADC 1C5BH 3BPOC 4MS8D 1HI6B 4LAJH 5EOQL 4KAQL 4NZRH 4WV1A 1IM9A 5DUPH 3D9AL 4LAQL 3W9DB 5ACZB 2JELH 1T1YB 5AYUH 2OSLB 2AQ3A 1QD0A 2A73B 1WQVT 4X0KB 1HKFA 5ESAA 3PQYE 1GGBL 1HHJA 1MCBA 2HT4D 3ZHDA 5IUSA 1NC4B 1J5OL 3BZEB 1AR1D 1IBGH 2ZNXA 1EXUB 3S34H 5ICXB 1AXSB 3MYZA 3GSWA 1NCBH 2K7QA 4HF5H 3LKNB 1BM3L 4L1DA 2NY4C 4WW1A 1DEEB 1JMZA 4ZXBA 5M7QA 2Q8BL 1SEBA 1XGYH 5BRZD 4HX1B 1CDYA 1I8MA 3WNKA 1VFBB 3U7WH 1U8JB 1LDPH 2FL5B 1M1SA 4NO0A 4XVUD 4KI5E 3MSPA 4NNYA 4XC3L 3O45B 1G7HB 2Y07H 3HUJE 4OBSA 1I4FB 5IW3A 1MCJA 3KPNB 4NO3A 4PGEA 5I8OH 3K2MC 4JO4L 4HW6A 2MNUA 3CX5J 4YE4H 4YXLH 4ODSH 4JZNA 3ARXA 1JPTH 5HVWA 5GGVL 5J3HD 4PGDB 4LSPL 1IAKB 1MFEH 5HD8D 4WFED 4OV6F 4C56E 1JGLL 4PJIF 3ZE1E 4PJEF 3F7VB 5BJTA 1CLOL 3QG7L 5D5MF 2OXHA 4RZCB 3GMMB 4HWUA 3HR5A 3ZDYF 3C8DA 3KWWA 3L3DB 1BD2A 4L3CB 1BOGB 4PJXA 3VJ6B 5I1IL 4I3GA 1QFWI 1ZVYA 1EFXD 5FUCC 2AK4A 4R7DB 4Z7WF 1JGVL 3CLEH 5HTSA 3MFFA 3VWJC 3BW9B 3P4NB 5I1JH 1YEKL 3RI5F 2ATPA 1UXSA 1ZSDA 4N0FB 5CGTA 3V0VB 2DL9A 5IEHA 2YBRA 2YKLH 4OLEA 2J8HA 3MLUL 4YHIB 4FFZL 1A7NH 2Q76A 4L1HA 4MA7L 5D9SB 3DURB 5T3XH 2AI0H 2BHUA 4YEEA 2HP4A 2APTA 3PHQA 4TNVF 1INEH 4GG6F 2K1MA 3PIQB 3INUH 3H3BC 3IFNL 4QT5B 3AY4C 1WBXA 2RHEA 1BX2A 3QQ9D 4AL8H 1NCNA 4POZD 2Z8WC 5AD0B 1HK6A 3NFSH 2ZCLH 4DAGL 1Y6KR 3BQUC 4ZTPH 3I6LD 3TO4D 1MELA 4G42A 3ZDZE 3DHMA 3BWUC 2UZIL 3EDEA 4WY7H 4HGWA 2W9DL 1MFBH 2B1HH 4RGMB 5LWYH 2HFFB 5HYQA 2R2HB 5C0JA 3S36L 5IESH 1JPSH 4WNQB 4L4TD 2QHRH 3L3KA 4MB4A 2A9NH 5C0CE 5C0AD 5DK2A 3QWOA 3MODL 1V05A 4M43H 5AAMA 1OP5K 5JNYB 2BMKB 2DLFH 3ROOB 4Y2DC 5D72H 4PJCA 2FRGP 4HH8A 3TWCH 3BUYB 2HJLA 3MR9A 3VFPA 1F3DJ 5DWUH 1CICA 3VA6A 3VXSD 4G8FA 4HIJB 5E2JA 3X11B 4GSDL 4WFHE 5EUOF 3RDTB 4JPIA 5I15L 4WWKD 3L9RB 4QKXB 4MX7B 1N2RB 4NQDD 5JOFA 5D1QB 2GJ6B 4UQ2A 4JLRB 1GL4B 5GS0H 3EJZD 5TPWL 1KIUA 1HXYB 3QEQD 4FQIL 1L4IA 4IIQC 1ZHLB 3ARFA 1S7RB 3ULVD 2AJUL 3U6RB 4L4JA 2EZ0D 1KC5L 1U0QA 1T5XA 1Z9SA 3GDBA 3QEGL 2DYPB 2E3VA 4GXUM 5K33A 1N6VA 2D31A 1DN2A 2XACC 4U2ZA 2AJZA 1A1MB 1NCWH 2YXFA 1F90L 2DMCA 1S9KC 2DQUH 1I8LC 3LSOA 5DK0A 1EEQA 3RVWC 2HT2D 3MUGB 5ID1B 4HPOL 2YEZA 1F42A 4HCRL 1P6FA 1JHTB 4Y4FC 4X8XA 1PG7L 3GM8A 2I9TA 5T5NG 5DTFB 1QSFB 4RFEB 4JM2C 4FMKA 4LCCA 5E6IB 4PJAB 3LIZL 3GBNL 3VWJD 4ZNEE 5B8CB 1TQCB 4LGSB 4GLRH 4K2UH 5FAAA 4PBWD 2CMRH 2ZJSL 4AEHH 4HS8L 5HYEA 2P4AB 5EC2B 2P5WE 3DNKA 3KLAA 4MNHB 4YIQA 5TFSH 1J1PL 2ADIA 3X3GH 4PUBL 4RISH 3WFCL 3EDDA 3FFCE 3E6FB 4NYLB 5D7SH 2WWKT 3H9HB 4CBPA 5MI0C 1CT8A 1ZA6A 3QRGL 4Y5YA 4YNYA 1GGCH 2ZCKL 2BNUB 3OHXA 3L3OA 4I0PB 1XIWB 4U3CA 1NSNH 4G6FD 1A6UL 4OD3L 4N5EC 4WCYH 3RJDA 4EQ3A 3H3KA 2EECA 4NPYB 2F9BT 1CDJA 2GHWB 2Z35B 1QFWH 3HE7D 4RGOL 3HC3L 4DKEL 1TETH 3QYCA 3VXOA 4HG4J 2GSIA 4Z7UB 4Y2DD 1IE5A 3TN0C 4PREA 4JFFA 1RV6X 4XCCL 5ISZD 3HMXH 2FBOJ 3WHE0 3SJVD 1QOKA 1MQKL 4JVWA 1IGTB 1NBYA 1Q1JH 2EO9A 4AQ1B 2AERT 4PB0L 2FWOA 3ZYJA 5F72S 3RNKB 5DHVH 4TOYL 1M6OA 4BELD 3DROB 2NY3B 3MRQB 1U42A 4HUVB 5J13B 2ED8A 3G9AB 3MOAL 1I85A 3F62A 4FNLH 1GJIA 4NJ9H 3HNSH 5DMKB 4JO3H 4PRHD 4M61B 3QIWD 1MCLA 4HS3B 3U1SH 5HHMD 4E5XA 4YC2B 2HLAA 1JMXA 3IVKB 5A43C 3BOVA 4AM0B 2ORBH 3WJJA 4BUGA 1Y18B 5IFJB 1IC5L 3EFFA 1CF8H 4YDIH 4PJIA 4U31A 5BRZA 3V52L 5I74B 4U0RB 3MYJB 3HMXA 1FZOB 3MUJA 3VFMA 4HJGB 5DQDL 4D9QD 1Z0NA 3D0VA 2XIDA 3LMJH 2HT3C 2VLJB 4KJQD 5EPMA 4UTBH 3K1KC 2G2RB 5FHBL 3MLYL 4JM2D 3P77B 5C0GA 3RTQB 1YN6B 4D0BA 1VPOL 5IJKA 3MV8E 4PTTA 4MZ2A 2I9LB 2XPGA 3GSUA 5ETUB 2EYTB 3L3JB 4M1DL 1U8NB 4LIQE 5I66B 3D39E 3W2DL 4L8SC 1JJUA 5F7MC 2QLVB 4EDXA 4K07A 1MNUH 5CIPH 1A5FL 4YX2L 3O2VH 4KQ4H 3VW3L 1ZVSA 4GW4A 1KELH 3UZQA 3MLTB 2APFA 5GZND 4QRRB 5SWSB 3BVNB 5EWIL 2CLZA 4L3EE 4OF7A 5D7IB 1KN2H 2IQ9H 1Q0YH 3GSXB 4HSQA 4DGYL 5C8JA 4OF6A 4KQ3L 4O2FA 3GKWL 3IDIB 4JM2F 5ESQA 1EFXA 4OAWA 5JDSB 1NAKL 4KJPC 4P57B 3ZTJG 3G04A 2X41A 2YA1A 2WINB 3JV6B 4AENB 4LSTL 2O26U 2OP4H 3OKOA 4P4RB 4WU7A 2UZYB 4UUJB 4XP4H 4CN1A 2VB5A 3D85D 4DTGH 4X5WA 4F9PA 3TN0D 4BQ9A 1I9JL 5IBLC 4NWTH 1OGAD 4UT9L 1U91A 1MFCH 3QHZH 1T66C 2VLRE 3SPVA 4JDTH 5JXEA 3A6CL 4RFOH 2BNRB 5F9WC 3GMLB 5MENB 3TO4A 4LF3A 5DEGA 3ULVH 4DVRL 4EI5D 3PGCA 4PGCB 9CGTA 1JWMA 5BXFB 4FQXD 2FJFA 5DYOB 4FFYH 1FDLH 1A3RL 1HHHA 1QRND 5C0AA 1TTUA 3KLHC 1KFAH 1PLGL 4LSQL 5KBNC 4NQEE 3CU1A 4M93B 3ZDZF 2BDNH 5F3HB 3MXWH 1INQA 2Q7YA 3QFJE 4LU5H 4XMLH 5DRZA 3SE8H 1HILB 2YRLA 3VXSA 3IDNB 2VQ1B 3QDGD 2EH8L 5JW4R 4JO1H 3I3DA 3LQMA 3H3PL 4LNVA 2E8YA 4BZYA 4L5FH 4WWKA 2JF1A 2NW3A 1NGPH 2D7TL 3GMQB 4NBXB 4HK3J 4NQDA 4CMHB 4D0DA 1H5BB 1ZK9A 2OL3A 1KGCE 3Q1SL 4P9HC 4S1SL 2HT3D 3QEQA 3MC0A 5MERA 5HYIA 4GW1A 4M5YH 4PJ5B 4WHYG 5C0BA 4ZFGL 5KS9A 4G43B 5AWNL 3DSFH 2WSKA 5I1DB 1E4KA 4XNMA 3GMOB 4BQBA 4NC1C 2V17H 5F1IA 3MRJB 4LRNH 4DGIH 1UZ8A 4YR6A 3C2AL 4PJ9D 1U3HD 1Q9WB 2E27H 3PWUA 2P8PA 4MQ7B 4PP2B 3ZLQC 4WGWB 2DLGA 5L0QC 2D9CA 5HHPB 2QV2A 1MREL 3LEXA 3QG6A 1MRCH 3PE9A 5JW5B 2C4FU 2FGWL 3DVGA 3DI3B 4J1UA 4N9OB 3IU3B 3MRCA 3KPSD 1T20A 3PNWA 2FX8H 1UJTA 3MREB 4FFVC 1RK1B 4UB0H 2VDLL 1KB9J 1T04A 1UCTA 4HAGA 4NC2B 2Z4QA 5GGRA 3O3AB 1RZ7L 5CBAA 4WW2C 2PN5A 1G0DA 3WLWD 4HLZG 3NACL 3VWJA 4KJPD 3UP1A 4RFNB 4U7SA 2XZCH 5HBBA 3VWKA 4XWGH 4XPGH 1FLRL 3AS0A 4YHPA 1JYNA 1TJGL 3Q6GL 4JVUA 4EUPH 4P48A 3OGOE 1JTPA 2WLYA 3QUYB 4RWYL 3IGAB 1N6UA 3RRQA 5C86A 1MIEH 4LCYA 4U1KB 3CH1A 2H26A 1HZHL 5IBLD 5ADOL 2FJHA 5DJXA 3I85A 4XCFH 5D7KD 1ORSB 3TYGH 4U6XB 3HS0B 3RHWK 2FSEB 1JHKH 2BVTA 3QIUB 5D71H 5D2LF 1JPFB 3FFDA 5D1XD 1A9BA 3MA7B 1A8JH 1P53A 2DQFB 3VXQB 3JWOH 1VKXA 4CL7A 2NY0B 3G08B 4I3SH 4KKLC 5C2UB 3PUCA 3LKSB 1FE8L 1AD0A 4QTHB 3MJ7A 2YD2A 2BSRA 4NZUH 4P59L 2R4SL 4WI5A 5GIRB 1I9EA 3HE7A 3VG9C 3ZYOA 3KLHD 1Q9KB 5E99H 3RBGA 1J05A 4G6ML 1BHGA 2BY2A 3T0BA 1E6OL 4Y2DA 1IL1B 2ADGB 3EOTL 5ISZA 4I77L 3UTTD 1RK0B 4EUPA 2GK0B 3SJVA 2Z31D 1F4XL 5FFLA 3WO4B 1KIRA 5IR1B 1CWVA 1IGCL 1OP5H 2D9QB 4NRZB 1PG7W 1RZIB 3QI9C 3HMWH 4H1LH 5CEZL 4OZIF 5JXAH 4H5SA 4ELMF 3MBXH 1QLEH 1UQSA 3QUXB 3QJHB 1DUZA 4LSUL 1NEUA 3K2UH 3C6SA 4ZUWB 4PRHA 5IEKA 4J4PC 3QIWA 3L3IB 2UWEE 4UIKL 4KZDH 5ELIA 5H35B 5E2VL 5I1AA 4DN4L 3MRIA 4X7FC 2AEWA 4L9LA 4GBXC 5F6HI 5E8OA 3RAJH 5L9DL 3UO1H 4MDJB 3WNLA 3S9DB 3UCRA 1P2CA 1CGWA 1OAXH 4W6WB 4F9LA 4ZAKD 3NCYS 2Y5TA 1ADQH 4M7LL 5IV2B 3KYAA 2W0FA 3SKJH 5DJ6A 3O8XD 5B3JE 4JREB 2LAGB 4FFVD 3IS1X 5I8CB 4G8GB 5DJYA 1O5DT 5E24E 4F7MB 2OK0H 3V5DA 3ARDC 4LDOB 4H1LA 4MJ2A 5DGRA 1OTUC 4IRSD 4W6YB 5C0NC 1ZEAL 1E4XI 4K7FB 4OD1L 3EYSL 1TVHA 3V6BR 4KC3B 5E8EA 2NW2B 4HV8B 2VZTA 2CRYA 2VIRA 2DBLL 3PGFH 4FQJL 5T33H 3VGHA 3WIIL 2GUOB 4JFZL 3OKDB 5L88H 3WNPA 3VXNB 1MIMH 3IDYB 3R06B 5HI5C 4FTVE 2K3TA 3ARGB 1TZIA 5HVGB 1TNMA 1N0XH 3G6JE 1CFQB 1T2QL 2QSQA 4U1LB 3EZJB 4O2CB 4QWWC 2C3VA 3EYFA 1VEPA 5CEYA 4PRBA 4WW2F 3SO3B 2I60L 1AGFA 5KZCD 3UYPA 1ZGLP 4RGNC 2CLRB 3DX7B 4L8CB 4JFOB 2GTZB 5BVPL 4ZFOB 2CK2A 3QUKA 4Q6IC 1JF5A 3D85A 3S37X 2IALA 3X14A 3MRRA 1EHLH 4NKMB 1T1ZB 1W72H 1JV5A 2XA8L 1MLCA 1AXTH 1FZKA 1LWRA 1SJVA 3QI9D 2VWEC 3LEYL 4EI5A 2YPKB 3QXDB 5CZVH 2HFGL 3VDCA 2HG5B 1KB5B 3NIFF 1CFVL 4FQXA 3CFCH 4X6CB 1NFIB 4U1MB 1DQML 3EYOB 3TP4A 4KY1L 5EG6C 3UEZA 2LABA 3GSQA 3BH9A 1JGUL 2NY7H 1CL7I 4Z0BH 3MFGB 2EDXA 1FV1B 4J4PD 3OAYK 5IM7B 1F58L 2NY6D 5ICYB 2R1WA 5ENWA 4QCIB 1WSST 1KJ2H 1TCRB 2IH3A 1MHCA 2N7AA 1J1XH 3QDGA 4LARL 5L2KB 2ILLA 4HIXL 5CZXC 4RQQA 2V2XA 3MJ9H 3I75A 1CTOA 4CDGC 5ANMA 4KJYA 3MRKA 2XKSA 4V1DD 2AV7A 1IZKA 4YLQT 2ED9A 3SGDI 4JCMA 4GFTB 2NX5B 2FJGA 1IZJA 1MY7A 2VC2L 1UJ3B 1MPAH 1YEDA 3ARDD 3UPAA 3GBLA 4QRPB 2W1NA 5C0ND 3QO0B 5F96H 4K8RD 2X4RB 2EE3A 3VFGH 1WT5C 4Q2ZA 4NRXB 4P5TD 3DMMC 4PJBE 2WM0A 4PJ9A 1P84K 1U3HA 1QZ1A 4JJ5B 2VDPL 4L8SA 1H9VA 2W65A 4F37F 4PRDB 4Y1AB 5FYKL 3EOBA 1NCDH 2IWGA 4U1HB 1WZKA 1ZT1A 4GS7B 5HI5D 1LEIB 4DEPB 1KJ2A 3KPSA 5EC1B 4KRNA 4DKFL 5IQ9B 2VISA 1A6TA 1SEQL 5HJ3A 2YD3A 4WUUD 1NLBL 1EJ6A 4HFWB 1CLZL 4EOWL 4EXKA 4LRIA 3HNTL 2D2OA 4F7TB 1F4WH 4XNXL 1YZZA 3BN9C 4DZBA 2V2WA 2ZUSA 3LN9A 1QO3B 3JWDL 3C60D 4Z7VF 2P8LB 5C0DB 4JG0H 3P11H 4QHUA 4ZD3H 3CVIH 3MV7D 3PV7A 5B4MC 2ZUQC 1RD6A 2H3NA 2X4OA 3UTPE 4A6YL 4OGZA 4ERSL 2G5BB 5IMLB 4EIGB 2AJ3A 3KYMA 3RWFA 2R15A 4BFIB 1MUJB 4N90D 4LKXB 3BIKB 1QLRB 5D6DA 1B88A 2WBJD 4U1NB 2MJWA 3HI5L 4NHCH 5D1XA 3Q6FA 5MEPA 5GRVK 3CVHH 1O0VA 3IXTB 4N9GA 4ELMA 2XNAA 2DM4A 3HG1B 3QSKB 4RWHA 5IKCB 3K4DA 3B8SA 2UY7A 2OMNA 4I18A 1IAIM 2ZUWA 1OT2A 4GMSH 3UBXI 1JZ6A 2FD6L 5EORH 3MCKB 4P0DA 2F54B 1BFVH 4OV5B 1AHWA 1Q8MA 3B8YA 4XAKD 4D94A 2GY7B 3W39B 4C4KO 2YWZA 3Q5YA 2BVOB 5I1EL 2XTJD 2J7LA 2Z31A 5F6IC 2ZNWA 1QSEA 3PL6D 5E9DD 4I5BB 3SDAB 1WAAE 3WFDL 1WZ1H 43CAA 2CK0H 4M8QA 4PB9L 1SYSA 3D2UD 1R5VB 1GC1L 3TT1L 1FN4B 2AABH 2N56A 4KTYA 4G8EA 2GITB 5I76A 3REWA 4QHMA 1JYVA 3QHTC 2HVJA 4GXUN 3AROA 3V5HB 4KTEL 3GHEL 3V4UH 2V9RA 3PHOB 1LEGA 1J1OL 5GSVA 2CIKB 4HS6B 1RJLA 1U8HA 5DVKA 2W92A 1JCKA 3Q2CA 3DMMD 4NSKB 1CL7H 1JYXA 2WUBH 4JRWA 2WBWB 3KJ4B 3TCLB 3OKYA 4TSCH 3RZWA 1BQLL 4APQB 5BVJA 4ZAKA 1RZGB 1MCDA 3M17A 3IDXH 3NGBC 3BZFB 4R4FL 3JV4A 3VFVA 2FECL 4QHLA 4R9HA 3SKMA 3O8XA 1N8ZB 4M8VA 3FOMA 2BY1A 4A2LA 3DVNB 3C09C 4MAUH 5I6XB 1HOCA 3WFZA 4OKDA 4BSWB 4MA8H 2HA1A 3JTTB 5EZLB 3BMVA 4IRSA 3ILPA 1RIUL 4Z7QE 3ROLB 2NXZC 3SGDH 1AKJD 4P4KC 3GHBH 1OQOA 2WNGA 1JUFA 2GQHA 1NGXB 5JR1H 4QOKE 2YD7A 1AQDB 5I8EB 3E0GA 5I2IB 5EOTA 3V6FB 2X4TB 1DR9A 1F45A 5GQBA 3VGEA 4JRYE 2BNQD 4JPKL 5AYUL 4GT7A 4TNVK 5GRWA 2NXYC 2BERA 4QNPE 2L4OA 1WK0A 3R1GH 3ESUF 2BSSA 1IBGL 5ECJE 1RURH 3BRFA 3S34L 2KKQA 1H0DB 1KG0A 5F44A 1MI5E 5KSBB 4M5ZH 1NCBL 1UWXK 4HXBH 2JB6A 1Y6MR 3KYNB 3J7HA 1UKSA 4HUXB 4K9EC 5TQ2H 4XCNA 4U6YA 5FYKE 4UINL 3SBWA 4KZEL 4AIOA 1U8IB 4PJDB 3U7WL 1JN6A 1LDPL 3LHPL 3FT4B 1Q72H 1B0WA 2LTQB 4NN5B 5CKGA 1HQ4A 2VXVH 3VFWB 2IPKA 2VXQH 4WHCA 1P4LA 4ODSL 1AO7B 2EE9A 4YPGA 5IIEB 4K8RH 5K9KA 3MV9A 2BP3A 3MRGA 2DJSA 1EEZA 1YYLL 3V6ZB 3BE1H 3EYUH 1VEMA 2R1XB 5IVXF 4TQEL 1PFCA 5IK3A 2OJZH 3JTSB 3R0MA 1C1EH 1JGDA 2HH0L 3KG5A 2B2XL 2DDQH 2MCG1 3ARPA 4CN6A 3P0VH 4U6TA 5IB3B 3F58H 3WN5C 4PJHF 3NZHL 1EJOH 3RUGB 5KSVB 5DI8B 3QNZA 5D7LE 1QLFA 4Z7OE 1AH1A 3T0VA 5EBGA 3BGMB 5IG7A 3MRLA 3CLEL 3HLAB 4JZJC 5KOMC 1T0PB 2JJWA 2BXZA 1SM3L 4P2RD 4UZGA 1FZJA 1A6WH 4LLWB 1KCSL 2DN7A 3N0PB 1ITCA 3AAZB 2ZP0T 3T3MF 3MRNA 3FB6A 3VD4A 1EO7A 4JY5L 1A7NL 4JM4L 1WZLA 3LKQA 2AI0L 4Z76B 3MNZA 3CX5K 4LEOA 4FXKB 4WI4A 3INUL 1FLTX 1QRKA 1PGRB 1FL6A 4P5TA 3VXMD 4HKXA 3M8OH 3Q48A 4O5LL 4NQCB 5IVNA 2ZCLL 3CXHK 5HYJB 3QWQB 4Z95H 1H3VA 4GKSA 1H3WM 4IRJD 5I16A 2NYYD 5CJQH 1PSKH 4WY7L 2H1PL 4OZGE 4M9PA 1MFBL 2B1HL 2JJUA 5J56B 1DQLH 1MCOH 2LU3A 2MQCA 5IESL 1JPSL 4GAFB 1XGQA 4WUUA 3U4EB 1H8OA 4YFDB 2NXYD 4GRWH 4WV1B 5CCKH 1IM9B 1MHEA 2IMNA 2CXGA 3QH3B 1F4HA 2APVA 2XV6B 3A6OA 3ARBA 5SWQA 5DMYA 2OQJB 2V5MA 2EXYD 1U3YA 5DJCB 2DM3A 1YJDH 1MFDH 3PP4L 4HWZA 4DZ8A 3C60A 4QYOA 3IJHB 5FEBA 1DBMH 1DQDL 1OW0C 1QACA 1MCNA 1KTDB 3GSWB 5I17A 4OZHB 1PDKA 3WIFB 3CUPA 3JUYA 4WW1B 3OZ9L 1JWUA 1K6QH 4ZXBB 3AU1A 1KBGL 1H8SA 4MDIA 2NQCA 4P23B 3WUWA 5JOPD 2WBJA 1RZJC 1N0LA 4AT6A 5J1TC 2AW2A 1GZQA 3O4LD 1FCCA 4NO0B 2C5DC 5JW3H 1RSFA 2DWEA 1HHIA 1RZKH 3QO1B 3B9VA 3KPPA 4NO3B 4OIAA 4PGEB 3U0WH 1BJMA 2CKNA 1NCWL 3ZE0F 3WL9A 1G9NC 4JZNB 1R5IA 3PDDA 2DQUL 1A4KA 3HE6B 1NMBL 2EDRA 3QCVL 1XF4A 4RAVA 4XGZA 2XTLA 3IETA 3N50A 4J6RL 3F7QA 1YEIH 1OAUH 1YPZF 2IPUK 4ZUVA 5DVMA 3SCMD 4LSSL 2VDKL 4UT7H 3GRWH 4WFFE 3VXUA 3L5HA 3PL6A 4Q0XL 2R1YA 5E9DA 5SX4I 1LP9F 3SDXF 5BJTB 3T0WA 1I3GH 1FIGH 5ABDE 3HR5B 1GXEA 2ICEB 3OAYH 1L6ZA 1UFUA 4OCYH 3D2UA 1HSAA 1TCMA 1BD2B 4W68A 4PJXB 2VDQL 2R4RH 4MAYB 4FQPA 4EUPG 1GVIA 4ZNCD 4JKWA 4K2UL 4OBRA 2G9HB 3QZWB 1H3PH 1G7IB 1VENA 4AEHL 3W5NA 4GAJL 4XPFH 1EEYA 1R0AH 1J8HB 5CP3A 5IEHB 1OPGL 4GXVH 3X3GL 3SN6N 3HB3D 4RISL 2Q76B 4LPCA 1DVFD 3MRFB 3DMMA 3UJJL 4FQHA 2X4PA 2MPAL 1X44A 4KK8C 3PHQB 2O5XH 2ZCHH 1F00I 3S35X 5SWZD 2WAHA 5I1LA 4P5MB 4HMEA 1NSNL 1D9KD 1BX2B 5DD0H 2BRQA 3H0TA 3LOWA 5J12C 4WCYL 4WIQA 4KROC 3RQ3A 1N5AA 3GRWA 5D1ZD 1QFWL 2YK1L 4G42B 1JNHA 2P47B 1K5NA 1BQUA 1TETL 3O3BB 3O6LH 1P9MA 3CSPA 1WV7T 5HYQB 3MRPA 3D1MC 2Q86A 1PEZA 5DK2B 2E9JA 3QWOB 1BEYH 1J0JA 2R9HD 3HCVB 1DN0A 1WEJH 3K3QA 4XNUH 3CNKA 4H1LG 2HJLB 3CFIC 1DL7L 1Q1JL 3T08A 3MR9B 3ZZ1A 1S7XA 3VFPB 1CICB 1ZHNB 5J11B 2EC8A 1U8MA 4MVBC 5IJVA 3QB7C 2BNQA 2HJFA 1IVLA 1CLCA 3N1PC 4X98A 2JCCF 4FNLL 2DLTA 3KPRA 4NJ9L 3HNSL 4NKQB 1IGYA 3HZKA 2E6JA 2Z92A 4UQ2B 3U1SL 3GMNA 4Y8AA 3SY0A 2GJ6E 3AGVA 1Q9LA 2EIEA 2ZUTA 2EYSB 5DUBB 2HRPH 1FNGB 3RKPA 1VGKA 5E2WL 3ARFB 1XCQA 1T5XB 3FMGH 3ULUD 1P5VA 32C2A 2YD8A 2ORBL 4QXTA 3PXJA 3SGKC 2A74B 4YDIL 3U4BH 1C8PA 2AJZB 4KDTA 5F1NB 2DKUA 1KYOK 1LO5A 4H25B 5K9QI 3KHOA 1HCFX 3DETC 2H41A 3VXTB 3U0TA 1I7ZB 3C08L 4UTBL 4H26B 3K4ZA 3TO2A 4KPHH 1E4WH 4UILL 5GSRA 5LGJA 2ZSVA 1U3ZA 5SX5K 1DANU 3RWCA 5JORA 2AJXH 1NUDA 1R3JB 2FCBA 1QSFE 1X5AA 4LCCB 4U1SB 3RX8A 1NANI 3DX9A 4UOJA 3CK0H 4KK6D 4PJ8D 1CVRA 4PJAE 5IMMB 3O3DB 1T5WA 3PWNB 2RFXA 1FHGA 1KEMH 4V2BA 1DBBH 4ODBD 3U48A 2XFXB 2CJUH 4FQQB 2BJMH 5IB4A 3CDGB 4X99B 1OTTC 3EKCA 1KN2L 1T1XB 2IQ9L 1W0YT 3KLAB 4KK8D 4CKVX 5IB5A 3HRPA 5F88A 2ADIB 4Y5XA 1B0GA 4M03A 1ORQB 1J11A 2YXMA 5JHDE 1BBDL 3LV3A 3BKJL 4BSJA 4XAWH 2XN9D 5JW4M 4P2RA 5IOPA 2DQDH 2LE9A 3OHXB 2GIYA 4XI5C 1MSPA 3LDBB 4BK4A 1J18A 1Q94A 3P2TA 5EZIH 1NBZA 1TFHA 2ZWLT 4KU1A 5BS0D 4X7SH 1S7WA 4DTGL 4H88L 3QIBC 3L95B 4JEGB 4NWTL 4ORGB 5MEOA 1MFCL 3QHZL 3VXMA 3PABA 5B38A 2APWA 4RFOL 1QBAA 1UXWB 3ES6B 2A6IB 5IGXL 1DQJA 2JB5H 4Z7UE 5DLML 4AH2A 5I30L 4IRJA 4ONFH 4LLYA 1IAII 3PQYD 1OSPH 4AEEA 43C9B 2IADA 1B2WL 1DBAH 1NBYB 2NY5L 4U2YA 3DHJA 1T83A 1EAPA 5TE7H 5FCUH 3VMOA 1X5ZA 5GGQH 5J1AA 3TT3H 1M6OB 1E6JH 1KFAL 4QRUA 3T0EC 4LOUC 3OJDA 2FX9L 1T2JA 2BDNL 5GS2D 1UM4H 4OCWL 1S8DA 1CFSA 2P5EB 3D5OF 3ECBA 4JO1L 1F11A 5FO7A 4E5XB 3QQ4B 4LMQE 5DS8A 2HLAB 1FGNH 3CFEB 3NA4A 4N8VB 4MCZA 5I71C 2YSSB 1N5YL 1YPZA 4OLYH 1H8NA 5D1QC 3UJTH 3FN9A 1TQBC 1UWXH 5BRZB 4PJIB 4PJEB 1A3QA 1T3FA 2BOCB 3TH4T 3VFMB 4E9LA 3O4LA 4UDTA 5C08D 3CCHB 3MLZH 1PD6A 3DSFL 2ESVD 1CK0L 4ZPTA 4I4WA 4C56D 4PJFA 1ZLVK 3ARZA 2V17L 5EPMB 5GGUB 4DGIL 5ALBH 2VLJE 4POYA 1KCRL 3OL2A 2VSDA 4U1JA 2E27L 4CVXA 5D2NA 4D0BB 3FQUB 1G6VK 4Z7WB 3MLRL 1L9NA 4PBVC 3FQWA 2HN7B 4OGAD 3QRFM 2MCPH 1CIUA 4FN0A 1OTTD 4FQ1H 3SCMA 1SMAA 1WCBA 1ZVSB 4GG6B 1A0QH 4YHNA 4G7VH 3MA9H 2CLZB 2OI9C 2HVKA 4QRRE 3G5VB 5SWSE 4Y89A 5IBTL 5D7IE 4OB5H 1SMOA 5C8JB 4N1HB 5B8CC 3L5IA 4O2FB 2XZCL 1X3DA 1RUMH 4XPBL 5ESQB 4L29A 4XPGL 1EFXB 4OAWB 1MJJA 4XI5D 1ZGLA 5DD3L 3T8XB 4ZS6D 3G04B 5KVGH 3P9LA 2WUCH 4NN7B 5JPMA 5ALCH 5EBMA 5D6CA 4DN3L 3AVEA 4Y4KC 1MIEL 4HXAH 2E7BA 3QIBD 1JHLH 2Y5EA 4PRID 1DVFA 4EVNB 3D87B 2R0ZH 1YEGL 1PEWA 3D0LA 5IMOA 2X4NB 2EKJA 2I27N 4ODTH 5D71L 4I0PC 5SWZA 1F13A 1AC6A 4OLXL 1U91B 4L8BB 3JWOL 1D9KA 5C0CD 1C16B 1QEWA 4I3SL 2CDGB 5EUOB 3BPOB 3L3GA 4RMSA 3I02B 1Z5LA 2BNRE 5D1ZA 3G6AA 3RY6C 1ZS8B 1ZWIA 2J88L 3GFUA 1CD1A 5MENE 4LF3B 12E8H 3R8BB 3PGCB 3ULUH 1AGCB 2A9MH 3TPUA 1JWMB 5E99L 4HFUH 5JPNB 4C4KT 1M71B 2PW1A 5HGGS 4J3UA 4L4TB 4LOUD 4LLQA 4ODVH 5C0AB 3RVUD 2H2SD 1CFTA 3L3HB 3P4OA 3FN3A 1YC7A 4LLMB 5E0QA 1ZA3B 3DV4B 4UOW0 3X3FH 2Q7YB 3KPOA 4ONGL 3Q0HA 3ZE2E 3HMWL 2WWMC 2NY4B 2PW2A 2R8SH 2IFFL 3B6SA 4M6MH 3VG0H 1F4YH 4DK3A 4PIRF 3C5JA 3CSBA 1IAIH 1ZANH 3QA3A 1G0XA 3WDHA 4D0DB 3RGVD 2H32H 2OL3B 4Y5VA 4CVZB 1BVKB 1P4IH 4ODUB 3L5WA 3QEQB 4D3CL 5MERB 4GW1B 4MNGA 2OR9L 5KS9B 3HZVA 4IHOB 4PJ5E 5CILL 5HGBA 3BRGC 3B3IB 5F1IB 3G5YB 1OAXL 4JHWH 3MLWH 3PWUB 2X9XA 1ADQL 3S88L 1ONQA 3SKJL 1JI1A 2O5YH 5HHOD 1RMFH 3DO3A 4XVJL 3LEXB 2R23B 3DVGB 1V7NH 3VH8A 3FJTA 1CD0A 3IF1A 2VLME 3MRCB 5JA8B 2OK0L 1UWEH 1U8LA 3PNWB 2A0LD 3UZEA 4NJAL 3CFDA 3NIDF 5KSAD 3FHAA 1EUUA 5DFWH 3GI9H 5CBAB 1EZVX 3PGFL 1F3DH 2VNCA 3VWJB 4PJ8A 3BEWB 1JRHI 3O9WC 2H32A 4O58H 3DRQA 3FFCD 5LJYH 3V4PH 2ZOKA 5B21A 4YHPB 4Y4KD 3MGTA 1YC8A 4BUHA 1P6AB 3LPFA 4HBCH 1WBYA 1AI1L 1N0XL 1AD9A 2WIIA 4JHAH 4KGLA 4LCYB 5EBWA 1LEKA 3CMGA 3BO8B 3QUMB 2DBJA 1ZTXL 2XYCA 5HY9A 1SBSH 2FJHB 4YAQB 2BSTA 5DJXB 1P4BH 3EJYD 3MCLL 3UTSB 2XN9A 3UJIH 2AEPH 3DRTB 3FB5B 4O02H 3BQUB 3WSQH 3FFDB 4F37K 3BZ4A 1VKXB 2FZ3B 1KJ3H 2X42A 1YMMD 3FQTB 4G6FB 1B90A 3S96A 3NVQA 5E5MA 5L6YH 5T3ZL 2R2EA 1AD0B 5BS0A 4HJJH 3HE7B 3CU7A 3SE9H 2ZPKH 2G75B 3DTXA 3NFPA 3Q5OA 1KPRA 3P9MA 4Y2DB 4M7LT 4FXGA 3TBSA 3MTRA 1W72L 5CHNA 3GK8H 1AXTL 3GMPA 2WWMD 3PQYA 1FO0A 5KSUA 4HUWB 5CZVL 4ZPVB 4GKOA 1U8PA 5LGHH 1KSRA 1KENH 2Q7NA 2HKHH 5E5UB 3J8F7 2NY7L 4JB9H 2EEDA 4Z0BL 3V4VL 2VXUH 4R26H 5CZKA 3IJSB 4WU5B 1UQSB 3BPLB 1RJZA 4M93C 5K59F 1DUZB 2Y36H 4RAUA 3FOLA 3TIEB 5IEKB 2FDBP 1BGXH 3IFLH 1P69B 2CRZA 5I1AB 1OARH 1KPUB 1ETZA 3A6BH 5TDOB 1BF2A 3HUJA 3MJ9L 4M6AA 4L9LB 5BMFH 3O6FC 4DQOH 4CMHC 1XMWA 2VITA 2PF6A 3U2SA 4XB7A 1G7QA 1IQDA 2EDBA 3C6LC 2Y5TB 2W0FB 4OLVH 1NCUA 1DQQB 1T7XA 3D39D 5DQ9B 3HZMB 3QQNA 3BIBX 4M1GL 4C56A 5GGSY 5L7XL 1A22B 5F96L 1U8OA 4CJ1A 5DJYB 2OZ4A 3VFGL 4JM2B 5FF6B 3RWJA 4ZQKA 3WUWG 3EW3B 3UYOD 4MD5A 5D70L 4L3ED 2RCSH 3O9WD 5E8EB 4IEFB 5SX5H 4WTWA 1KCUH 1NCDL 2MMXA 4WEUD 2AGJH 4LHJB 4ODXA 1GGYA 3X13A 4IMKC 2IAMC 2R69H 1ACYL 3WJLC 1HHKB 1NAMB 4WHTA 4I2XB 1VACA 2NTFA 3BAEH 4OCXL 1F4WL 4MJID 3KPLA 3V5KB 2VRAA 2ATKA 1XH3A 4KFZC 2C3VB 3EYFB 4PRBB 4KXZI 3DGGA 3UAJC 5CMAA 3OR6B 5FO9B 5GZOD 5CJXA 4JG0L 4PV8A 2FO1A 2QKIA 4J2XA 4HQQH 2VLRD 3EOAB 1E4XL 3OXRA 5DQJA 1GIGL 5HGHB 1VB9A 4PJGF 3U9PH 3WCYA 3DUSA 3O11A 2HLFD 4NQVA 3CLFH 3QUKB 1QFUH 2APBA 1FPTH 5TQ0L 1JRHH 2HFEA 3ZKNC 5CKAA 5F8RC 4QEGA 3TN0B 4ZO9A 1OGAB 2AVGA 4DUWA 1XGUB 3CVHL 1JK8B 2QEJA 3AS1A 5C0CA 3G6DH 5C0IB 4WTXA 3MZTA 5EO0A 1LO2H 4X4MA 1F2QA 2OYPA 1JV5B 5EOQH 1MLCB 4F7CA 1JTOA 2AJYH 4NQED 1SVCP 4FQ2L 4XPHL 3QXUA 3QAZB 2XZAH 3QFJD 3PWJA 2Y25A 2GKIA 1FNLA