2OX5A

The soxyz complex of paracoccus pantotrophus
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
108
structure length
108
Chain Sequence
ADDAKPRVKVPSSAKAGETVTVKALISHKMESGQRKDADGKLIPRSIINRFTCELNGVNVVDVAIDPAVSTNPYFEFDAKVDAAGEFKFTWYDDDGSVYEDVKPIAVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords SoxZ protein
publication title The SoxYZ Complex Carries Sulfur Cycle Intermediates on a Peptide Swinging Arm.
pubmed doi rcsb
source organism Paracoccus denitrificans
total genus 19
structure length 108
sequence length 108
chains with identical sequence C, E, Z
ec nomenclature
pdb deposition date 2007-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08770 SoxZ Sulphur oxidation protein SoxZ
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ox5A00
5C0DA 1QFPA 4DW2H 5F1SA 1S9YA 1PKOA 1U36A 4KK9D 4Z0XA 4JFHD 1NGYB 3H9HA 1DBJL 3CFKA 2DQTL 3LZFL 3L1OH 1Q72L 3RPKA 1CLZL 3WKML 5HXMA 1JF1B 1CYGA 3PHOB 4Y5XC 4PJ9B 4JPKL 3C60C 5F9AC 4HWZA 2P8PA 3OGOE 4R26L 4JPVH 2DLGA 4UDUA 2QV2A 2OYPA 3MNWB 3BH9A 4HUNB 5JR1H 5TPWH 1ETZA 3MRNB 1Y6MR 1M71B 3SDYH 4BH7A 2IANA 1AGFA 1BZQK 4CVWA 3NFNA 3I02A 5GRVK 1ONQB 3GSRA 3QI9B 4KJPD 1A1NB 2B39A 3MLYL 4JLRA 5CMAB 1FNEB 4MCZA 4KI5D 5DHVB 3W0WA 3ZDYF 5F6IB 1JF5A 4IEFB 4E0RB 4H20H 4TVPE 3BKYL 4N8VG 1OAXL 5D70L 5HHMB 1ACYL 2DLFL 1KJMB 1NUFA 4NDMA 43C9A 2H26A 4KQ3H 5CINH 3FRPG 3H0TA 1XAUA 1AKJB 3RZWA 5CP7B 3UJJH 1LO4L 5EZOL 3S36L 2SEBA 2VL5A 4GMTL 4LHQB 4X4YA 1NMCC 4HIIA 1AD9A 4NBXB 4XPTL 3WS3A 1T22A 5FGBA 1RY7B 4PS4H 5CIPA 5I30H 1V7NL 1CD1A 3BXNB 2Z93A 3ZKNC 4L8BA 5KS9E 1FVDA 3DJ9A 3FMGH 1J1PH 3TPUA 1W0WB 1FCGA 2AJVH 5EUOE 3MRKA 2H2SC 3CSYB 4M62H 4UIMB 4XI5D 5C09E 5E4EB 2X9WA 2F54D 4MX7B 5C0AE 3BP4B 4JPWL 5GGRY 3EYOB 1QPPA 3UTQA 3T4AB 3RVUC 4R0LA 2ZSWA 35C8H 3O6LL 3U4EA 1HKLL 4XNXL 1KV3A 5I1EL 1W8OA 5KS9F 1ZVHA 1J8KA 1JPST 3RJQB 1O7VA 2RGSA 2A2QT 4HXAL 5DQ9A 3S4SA 4OSUL 5LGKA 4NQVB 3DI2B 5J06A 2CR3A 1OD9A 1LO3H 5JUEL 3GI9H 3C09C 5AEAA 2JB6A 1ZT1A 4IOFD 4QHKJ 4JDZA 3O4LE 4PJ7A 1EO8H 1IGCL 2YA0A 2E7BA 3WNPA 3NACH 3BPCA 1U8PB 1JMZA 1T20A 4I18B 2GUOB 1UADC 3TPKA 3B9VA 3H9SE 3RNKB 2BRRH 2HYMA 2Y5TB 2VR5A 5HDLA 5IB2B 5C0BE 3O3EB 5SWSE 1GGTA 2AK4A 4BK4A 4DJMA 5KVMC 1U58A 3NCJH 4YQXH 2YD6A 4W68A 1S9WB 3Q5TA 3EDJA 5DDHB 4NKOA 3PWJA 4FMFA 3BGFC 2XPGA 1OCWL 2VC2L 3BDYL 3GM0A 3GMLA 3WFZA 3D39B 3HZKA 4YDIL 1YDPB 4RBPH 4ODWB 2F53D 2GTZA 2ZPKL 3GBMH 1D5MB 3KPSA 3IDGB 4HFUH 2EXWD 4DCQA 4NRZB 4JZJA 2X5PA 1LQSR 4PJEA 2JKXA 4QY8A 3PV7A 2PO6A 5IWLC 1C1EH 1G7PA 4NJ9H 1G7IA 5DVNA 3MLWH 5F9OL 1IGYB 5D7JC 1WWCA 4ZFOA 4ZUUA 2VZSA 5IT2L 1EHNA 3WE6B 5F3BB 3OR7A 5ACMA 5T33L 3SDXB 4H26B 5LVEA 3SJVB 4HLZH 4BZYA 2AJ3A 1G1CA 2G5BA 3VXNB 4C56E 2LVCA 4TPRH 2OSLA 4ISVB 5E1HB 3BE1L 1RK0A 3MRJA 1DBJH 3LZFH 2DQTH 3WKMH 1Q72H 1CLZH 1EBAA 5J6GB 1FSKB 2CLZB 2MSPA 2O5ZH 4HGMA 3WYRA 3WBDA 3RFZC 2WBKA 4CNIA 1HH6B 4RQQB 3NGBB 1J0ZA 3EZ8A 5INDA 4JPKH 1CIDA 4R26H 5IW6A 1U8OA 1JGEB 1MLBB 3QDGE 3PUCA 1MRCH 1UFUA 1WTGT 5CJXA 3EJZD 4Y4KB 5B38B 3QIWB 4ZPVA 4P5MA 3VRJA 4PJHA 3SDDC 3ZKSD 3R0MA 4LDEB 4QHUA 4CBPA 1U8NA 2EICA 5D2LE 4Z95L 3MLYH 5EU3B 2VSCA 4KRLB 4XAWL 3MJ9L 4MNQB 1U8MB 5D7IB 3PV6A 3BKYH 2E7HA 5D70H 3F58L 1ACYH 2DLFH 3SDCC 5IG7A 1K8IA 4WFFE 2PYFA 5CLTA 4NN5C 1NDMB 3BWUC 4L3EB 2V2TA 2VTFA 3UDWA 4Y7MA 1U8JA 4DTGL 5CEXB 1LO4H 2CDEA 5EU4A 5EZOH 3S36H 4GMTH 4XPTH 1E6OL 4NZRL 1DR9A 4JZNB 1AGBB 1V7NH 1N3NA 2PCPB 3FB6A 5C9KA 3BHBB 3TVMB 4FQXA 1DQDL 5I8OL 2D7PA 1KLFA 1MFDL 2RR3A 4GG6F 3G6JB 5J3HD 1I1RA 1ZHNA 5FOJA 1A9EB 1R3HB 4Z7WE 3W9DA 4JPWH 3MV8D 5B3NA 5JOFB 5IV2A 5EBMA 4Y8AA 4WFEE 4GG8B 5GGTL 4FA8A 1A6TA 1R5WB 1L6XA 3MNZB 3DBXA 1Z9SA 3VGGA 1RZGA 3ULVD 3O6LH 3QG6B 5AYUL 1UYWL 1HKLH 4XNXH 1OQXA 5I1EH 1DQQA 2QKIB 4OF3A 3OKDB 1TJHL 3IS0X 1BVLA 4HKJA 3P11L 4HXAH 3BPNB 1V3JA 3TJHC 4YJZL 4OSUH 4PJXF 3QO0B 4Z7WF 5JUEH 3C5ZD 3DVIA 3FZUD 1XH3B 4QTIH 4X0KB 1LEKA 1QLFA 3V5DA 1HINL 1IGCH 2O5YL 1Y0LA 1G0DA 4CVZB 3KPQB 5IMKB 4GW5A 3VH8B 1SJHA 3PHQA 4P46B 3P2TA 4QRQB 2H3NB 4QRPB 3PWNA 3DVNA 2HTLD 4JZJC 5B4MC 1B6DA 3FO0L 2H6PB 2R2HA 1EMTL 1TZIB 3NTCL 5DK2B 3UPCA 5TE4L 1HDMB 1I1FA 5GGQL 1N8ZB 4D3CL 5E8NB 1A1OA 1QLEL 3GKZA 3FFCB 4UT7L 4X6EA 4QHMB 1FQ9C 3R06B 5F89B 1OCWH 2VC2H 3C5SA 3BDYH 1LNUB 4BQ8A 3KJ4C 5ECJE 5IESL 2NY6D 2X70A 5KVDL 4YDIH 2Z35B 4YDLC 1CLCA 2ZPKH 4PD4K 1D5ZB 3IVKB 3T0XA 5BVJA 1S8DB 1C8PA 2YBRA 3Q6FB 2EEDA 4QOKE 3WIIL 1RZFL 5GPRA 1P7QB 2YN3A 3OQ3B 1BOGA 1EEZB 3ARTA 5F9OH 3VE0B 2Z31B 1WC7A 1IEAB 2GYSA 3WO4C 3EOAA 3MREB 4G9FB 2AAVA 1FZMA 5IT2H 4MXVF 3EO9L 5HDOA 2HT2C 3QA3B 5H8DA 3U4AA 5T33H 1YPZE 4XMLL 3DX8B 5ICYA 3UYRL 2EEBA 1H3XA 1AI1L 4NWUL 1GAFL 3MLTA 3BE1H 3AS2A 3LKOA 3MRFA 3NPZB 1D9KD 4P5KB 1HI6B 2VQTA 4BKLB 2V2XA 4H1LH 1KEGL 3GMOB 4Z7UA 2UVFA 2DTML 3AU1B 4G42B 2ESVB 3IDMB 4PRDA 1CLYL 1P4LB 3VD7A 5AD0B 3DO7B 4HIJA 3GJFB 2H2PC 2X44D 2EYRB 3UDWC 4HIHB 3F5WA 1WBXB 1U0QA 5A2KH 1TENA 3SBWA 3UPRB 3TIDB 4OD2A 3RIAF 3FT2A 4Z95H 5BO1L 3QPXL 5C92A 4XAWH 3MJ9H 2Y25A 4XCFL 1OQOA 1JL8A 3A6OA 3B5HA 3L95A 4HZLB 2X4QB 3F58H 4NHUB 1O7SA 3W5MA 3VXSD 5DHVH 5HI5D 4DK3A 1KPUA 5I1JL 3QISA 1WFOA 5I9QC 4DTGH 3NFPB 1RZKL 1NBVL 4U1HA 5DWUL 1KJ2B 5DA4A 1E6OH 3K7UA 4NZRH 3U9UA 1UZ8B 3O81A 2MTPA 5JIIA 4G80B 1I8LA 3SN6N 5I8OH 3G08B 3RWCA 1MFDH 5TDNA 5C8JA 5DSCB 4ODSL 5KN5B 4KUCD 3VXTA 4RX4D 4CVUA 1U2HA 2JJSC 3JV4A 4JAMA 1BLNA 4CDGC 1Q9KA 3BPOB 5GGTH 4AQOA 1MLCA 1WBYB 3MLXL 3BDXA 4XCYA 5AYUH 1UYWH 1FFNB 1TJHH 5KS9B 5HJ3A 2JELL 3P11H 1DQJA 3ZDXF 4NKMB 5EUOB 4JZOA 3WFDL 2YPVL 1Q38A 5C09B 2F54A 1MUJB 5INCA 1F4WL 3VFNA 2XACC 4D9LH 1HINH 4LCYA 1Q9LB 2O5YH 1HEZA 1S5HA 1U8QA 3G6AA 3LRSB 4WCYL 3KLHC 5DURD 4ZUSB 1XF5B 1HHKA 1AGDB 2W91A 4LGRB 3FO0H 3EDKA 4JB9L 4FRWA 2OM5A 3S5LA 4I4WB 3RVTD 2FYYA 1EMTH 2AXFB 3NTCH 1I4FB 4NUJA 4K07A 1WIPA 5TE4H 5GGQH 4P4RA 4NZUL 2VXSL 3O4LB 4P4KD 4D3CH 1WAAA 2EIDA 4BK5A 1ZHBB 1QLEH 4UT7H 1BEYL 1XGTB 4FQJL 3QXWA 1S7WB 1RHFA 5IESH 1T0NA 3H9SB 4N0FB 1NCNA 5TDPB 3LN5A 1EJOL 3GSUA 4Y2DB 5I73B 1TCMA 3HPLA 3QQ9D 4JRYE 5C0BB 1RZJL 3QI9C 1LK2B 4QGTA 4HWBL 1GXEA 3QJFA 4R2GB 5IVXA 2Y4SA 3WIIH 1RZFH 4PJCE 3S3PA 3OXSB 4AM0B 5F6IC 1D5XB 3TP4A 3WHE1 7FABL 2W65B 3FQUA 3MXWL 3RY4A 5L8KB 1T04A 5HGHB 4IS6B 3EO9H 1M05B 3QUZD 4XMLH 2F53A 4PP2A 3P0VL 1RZ8A 3UYRH 3DSNA 3EJYD 2VLKB 2Z8VC 1AI1H 2N4IA 4NWUH 1GAFH 5JNYB 4PJCF 1MHPL 3QDME 5GS1C 4JANB 5E9DB 1PQZA 1KEGH 5HHVL 4LLWB 2EDYA 4AIZB 4HULB 5J8OA 2DTMH 4PLJC 3S4SG 4X6CA 3IJHB 4RFEA 1CLYH 4HX1A 3ALXA 3DMMD 5E4EC 4DZBA 4QCIA 3KAAA 4BQ6A 2QSQA 4YR6A 5CJ8A 3TBSA 2VLLB 4K71C 3MJGX 2CJUL 5DEFA 4KV5E 3EGSA 3OJDA 5EUKB 3RL1A 5TQ2H 4PRNA 4A2LA 43CAB 3ZYIA 4P2CG 1KUMA 1QFOA 1QO3A 1U8KB 1X5JA 5D1QB 3FAXA 4G9DA 2QLVB 4KI5C 2MCPL 5BO1H 3QPXH 4M1CD 4OCMC 4WRLA 32C2A 1CL7I 4XCFH 3G5VB 5K9KA 2M2DA 3C5JB 4OFYD 4QWWC 5E94B 3QDGB 2PTTB 1CFQA 2F74B 2FCBA 3FFDA 1M7IA 3QT2A 4KV5F 4DK6A 1QSZA 5I1JH 1QLRB 4UT9L 4I18C 1YEHL 1Y6NR 1RZKH 2EH7L 4ODXA 4HS6B 5DWUH 3GJFK 5C0ND 1ND0B 2HJLB 5M94B 1KB5B 2E5EA 4PREA 2VWEC 1B0RA 5FM8A 5ESVB 5DD5L 5C2BL 4CVXB 4QHLB 4XCEB 1T1ZA 4GAYA 4ETQB 2GY5A 1MFBL 3UROR 4ZYKA 4ODSH 1P7KA 5CEYA 3MGOB 5JXEC 4WI4A 5EC1B 1BVKB 3CU1A 2CK2A 1CLOL 2NW2B 1KCSL 4TVPL 5B8CC 4UTAL 3D0LB 2X1WL 1NSNL 3BP6A 3MLXH 4R4BA 3R0NA 2BNRD 1L7IL 1BZ7B 3QNZB 2LVEA 4ZQKA 2MJWA 1CICB 2FL5B 3BO8A 2JELH 3E2HB 3V6ZB 4OGXL 5C0EB 3WFDH 2YPVH 4JM4L 2PTVA 1LO5A 4X8JA 4Z7WB 5T5NF 4LHJB 3S3SA 1F4WH 3MV8A 3QDJB 1R5VA 4HJ0D 3TBVB 4MD5A 5DA0B 4DVRL 4QHNA 2C7UA 4WCYH 1T1WB 2RIKA 2VLRD 1A6PA 5F1OB 1YJDL 3IXTA 5LWYL 1T4KA 1ITCA 1E4XL 4ESKA 1AIFA 1FSKC 4PR5B 4JB9H 4KWUA 5FUOL 5FXCH 4BQBA 5EZLB 3NGBC 5HI4C 3C5ZA 3CFDB 3DURA 1ZT7B 2H9GB 2P5EB 2VXSH 4NZUH 3VG0L 4LCCB 5JORA 3BQUD 4GKSA 5LCVL 4J12A 6CGTA 3ZHLA 3AAZB 3HZVA 5D96C 4KH2A 2CKNA 4IMLB 1NEZA 5FO7B 4UMGA 5AYQA 3KLSA 1EXUB 2YWYA 4ODTL 1EJOH 4Y4KC 1A4KB 4OJFL 3N0PB 1QR1A 1RZJH 1T1XA 4HWBH 1S7VA 4BELD 1G9EA 4BSVB 5MEPA 1P1ZB 3WIFB 7FABH 2AVGA 3ARFB 2R23B 3MXWH 3WIHA 4JFQB 5J6HA 4GKNB 1XGQB 3LV3B 1S9VB 3D85B 3N1PC 3IETA 2X1OA 3X3FL 4HH8A 4J8RA 4OCWL 2NY1B 2QADC 5ABDE 3P0VH 2Q86B 3V6OE 5FCSH 5IQ9A 3OAUL 2W07A 4NQDB 1HQ4B 1H8SA 4MCYA 4ZUWB 4QOKB 3QUYC 5C0CB 3TO4B 1MHPH 4Z7VE 4NPYA 4HK3N 4UNUA 3OKNB 3P4MB 3F62A 2NW3A 5HHVH 2DQJL 5DMKA 5C2UB 1BQHA 2JB5H 3IFOB 2V7HA 1QFWM 4WO4D 4LDLB 1N5YL 5HBBA 3LN4A 4NNPH 2PW2A 4JG0H 4YUEL 1YQ2A 5HGDA 4Z7VF 2CJUH 2ADGA 1RMFL 2VKXA 3CZFA 2LAAA 1R5IB 3B8YA 2FZ3B 1QQDB 1AJ7H 1D9KA 1U92B 2P8MB 4GRWE 3V4UL 3GJFH 3K2MC 1OB1A 3JUYA 5C9JA 1T0PB 2Q7YA 3BPNC 2BVQA 5I19L 2MCPH 3S34L 4LPUA 3KPNA 3IB4A 4WI2A 1QSFD 4MWFA 3QAZC 4PBVC 2ATKB 5KG9A 1E4WL 3T0DA 4N68A 4CN6A 3MUY1 2BZDA 3DRQA 3O6FB 4FABL 5DFTA 3ARBA 4UT9H 4GRWF 1YEHH 3QEGH 3ABZA 3STLA 2EH7H 4BSWB 3MRBB 2AV1B 1UQSA 4POZD 3VGHA 5FYLE 1KTLA 1FC2D 4JCLA 4TQEL 4UUJB 5BS0A 3HRZA 3MCG1 4WU7B 5DD5H 1JWUB 4NRXA 5C2BH 4EUPB 4TOYH 2BK8A 1MFBH 4LCUA 4WW2F 5AG8A 1YN6B 1KB5L 2GT9A 4ZXBB 1RZJC 1CLOH 1ED3A 4XBGB 1KCSH 4TVPH 4UTAH 4BFBD 4MXWL 5J1TC 5E6IC 3WN5A 1RJLB 4PTTB 1NSNH 4XGZB 3UO1L 12E8L 1L4IA 5FF6A 2YR3A 1L7IH 4PJFF 1AQDA 3O41B 2YD1A 4KKAD 3VD5A 3AXLA 1OTTD 1IGIL 4O9HL 4OGXH 1JIBA 2YK1H 4NN7B 1SYSA 3MRQA 1FZOB 4JM4H 5ID1A 4RX4A 3L6FB 1GOHA 2Q8AL 4MAYD 4NFDA 4MJ6B 3FOMA 4RRPG 3ZKXC 5I1CL 5E70A 1U41A 1ORQB 4DVRH 3K80A 4L3CA 4UIKL 4PJGE 4U1NB 1CDBA 2X89D 1PGRB 4X7TB 2MQ3A 4OCXL 1YJDH 3K1DA 4F7EA 5BXFA 2C3VA 5LWYH 2HTLC 1E4XH 1WWWX 4L8DB 4LVNB 1CDCA 5E5RB 4B50A 3S9DB 3L3GB 5FUOH 3KXFD 2ZUYA 2EE6A 3VG0H 4JG1L 5LCVH 3CH1B 5KSVB 4YE4L 4PJGF 2GJZB 3TYGL 3MRRB 4N90D 3OXRB 2EIZB 3QNYA 3SGDH 4ODTH 2MQ0A 4U1IA 3CSBA 3J8F7 4OJFH 2VLJE 2VISB 4JGJA 3S96A 1FZKB 3KYMA 4JM2D 1I8KB 2BVUA 5GGVY 3FO9A 1CDGA 2XV6B 2HG5B 5GISL 4JQVC 3QWRD 5F7HA 3UYPA 2EE2A 4P4KA 4LIQE 5F6HJ 4WUKL 2D7NA 4DUXA 2WWMC 4EN3D 3VWJB 2VAAA 5L8LB 3FN0L 3R8BB 2XIDA 3X3FH 3UX9B 5HHNB 4HUVA 3PF2A 4XWOD 5EOCL 4OCWH 5HY9B 1F6LL 4LKXB 2A0LC 3BZDA 4JRYB 1FNAA 1MRDL 1GZQA 3GMPA 3OAUH 4G6AC 4KXZI 1S78D 1SHMA 4JRXE 4PJCB 4XVJL 4JKLA 3ALPA 5BZDA 4PYGA 3B2UC 4ZFFA 3GK8L 4K9EC 1NUDA 3IFLH 1N6UA 2FJHB 1ZT4A 2DQJH 4DN4L 1A7PL 1DVFC 2R29L 3STZA 1WQVT 8CGTA 1LEIB 4P3DA 4KK6C 5CGTA 4ORGB 2PXYD 1T6WA 3P0YL 3I85A 5JW4M 2QEJA 3QUZA 1N5YH 4PRID 5TH2B 3MRIB 3T2NL 3BPOC 4YUEH 2IBZX 3ARBC 1RMFH 5IMLB 3QDMB 3SKOA 3V4UH 4CJ1A 3MV7E 2V6HA 3VXOA 2GSGB 3ROLA 5KSBF 1T21B 1BJMA 1A6AB 3DUHA 5HYJE 5JW4R 5I19H 1IEBA 1NJ9B 4GW4B 3T77A 3S34H 3X11A 4PJ8B 1CCZA 5EBWA 1FNHA 3DMMA 3BEWA 1S7SB 2E27L 1E4WH 4PJ9D 3GSNA 4GSDL 4JHZA 1KF9B 2FDBP 4FABH 1JNJA 4M9OA 1DP0A 1YY9C 3OG4B 4E42B 3IGAA 4Y16B 3IDXL 3VWKB 4L8CA 3J7HA 5DYOB 1EZVX 3ZT7A 4JFED 4TQEH 1CU4L 5MEOA 1P9MC 1RI8A 4DFIA 3ILPB 4HBCH 2CR6A 5JW5B 3PHSA 4EZMA 2CIKA 2OQJB 3C8KB 4N5EC 1KPVA 4OFYA 3RIAK 1KB5H 1KCUL 2OTWB 4F33A 4J7RA 3VD9A 1QP1A 2MMXA 4Z5RA 1H3UA 4WI7A 3H7BA 4MXWH 3D3VE 1HOCA 1CFTA 4Y2DC 4CGTA 3UO1H 4RMTA 4Z0BL 5BV7B 1AKJD 1EA9C 2DMCA 1I75A 5FHBL 4QXTA 1IGIH 4XH2B 4O9HH 1N0LA 3NH7L 1UM5L 2NYYC 3NCMA 4J4PD 4N9GB 3TCXA 3RX5A 3ROOB 4KMTL 1FL5B 5J9PA 2Q8AH 5GRWA 2B4CC 2GAZB 1X5YA 5I1CH 1AFVL 1W72L 3ZT6A 2GCYB 2OLDA 4UIKH 1VADA 1BFOB 3M45A 1T80A 2BNRA 3ZTNL 4DN3L 3H8NA 5BQ7A 1J7VR 4OCXH 4B7IA 1CGTA 3KVQA 4Y89A 1FPTL 5IROA 5L9DL 1JHKL 5F7WC 1UEMA 1EBPA 1PYWA 1G7HA 4JG1H 4I2XE 4YE4H 3E6FB 3VFRA 3BW9A 2ITCB 3TYGH 5JQ6L 1T66C 2R56L 4NO0B 1CG9B 4M7ZB 2NPLX 4O2FB 2VLRA 1UXSA 4JO1L 1N26A 1ROWA 3GSQB 2FGWL 2F19L 4OFPA 4NRYA 4XPAL 5GISH 3P77B 3QUXB 5IB5A 3ULSB 1BFTA 5E6ZA 1ZKAA 4X80L 4OGZA 2ICES 1JYVA 4WUKH 1TZGL 3MNVB 1Z9MA 4NO3B 3BQUA 4Q6IC 2Z0BA 3WLWD 2ITDA 3IFNL 3FB7B 3FN0H 3HHRB 4FTVD 5E0QA 5EOCH 3MRDB 3QP3A 1MRDH 3ES6B 2HN7A 1OY3B 3BKJH 1H5BA 5DRXA 4Q9QL 5L2JA 3FN9A 2EKSA 3QYCA 1JPGB 4XVJH 1ZLWK 4N1CA 2I07A 1FVCB 3GK8H 4ZOAA 5DJ0B 1U95A 4LVEA 3U4BL 3W81A 1I1YA 3NFSL 4DN4H 5CILL 1A7PH 3AFLA 5DMYA 2R29H 3GSWB 3U2SB 2DWDA 3CSGA 4WU5A 3DMMC 3P0YH 1NUNB 1FG9C 3DX7B 2ENYA 3FOLB 3T2NH 3KYAA 3QPQD 5CZKA 4Z7VB 3BWAA 3SJVD 5DLML 3MCKB 2DL9A 2I25N 4XPBL 1I7RB 2KUTA 4Q9BA 2ILLA 5M95B 3UTTD 4YHPB 3KYOA 2RHEA 5I15L 1YY8A 2E27H 3STBA 3H7LA 4WO4A 3C6LB 5HYSG 5SWQB 3FONB 3DIFB 4GSDH 5ESQB 1GGIL 1FDLL 4KKNA 4W70A 3MRGA 4PV9B 2DOCA 2EH8L 3O2DL 4GRWB 2CD0A 4PJBF 1NEZG 4P2QE 3RBSA 5IB4B 1UCTA 2NNAA 4JKPL 3VRIB 2CLRA 3IDXH 2IF7A 2VE6B 4IMKC 3T8XA 4PG2C 4JFYA 5D4QA 1AXIB 1DDHA 1CU4H 3QIWD 4LVHB 4PJIE 2A73B 3CVHB 1QSFA 3MO1A 4MB4A 3RTQB 4LCCC 3VGEA 4WW2B 3GSXB 5DI8A 1KCUH 4ZO9A 3L3DB 1X5XA 2EYSA 4H25B 3TIEB 4EUPH 3VFMA 3FT4A 2B0SL 1GIGL 5ANMA 1Z5LA 5A3IC 4Z0BH 3OGCB 5FHBH 5HGAB 1AC6A 4PJFB 1QSVA 3RPIA 1DEEB 1ZSDB 2EZ0C 2FEDD 4JY6A 8FABA 1KNOA 5E8OA 4LSQL 2DLHA 2PF6A 1UM5H 3NH7H 5M7QA 2BCKA 3N06B 1YNKL 1DFBL 4KMTH 3O8XC 4X6DA 4ZDHB 5HVHB 3ETBF 3BVNB 2CRIA 4GW1B 1DN2A 1AFVH 2UWEE 1J8HE 2R9HC 3UPAA 4ZUVA 3EO1A 2V7NA 2ZOKB 3P4OB 2ERJC 4DGVL 1SJEA 4E41A 5C07B 1K8DA 3ZTNH 4DN3H 1JHTB 5T3ZE 1SMAA 5CZXD 3WDIA 5ADPL 4D8PB 3NABL 4X7DC 1XF3A 1FPTH 1OPGL 1XGYL 3HCVA 2Y06L 5L9DH 5BJTA 1Z6JT 1MF2L 2F58L 4NN6B 3NZ8A 3T2QA 5B22A 4MAYA 2P24A 5C0JB 4JFFB 4ZOBA 4AH2A 3TBTA 5MEQB 2RBLA 4PJGB 4EVNB 5JQ6H 2A6JB 1KIPB 1DUZB 2R56H 1S7RB 1NFKA 2GFBB 1LEGA 2VSDA 2X89A 4BYHA 3QNXA 1CE1L 3MRLA 5H37G 2WIIB 4JO1H 4OFVA 3RY6C 5DEZA 5DQJB 2FGWH 3TZVD 4AEEA 2F19H 1JNHB 4XPAH 1ZLWH 4P46D 4MNGA 4LKCA 3KXFA 4QRPD 3O9WD 5MENE 5E00B 4PJ5E 1SBBA 4X80H 1TZGH 4LCWE 5E1AA 2H41A 3IFNH 4UT6L 2AXGA 4NQSB 4J3OC 3KNBB 3MRMB 3PDOB 3SKJL 2VLJB 4EQ3A 4RGMB 4OLUL 4DUVA 2HAZA 1ZVYA 4Q9QH 1KJVB 4JM2A 1CDIA 3QWRA 3OWEA 5GGSB 1N2RA 1WBZA 5IR1B 3HTLX 3GMRA 3U4BH 4GBXB 1R0AL 3NFSH 1CFNB 1R3KA 2ORBL 5CILH 3VGAB 4EN3A 3OB0K 4G8EB 1F45A 1CR9L 4M7JL 4D9QE 2CK0L 3DRTA 4QNPE 1UJ3B 2Z31D 3DGCR 2XA3A 5F1KC 4KTYA 3AC0A 3KPPB 3LS4L 1KEML 4UQ2B 3WFHA 3L9RB 1B9ZA 5K93A 2KQNA 4JRXB 4O02L 5BRZD 5TF0A 4V1DE 5F70A 5DLMH 3CMGA 3MLSL 1HQRA 4XAKE 1MHEB 2VXUL 4HAGA 4OCRH 3JSSA 2QQNL 4XPBH 4C83B 5KSBB 1YNTB 3QXUA 1UC6A 4YXLL 1OGAE 3L5HA 4QNPF 2PXYA 1U3ZA 2W60B 4RFOL 5I15H 1KB9K 2XOTA 2MFNA 4PRIA 1A6ZA 5F1NA 5FB8B 2ESVD 1FV1A 4Q7DA 1ZLVK 3VDBA 1GGIH 5IK3A 2DD8L 4TTDC 5I17A 3UJIL 2EH8H 5BZWB 1HILB 3O2DH 1IC5L 3SE4A 1MIML 2GJ6D 1VSCA 4JKPH 4H1LA 4POZC 3GKWL 5GGUB 4Z78A 5HYJB 1JWMB 1F6FB 4LEXL 4EJ1C 4DVBA 2AS5M 5DFVC 1FFPA 1NGYA 5MERB 1V3MA 4FG6C 1ZA3B 3RGVB 4W4OC 3E6HB 4PJ9A 2VDLL 1NCUA 3OKKB 1QFHA 4AIXA 5IVZB 3EYQD 2NY0C 1FO0B 1F5WA 3I3BA 3CVHL 3LSOA 3MNWA 2X4PA 2B0SH 4ZNCD 3S97C 2NLJA 4NCDA 1ZS8B 4RMRA 4L1DA 1SYVB 1PG7X 4O2CB 5D93B 1IAOB 1NANI 4Y4HB 4JFEA 2LE9A 5DTFB 2YEZB 3MJ9A 5BOPA 5CD5C 4YHYB 1N59B 3BKCL 1OTTC 3OJ2C 4MNHA 2DN7A 5FYLL 3FRUA 4LSQH 5E5MB 5IM7B 5DHVA 3QFDA 4DOHE 1KLUA 2R39A 1YNKH 1DFBH 4CRPA 4TVPD 3QUKA 4OB5H 5D72L 4JQIH 4XHJC 2IFGA 4L3AA 3JWOL 4DGVH 3BZEA 3U30C 1KIQA 1AKJA 1NAMB 1A3LL 3I6LD 1V3KA 2Y7QB 5ADPH 3NABH 4Z7OE 2R0KL 3SPVB 3ZTJH 2C1OB 1TQBB 1OPGH 3BZ4B 3LB6C 4J4PA 1XGYH 1YECH 2Y06H 2QHRL 3L7EA 5ACZB 3NIFF 1FLRL 2WANA 2ZSVB 3GEWB 1MF2H 1NL0L 2F58H 5F97E 4JKMA 5E8PA 1T3FB 5FECB 3DXAE 3DETC 4Z9KB 5GGTA 1S7UA 1W0WA 1RJCA 2FJGB 4BA8A 4RIRB 4UIMA 5C0AD 2X1QA 3ARRA 1DE4A 2X6MA 1XZ0A 1INQB 5EULV 1QEWB 2BVEA 3EYOA 1CVRA 1CE1H 4CMHB 4Z7OF 4OZGE 1Q0XL 1CD8A 3CD4A 1EAPB 4H88L 3S88L 3WUZA 4HHAB 2PKDA 4PD4J 1I9JL 3RBGA 4PJ8C 3TFKC 4I2XB 4L4VD 3OB0H 2MCG1 2EC9U 3AY4A 2IALA 1BX2B 1J88A 4GFTB 5GIRB 4UT6H 4IRJB 1OGTA 3KLAA 3LRHA 5IBTL 3SKJH 2B1HL 1I8IB 2DB8A 3JWDC 3VWKC 3Q0HA 3H9SD 3MV11 2XKUA 3VFOB 2C5DC 5HHOB 3QH3A 4I48A 3MCLL 2WINA 3EYUL 3NN8A 5SWSD 1R0AH 5IB2A 4R2GD 1TZHB 2ORBH 3MSPA 3N1FC 5K9OA 3VXUE 1MCJA 4NQCE 3CXDL 3SO3B 1CR9H 4FQIL 4M7JH 4FTVA 4LIQL 1FVEA 5DDHA 3FQRB 3LS4H 1CXLA 1KEMH 2EECA 5ICXA 5FDWB 1JHLL 1FFOA 1I1AC 1ZLVH 2APVA 1ZA6B 4HUKB 4O02H 1F11A 1A3RL 2I9LA 3I2CL 3RKPA 5BV7C 1YDPA 3KPOA 2HVKA 3NBNA 3MLSH 4IIQB 4RNRB 3EFFA 3IDGA 5FYKL 5T1LD 2DJ4A 3BIAX 2VXUH 4NRZA 4QKXB 5KAQF 2QQNH 3JTTB 1P6FA 4YXLH 4RAVB 2VDKL 4GLRH 4NO2A 5IW1B 1ZK9A 1QA9B 4RFOH 4RAUB 1ZHKA 5FUZL 1HIML 4OZ4A 2XKNA 2QBWA 4LHUB 1BIIB 4G8IA 4N9OB 2DD8H 4G3YL 5F3BA 1J86A 3SDXA 3UJIH 2LTQB 3SJVA 1IC5H 4C56D 4R96B 4UBDC 1MIMH 5FO9A 4PJBB 2AJSL 1IKFL 2A74A 4ODUA 4PP1D 3GKWH 4HUUB 1MI5B 3QWOA 4LEXH 2AABH 2XXCB 2JJTC 4GRWH 1GGCL 1WZMA 2IPUG 3UTTA 3MA7B 4LPTA 3Q3GB 5D1QD 1CGYA 5JMRA 1G6RB 1MJJB 2VDLH 4L8SA 5I2IB 1HH6A 2DM3A 2X2YA 5IFAH 5HYQA 3OKOA 2DYPB 5ISZB 5HD8C 1HH9A 3CVHH 1CFSB 2DQCL 3D2UB 1IZJA 1U8LB 3KG5A 3QDGD 4M7ZC 4WJ5A 1WCBA 1MLBA 4MDIA 2IADB 5E8EA 1FO0L 1XMWA 2BVPB 5B38A 3QIWA 1G7MB 4P23D 1WFNA 2W92A 3BKCH 2NTSP 2H1PL 5FYLH 1FP5A 5L8JB 3T3ME 4MJIB 2J7LA 3RI5K 1MCOL 2P49B 3JV6B 4M7LL 5D72H 3RNQB 1U8MA 5D7IA 4WFFD 3D48R 1YMMD 3GBLA 5C6PB 4S0TD 1Y18B 1CQKA 5HHXL 3JWOH 4U6YB 2N7BA 4PJAF 4OZIA 2QR0A 1A3LH 1HSAA 3TNNB 3F7VB 4HMEA 5C0FB 3OPZL 3T3MF 2RFXB 5CSZA 5H35B 2R0KH 5JPMA 1JNNL 1JV5A 3UP1A 3WHXA 4ZTOL 1CICD 2QHRH 3BHBA 1FLRH 1NL0H 3KPLB 5LXGL 4QYOB 1IQDB 1J8HB 2NY4D 3DPBA 3G6JA 4HLZG 1X4XA 1J10A 4J3TA 1WK0A 1KACB 3AY4C 5FA3A 5J89A 4EI6B 1UB5A 1R3HA 4WFED 5DK0B 2R2EA 3PNWB 3SGJA 4LPVA 1Q0XH 5GS0L 5EBLA 2OR7A 1GZPA 3JV0A 3P40A 3CC5A 4H88H 4YHMH 2FJFA 3S88H 2H8PB 5HI3C 3WFEL 4Q97A 4AJ0A 4HMDA 1I9JH 4KGLA 3NCCB 1IAKB 4GRMB 2C1PB 5CP3A 3SGKC 3SE9L 4YHNB 4APQB 3C6LC 2IQAA 3FCTA 5EU6E 5C3LD 1WWAX 2HVJA 2JCCF 4OF0A 5IBTH 3EYVA 1N5AA 2B1HH 5I8EA 1XGRA 4CVZA 2Q3ZA 2DM2A 4HGWB 3TZVA 2YD9A 3MUGB 1U3HC 4N0CD 2HFFB 2ICCA 2XA8L 3WLBA 3VH8A 1R24A 4P46A 4PJ5B 3U6RB 2H3NA 1BMGA 3O9WA 4QRPA 3MCLH 2P46B 2EDHA 3P4NA 1HHHB 2CDFA 5SX4I 1ZGLB 4LCWB 2DQFB 5I66A 3RTQC 3V6FB 2Z92B 4WW2C 4FQIH 4F58L 1YUHB 3M07A 4HDIA 4NYLB 4LIQH 5E8NA 3IFPA 2FBOJ 3ARFD 1S7XA 5DC9B 3VI4E 1D6EB 3FTGA 2QQQA 1JHLH 1AP2B 5DO2D 4HWBA 1LNUA 2YKLL 1A3RH 3I2CH 3V9FA 3FO2A 2DF3A 2ZUQB 1I85A 5ID0A 5F3HB 3U0PA 1X4YA 4QOKD 1S8DA 1WT5C 4GS7B 3JZ7A 2VDKH 4PRHE 2VYRE 3N9GL 4OZHA 3WD5L 4OI9A 1EEZA 2IMNA 4YBQD 5J0BA 3VI4F 3HG1E 2GIYA 2Z31A 1NKOA 3A6CL 5FUZH 1HIMH 4QXGH 5D6DA 1YYML 4V1DB 4XX1G 3QA3A 2G75A 5BRZA 4G3YH 5F1IA 3I3EA 4WTXA 2AJSH 1IKFH 4UOJA 4OT1L 1OGAB 3T04D 4XVUC 1E4XI 4J1UA 1H8OA 5ENWA 1GGCH 5EO0A 2PYEE 1BF8A 1NMAL 5CD3A 3PXJA 3GMOA 4P2OB 4OZFH 4NKDB 4PGEA 4CMMB 5IB1B 2ESVA 1O0VA 3ZSTA 5JW3L 1P4LA 3HR5A 4O2EA 4MVBC 4WW1B 1TTUA 3DO7A 2DQCH 3L3IA 4LPCA 3GB7B 2GJ6A 1OTSD 5B21A 3R8QA 1OT2A 4GAFB 3O6FD 4BH8A 3WJJA 3MV9E 3DTXA 1FO0H 4Q2ZB 3O0RL 3BGAA 3IDNA 2X41A 4RDQG 3MACL 2H1PH 5JOPD 2GHWB 3THML 1QOKA 1PBYA 1MCOH 1ZANL 2Q87A 4XWGL 4M7LH 1J0IA 3V7MA 4HZLA 1HSBA 4UZGA 1OP9A 4QF1B 4Q6YA 5EOTB 4ZXBD 4F7MB 5HHXH 5DJ2B 1NH6A 3MBEB 4WUUE 3H3PL 2W0FB 3HR6A 2YPKB 3OPZH 3QUML 3D6GA 1JNNH 4DOHB 4GBXC 2BSSA 5F7YC 2VDNL 3NCEB 4ZTOH 3VGAC 4G80A 4U1MB 3VFPA 5LXGH 3G08A 5C86A 4WI5A 1AR1D 1JVKA 1BQSA 1UJ3C 1YEGL 4TUOA 3HE6C 3VXQA 1NC4D 2ICWB 2K9UA 3O6ML 2YN5A 1MHHA 1FZJB 1NGWA 3CFEB 4KHTL 4S0SD 4MZ3A 4F9PC 2KH2B 5GS0H 1WBYA 1G9NL 3LKQB 3V79C 4UTBL 4MQ7A 3IKKA 4H1LG 3EW3B 3DROA 3WFEH 5T3ZL 3KHOA 2VXTL 4U1LB 2D0GA 3EO0B 3DXAB 2HLAB 1DQLL 5D1ZD 3QIUC 2R1YB 4NKMA 1IL1A 5EUOA 3SE9H 3LKNA 2R1WB 5C0AA 4XCNB 5EO9B 3B2VH 1MUJA 1VFAB 3EDFA 5J1AB 2ZNXA 1NGPL 3BUYB 1E27B 1PKQE 1P6AB 3EYFA 2A6IA 4O51B 3D25A 5C0GA 2XA8H 4ELKB 4M9PA 2ATPB 1JUFA 1K5NB 4X7CC 1KULA 2AK1L 3HLAB 1XIWB 2IAMB 4I4WA 4ZOCA 4L4VA 5C0IA 4F58H 1LP9A 5DHYA 1X5FA 2Q76B 4X5XA 3VWJD 1GPOL 1XGTA 4K7FA 1WF5A 1W0YT 2YKLH 2ENSA 4XP1L 4S1QL 3H9SA 1JRHL 5D93C 4L9LC 4K7PH 1U93B 3W39A 1A4JB 2BC4A 5SWSA 5IUSA 3VXUB 5TGBA 2X1XR 4NQCB 1XFPA 5L7XL 1S9XB 3OXSA 5FOBA 2FSEB 2DQDL 1NFDE 3N9GH 4AM0A 4RAHA 2ADJB 1BP3B 4U3XA 3WD5H 3HC3L 2IANE 1HZHL 2DTSA 4HJGB 4ONGH 1YYMH 2OXHA 5JHDB 1OTUC 1AR2A 1M05A 3QIBB 1YEKL 2AEQL 4GKZA 2FLRT 2FBJL 4HS3B 4XPGL 3W0WE 3S6CA 3V8CA 5T1LA 2APTA 4YFEA 1MCWW 1F4XL 4OT1H 2QQKL 2ZCKL 3GIZL 3KPMB 3RJDA 1TQBC 1MVUA 1NMAH 3AROA 2FX8L 1JZ6A 1IILE 4YGVA 1IAIM 3IXAB 1X6NA 3MMEB 3V5KB 4WI8A 4WTZA 3QEHB 3ZLQC 3OR6B 1F6AA 2VN7A 2YUVA 1ZMYA 3QXAA 1TNNA 3TH2T 5JIHA 3WV0A 4C56A 3ESVF 3PL6A 2VLLA 2ARWA 2NXZD 1F58L 3BIKB 4U3HA 4LCIL 3S98A 1MFNA 5EUKA 3O0RH 1MELA 1NBYB 2J88L 4I5BB 3EDDA 43CAA 4Y16D 4CADA 1NPUA 1U8KA 3MACH 1NFIB 5LAXA 3T1WA 4M6NL 3ORJA 1DQTA 5D1QA 1N4XH 4HPYL 2VXVL 2DM4A 5EU5A 1QRKA 3THMH 1TQCB 1JGVL 1ZANH 1RPQA 3H9ZA 1M6OB 3CLEL 4XWGH 1I9RL 3W11D 1TETL 3G5VA 4PY7A 1U8HA 3QZWB 1HYSC 3QDGA 2L0DA 4HC1L 4LSPL 2BOBA 2R2BB 2Z8SA 2ZKHL 5DD6B 5F9WB 2X05A 4PJAB 3O3BB 1BECA 3QO1A 3H3PH 1DLHB 4P23A 4PRBA 5F7DA 4ODHL 2WBJB 3CFJA 3ZE2E 5D2LA 2E7CA 3QUMH 1NCTA 5MI0B 4J2XA 1BM3L 3IJYA 2VDNH 3EFDL 4LPXA 1L0XA 3Q5OA 4CVXA 1PD6A 4CN4A 3OTTA 3ARGD 1YEGH 2CKBB 1YMMA 1EEQA 1AHWB 3K0WA 2UYLB 3O6MH 3VCLB 1NLBL 3EAKA 5MP6L 4CN1A 4GQPH 3FT3B 4ZS6D 3D0LA 5HPOA 4KHTH 3ZE2F 1X5AA 4R4NC 4IIQC 2B8OT 1G9NH 1XGPB 4UTBH 5I18L 4PJ7F 1P84K 4CJ0A 5T3ZH 2VXTH 1CICA 2ICEA 1JZ8A 1DQLH 4XZUA 5F96L 4FQ1L 3MXVH 1RURL 1D5BB 1RK1A 2DKMA 4OLWL 4GOSA 4HWUA 4EOWH 3FQTA 1JTOA 1NGPH 4EI5D 4PJEE 2LTQC 4RSVA 4M6ML 5CEZE 1DZBA 3GGWB 5K59F 1J12A 4LLUB 4NO0D 3QJHB 4YIQA 4N0UA 4H8WL 2B7DT 3D0VB 2QTEA 4NZDA 1T2XA 5B38G 5D9SB 4JFPB 5B39B 2AK1H 2ED7A 4PR5A 3HS0A 4H0HB 4PB9L 1ZVSA 4GKOA 5EU6B 4P2RB 3HUJE 3ULUF 2OR9L 3B8SA 1ZT7A 4PJEF 1RJZB 2BFVL 3KYNA 3B9KD 1GPOH 3RUGE 1KCKA 5DS8B 4X6BA 1TVHA 5DMGD 3WJLA 4XP1H 4NQEE 5EOCJ 5C70A 2XNAA 4S1QH 1JRHH 2OL3B 4IRZL 4MGXA 3MBXH 3V4PL 1K3IA 3G04A 1JWSB 4D0DA 4PGDB 4JY4A 2Z8RA 4EQ2A 1SY6A 4BSVA 5L7XH 2DQDH 3AREA 4LL9A 2EYTB 3GMMB 5E7FA 1E28B 1P1ZA 3V7AE 3HC3H 3ARFA 4G6FD 1HZHH 1WIOA 1DBBL 5K9QI 3LV3A 4LF3B 1S9VA 4QTHA 2BXZA 3ZT5A 4WEUD 4OFIA 1YEKH 2AEQH 2NY2D 1R3JA 3B6SB 2FBJH 3WFCL 3PL6C 4XPGH 4IRSC 2Q86A 2VABB 1V3LA 1CQYA 1F4XH 1PAMA 1BJ1H 2BSRA 2QQKH 2ZCKH 4QOKA 4ZUWA 3GIZH 4HCRL 3HE7D 1RQ5A 1W0VB 1B6UA 4IDLA 2FX8H 1BIHA 2IMMA 2F8XC 3M17A 2YD8A 3HMWL 4W6YB 3HI5H 1YPZA 4LLMB 3PWPE 3A6BL 3HKFA 2OTUB 2VIRA 4ENEC 1I7ZA 4TYUA 3GIVA 4WNQB 2KZ1B 3IKCB 4GAJL 1F58H 4AT6B 1CGVA 5CBEA 4WI6A 4LCIH 4GUPA 5MHSE 4UAOC 1CDUA 2FZ3A 4YAQB 2PYEB 3TV3L 1QQDA 2J88H 4HKZB 3VH8G 1Z3GL 2EDXA 4M6NH 4HPYH 3X17A 2VXVH 1OF2B 1F42A 4D9RE 3C2SA 2X10A 4APQC 1JGVH 4RMSA 3DYMA 5DRWB 2BY2A 3SCMB 3CLEH 4KJYA 1RJYA 4LOUD 1I9RH 3GUTB 1TETH 3V4VL 1QSEB 3S36X 3CPLB 4MJ2A 3HC0B 4U7SA 4UOW0 1BZ9B 3GMNA 4HC1H 4LSPH 3MV9B 1DUYB 4FNLL 1IE5A 3O6FA 2ZKHH 1V05A 3IU3A 3TA3B 5FYLD 4BSWA 1U3JA 4ODHH 2GK0B 3EOYG 1J1OL 2P5WE 1EO5A 2VJXA 2IPKB 3EFDH 1A7NL 1C16B 1ZE3C 1NMCB 3HN3A 2CDGA 2V5TA 2OBGA 1NCBL 4YXHL 2NY4C 4YHZH 1MAML 1WWBX 5LGHL 1F3JA 4P59L 4UDTB 3VI3E 4ZXBA 5I16A 3ARSA 5JIPA 3QEQE 1NLBH 2DQUL 5MP6H 4WUUB 3LQAL 4ZPTA 4LRNL 2J1KA 2ZUQC 4L4TE 4NZJA 1J5OL 3RZCD 2CKBL 4PTTA 3AS1A 3FRPA 4I3RL 1OD7A 3VXME 2XN9E 3BP5B 3PE9A 5I18H 2EXYD 3RWGB 1VERA 1ZXQA 1XF4B 5BOZG 4JFDD 3PWUA 2X4NB 1FYTB 1W72A 4X4XA 4ZFZB 5F96H 4FQ1H 2VDPL 4OQTA 1G7JB 2BOCB 1RURH 5FKAA 1NC4A 4MDJB 2C4FU 2E7MA 1XCQA 3OHXB 1JI1A 4OLWH 4R7DB 5F9JB 3LEXB 2M1KA 1ORQA 2ZCLL 4M6MH 4WDIA 1K9TA 2EO9A 4ZAKB 2A6DA 4I9WE 4PGZA 5D1XA 4YO0A 1QTYT 4NNXA 1IJ9A 4X7TA 2YS4A 4H8WH 3O3AB 5JA9A 5F88A 3CUPA 3HAEH 4L8DA 5D1ZA 2DQIL 4MJ4A 4OBRA 4P2OC 3QQ4B 4PB9H 3T4YB 3AREC 4ZNEE 2I60L 2OR9H 3GSOB 2WM0A 1LWRA 4NCC2 3F7RA 2BFVH 4M6OL 3FB5A 3ILQD 3O45B 4A6YB 3MRRA 1RZIB 3CVIL 3JVGC 4JN2B 3OZ9L 1QRNE 2DQGL 3QWQB 4MD0A 2EIZA 2DS4A 2VLJD 4IRZH 5DVLA 2GJJA 3DARA 5HHME 3BGFB 2FLBT 4LGPB 4XBPB 2VISA 1FZKA 1JTTA 1Q0YL 3PABB 2GKIA 2WUBH 1BVZA 2HKFL 1PSKL 1I3RB 5I8CB 1IAIL 4XNYL 5C0DB 3OKMA 4I13B 4TULL 3BN9C 1FHGA 1S9YB 4ZS7L 4YHLL 2X4OB 2HA1A 2VB5A 1SEBA 2BMKA 3VWJA 3H9HB 3CFKB 5IJVA 2YUWA 3ZHKA 2OTPA 3SKMB 1AC0A 3V0VA 4Z7UF 4Y88A 5HY9A 2YSSA 5FYKD 4ERSL 5D7JB 3WFCH 1SQ2N 3RDTD 2EE9A 3R4DA 5HDBE 4AZ8A 4HWZB 3BGMB 2P8PB 1FG2A 4PTUA 4UDUB 2OP4L 4OUUB 1J0KA 3BH9B 4PJCA 1NFDB 1F3DH 1EZVY 4LQ1A 4HCRH 1ETZB 4R3SA 4U6HA 4BH7B 2IANB 4FXKB 3P9MA 4KRNA 1AGFB 3NFNB 3I02B 4CUCA 1CK0L 2P4AB 2BJML 1LEIA 3EYSL 3ET9F 3GSRB 4KROD 2OR8A 1EFXD 3A6BH 4JLRB 3W0WB 4MCZB 4GAJH 4KI5E 4JEGB 2APBA 1TVDA 2VOTA 2OJEA 3OX8B 1FL3A 3TNMA 3TV3H 5IMLA 1MIEL 3MV7D 4NDMB 5CGMA 43C9B 4Z7QE 1Z3GH 2GSGA 5F7KC 3CSPA 4PRAA 3L3KA 4NFBA 4FHBD 2SEBB 1NJ9A 4GW4A 4X4YB 1AD9B 2APFA 1KGCD 1T22B 3V4VH 2WZPD 1S7SA 3RGVD 3BD5A 2Q3AA 2CH8A 5CIPB 4KI5F 1CD1B 4H8WC 2XKSA 1H3VA 2MNUA 2Z93B 4L8BB 5EU7C 4K8RC 4FNLH 1VDGA 1KPRA 5D6CA 3TPUB 4PJDE 1YN7A 3SDCB 3WS6A 4JJHA 3MRKB 4RFNB 5BMFL 1G9MH 4Y16A 3MGTA 4NN5B 1J1OH 1KLGB 3L5IA 1XIWC 1FBIL 2E8ZA 4Y4HD 3Q2CA 1A7NH 3UTQB 3FQNA 4XVTL 1WGOA 1G0XA 4FFWC 4R0LB 2ZSWB 3U4EB 1NCBH 3ZL4L 4YXHH 1FNGB 3V2AR 2NXYB 2D3VA 2ZG2A 1MAMH 3LQMA 2QHLA 3QG7L 3UTZB 4U6XB 5LGHH 4P59H 2OTWA 3H3KA 2DQUH 1MWAA 5DQ9B 3LQAH 3D3VD 4LRNH 1Q9OA 3FQWA 3S4SB 3WSQL 3ARDD 2CKBH 2OX5A 1FNSL 4I3RH 2JB6B 5D1XC 4U0RC 1WITA 4JDZB 5IHZA 4XB7A 4PJ7B 5DJDB 2HT4C 2XFXA 1I3GL 5D5MA 2OJZL 1B4RA 5D1ZC 3LOWA 1T20B 3ARGA 2VDPH 4Y5YC 4N9GA 4LNRB 4KJQD 5A1AA 5JDSB 3TLRA 2GAZA 2N1KA 4FZ8L 4WTZG 1CWVA 4FFVC 4ZFGL 5GS0D 2AK4B 2ZCLH 4Y1AE 2NR6C 5GSVA 5IVXE 1TCRA 4DKEL 1U58B 1WAAF 2GK2A 3PWJB 2XPGB 5TE6L 5I1AA 2DQIH 3HZKB 4XTRC 1A02N 2GTZB 4MA3A 3BYTA 2X4SA 3BRGC 2F53E 5I1LB 4JZJB 4PJEB 4QY8B 5IVXF 4DKAA 4M6OH 4EI5A 2A6KB 2PO6B 4Y4FD 2NY5C 4K23L 3G5XA 4IRJD 3CVIH 4NO0A 1G7IB 3OZ9H 1CG9A 2DQGH 4IOIA 4O2FA 2J4WL 3F6LA 4HG4K 5CGYC 4ZFOB 4ZUUB 3HI6L 2HLFD 3AM8A 3K46A 2Q7NA 4A6YL 4X6CE 1Q0YH 3KJ4B 4Q0XL 5CUSL 5A2JH 3SKNA 3NA4A 4I0PD 2HKFH 1PSKH 5T1KD 4YDLB 1IAIH 1TQCC 2G5BB 4XNYH 4TULH 2YPLD 4LVOC 1F4AA 4YHLH 4ZS7H 4NO3A 1RK0B 3B9KA 1G9MC 1K6QL 3MRJB 3RIFK 3BZFA 4PG9A 5F9WC 5K33A 4CNIB 4EIZC 4F80A 4ERSH 3ES6A 4X6CF 4KQ4L 2YA1A 3DNKA 2ZCHH 1IARB 2WBJC 1U8OB 2OP4H 1A1MA 4G6JH 5IFJA 1FVCA 4KK8D 5CJOL 1H9VA 1JPSL 1CK0H 2BJMH 3GSWA 3U2SA 2YA2A 1AHWC 3EYSH 1MJUL 4FXLA 1XR8A 4ELMA 3DX7A 4QHUB 4PBWD 1U8NB 3FOLA 3B9DA 3V6OA 1VKXA 2VITA 5TE7L 2NTFB 4Z7VA 3PV6B 2XZCL 1AD0B 2AXHA 3WS6C 3MCKA 1K8IB 1MIEH 1U42A 3HE7A 2V2TB 2NY3B 4U1KA 4U05A 3AS3A 4KHXL 4XNMA 2CDEB 5EU4B 3UAJC 1K2DA 4YHPA 5FFLA 4GMSL 1OW0C 5SWQA 1N3NB 3RWJA 2ARJB 3DIFA 4LSVL 4FQXB 5ESQA 5JMOC 2EEAA 2VLME 4P2QD 3D2UD 5IBLD 4AENB 5IB4A 2Q6WA 5BMFH 5KZCB 1ZHNB 4WHCA 4Y5VA 1WZLA 3FFCE 4P9HC 4X6FA 1QNZL 5I9QB 4YPJA 5IV2B 1FBIH 4EBQL 3MV8E 3VXRD 5FM5O 1A6TB 3OAYK 2CXGA 3DBXB 4XVTH 5DJCA 1RZGB 3ZL4H 2BRRL 2C3XA 3D18A 1DQQB 4XNZC 3QG7H 3P0GB 1QG3A 1BVLB 5AUMA 2VQ1B 2K3TA 5DUBA 2HMID 3I6KA 3WSQH 4ZS6C 4LGSB 2HRPL 1NC2B 4UU9A 2P5WB 4G7VL 4HT1L 4KKCC 1FNSH 4TTGA 2YRPA 3OGCA 1TTFA 1LEKB 2XQYK 4BUGA 1I7TB 1UWEL 3V5DB 4M1DL 1IM9D 1Y0LB 1I3GH 3FO1A 4MXQC 4OGAD 5CBAA 3ULVF 4F7PA 3S35L 1JK8A 3PHQB 4S1RL 3PWNB 3DVNB 4ZDHA 2R2HB 1T83C 3BVNA 1J8HD 4FZ8H 4L4TB 4EI5C 3LCYA 4ZFGH 4DQOL 3VXMB 1PG7W 3RZCA 4DKEH 2XN9B 1I1FB 2FR4A 1H3GA 1A1OB 4KVCL 1FAIL 1DBML 4X6EB 1D5IL 4JFDA 5C6TH 5TE6H 3C5SB 1I8MA 2E9WA 1CFBA 1FAKT 3D69A 3HPJA 5KVEL 4TPRL 1VEMA 3EIFA 1YC7A 1I7UA 3K8MA 3BJ91 5GRVL 5JHLL 3BISA 2WV3A 4BFIB 4I0CC 2O5ZL 5C0JA 2YBRB 1OM3L 3B9KC 4S10A 1FYHB 4LEOA 3KJ6L 1KT2B 2A6JA 4K23H 1KIPA 1DUZA 4QHKI 3ZDYE 1WLHA 5DVMA 4M61B 2GFBA 4X99A 5BCAA 2J4WH 3EOAB 2O61A 3U9PL 5CEZL 3HI6H 1FZMB 4LLAA 5DQJA 4A6YH 4Q0XH 5CUSH 1MRCL 1JNHA 3RRQA 5MEND 1GGBL 2MPAL 3KYKL 4ZFOL 3SCMC 3MLTB 3G5YA 4LCWD 4M5ZL 3KDMA 3LKOB 4EUPG 4WFHD 1K6QH 2HFGL 4UB0L 1T0MA 1J0HA 1BFSA 1QRNB 5EC2A 2V2XB 1G7LA 1NGZA 4TNVF 2WBWB 3PDOA 2VLJA 3TA3C 4KQ4H 4HW6A 4PRDB 5D2NC 2XWBA 3PWVA 2YMXL 4HIJB 4NO5A 5L0QB 1BD2D 1IT9L 3ECBB 3P73A 2AXJA 3F5WB 2VQUA 5CJOH 1KENL 4JHBA 1A0QL 1JPSH 2R69L 4D9QD 4G8EA 5K9QG 1MJUH 4Z76B 5GS1B 1MHCA 1A64A 1RD6A 4RMUA 5TF1L 5SWZE 5EIVA 2LAGB 5H2BB 3RDTA 1XCTA 5BS0E 4V1DD 1CXFA 5TE7H 1XF2A 3L95B 2XZCH 3S37H 1LVEA 4WWKD 4XAKD 2OMNA 1UJTA 1KPUB 4K71B 4LK4A 1OGAD 1YMHA 1Q94A 3QQ3A 1CTNA 2BXYA 1UENA 4KHXH 2FHCA 4QRUB 4JQXA 2J6EA 2QSCL 3OAYH 5FO8A 3NMEA 1ZWIA 2W60A 3UZQA 4GMSH 3U9UB 4OAWA 1EFXA 1M7XA 2J8UA 4LSVH 5EH1A 4KTEL 4ZAKC 1OSZA 3RAJL 4JVWA 1R3LA 4QTIL 1HILA 4XBEL 5TDNB 5C8JB 1T89C 3MV7A 4WFGE 3RVXC 5CIPH 3VXTB 5GGUA 3SGEI 4OZFA 4JAMB 1QNZH 1BLNB 2LFGA 4P3CL 2FHFA 4EBQH 2C3WA 1JPFB 1MLCB 4DZ8B 4XCYB 5GGRB 1KIRA 3RGVA 2Y23A 1MCPL 4KJWD 1WV7T 3UCRA 3OKKA 5HJ3B 1RFDL 5DJYB 4KUZL 4PJDB 4X5WA 1DQJB 1FFQA 4KMLB 1MCQA 2RAMA 4KK5C 2HRPH 2G5RA 4KUCF 1BBJA 2Q1EA 1P53A 1ZS8A 4G7VH 4HT1H 3MBED 2F54B 1OAQL 1SYVA 1WFUA 2FNBA 5IEKA 4KRPD 3VFNB 1HWHB 4JREC 1N6QL 5B8CB 2BHZA 1CN4A 2QQLL 3KR3L 4Y4HA 1UWEH 5DTFA 4M1DH 2YEZA 3RWFA 1HEZB 1S5HB 4KDTA 1U8QB 2I26N 1HE7A 4NT6A 3S35H 5I1HL 2DM7A 4P2YA 2VLKE 4S1RH 1HHKB 4MD4B 3RKDC 3D3VA 4XRCA 3S5LB 2FYYB 5E9DE 3ARDA 4NUJB 2W9EL 4DQOH 4G43A 2V5YA 4P4RB 5KSAD 3ISWA 3U7YL 5FKPB 4KVCH 1U91A 2D7QA 1FAIH 1H3WM 1DBMH 1Q1JL 2NCMA 1D5IH 4JGUA 4PRPD 3PIQB 5JZ7C 1T0NB 3CX5K 3ZKMC 1FJ1B 4NCC1 5KVEH 2EDEA 3ELAT 4LDOB 3TF7C 5CJQL 2ZSVA 3HPLB 3X14A 1P5VA 3DXAD 5JHLH 1T3FA 5FECA 1T2JA 1KTDA 3QJFB 1KXVC 3ILQC 4Y1AB 1OM3H 5IVXB 1QVOA 1KBGL 1QBBA 4HAFA 3KJ6H 5LQBL 1CT8B 1SM3L 2JJVA 3B3IB 1INQA 3FQUB 3I6GB 3LQZA 2W1NA 1G7QB 4KKLC 1EK3A 3QR2A 3U9PH 4U1SA 2HT3C 5CEZH 1OOAA 2I5YL 1WSST 1WZ1L 5D96B 3N1QC 5DRNA 3ZYJA 5KTEL 1T1YB 3W2DL 2F53B 1MVFA 4PP2B 3L7FA 5DVKA 1GGBH 1GC1C 2MPAH 3KYKH 4GT7A 5HHPB 2GI7A 1X5HA 5FGBC 2IAMD 1CXHA 4M5ZH 2ZOLA 2K7QA 5I6XB 2HFGH 4Y4FA 4UB0H 3K74B 1PQZB 4IRJA 4YDVA 4YXKL 1WCQA 4TNWF 4M7LT 3D9AL 4Y19E 1UGNA 4RFNC 4X6CB 4GG6E 3UBXI 4HX1B 2IH1A 5DZOA 4DZBB 3MRPB 4OKDA 4QCIB 2YMXH 1WJ3A 4YR6B 1IT9H 4I0PA 4MQXD 2QADB 5T1KA 3TBSB 1RIVL 5DEFB 4R0LC 2YPLA 3QUYB 4NUGL 1KENH 1BHGA 1KCRL 2HJKA 2NXYC 3EGSB 3L3OB 3NCYS 3RL1B 1A0QH 4P3WA 2FO4B 2R69H 4PRNB 3IRZA 4KROC 1LE9A 2A38A 3CH8A 3AGVA 4I8DA 4G9DB 3E3QC 1WTLA 5DFWH 5T5NG 5TF1H 1MREL 1SJXA 1TPXB 2ZUXA 3O4OB 4Y8DC 3MRCB 3DHMA 32C2B 5CJ5A 5K9KB 4WEMB 3MRHA 5JO5A 4PJXE 5IW3A 4OQ1A 3ZTJG 2CMRL 3FHAA 3HI1A 3QDJE 3FFDB 1M7IB 5BVPH 2A1WL 5SX5K 4RISL 4AEIH 3DX9B 4RAVA 5T1MA 4U1JA 5ITBL 2QSCH 2X4UB 4ODXB 4ORZC 2NMSA 5IJKA 2VO5A 5EO1B 4PREB 5I1DA 1B0RB 2CIIB 3RHWK 4KKBD 1AGCA 1ZOXA 3GDBA 4KTEH 3TH3T 1T1ZB 3RAJH 3QAZB 3BESR 4GAYB 3IS1X 2K7PA 4XBEH 4ZYKB 4R96A 2P5EE 3QEUA 5CEYB 4D9LL 4OCSL 2PR4L 5IVOA 4FQQA 5F8QC 4FZEL 4DGYL 1HNFA 1MNUL 4P3CH 4MJ5A 2H45A 4CDHA 5F7UA 3HFML 2MOVA 1RULL 3MA7A 3BRDA 4R4BB 3ULUC 1MCPH 4ZQKB 3VGBA 2PO6C 1RFDH 2Y72A 3BO8B 4U33A 4G7YL 4KUZH 2YRLA 4UV7L 4I0KA 4P2QA 1X9QA 4QRSA 3ARDC 3D2UA 3HNTL 1LO5B 4X8JB 1OAQH 2IADA 1MCKA 3MV8B 3DUUA 4OFKA 1N6QH 2QQLH 3KR3H 2BVPA 4PJIA 4MXVE 1G7MA 3VXRA 5E6IB 4MD5B 1U8IA 4QHNB 2C7UB 1A5FL 1LILA 4MSWA 1UH2A 5EPMA 5I1HH 4AEFA 4NQDE 4H5SA 4KJQC 3IXTB 5C0CE 2FGZA 2VLRE 1T4KB 5E24E 1C7SA 1C08A 1AIFB 3RNQA 3UBXA 4K3JL 5C08D 15C8L 4NHCL 2R0WL 2W9EH 4PPTA 1ZLSL 3TN0A 1VFBA 4U0QB 3QUMA 3C5ZB 3DURB 4MZ2A 3DV6A 3U7YH 5JORB 3ZKXB 4GKSB 1Q1JH 3HB3C 3TNNA 1IM9A 2RFXA 4W4NA 2P7TA 4F8TA 4NBZB 5H35A 1NEZB 4X83A 1P69B 5ICZA 5E99L 5CJXC 5CJQH 2G9HA 4PY8I 3HNSL 3KPLA 1QR1B 4QYOA 5EIIB 1T1XB 2UWEA 1J8HA 4G8GE 4WWID 4R4FL 1KBGH 4QT5B 3WNKA 5LQBH 4OIIH 5MEPB 4HUXB 1SM3H 3PGCA 2I9TB 4RRPA 4X9BA 2IH3A 3PNWA 3BIBX 5J6HB 4KAQL 2GW5A 4PLKD 2I5YH 1WZ1H 3IETB 4EXKA 2NY3C 5KTEH 1MSPA 1QKZL 4X7EC 3W2DH 2W0LA 5TQ2L 1D6VL 5IQ9B 4LLQA 4LLVA 4M5YL 4MCYB 1JYNA 2I27N 4YNYA 4YHNA 4NPYB 5KANG 1F3RB 5I1GL 5EU6D 4FQXC 4YXKH 2NW3B 5HSFA 3NIGE 5DMKB 3D9AH 3SDAD 1BQHB 1EHLL 4B5EA 1BBDL 2V7HB 4NM8L 4G6KH 3RVWD 3MC0A 4HWEL 3ARQA 2HFFA 1QBML 4S1SL 3LMJL 5MENA 2EDWA 2JIXB 4E5XA 2NZ9D 5FYJU 1RIVH 2ADGB 1HHHA 2FWOB 5SX5H 5I0DA 1ZGLA 4NUGH 4LCWA 3BSZL 5A40E 1KCRH 3V6FA 1RUKL 1D9KB 1EGJA 3NIGF 5FA4A 3MROA 2GSIA 5C9JB 4NYLA 1CXIA 3EOBA 5HVGB 1RU9L 1MREH 4C59B 1DVFB 4RGNC 4B7LA 1D6EA 1VENA 1OL0A 1VCAA 3ZDXE 3NCYP 4PGCA 4MWFB 3IYLW 5KG9B 5T3XE 2YWZA 3GBNL 1U9KA 2CMRH 3MFFA 4IM8A 3REVA 1BD2A 5F3HA 1YNLL 3F12A 4ZSOE 1BJ1J 1FORL 5DEGA 4HPOH 2A1WH 3MJ8A 3ARBB 4PRHD 4RISH 4NQUA 3STLB 5ITBH 4XC1H 4JFOA 3I3DA 3HG1D 4MB5A 1UQSB 4X9FA 5FYKU 5ANME 1KTLB 3EHBC 5SWZB 4PY8J 3DECA 4NJAH 5BS0B 1T5WA 3HRZB 2XTJC 4V1DA 3BOVA 4LCUB 5TFSL 4WWKA 5DJZA 1T5XB 2CRYA 2GT9B 4OCSH 2PR4H 3GSVA 3C60D 4NQXA 4FZEH 4OD3L 3TT1H 1MCHA 4DGYH 1OGAA 1ED3B 4X6DE 4UI2A 4YDJB 2V5SA 5FV2A 5E56A 1MNUH 3K8KA 3IF1A 2G2RB 3WN5B 3HFMH 1RULH 1RZ7L 1DJSA 4NKDA 4E41E 1AQDB 5IB1A 3QBTB 3AXLB 4G7YH 4M00A 4UV7H 2HMIC 3TYFB 4CW1B 5GZNC 4DAGL 1SYSB 3TN0C 3DGGA 3HNTH 4X6DF 4YFLI 4OCNC 3FOMB 1ES0A 4N8CH 4WHYG 3KWWA 5KBNC 2YUXA 2EDFA 4L3CB 4DEPB 1A5FH 1P84J 5BXFB 2C3VB 1IGML 4K3JH 15C8H 4NHCH 2R0WH 1ZLSH 3ZKND 4F7TA 5A43C 3KXFE 1QZ1A 3MBEA 5GXBB 4WUUD 3U7WL 5DC4B 1JZ5A 4N1EA 5L0QC 1IAMA 2H2SD 2FECL 2ICWJ 1A6WL 4X8XA 4OKVA 3W82A 5E99H 4KK9C 4U1IB 4XPHL 5DURB 4Z18A 4GRLD 3VJ6B 3SBWC 3HNSH 4DFHA 3RVUD 3S96B 3KYMB 3VMOA 4HMCA 2Y5EA 1K4CA 1CVSC 4R4FH 2ICWA 2X42A 3DYPA 5J12B 2JB5L 3VFUA 1KCVL 4P4KB 5KSAA 5I8KL 5HHQB 2VAAB 1CL7L 4KAQH 2FX9L 4NNPL 4PRPA 3K4DA 4JG0L 4AMKL 4OZFG 1QKZH 1GZQB 3EO0A 1D6VH 2E6JA 3CCHB 1AJ7L 3NOIA 3DXAA 3V0AC 2HLAA 4M5YH 4JM2F 3QHFL 2P45B 1B4JL 4KJPC 1J1XL 5I1GH 5BZDB 5JOEA 2DMBA 1I8LC 1VFAA 3SE3A 1IBGL 3B9EA 1ZT4B 1ZHLA 3ESUF 4OZGA 2WMPA 1EHLH 1J0YA 3HAEA 4Q6IB 2M8XA 4P3DB 1BBDH 2A77L 3VG9C 3CDGB 4NM8H 1E27A 3OKEA 3F7YA 1OSPL 3QUZB 4HWEH 4HV8B 4NNYA 1QBMH 2CPCA 4S1SH 3LMJH 3QEGL 4ZMAT 1XT5A 1EEYA 4I77L 3HLAA 1UXWB 3BSZH 2IAMA 3MYJB 1RUKH 4GXUM 5J4MA 3SKOB 5GHWL 1T7WA 4BZ2L 3VXOB 5FAAA 4R7NA 4XXCA 4Y19B 4TOYL 1RU9H 5HDQL 1IEBB 3WXVL 2Q76A 1KJ2L 4GG6B 3T77B 3X11B 4XI5C 5EBWB 5IMOA 3DMMB 3BEWB 3X12A 4K9EL 3GSNB 3GBNH 2AW2A 5D7JD 1U93A 4Q9RL 4TNVK 3SHSA 1YNLH 1FORH 1JNLL 5EN2A 1A4JA 1RUPL 4M02A 1S9XA 3IGAB 4P5TD 2R2CA 1TNMA 2FH6A 2YK1L 5MEOB 5IOPA 2DWEA 4JFEE 1NBQA 3GM8A 4PJXB 4HUWB 2BNUA 1KSRA 4YK4B 5EFIB 1J05A 3VA2C 4IOFC 2CIKB 5TFSH 4HS3A 4F33B 3F7QA 3T3PF 1KXQE 4OD3H 5J11C 4Z5RB 4Z7NF 2DBJA 3KPMA 1KN4L 5GRYA 1HOCB 1TVBA 3I84A 1CFTB 4KDWA 1RZ7H 2X7LA 3VA6A 2YHGA 1JYWA 2OMBA 1JGDB 5JDJA 3WCYA 4U1GB 4NC1C 4QXTB 3OR6A 4WTWA 3SDDD 5HYSA 2DICA 4DAGH 4W6XB 3BIKA 5J9PB 3RX8A 2VH5L 5D8JL 5GSRA 1FCCA 1KFAL 3SDCD 4B41A 5KSUB 1CD9B 4M3KB 2EXWC 4OTXL 2R15A 1Z0MA 4PV8A 2BNRB 1R3IL 3PQYD 5I6XC 4JDVA 4TRPL 3UTPE 1AO7D 4WHDA 1IGMH 1LO2L 2ZUVA 4LBEA 1N0XH 3QZWA 3NPSB 4LRIA 1DQML 5A2FA 2CRMA 1PZ5A 2BNQE 4MA7L 3TM6A 4F2MB 4Z6AT 3O8XB 1PYWB 5DD6A 4D2NA 1G7HB 3U7WH 5JXAL 4BUHA 1P4IL 1CZ8L 3OKLA 1WFTA 2XYCA 3BW9B 4ONHA 2EE3A 1DN0A 2NX5E 1A6WH 3WNNA 2ERJB 2UZYB 4S2SA 3B5TA 2VLRB 2B4CL 1UXSB 4XPHH 1A2YA 1KG0A 1TJIL 2E8YA 1NDGA 2K1MA 2WQ8A 4NRYB 3IFLL 2CKBA 5C08A 1E4JA 3DV4A 1TPXC 3O4OC 1KCVH 5I8KH 4AIOA 3FT3A 3RL2B 2ITDB 1CL7H 3O3DA 4GQ9L 2FX9H 4B53A 1XGPA 3NCFB 1NAKL 5A2IH 5H94A 4AMKH 2UV3A 4FTVE 1BF2A 3EJZC 4FXGA 3WXWL 1S7QA 2HN7B 3HMXL 1H5BB 5DRXB 1REIA 5L2JB 4JRWA 4G8GB 3QHFH 1B4JH 1DEDA 4H0GA 1J1XH 3BMWA 3VDCA 1J18A 2I07B 3RWIB 3JTSA 5B4MD 2PN5A 1P4BL 1I1YB 1IBGH 5CEZD 2JK5B 1KN2H 2DWDB 2A77H 3GGWA 2AEWA 2MWCA 4WU5B 4LLUA 3QJHA 1OSPH 4HKBA 1ZTXL 2X9YA 3VU2A 4YHIA 3D0VA 4TUJB 5ETUB 5ESAB 2XWJB 4I77H 3BWAB 4N5UA 1UVQA 4RCAA 2AKRA 2D31B 1MCFA 5EU6A 2PW1A 5GHWH 1C5DA 4BZ2H 5F6HI 4PJFE 4C55A 1RJZA 2ZUWA 1LD9A 4HBCL 5HDQH 3O2VL 3Q1SL 3WXVH 1LDPL 1EAJA 1KJ2H 3SDAA 1IMHC 3UBXG 4IBLT 2IWGA 4NQED 5J3HC 4Y2OA 3KYOB 3VXSA 1YY8B 3UTTE 4K9EH 1S3KL 5DF0A 2YRZA 4OFDA 3VGFA 4Q9RH 4TNWK 4L29B 3NIDE 2R1XA 1JNLH 3SQBA 3MRGB 1JWSA 3WNMA 1CFVL 2HT2D 3SDXF 3ULVC 1RUPH 1FIEA 4QRTA 4X9GA 5C07E 4NM4L 3T8XB 2XY2A 4JFYB 1CGXA 3T0ED 1DDHB 2LQRA 5BW7A 2AERT 4XP4L 4F7CB 1QSFB 2VERN 3MO1B 3C5ZC 3FZUC 4FQHA 3SKUD 2LU4A 3B6SA 3NIDF 4ZSOB 1FE8L 4JFFE 2EYSB 1CF8L 4X4MA 3WFBL 1IZKA 4PRHA 3VXPA 1KN4H 3VFMB 3FT4B 4X98A 2H2PD 1RUAL 3HG1A 5ANMB 1Z5LB 3RWDA 3U46B 2DIAA 4OZIE 3RPIB 2D4DA 3P9LA 5C0RL 5IQ7L 3MOBL 3PWPD 2WUCL 1KNOB 2WP3O 4LLMA 2YZ1A 4TSCL 4Y5XA 2BCKB 4WNQA 5DJXA 4LSSL 2NY0B 3C60A 4X6DB 5D7IF 4AT6A 2VH5H 5D7KE 5D8JH 5IIEB 2NY6C 4BZ1L 1KFAH 3CLFL 4YAQA 4RMWA 5DR5L 4HKZA 4FOMA 3EO1B 1KJ3L 1PVHA 3VRLE 2V7NB 4OTXH 5TQ0L 2FRGP 3DLQR 4OZIF 4E41B 4EEEA 1K8DB 5ITFA 1OF2A 2F5AL 1R3IH 4M8VA 4TRPH 4JJ5A 4POUB 4XXDA 1LO2H 1XF3B 3QCUL 2FIKB 3HC0A 1DQMH 3HCVB 1CE6A 5A16B 4MA7H 5BJTB 3PGDA 3NZ8B 1IM3A 3G6JF 4MAYB 2P24B 1C12A 5JXAH 4IHOB 3VRLF 3TBTB 1VA9A 1NC2D 1P4IH 1CZ8H 2P5WD 2P8LB 2KZWA 3WHE0 5ERWB 4Z77A 3BKJL 3U30B 1X7QA 4U4BA 2V2WA 1Q8MA 1M7DA 2B4CH 3MRLB 3MLRL 1D9KC 1TJIH 4HFWB 3F65A 4PB0L 4MNGB 4LKCB 3KXFB 2BX5A 4UNTA 3QEQD 5KSBE 3JV5A 3UYOD 4L4TD 1HCVA 4WUUA 2IG2H 5E1AB 4GQ9H 3QFJD 3VXMD 2XN9D 1HCFX 2AXGB 1NAKH 3BP5A 4U49A 3LD8C 4HG4J 1K3ZA 5FIEA 4M8QA 3WXWH 3DX6A 4GRLA 3LN9A 3U48A 3HMXH 1X3DA 2WQRA 2X4NA 4P57A 4JM2B 4ZFZA 4JFXA 3KLHD 5F7EL 2BOCA 3JXAA 1TDQA 1QYGL 3WO3B 1WBZB 1OT1A 3GMRB 1P4BH 1R3KB 4YZFF 3IAGC 3L5WA 3DRTB 4OZHE 5HI5C 3RVWC 1ZTXH 2APXA 4P48A 5EZJA 3WN5C 3LH2H 3O3AA 1IGTA 3WFHB 3C6SA 4RWHA 5BRZE 3QQ4A 1HQRB 4MQSB 2IJ0C 3RWEA 3QI9D 3O2VH 3Q1SH 1LDPH 1PKQA 4OZHF 4A6YA 4JPIA 1RZIA 2PXYB 1QRND 3EDEA 4JN2A 2R8SL 1S3KH 4PRIB 1A6ZB 5F1NB 5HHMD 3GMQA 4FS0A 3QXDA 1FV1B 1VEOA 3O11B 1I1AB 1VACA 4HH9B 5IK3B 3T2OA 1CFVH 4DEPC 3LIZL 1MRFL 1WICA 4FQLL 4H1LB 4Z78B 3AVEA 2GJ6E 4NM4H 2X4OA 3T1FA 4DVBB 3TBYA 1FFPB 5JLZA 4XP4H 3G5ZB 1XR9B 3BT2H 3RWHA 5IWLA 3SKMA 5D7JA 1HXYA 1FE8H 2Q8BL 4PLJD 1UM6L 1YEDA 3BGMA 5IKCB 1CF8H 3WFBH 3S7GA 3LSOB 4OUUA 3PJSB 5T3XL 2X4PB 1NFDA 3IJSA 4OI7A 2OI9B 1RUAH 2NLJB 5I74C 4P5TA 3MV01 2OS7A 4FXKA 4R90L 4JFEB 3RVTC 5C0RH 4M1GL 5J12C 3MOBH 5IQ7H 2WUCH 4MNHB 3OBAA 3FRUB 2EDQA 2VKWA 4P4KC 4CU7A 4TSCH 4RZCA 3QFDB 1KLUB 3T0VA 3T0BA 4LSSH 3PXHA 3QUKB 3HAEG 3M1BB 3OX8A 4BZ1H 4F3FB 5IB3A 3CLFH 4QWWD 3ARUA 3I75A 1B0WA 5DR5H 5L88L 1KJ3H 3B4NA 5TQ0H 3QQ9C 3BZEB 1KIQB 5IEHA 1WISA 5FGSA 2F5AH 4KXZH 1EHXA 1JTPA 3L3JB 3I6LE 4M7KL 3WEXA 3SDDA 3L5JA 5HHOE 3QCUH 1QFWL 2X4RA 3L7EB 1JBJA 1RSFA 5E8PB 3VFVA 1UB6B 1S7UB 5AG9A 3QUZC 3SDCA 2J2ZA 25C8L 3TBWB 5JXED 4EDXA 1DE4B 5FUCC 1XZ0B 3EJYC 4D0BA 1G1YA 2J8OA 1KLGA 2ZUTA 5KAQG 3D39D 1AXSA 4GRLC 3MLRH 3PQYA 4LLYA 1AO7A 2ZWLT 1FNGA 2P1YA 2BNQB 4PB0H 2UY7A 4Y0GA 1B0GA 3UTZA 4U6XA 2EDDA 1K4DA 2YC1A 5EUOF 5DVOA 4KFZC 1H0DA 4LARL 2NX5B 4BM7A 4L4VE 3SY0A 2IALB 4YDKL 1INDL 1NLDL 3EKCA 4K55A 1OGTB 3KLAB 1LP9E 3U83A 5DJDA 2DI8A 5GGVL 1KC5L 4LMQI 3VMPA 4OCRL 4RMQA 2ADIA 4PJBE 3WDHA 5F7EH 4URTB 4LNRA 1MI5E 3QH3B 1QYGH 4I48B 4M1CC 5JDSA 2WINB 3RVVD 3NN8B 1JI2A 1S7TA 1S9KC 1TXKA 1YC8A 4YK4C 4Y1AD 4HF5L 5K9OB 1F90L 3QULB 3MJ7B 4ZO6A 1UEYA 5HI4D 2DJUA 1LP9F 5DQDL 1P2CA 4FTVB 1FVEB 5ISZE 3D5OF 4R6UA 5ICXB 1BQUA 3R1GH 1FFOB 1F11B 2I9LB 4XP5L 3MOAL 1U3HB 5C0NC 3KPOB 3WL9A 2HVKB 4P49A 5SV3A 1GVIA 3EFFB 2HWZL 4Y4KD 1ORSA 5I1LA 1CGUA 2CLVA 2GITB 3V5HA 4U1GC 2XT1B 3AMKA 4K7PX 2JJUA 3JWDL 2IFFL 4NO2B 2A6KA 5TDOA 5LBSL 3QZWG 2B20A 2ZUUA 4MJIE 3NA9L 4MNQD 4NC0B 2R8SH 1ZHKB 1SVCP 4AQ1B 4LNVA 3SE8L 3E8UL 1HHGB 4OZ4B 2XKNB 1HYRC 4G8IB 4ZD3L 3MFGB 2YOCA 4L3ED 3IU4H 2Z91A 2CO7B 3LIZH 4D0CA 1MRFH 2VDQL 5FO9B 2QADD 3HUJA 3BPLB 2A74B 2JTDA 2AI0L 4FQLH 4ODUB 4P5TC 5D7LE 3QUYD 3QWOB 2VDML 3RUGA 3NPSC 5BV7L 5IROC 4NQEA 3TVMD 3UTTB 1B90A 4OB5L 4L8SB 3L3HA 3LKRA 4JQIL 4HJ0C 5HYQB 2Q8BH 2WWKT 1UM6H 1XF1A 3OKOB 1AGEB 1HH9B 4W81A 3U0TA 5T3XH 4WJ5B 4OIAA 2VDRL 1WCBB 1RIHL 4MDIB 2J12B 4LLDB 5I76A 2ID5A 3ZMRA 4GJTB 4R90H 5E8EB 5DRZA 3T0EA 1TLKA 1HHIB 2RCSL 1YECL 4M1GH 4KC3B 2QL1A 3RU8L 3BQUC 1EO7A 1BREA 2NTFA 4EXPX 4EDWL 1OAXH 1AD0A 2X4TA 5IBUB 4YC2C 4WV1A 3LKSA 1YMME 5L88H 3B9AA 4QXWA 1H5BC 1V7ML 4OZIB 5EIQA 2QR0B 4FMKA 5B39G 1HSAB 4HIEA 5D2LF 3PWPA 5CSZB 2UUDK 4M7KH 3VDAA 5JPMB 2HJFB 3LKPB 3VFSA 1BWMA 3BD4A 1JV5B 3WUWB 3MR9A 3WHXB 1QFWH 1KTRL 2ARJA 2VLMD 2AV7A 1IFHL 2ARJQ 3CFBA 4AENA 3CNKA 25C8H 5FA3B 3FFCD 2B5IB 1UB5B 3PP3K 4XMKL 2R2EB 5E6ID 5GRXG 1MH5B 5EBLB 3HZYA 1LE5B 1GZPB 1HXMA 3CC5B 3CX5J 2FJFB 3FKUS 5FV1L 2VR9A 1VGKA 4N0UE 1P7QD 2VQ1A 1NGXA 1ADQL 5J7CC 4JGMA 5FK9A 4LARH 4WO4C 3HE6B 3SO5A 1NC2A 2IQAB 2P5WA 4G9FD 3FCTB 1INDH 4YDKH 1PZUB 2RJMA 1NLDH 4WHTA 2JJSA 4G8FA 2HVJB 3LDBC 2CO6B 1I7TA 3EYVB 5GGVH 1N5AB 2CUIA 5I8EB 4V2CB 5IF0A 1KC5H 1XGRB 2GTWA 4WIQA 3TZVB 3DUSA 2LU7A 3WLBB 4NSKA 1R24B 1FL6A 5KOVC 5KOMC 3QEQA 3O9WB 3QRFM 4HK0B 1AXTL 3P4NB 2CDFB 4KU1A 4L4TA 3QIUB 3U82B 2BSED 4YPGA 5I66B 4HF5H 1F90H 3QFJA 3VXMA 2XN9A 1RUML 1ERNA 5DQDH 4HDIB 3IFPB 3TCLA 1JZ3A 1S7XB 2W9DL 1A9BA 2FEEL 3FTGB 1TJGL 4QXUL 3MUZ1 3FO2B 4XP5H 3MOAH 1J87A 3I9GL 5ID0B 2FO1A 2AABL 2WP3T 2HWZH 1C7TA 3U0PB 4X7FC 2ZNWA 4BFIA 3PG2A 1JF1A 2EKJA 3JWDH 3SEPA 2IFFH 3PHOA 2XQBL 3CDYA 4OZHB 5LBSH 1KT2A 2WK2A 5IFAL 3NA9H 4M61A 2WWMD 3SE8H 3E8UH 2V5RA 4ZD3H 1H8NA 3MRNA 5DHXB 1M71A 1YA5A 2G75B 4CU8A 5BRZB 5F1IB 2VDQH 4ZNEA 2A0LD 2JIXD 4L9LB 5F93C 2AI0H 4KKAC 4Q74A 4G6AD 1ONQA 3T0EC 3QI9A 4QEGA 2VDMH 3LPGA 4J1UB 3K8LA 4I3SL 5ENWB 1A1NA 3AB0B 1UH3A 1GHFL 1UCBL 5CMAA 1FNEA 5BV7H 3B2UD 5EO0B 5CD3B 1QRNA 3N1GC 1OP3K 4E0RA 4MAYC 3NIFE 3ZYZA 4QRRE 1DVFD 4PGEB 4LPWA 1KJMA 4KK6D 1YPZF 1TFHA 3HR5B 4O2EB 2OCFD 4WV1C 3L3IB 1W2KT 1FC1A 2VDRH 5CP7A 3ECBA 1RIHH 2GJ6B 1UKQA 4BH8B 3FB8B 3ARBD 3DTXB 1FIGL 4M48L 3IDNB 3OSKA 4L1HA 2RCSH 3V52L 4LASL 3BXNA 4Z76A 5GS1A 1HN1A 2UUDH 1Q9WB 5SWZD 3RU8H 4OUOA 5DJAB 5BS0D 5JOPE 5H2BA 5C09D 3CSYA 1IGJB 1TTGA 4MX7A 4EDWH 3BP4A 1HSBB 2AGJL 5JPNB 2N7AA 3PP3H 3T4AA 1JZ7A 1V7MH 5EU7E 4JM2C 4YHML 4QRUA 1UKTA 1YY9D 3QDAA 3V8OA 2GY7B 1A47A 2BSSB 2D9QB 4EN3C