2OX5A

The soxyz complex of paracoccus pantotrophus
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
108
structure length
108
Chain Sequence
ADDAKPRVKVPSSAKAGETVTVKALISHKMESGQRKDADGKLIPRSIINRFTCELNGVNVVDVAIDPAVSTNPYFEFDAKVDAAGEFKFTWYDDDGSVYEDVKPIAVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The SoxYZ Complex Carries Sulfur Cycle Intermediates on a Peptide Swinging Arm.
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Transport protein
molecule keywords SoxZ protein
total genus 19
structure length 108
sequence length 108
chains with identical sequence C, E, Z
ec nomenclature
pdb deposition date 2007-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08770 SoxZ Sulphur oxidation protein SoxZ
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ox5A00
3WDHA 3CC5A 5I1CH 1QACA 4NO0D 5B4MD 5GRUL 1S7SA 3KPTA 1QRND 5HJ3B 2WWMD 1A3RH 4ZFFB 5HVWA 1GXEA 5E7BA 1YNKH 5ACMA 3QB7C 4KROD 2B1AL 1AQKH 2A83A 3SPVB 5KN5A 4WENB 3RWJB 5K59F 4M61A 1RUQH 4LMQE 3F7QA 4X5WA 3VXSB 4NQDB 4YAQA 2HWZL 1RZIB 4RZCB 5ICXA 3VFMA 4OAWB 4J12A 1A6TA 5EZJA 1AC6A 3ULVF 3L3KA 3TBSB 1B4JL 2OTWA 3QUYD 3O45A 7FABL 1PLGL 2H45A 1UQSA 3RBGA 4X0KA 1C5BH 4PRHB 5E2UL 3DGGA 2NLJB 4ERSL 4OUUA 1D5XA 2IH1A 4Q9CA 5LGHH 1RZIA 2ZPKH 5J6GB 5C0CB 4TULL 4FQXC 4GMSL 5AAMA 3NPSB 4K8RD 4JFOB 3S3PA 4ZXBC 4LIQH 1ZVYA 5HD8D 5FKPB 4I13B 5D5MF 3QQ4A 1J05A 2WUBL 3EFDH 1V7ML 1QOKA 1EHLL 1G7QA 1U8KB 5D1QD 1WFOA 4P23D 3CH1A 5ICYB 2DMKA 2YPVH 2X09A 1A1NB 1J86A 3DRTB 4QOKB 4MJIB 4NKDB 3ABZA 2I9TA 4MCYA 2XKNB 4DZBB 4P4KC 1MHEB 3E6HB 3BP5A 3NIDE 1FFPA 1KCRL 3QUML 2C4FU 5B3JE 4JM2A 1DBBL 2IPTH 5DA0B 3EYOB 4M8VA 5E1AA 4ELMB 4MWFA 2VWEE 4U1GB 4PRIB 4IIQC 3SKNB 2I07A 3MACH 4PJ7F 1JNHB 5HGGS 4KJPC 5IG7B 3OGOE 1A2YB 3S96B 2IC2A 3MJ8A 3DARA 2CRMA 3S6CA 4JG0H 1V3JA 1WCBB 1KLGA 1CGWA 4POZD 3BPNB 2G5BA 5J6HA 2LAAA 3K2UL 1PKQB 4I48A 5BRZD 4TULH 4UBDD 2VXSL 1ADQH 1K6QH 2QQNH 4BFBD 3PL6C 1TJHL 3SOBH 1XGYL 3KPOB 2GJ6E 4PJXE 3VXTB 4HMDA 4JO1L 4DCQA 3VA6A 1JZ7A 1G7PB 1HXYB 4XP5L 1PZ5B 1F3DJ 3RWFA 3BPNC 2GK2A 2ZOKB 2VDML 4ZOBA 4XX1G 2Q7YB 4F37F 3TJHC 1BVKB 4M8QB 3ULVD 3EW3B 3FB7B 4F9LA 1CTNA 1AKJD 4O00A 2BY1A 1TNNA 4PRDA 3QSKB 4LCWD 5F8QC 3T0EB 1OGAB 2X89D 3BZEA 4OLWL 3VFOA 4KI5E 5JW5A 5D71H 3GNML 4NZTH 3DUHA 2FL5B 2P46B 3LQZB 1S9VA 1I9JL 3BQUD 1XMWA 2VNCA 3P4MB 5GPRA 1BLNB 3VGHA 2X4UA 1OTSD 1QSFA 4MAYA 4X8JA 4EN3C 4ENEC 4G6KH 4I1NB 2EIDA 1A3LH 1S7TA 4BFGA 4UOW0 4ZNCD 1AXTL 5DUPH 5D96C 3EDJA 3RWEA 3BX7C 4M7JL 1CVSC 3BP4B 2IMNA 5DRNB 4UZGA 4NBXB 3GB7A 4KKCC 1LO5A 2Y5TA 3PQYD 1FFQA 3FOLA 4IRSC 3O4LB 4J8RA 4DW2L 3LN9A 1T5XB 1X9QA 2JIXB 1C08B 1TDQA 1WWWX 1YEFL 4EOWL 2AXHA 2Q86B 3LN5B 4YHYC 1PX4A 1Z0MA 1ACZA 2W92A 1MFEL 1MFBL 5D2NA 1OAUH 2P43B 1T7ZA 4QRPB 1GZQB 3P0YH 3HCVA 4OFYD 4AEFA 3JWOL 1I7UA 3LEXA 5CEZE 5I1KH 4MD0A 4XCEB 1YMMB 3JXAA 1P6AB 5KANI 3V7AG 3BSZH 1WEJL 1TTFA 3O3DB 4PJHF 4N8VG 4GO6B 2P7TA 4RDQG 3ILQD 2AV7B 3LEYH 4YX2H 4ZO9A 1YEDB 2AXJA 3PDGA 1EFXA 4X80H 3VG9C 1QFWH 3D18A 1MJ8H 4JDVB 4PYGA 4TUKH 1ITCA 4CU7A 2FZ3B 2NW3A 3WLBA 4YBHA 5IW6B 1E4XH 1SMOA 1ZA6B 3K4ZA 5FGBA 3JV4B 2X70B 3MRGA 1WK0A 1RZGA 1S3KL 4GW5B 1I7ZB 5FYLE 3STLB 3X12B 3K74B 4JDTH 4M6NL 4AYFA 8CGTA 3G6DH 2G75B 2QV2A 1WJ3A 4HUWA 4AG4H 5IM7B 1V5JA 1AGEB 3THML 5HDOA 4LVNC 2X40A 3SY0A 3VH8A 4H5SA 4WEMB 5C09B 4DFIA 1KJ2L 1LEKB 4RFNB 4FQQA 3I3BA 1RJLA 4RAVA 2NY6B 4ZO8A 1JZ2A 3U2SA 3RVVC 3DVNB 2AQ2A 5BRZA 3AFLA 5IR1A 1YEHH 2B4CH 4Q58C 1ZLVK 1NLBH 1VFBB 4PUBL 2AK1L 4NO2A 3SDDD 5MI0C 4NCDA 1RURH 1HCFX 3HC0A 2XA8H 4G7YL 5I1JL 3EYVA 4JZJA 3NCCB 3NZ8A 3DI2B 3U36B 3Q5OA 3BP6B 4OLVL 1H5BB 1MCSA 3WNNA 1QFOA 3HR6A 4NHUA 4JQIL 3FQTB 5C9JA 3PP4L 2WUCL 3CDYA 2Y4SA 1V7NH 5MEPA 1I1YB 3GMMA 4BK4A 1KJ2A 2BY3A 1AQDA 4GUPA 4WRLA 2YSSA 1UACH 4C54A 4F9PC 5AZEL 3JTSB 1KGCE 2WSKA 4MD0B 1HN1A 1PG7L 3EO1A 2V2WA 4OGAD 4P2QD 5DA4A 2AJZB 1KCRH 2V5SA 5C0RL 1RVFH 3CXDL 4PJ8B 1HH9B 3R06A 4ACPA 3PXJA 3QNYB 4YJZL 3HR5B 4LIQL 3D9AL 4K9EL 3MLRH 1J11A 1CWVA 5D7KD 3VXMA 1ZHNA 2IFFH 5E8NB 4F7MA 2ICWJ 1ETZB 3FB8A 4A6YA 5BS0D 5EBWB 1J0HA 4IJ3B 1NAKH 4LGPB 5KTEL 4YNYA 2DQIH 5CGYC 4XP6L 2H1PH 4I3SL 5DK3A 1EMTH 4XPTL 5EIVA 1G6RH 2D9CA 4HD9A 1MY7A 4NQUA 1ZGLB 1K8IB 3HE7A 3KPPB 4NZUL 2APWA 4KMLB 4R3SB 1JZ5A 2IPTL 1NCBH 2DJ4A 3RWDB 4MQTB 1LMKA 2ESVB 4DN3H 4YFDB 3ULVL 3LQZA 4J3WA 4MAUH 4OZ4A 4TVSa 2DBLH 4X9FA 1RUKH 5JW5B 4I77L 1GHFH 1FFOA 2VKWA 4R4BA 3WN5A 1FG2A 4OQTA 4H25A 1AFVL 2D7PA 4WWKD 3T3PE 4HPOL 4KJWC 4NUJA 4ZS6C 4Z0BL 5IB5B 1YPZA 4PTUA 2BVOB 2HTLC 2YPLA 3VWJD 4Y4HD 2ENSA 2CIKA 32C2A 3QXVA 4LF3B 1RU9H 2RJMA 2R69L 1CTOA 5DJYB 2ZUXA 4OQ1A 5EOQH 1SYSB 3OBAA 5GGSA 4ODUA 3TV3H 1CYGA 2R0WH 5DSCB 1EEUA 1HDMA 1NFDE 2VIRA 4YHZH 3V5HA 3HI6L 4E41A 1DR9A 5IHUH 5JUEH 4ZSOB 1MJUL 3RGHA 1JJUA 1A3LL 3ARGA 1UXWB 5CCKH 3V0VA 2AK4A 4XZUB 2HJLA 5A2KH 3QIUA 3RDTC 2UV3A 1UM6H 3MZGB 4NQCA 1IAKB 3PHQA 4HSQA 5JO5B 1EO5A 4HKJB 2FLBT 2J6EH 2NY5C 2ZCKL 4PJAA 4XPBL 3C5JA 2NY4C 2HJKA 5EU6E 1PEWA 5D6DA 5AD0B 2EXYD 2HT3C 2FDBP 2UY7A 4U31A 5HYJD 3WSQL 3BN3B 1MH5B 2VL4A 1NBYA 1OCWH 4R8WL 1BZ9A 2LVCA 4NNXA 2GCYB 3SDYH 1FV1A 3MJ7B 3SDAB 4NP4H 3CGTA 4ODVH 1OSPH 4HXBH 5IFJA 4UT9H 5F1KC 3VCLB 2PETA 3FN3A 2GAZA 4ZPTB 3UZQA 2BHUA 4OFYA 2Y5TB 4LLWA 4RFOL 4NKIL 1OTTC 3GSVA 1T2QH 5TF1L 3HZYA 3RVUC 3MV9A 5DD0L 3WS6C 5T1LA 3OKOA 3EUUA 3WL9B 4ZTOH 4LEXL 3G5YA 5FO9B 1FSKB 5IB1B 3RFZC 1CDIA 4NKMA 4K7PY 1KCKA 1CQYA 2VABB 3Q5TA 3C9NB 4NQXB 2BC4A 1T21B 3M1BB 1KN2L 3MBXL 3UCRA 3EAKA 2B5IC 4FFWC 4PJGA 3O9WD 2XTJD 4Z7WA 4NT6B 4GRMB 5ITBL 4YC2C 1CICA 2GUOB 2RFXB 2F53E 3O6KL 5JHDA 3EYUL 3SE4C 2W60B 4Z95L 1IM9A 3IDIA 3VFVB 2VABA 4F8TA 3BWAB 3F12B 2AERT 2Y07H 2FEDC 1RK1B 4BH8B 1OSZB 4HXAL 1EHLH 4XPHL 4XXDB 5DT1L 1HQRA 4EZMA 1D5ZA 1DFBH 1HOCA 4ZFGH 2FNBA 3SJVD 1HXYA 4JKKA 4Y5XA 1MI5A 4AZ8A 1L7IH 2OP4H 4NNPL 5E2TH 4PGEB 4K94H 3DV4B 4ELKA 5DD3L 1P4IH 1RUAH 3O4OC 2HTKC 5DJCB 3L1OH 5SV4A 1TZGH 2ITDA 3PJSA 3SKOB 3KJ4B 1I1AB 1MLCA 4UB0H 3HE7C 5F3BA 1OHQA 3FTGB 3QEGL 3FT4B 2HJKB 4YHLL 4PJHB 4JQIH 4FFVC 4QGTA 4Y2DA 3INUL 5KVMC 1BJMA 5E8DL 5IEHA 3V4VH 4U6HB 2FH6A 3PWNB 4DKAA 1SJVA 1HYSC 4C56E 1X5FA 3PNWA 4LCWE 5L2KE 1ORSA 1GC1L 1A6ZA 3PP3K 5E24E 1WC7A 3BGFB 3BO8B 4XVJH 4D9QE 1U8JB 1X3DA 3QPXH 3HNVH 3RBSA 3ULVE 2D4DA 4MJ5A 2BSTA 5F7EH 5BZDA 1TZHB 3QCTL 2H26A 2Q3ZA 4OLVH 4UTBL 2UVEA 4AEIL 2W07A 4URTB 3NACL 3ZE0F 2KL6A 1WF5A 4TNVF 4OZHE 2AV1B 2R15A 2D9QB 1T6VN 4R7DB 5K9JH 2NY1C 2VDQH 1QO3A 1EV2E 4IIQA 2QSCL 1R5VA 3PWLA 3BMWA 3C6SB 3HPLB 5I76A 4DKDC 1DQLH 1EGJL 1WTGT 4HUXA 1NC2A 4KVNL 3FFCA 3O2DA 5GISH 1K4DB 3VFGH 5L8JB 3DTXA 1HHHA 3ARSA 1CLYL 3OAZK 1A4JB 4X6BA 3VGFA 1Q9KA 3T0EE 1IKFH 4X9IA 3SGDI 2OJEA 2BVYA 3MREA 1NC4A 1R0AH 4I77H 3ARGD 5IW6A 5DRZB 2DBLL 2KQMA 4YHZL 2RHEA 4F3FA 2LV4A 4J3UA 2X1QA 3QHTC 3LD8C 3V52L 4X9HA 5IFAL 2APBA 2JJSA 4WTZG 4WWKB 4RRPA 4TUJB 4YFEA 3EO0A 1PBYA 4D3CH 5BS0E 4N0YH 4HUUB 1FV1B 1CFQB 4NZUH 4LDEB 2HVKB 1Y0LB 2H9GA 3ZKXB 5EA0H 5FYJD 4HJJL 1L0QA 3ROOA 1NCDH 3MCKA 1DBKL 1KSRA 4NO5A 4PJEE 4YDIL 5BZDB 1BD2B 2D2OA 3ARQA 1Y18A 5ADOL 4L5FL 3MGTA 2EE2A 2FLRT 2VDNL 2OR7A 5TQ2L 2VLME 4LBEA 4DGVL 3WEXA 1D6EA 2OI9C 1SQ2N 3MJ8B 2Z8SA 5IEHB 3MOQA 4ZG1A 1YJDH 1BBJB 3HZVA 1WWAX 1Q0YL 3GSXA 4NQSB 4U3XA 5D1XB 3VJ6B 2C3VA 2EECA 5FECA 5C09D 3KLAA 1E28A 4X98A 5I71B 1KNOB 1N5YL 2BSSB 3PV6A 5HSFA 5EH1A 5IBLC 3TF7C 1S7TB 4KHXH 2BRRH 1Q1JL 2JKXA 5TJWK 1ZT1B 2EH7L 5GRJL 2PF6A 4WW2C 3VD4A 4LPXA 1S9YA 3UTSE 1RHHA 3FOLB 4CKVX 2GJZB 5I75B 1U3YA 3IT8D 2ORBL 1D5ZB 3LKNA 4OM1H 1CE6B 3OHXA 3MV7E 4RWYH 4UV7L 2ADGB 2NPLX 4Y5YC 3ZT6A 5DD1L 1MCOH 3AAZA 4O4YH 4Y4FD 4YHML 2CKBA 4FTVE 3OX8A 1IRAY 5J7CC 3L3JB 3LSOA 3H0TA 3QISA 4W6XB 4X6DF 3S98A 5KS9A 3O6FA 3H3BC 5DRZA 1X5YA 2APTA 1U8IB 3CJJA 5IF0B 5CBEA 3GJFK 5D70H 2FGWH 5FYLD 5L8KB 1WTLA 2D31B 3RHWK 3OR7A 3UPRA 2DJSA 4F57L 5K9OB 3I3EA 2E7BA 1T0NB 3LSOB 3WUWA 5KG9A 2A6IB 3U7AA 3GMNA 4CVZB 1HINH 4C4KT 3QXTA 2XYCA 1KN4H 4MZ2A 4LEOA 5FK9B 1WITA 1Z3GH 4G80B 5DFWH 4P3WA 1B90A 3LKNB 1TMCB 43CAB 3MV8D 1CDGA 3IDUA 4LEXH 4ZXBD 3DX7A 3FB8B 4A6YB 3S36L 1OVZA 4C56B 3JSSA 4G5ZL 4Y4FB 3S96A 1LK2A 2DB8A 2P8LB 4X80L 3K80A 3TFKD 1W0YT 2E9JA 4ZQKB 5DC0A 3QIWB 5AAWA 1NMCB 1P2CB 1U8JA 4L3EE 5I73B 4AEHL 1K4CA 1WV7T 1Z9MA 4AEEA 1N5AB 4NKOB 4QTHA 2VLJE 3T0ED 2DJUA 1MWAB 1F97A 2J2ZA 5CWSB 1G0DA 3MLTA 3DRTA 4X6CE 1JE6A 3CZFB 2QTEA 4L4TA 3R8QA 4L4TD 1S5IL 1RUMH 3MLZH 2W59A 3VI3F 4DN4L 5GSRB 3MRCB 5EBMB 5EFIA 4BFIA 1J05B 1I8KB 1IC4H 3Q3GA 1HQ4B 4NHCH 1WIPA 1AXIB 4M1GH 1INDL 4BSVA 1VFBA 1A0QL 3AROA 5EB9A 4MA7L 3LS4H 4I0PB 3WJLA 4LPUA 3MUHL 4KK6D 1NCUA 1YN6B 4X5XB 5C0GA 4Y1AD 2RCSH 1RJLB 4NGHH 3QWRA 3DYMA 3KXFD 1OGAE 2E8YA 4D9QD 3J7HA 4YPGB 4YXHH 4HT1H 3N06B 5DJ8A 5KVFH 5C7XL 3TPKA 4KQ4H 4R2GC 1B4JH 3VXSA 1ZA3A 1QG3A 3AGVA 1AY1H 5EU3A 2ZJSH 3BKYH 5BO1L 4DTGH 1DQLL 2YA2A 3TESA 2IH3B 5H2BB 1G6RB 1I3GL 2O5YH 1A6AB 5CSGA 3TWCL 1Q9WB 1JZ8A 4BQ9A 1UQSB 3QO1A 4DGIH 1KXVC 3ZHKA 3DWTA 4GS7C 5MEQA 1DLFH 1MCJA 4GMTH 4WFFE 5I1HH 4FQ2H 1MCIA 1FFRA 3HS0B 4IEFB 5I1LA 1J0YA 4RGOL 4XMLL 3OAYH 1G6RL 3NCYS 4HAGA 3HI1A 4XCEA 4JKMA 4OLYH 3MJ6A 3LQAC 3QHFH 3QUZA 3MLUL 2DLEA 4GS7B 4QXUH 4S1DD 3QIWD 3IFLL 3DX9A 3MJ7A 3SDAA 4U1MB 2Z4QA 4UU9B 3C09B 4PY8J 5IG7A 2EKSA 4Z77B 1NCBL 3MRPA 1BX2A 3C60B 2JE8A 4K9EH 3T09A 1B0RB 2C3XA 4Z5RA 4JPKH 1BFTA 3I3DA 2ZSVB 1MAKA 5HHVL 5GZND 4NQSA 4ZSOE 4TNVK 3S34H 4M7ZC 5DQJB 3BP5B 4QF1B 5DD5L 1C8PA 3MRPB 3MR9B 1RZKC 4LBEB 5HHOA 5CEZD 1G9NH 3GSWB 4XZUA 2F19H 4M5ZL 4M5ZH 3TIDA 2Z93A 1IC7H 3UZEA 3GK8H 1G9NC 4PP2A 3ULUC 4G9FD 1Z2KA 3KWWB 4CU8A 1VACA 3BKCH 4S1SH 3IRPX 1TENA 4NDMA 3BH8B 3BGAA 2YKLL 4JM2F 1OSZA 3BT2L 1OAKL 4ZD3L 1JPFB 1E6JL 2AK4E 3CNKA 4HH8A 1P7KB 3T2OA 4DEPB 5E8EA 5I1IH 2UUDH 5F7MC 1DDHB 3DRQB 3L3GA 1MF2L 4N1EA 4KKLC 3QO1B 3MMEB 4OD2B 2YD5A 3CMOL 2FX8L 1OW0A 1H5BC 1G6RA 3RL1B 3AC0A 4YDJB 4RQQB 1G7PA 2V9QA 2HT4D 1AGEA 2UVFA 3GK8L 4HX1B 3VGAB 4U4BA 1LP9B 4NWUL 2GT9A 3SGJA 5C3LD 1C5CL 5JDJA 4HHAA 5CD3A 3STBA 3RZCA 4XXCC 4DJMA 1TNMA 4QRUA 3P4OA 1P84K 2VN4A 3S5LA 3D18B 3LEVH 4JHZA 5HD8C 3BH9A 1FBIL 2VLLA 3LN4B 4EDWH 3NMEA 5I9QB 1BAFL 5JHLH 4Q2ZB 5DJ2A 4UQ2A 3MLXH 5F7DA 4NQDE 1XF4B 1A5FH 4L4VD 3BH8A 4Y16C 2X4PB 4OFDA 1F3DH 3JZ7A 1I85A 2BSTB 1CFVL 3Q6FA 3EYSL 2HVJA 2J8UB 4AM0B 1DN2A 2CPCA 3SDCC 3IETB 4LRIC 3G5VB 4PD4K 1QRNB 2V2TA 1X5LA 3MLYL 3MXWL 4OF7A 5B3JF 5IEKB 3U9PH 1YZZA 2NCMA 1A14L 1N64H 3QYCA 4FQCH 4HK3N 1MWAA 3PHQB 5HPMA 2NY4B 3KYKL 4JFDE 4NN7C 5DYOA 1A3RL 5E9DB 2RAMA 3UTTD 2XWTB 4KY1H 1JTTA 1P2CA 3H9SD 5TDOB 4PR5A 4NWTH 2RCSL 4WW1A 4BH7A 1I3RB 3FN9A 1E4WL 2OQJA 3HAEB 3L3IA 5DEGB 4JFPB 1TVBA 2DQCL 1GPOL 2BJMH 1DSFL 3SCMB 3MFFA 1N7MH 1NCWH 1NCWL 4C55A 2X4UB 1OY3B 4C59B 5BJTA 4ZUUB 5C8JB 2BMKB 2CIKB 1SVCP 1V3LA 1M71A 1JGLH 1RV6X 2X4QA 5EU3B 1BQSA 1CLYH 3VFOB 5IW3A 4U2ZA 3KHQA 2ZCLL 3F7VB 5LVEA 1CDBA 4YXLH 1BGXL 3V6BR 3TBYA 2V7HB 5DDHB 1HSAA 2IAMC 4TOYH 3OB0H 4RA0C 1QQDB 3W9DB 4TVPL 4S10A 4X4MA 4Y5VA 4TNWF 2VXUL 1A14H 1NJ9B 3KNBB 4DUWA 4L29A 1L7IL 3I9GL 4M48H 1UA6L 1CK0H 1G7IB 2BX5A 4M9OA 4JFPA 2BFVL 4N8VA 4PV8A 3IFOB 4UTBH 2EYTB 1RIVL 2CRYA 1JMXA 3PXHA 4FNLL 5FOBA 1TJHH 2NW2B 4ZUTA 4JDVA 5E8OB 2YD2A 1ZT7B 4OCMC 4NQVA 4MD5A 5L9DL 4KQ3H 4L4VB 3RJDA 3VFNB 4LLAA 3MACL 1I1AD 2HKFH 1UH4A 2YUVA 3LH2L 1VPOL 4HLJA 2FJGA 1ZT1A 2DTML 1AHWC 4YDVA 4NKOA 5DXWA 1EGJH 1EFQA 1EAPB 2AJUL 3L9RA 3DSFL 4I4WB 4OZGE 4O58H 4UINH 4P4RA 1K6QL 1F3RB 4CNIB 1SJXA 2EO1A 1CE1L 3CZFA 4XHJC 2DKMA 3ULVH 3FJTA 4KJYA 5KSBE 1KJ2B 1X5JA 1H3GA 2P8LA 2ARJA 2NNAA 4S1SL 5HTSA 4OF3A 4AY0A 2EDRA 2A74B 1OAYH 3KPSB 4TSCL 3LQMA 3LH2H 4NC2B 5IFHH 1UENA 1R3LA 3O2WH 3HZKB 4E41B 1UCTA 4RX4A 1CF8L 5FM5M 3HC0B 4M7KL 1FNHA 2A77H 5HI4C 1YN7A 4PG9B 2ICWA 3R1GL 2O61B 1TCRB 3NA4A 1IGJB 3U7YL 1DVFA 1QSVA 2DLTA 3MLRL 3ZDXE 1Q1JH 1DUZA 1MI5E 3PWVA 1YJDC 5KOMC 1JWSB 3ZDZF 3M17B 1MCPH 3WNMA 1YUHA 3SDDB 4UUJA 3DVGB 5KOVC 5IVZA 2CLVB 4OTXL 4LLDA 4OM1L 3KGRA 5GQBA 1YEKL 4KDTA 4RFOH 1FFOB 2VZ1A 4U1KA 5ACLA 2QKIA 5SWSB 5EOCJ 5TE6H 3V8OA 5JZ7C 4HWEL 1CE6A 3FZUC 2XY1A 2X4SA 4HS6A 4NUGH 1T0MA 3ARZA 3FRPA 2XN9A 1XGUA 5T3ZE 1RU9L 1M7DB 2OTUB 3BKCL 3MA7B 4KMTL 4WWKC 3UTSA 3ZHLA 5FA3A 4FZ8H 1MCWM 3GBNL 4Z7OE 2AV7A 2CJUH 4QWWD 3OKKA 1I8KA 1U8OB 4LPVA 1VB9A 4OGYL 3AUVA 1YJDL 3QG6A 5TH2B 4M7LT 4LKXB 1JHKH 1RZFL 1TZHA 3DROB 3THMH 4HWNA 4MB4A 5F9WC 2K3TA 2X89A 1LE5B 1EEYB 1KJ2H 1CDHA 1HI6A 1P53A 3H9HA 2BSED 1MLBA 4G9DA 3WXVH 4Z76A 4IRJB 4MB5A 3A6CH 5EORH 1G7MA 3SKNA 4K3EH 1J9CT 1DEEA 1A9BA 5T1KA 4OZIF 3E6FB 1S9KC 2CJUL 2VDKL 4GUPB 4ODSH 5EZIH 4OI8A 3VI3E 2BNRB 4Z7UE 2IMMA 3BYTA 3VMNA 1FL6A 1U8MA 5F7EL 1N0XH 1VGEL 4PJBB 3QQ9C 5FA3B 1QSEA 3NCFB 4GQ9L 3DV4A 4ELKB 1QBBA 2XN9B 1IT9L 3AXLA 3QO0A 3DETC 1K9TA 5DUBA 4CU6A 2YPKA 2DKUA 3N85L 4M43H 4EOWH 5C0IA 4RMTA 4WDIB 2FJFB 4GAYA 5C0AD 4KAQH 4HBQA 4Y0GA 1HINL 4IDJL 5LCVL 3BAEL 1JI2A 1U36A 1QA9B 1FG9C 5K9QG 5J06A 4RAVB 3SQBA 5CP7A 1VESA 3CPLA 3MLSH 4UT6H 4G8EB 4IIQB 1ZHBB 3UTQA 3MREB 2CKBH 4CBPA 3GGWB 4JANB 1H3VA 3STZB 5I66A 3QEQD 2LTQC 4LLVA 5MEOB 1VEPA 2H1PL 1S5IH 3D0LA 4LKCA 5EBGA 3NTCL 1R5WA 5F93C 4HCRL 5E56A 1HZHH 2VLKB 2JJTA 2DKSA 2VZTA 2Z35A 3IXTA 4NHCL 4PRBA 4Z7OF 4LNRB 3RVTD 1C12B 2AGJL 4KJPD 5JW4R 5JA9A 5JW3L 2BHZA 1E28B 4BFEA 4ZXBB 4QHUB 2D7OA 1YMMA 4HFUL 2H6PB 5FDYA 5HHME 4HJGB 3INUH 4K23H 1F90L 3QXAB 4JHAH 4P57B 1MJJB 3BUYB 5D7LE 4BQCA 2NZ9C 5TF0A 5IESH 5D2NB 4DAGL 3GBML 1T1YB 3QFDA 3BOVA 1INQA 5GZOD 3E2HC 4R7NB 4QO1A 2XA8L 3I02A 2N7AA 3G5ZA 4HEME 4LLQA 5B38A 2VYRE 2YBRB 3GKWH 3N9GL 2VLLB 4XBEL 1RIVH 1A6VH 1UCBL 1FE8H 4UNVA 2IFFL 2AJYH 4V2CB 3BP4A 3LZFL 5ADPH 5D7IF 2R8SH 3HMXH 3HMXL 4BELD 2BNQB 3FAXA 4QOKD 3IF1B 2FBJL 2UZIH 4Q9RH 4QHNA 3RUGB 1CDUA 1C5DA 5EC1B 2P44B 2NY3D 5L2JA 1R3JB 4P2QA 4OKVB 4PV9A 1NGYB 4MYWB 1YC8A 3BD4A 4ONHB 3BKJH 4LGRB 1N59B 4QHMA 5M7QA 3C60C 1KEMH 5SWZD 3EHBC 5IB5A 3I2CL 1S7VA 3VFPA 2VAAA 5KSBF 2AS5M 1FC1A 2R2BB 4RGNC 1NBVL 3RDTD 4OIBA 1Z9LA 5DJ8B 5I6XB 4PTTA 4M3KB 2FD6H 1MFEH 1CU4H 1TFHA 1AKJB 3IRZA 2JCCF 4EN3D 1TZIA 3GIVA 1IE5A 5C0DB 1UXSB 4H1LB 1JGVH 4MQSB 1N59A 5IHBA 4PJXA 1CXFA 4Z7WE 2HLFD 5HYJA 1R3IH 3HLAB 2AQ1A 1WQVT 5DWUH 1JHKL 4D3CL 3RKDD 3WKMH 1EVTC 1F5WA 2EYSA 3FQUA 3TA3A 5I6XC 4QKXB 1XF3A 4HS3A 3OB8A 1FL6B 1MFDL 2VO5A 2F74B 2JIXD 1G9ML 3H42L 4XPFL 5HHXH 1GZPA 4LQFH 2E7LC 4KMTH 5E5MB 4MMXC 2B1HH 4LLWB 2BXZA 3AY4A 1M6OB 5D7JA 1F3JA 3MJGX 5JO5A 3VXMB 4F7MB 2ZKHL 2DQGL 4LVOB 1ULVA 5ESQB 1IGCH 3OKNA 5KSAB 4G6ML 1N5AA 1XZ0A 4PPTA 2ZG1A 1NCDL 3TH2T 1A8JH 2D03H 1FCGA 1CFSA 2YD3A 4NN5B 4OCWH 4PRID 43C9A 5IV2B 4AT6A 5DVNA 1C1EL 1HHJA 4JKLA 4YH6A 3QIWA 3ZSTA 4G8GB 3DROA 4O02L 3IDJB 5F9OL 1IEAA 2V7NB 4FS0A 5DJDA 3VRLE 3PF2A 3VD3A 2VITA 3MUY1 4WU7B 2B39A 5CS7A 4YIQB 5GS1C 3GO1H 3WDIA 1EVUA 2YA0A 4I9WD 3L6FB 4EN3A 3VXQA 2ZP0T 4K94L 2KQNA 1DQMH 4P23B 5GGRB 1EDQA 4XI5D 3IDGB 5CLWA 2EYTA 2ARWA 3MV7A 5FUCE 4FRWA 4JZNB 2E7LA 4K55A 5AG8A 4XH2B 5HYEA 2Z9TA 1MVFA 4GAYB 5C0CA 4CMMB 5E1HB 4Y19B 2BVPA 5D7JC 3TCXA 3QDGB 3HG1B 32C2B 5HGAB 2FYYB 1MHCB 2EC8A 4FQCL 3U0WL 2XN9E 1XAUA 4CJ1A 1P5UA 2A38A 1XH3B 1ZMYA 5C9KA 1IAOB 3PWLB 2A6DA 5IMOA 5C71A 3ARRA 4LARL 1KCVH 3OKYA 3D69A 2YEZA 3ZE0E 1DBBH 1IGJA 1LE9B 1U95B 3FRUA 1CI5A 5GRZA 4BJLA 3P0GB 4XP9H 3BESR 2C1OB 2E9IA 4XPHH 1FVEA 4PRPD 3C8KA 4X9BA 5F7YC 3RWDA 1DN0B 3B9VA 4AIXA 2PNDA 4XP6H 1B0GB 1XGQB 2A73A 5IFJB 3KLHD 1KELH 3RZCC 2B4CL 5E8DH 2EDDA 3MUZ1 4NN6B 1QBMH 4DZ8A 4JRXB 5SWQA 1ZHLB 4NOBA 3T1FB 2Y7QA 1CLZL 5TDOA 3T0WA 1UH3A 3AVEA 2R2HA 1I1FA 3QQ3A 4HKJA 3O11B 4JE4B 2V2XA 3NFNB 4KKCD 5E99H 4H8WL 4R9HA 3HZMB 1SJEB 4HK0B 4DZ8B 1AP2B 3TP4A 2X05A 5SX5K 1BVLB 3NA9H 5C0BE 3TN0A 3UTSB 1OB1B 3TO4A 5A3ID 4NZDA 4LVHC 3RGVA 3UC0H 1IBGH 1NCCL 1QKZH 3BW9B 2AJVH 4LDLB 3ZKQD 4Z7WF 4PJ5A 1X5HA 3O9WB 3ARGC 3VRLF 3BGMA 4KKAC 4WW2B 2WBJB 5E8OA 1AQDB 3WD5H 3QULB 1WFNA 1RIHH 1HHIB 4YDIH 1LE9A 3MV11 3FB5A 1JGDA 1A22B 1XR8A 1FGVL 4FNLH 4OFIA 4LHQB 1DQJB 5INDB 3AS3A 3T65A 1IKFL 4QLRA 5DR5L 1AXSB 1QSFB 4MAYB 2WWKT 3KPSE 3TVMD 3PL6B 3V79C 5ILTL 3C6LD 1EPFA 1Q9WA 1CICB 3X3FL 1L0XA 5I1GL 2ZNWA 5B8CB 1P1ZA 4G9FA 5KW9L 3SKMA 3V7MA 1J8HD 2OR9L 4LHUA 3OKDB 2X7LA 4KTDL 1LEIA 1UWEL 1DBKH 3O8XD 5KVDL 5KVDH 1BHGA 5A43C 5KBNC 2V17L 3P9MB 2WM0A 3LS4L 5GZNC 3O3UN 3MBEC 5D1QA 1B2WL 3HZYB 1UZ8A 2EH7H 5GRJH 2NXZD 1B4RA 2GJZA 4PJDA 4G6KL 3QI9C 1GGIL 4YFLI 5DR5H 1DCLA 3QEQE 1R3KA 4WY7L 4KUCD 1WFTA 5ERWB 2YN5A 2JCCE 3MQIA 5JR1L 5DUMH 3OZ9L 3GSNH 4WFEE 1RZGB 3BPOB 3I50H 1X5ZA 4U6XB 1U8LA 4H26A 1OT1A 43C9B 1IEBB 4L8BA 3H3KA 2VH5H 2DTSA 2C7UB 2H6PA 5BOZG 5DGRA 1JHLH 1JHLL 2NY3C 1ZEAH 3PWNA 3O3DA 3NFNA 2MQ0A 4S1QH 4NRYB 1MRDL 4S1QL 4P4KD 4XP5H 1VGKB 3TCLA 1E4KA 4OT1L 4YC2B 5HYQA 3T0EC 1IEBA 3G5VA 4AK1A 3PHSA 1TVDA 3ULUE 1H3XA 1RJYA 4QT5A 4JB9H 4U6TA 5ID0A 1ED3A 5D7IE 1U8OA 1RZFH 4WTZA 1QLRA 4WTXA 1ITBB 4Z7UA 2R0LL 5ERWA 3QDJE 4OLXL 1MJ7L 2VISA 1DQQA 4TUOB 5I66B 5D71L 1AJ7L 4KGLA 1XGYH 4FZ8L 3EYFB 3I85A 4P5TC 43CAA 4RDQF 1C5CH 1MCHA 3QZWG 5ICYA 4U05A 5MEND 3MOBL 4U1KB 5EDXA 1DBJL 2IBBA 4XNXH 3VFWB 1CBVH 1KPRB 2DQIL 4ZYKA 3P0VL 3OJ2C 3HC4L 3QCVH 4F7EB 1ZHKA 4G8FB 1S7VB 2PXYC 1G7IA 3KYMB 1AGCA 4BSJA 2IG2L 4DUVA 2DIJA 2RFXA 2FYYA 1DUZB 3PWPE 4OJFH 3OJVC 3MMEA 3D87B 1PY9A 3PP4H 1J8HA 4RWHA 3NAAH 4WHYH 3R0MA 3JVGC 5D70L 1QSEB 1QO3B 3RUGA 1CG9B 1OGAA 3TBYB 4JZNA 4PJ8D 1ORQA 5TE7L 1CXEA 5I1AB 4XBPB 3ILPB 3RWJA 5I1JH 5J6HB 1CLZH 2Q7YA 5IW1A 1CFNB 2PUQT 2R2EA 4JAMA 3WFEH 5DD1H 1FBIH 1JYWA 4H1LG 1G7MB 2GK0B 1EJ6A 3CK0H 3X17A 4EUPH 2EKJA 2VUYA 1BFOA 3LKSB 3QIBA 1QYGL 3MRLB 5IVNA 1GRWA 3CVHL 2AK1H 4DAGH 5DK0A 4IDJH 1JZ3A 3DVIA 3WDJA 3GMMB 1Z5LB 5B4MC 4M4PA 2YPLE 5D7SH 3AU1B 3QIBB 4CVUA 4M6MH 1JPTH 3GI8L 4I2XA 5CEYA 3ZDYE 1F4AA 5DRNA 2UWEF 1YEEH 1VFUA 4Z7UF 5F8RC 3AREC 3S8WA 4KHTL 5IW1B 4N1HB 5FO7A 3SKUD 3ZL4H 4UDTB 1CQKA 3R4DA 2ZUWA 4YHKH 4HUVA 1MRFH 3VXPA 1BEYH 5I1CL 4LLDB 5ID1B 5JIPA 3MXVL 4PJXB 1I3GH 2O5YL 2OTPA 3P3YA 5KSVA 1I7RB 1JYXA 1K5NB 2IALA 5GHWL 3CFBA 1U8KA 1YNTB 4DFHA 1H3PH 5EU6A 2KZWA 2R4RL 2PR4L 2VZ3A 1IVLA 3N1QC 4JQVA 5B21A 1S7WB 4NDMB 2EC9T 5F9AC 1N7ML 4M00A 3ZYOA 3VXUE 3ZKNC 4Z9KB 1CD9B 3LKOB 3MLVH 2A1WH 2DRUA 1IGYA 4P5TA 4YHKL 3BE1H 1R5VB 4QWWC 1D5BA 1M7IB 2X5PA 3MR9A 1NGXB 4X6CA 1B2WH 4WW1B 2ZOLB 3AM8A 1J0KA 4LQFL 4OZFH 4PG2C 5J4MA 3SOBL 2GI7A 2BNQE 1ZS8B 2VQ1B 3ARDC 4HG4J 4MX7A 2JJVA 4FQ2L 1U9KA 2B4CC 3E6FA 5DK0B 4MNQD 3MV8E 2NY7H 4X6EA 5A16A 2XV6B 5KVFL 4Q74A 3ZDZE 4NM8H 1MRCL 1F58L 1SBSH 5DTFA 1R3IL 3D3VB 3T4YB 4P2OA 3ARWA 4F9LC 3T0XA 3HNTH 2BVUA 2OMNA 4QRRB 2QJDA 2ADIA 3UZVB 4XGZA 4XAKD 3T77B 1KYOJ 2Q3AA 4V1DB 4P46B 2FGWL 3EDEA 4JR9L 3H7BB 3QWOA 3HKFA 1UVQA 2Z31B 1MWAH 4AIZB 3VDCA 1OAZL 2FIKB 5C0FB 2P5EA 5I1IL 1CG9A 2YR3A 4EIZC 5I8OL 5I8CA 5DHVB 1YYMH 3KPRD 1G7QB 4Z0BH 3TN0C 5JZ7D 4GFTB 4UIMB 4KK6C 3P77B 1S9VB 1FHGA 2BVEA 3O3EA 4WUUD 5CKAA 4OZHF 2PO6C 2FEEI 1I9JH 3KS0H 3LD8B 3DIFA 4JREC 3SGKC 3MROB 2FECI 2XFXB 1E6JH 4CVWA 1OAZH 2XQBL 1IGYB 3R8BB 4W6YB 4FFWD 1KCVL 3RTQC 2CUMA 2YD8A 3L3KB 1NGYA 4GRLA 1T1XB 1SJHB 3RVWC 8FABA 1WLHA 2COQA 3QUKB 2FSEA 2QSVA 4HH9B 4O4YL 1BQHA 1EIBA 5BW7C 1C7TA 5HYSG 5C92A 3L3OB 2W91A 4XP9L 5C0IB 5IKCA 3U7YH 3MCLL 1F45A 4XNZB 4JPWL 1N3NB 3MRGB 4Q9QH 3KLHC 4FG6D 4D0CA 3RQ3A 2F15A 1PKQA 5F72S 5HYIA 3ES6A 4P23A 1PSKH 1EZVX 3WFDL 3D6GA 4RFEA 4MMZC 3RPKA 5BMFH 4F57H 1BVZA 4LPTA 1BFVL 4NNYA 3I02B 2IADA 3TO4B 4UDTA 5C07D 2GW5A 4PJGF 5JPNB 4OCXL 2OSLA 6FABH 1KN4L 1I3UA 2UZXB 1M1SA 2HRPL 3HA0A 3HE6A 4JN2A 4K2UH 2BOBA 2XZQH 1RMFH 5SX5H 3ESVF 3MRIA 4PB0H 1OWRM 5FIEA 1VGKA 3TCLB 5L88L 3MCG1 1X6NA 1KIUA 4YQXL 1FIGH 2EDLA 2LQRA 5DJ0B 3DECA 2GK0A 1J1PL 5HVFB 1WBYB 1ADQA 2EDEA 3RVWD 4PJHA 4V1DD 1NUFA 1TQCB 1OW0C 1JYNA 2DQHL 1IMHC 5D5ME 3LRHA 4G6FB 3H9ZA 1JFQH 4D94A 1I1RA 5DD0H 5I8EA 2MFNA 1LO4H 4YHPB 3TT1H 1P4BL 1NH6A 2CLZB 3GZKA 1WT5C 3FO0L 1I7TA 3SDXB 5FUZL 5LXGH 2E7CA 3UPRB 3LKQA 5KSAC 3ARFD 3C5ZD 1EO8H 1WZ1L 3AS0A 4KROB 2DQCH 1RI8A 3OXRA 4OM0H 5TQ0H 2I60H 2FHCA 1HYRC 1NKRA 4R2GD 3AM8C 1HHKA 4QHLA 2VLJB 1UA6H 4EQ2A 4CRPA 1UXSA 2BNRE 4XNYH 1UJ3B 5L8LB 4WO4C 1AH1A 3S37X 3QPXL 1T2JA 3VFGL 4JVPA 4D0DA 2F54B 3ARFB 1NFKA 4XCFL 5BV7C 2B1AH 3RJQB 5GGVL 3MODL 3GI8H 3CLEH 4MXVE 3QJFA 4RA3A 4OZIA 1BBDL 3FO1A 4LCCA 4YXLL 4LP5A 1VACB 4X6FB 4QHLB 3NZHH 1KEGL 1OARH 2YRZA 1FIGL 5L2JB 1DQDL 3OJDA 1IAIM 4Y5XC 3MRMA 4DN4H 5INDA 2GIYA 4ZODA 2BC4B 3CLFH 3IU4H 3S35L 4F7EA 1E0OB 4Z0XA 5L0QB 4YK4B 2FB4H 5EA0L 5DI8B 1BWWA 5FECB 4CVXA 1JHTA 3GDBA 3WFBH 3MV9B 3O41B 1ZV5A 4RBPH 3GSXB 2ZCHL 2WV3A 1JZ6A 5CSZA 4PJ5B 1AR2A 4WHTB 3UJIH 2XQYK 1JGUH 3LZFH 5HPMB 4KV5E 5IROA 3KLDA 3RGVB 1FFNA 3O81A 4ZDHB 5C1MB 2VISB 1NAKL 1R3HA 5DJ6B 3PNWB 3X3FH 4W4NA 1NMBL 1NEUA 3VWKC 3W0WB 4IS6B 1NBYB 3V6FA 4BZ1H 5HHPB 1HKLH 4K3DL 5TGBB 3VXOA 2HRLA 4YHMH 4XMKL 1AO7D 5D7IA 4OZGB 1RVFL 1GZPB 4PS4L 1QRKA 3HNSL 3HB3D 3ARXA 2EYSB 1AR1C 4YHIA 4LSVH 4KC3B 1XGUB 5DFVD 1CBVL 5BOPA 1T89C 4HZAA 3HG1A 1IAIH 1NLBL 2GY5A 2X4SB 2FRGP 3KJ6H 5LGKA 4HZLB 3CSGA 4OTXH 1U8HB 4ZUVA 1S8DA 2EDKA 5IQ9B 5K9OA 4U6VH 4PJ9D 5F6HI 2G9HB 4QRSB 3UMTA 2IF7A 4RBPK 3WHE1 4OLXH 2EZ0D 2DQDH 2Z0BA 5CEZL 3IDGA 3NH7L 5AYUL 1AXSA 2EH8H 1J10A 4O2EB 5D6DC 2AEIT 5DDHA 5DMJB 5D93B 5CJXC 5HGAA 3S3SA 4P49A 5CGYD 4WNQA 5DHXB 4OT1H 2XQBH 3VFMB 4PJGB 1GGCL 1BWMA 1T03L 1ERNA 4I0KA 5DEFA 1MRDH 2NY7L 4LSDA 1NANH 3UO1L 4U1GC 3QEQB 5EIIA 1MCOL 3FO9A 1G9NL 3RZCD 2UWEE 2NY0B 5BJTB 4OLUL 1Y6KR 2I9LA 5DHYB 5GGQL 5FYLH 3CK0L 4M7KH 4F58H 2ZUQC 1I9RH 2DDQH 4IRSA 3FO2B 5E94B 4PRHE 1RPQA 3KPSA 3SE3A 1U8MB 4N0FA 4RNRB 1IQDA 3MRDB 4ZUWB 5JDSA 1GPOH 2BJML 2L7JA 4OLEA 5GS0H 3JWDC 1OWWA 5IVOA 2PW2A 2MQ3A 5I30H 5E70A 1E4KC 1YECL 4OZIE 4FQLH 3TO2A 1F00I 2XG4A 2YRPA 1LK3H 2DQGH 3EYOA 3MSPA 4P2CG 3O6KH 4HPOH 1UM6L 1MLBB 3QHFL 4MJIE 3CX5J 3P30H 3GSNA 1MAJA 2Q86A 2QL1A 1FNGB 1RIUH 2LAGB 3T8XA 3V6OC 4GQ9H 2HTKD 3ARDB 3LQAL 3LRGA 3WE6B 1KIRB 4JJ5B 1AE6L 3RIFF 1QVOB 5JLZB 3DETD 4ZUTB 1JYVA 1Q0XH 3ARYA 4U2YA 4YEFA 4X7TA 1NFDA 5CUSH 3SKOA 1QLFB 4N8CH 1IQDB 5ESVA 2P49B 5TPWH 3F12A 4HV8A 1RK0B 2R23B 4IRSB 5C08A 4MA7H 5H94A 5JHLL 4HKXA 4M1CD 1M7DA 5DMIH 5CD5D 5C3TA 1DUYA 1WEJH 4H0IA 5EN2A 4WV1A 3DGGB 1A6AA 1QSZA 5FHBL 4KRMB 2HH0H 3LHPH 2D0HA 3FQRB 5FGCB 2H8PA 3FHAA 4JCLA 3OXSB 2WINB 1JUFB 5DEFB 2LE9A 3K8MA 4P2OD 2V7HA 1IBGL 1NCCH 4K3EL 4XI5C 3D69B 3TFKC 1BF2A 3ARFA 3NCJH 1MCDA 2FBOJ 4ZYKB 4J1UA 4U33A 2DIAA 5T33H 3P2TA 5F7FA 2EXWD 3FQRA 4LVOC 3L1OL 5GS1A 4P2QE 3WO4B 4R4NC 1OPGL 3EHBD 3QZWB 4YDKL 1KGCD 3TM6A 4PLNC 1LO4L 3O8XB 3V4UL 1AGBB 2R39A 3S7GA 3ME0A 1LD9A 2W9LA 4OIIH 4BSWB 3ULUF 2BNQA 2PXYD 2X70A 4Z7NE 1VADB 2Z91A 1LO0H 1ZT4A 4DOHE 1TITA 3QAZB 4L3EA 1AFVH 3PL6D 2R0ZL 3L7EB 4P5MB 5E00A 2P47B 2E6PA 3TH3T 2XTJC 1PAMA 3VRIA 4XT1C 5CD5C 4G7YH 2LU3A 1JNJA 4HIHA 1SEQL 3A6BH 2B20A 3OTTA 2AW2A 2UYLB 1T1YA 3N9GH 3DUSA 3WFZA 3MC0A 4EUPB 3IDJA 3U4EA 4XC3L 3EDKA 4ZOCA 1KF9B 4AENB 3V95A 3S34L 5K9JL 3OF6A 1CZ8H 3MRKB 4LLYA 4YBQC 3C2AL 4NC0B 1S5HB 4FN0A 1F90H 3O8XC 1RULH 2ZG3A 1EMTL 1A4KB 3QNXB 3SO3C 4X99B 2AXFA 3D3VE 1F3JB 1F2QA 3G6DL 5GS1B 1PD6A 4YR6A 1CT8B 4K7PL 1KIQB 2NXZC 1JNLL 2EXYC 2HT3D 2KBGA 5CINL 3QDJB 5IB2A 3ZKXC 2PO6B 1QFWM 1RZKL 4HS3B 1HKFA 4QXWA 1MVUB 1V7MH 1J8HB 2WINA 4WI5A 2V5RA 3ALXA 4NM4H 1MUJB 4EVNB 5J12B 1Z9OA 1U93B 4LFHG 2D7MA 2LVEA 3P0VH 1UG9A 4JFZL 1AGCB 5E8PA 5C0DA 4KZDH 3OAUH 2ATPB 4U6VL 5DRWA 3QH3B 2EDHA 4H25B 4WGWB 4KI5F 4G8IA 3CFJA 4V1DE 4K3JL 3D85B 4EI5D 5ADOH 3VFWA 5CZVL 3T0BA 1FVCA 3P9LB 2D7QA 1J5OH 1KYOK 1A9EA 3EOAB 3RAJL 1TQBC 3CIQA 2WWMC 4PRAB 4X5XA 1N2RB 1HHKB 3LPFA 1O0VA 2M1KA 3JV4A 1D6VL 4OBSA 3QO0B 5GGSY 1OP3K 1BZQK 3S4SA 5B38B 4UNUA 3MRRB 4Y19D 2GSGA 3DV6B 2I27N 4LHUD 2G5RA 5D2NE 2QBWA 1T20B 3REVB 1YYML 3IB4A 1HWHB 2BFVH 4WJ5B 2ARJB 2F53D 3QQ3B 4DKFL 3FT4A 2X4NA 3GSOB 3I6GB 1CFTB 3NN8A 4F80A 5J13C 2AJ3B 4JR9H 2CUHA 3L5HA 1SVZA 5HHPA 3MRLA 1K8DA 4I18A 5DD6A 3MBEA 5CCKL 4Z77A 2WZPD 3BJLA 1HH9A 3DX9B 1K4CB 3GSNL 4PRBB 3WIFB 4OFVA 1G0YR 5CJ8A 3ARTA 4JY4A 4K71C 4NQEE 3MLXL 4PRPB 1OGTB 3WS3A 3F62A 5D96B 5KZCB 2DL2A 1EA9C 3W9EA 1BJ1H 5KSAD 4PREA 3QFJD 1IFHL 4NO2B 5F21B 2UUDK 1U95A 4OCYL 1EJOL 4Q6YA 4WWKA 3UDWA 5HYJE 1TVHB 3A0OA 4TPRH 2KDGA 2ED7A 1R5IA 3B9AA 5CUSL 3QDME 5EU6D 4L9LC 3QDGA 1MUJA 1KTRL 4EVNA 3QDGD 4Z78A 1QSFD 4MAYD 1DBAH 3LV3A 3KAAA 4CMMA 1JF6A 4HH9A 4S11A 2X4OB 3O9WC 4OCWL 1D5XB 2XOTA 4WNQB 4EKXA 1EXUB 3CFDB 2ESVA 3RY5A 4QXTA 4JEGB 3CPLB 5JMOC 3ARBA 2ENYA 4NSKA 4K71B 1DSFH 2R0WL 4HWUA 3W82A 3U1SL 2YC1A 4YUEH 1QFPA 1U42A 3MGOB 4R90L 2NQCA 3UTPE 2R56L 5LBSL 3QHZH 1CXKA 4Z7VB 4KDVA 3W9EB 5EZOH 4WDIA 4HZLA 3FL7A 3MNVB 2J5LB 4C57C 4Q0XL 1KXTB 2HRPH 4GW5A 3Q3GB 5DUBB 4WFHD 1L6XA 4XTRC 2BOCB 1QD0A 2NW3B 4QRPE 1IGMH 2D0GA 1IGFH 4MLSA 3ZTNH 4DQOL 1FGNL 2VL5A 4NRYA 4JFYA 2X1WL 1FO0A 3ARUA 4KKNA 2BNQD 2NNAB 3QXWA 4JFQB 4K3DH 3UDWC 2XWBA 4LPYA 1W72L 5AWNH 5A2JH 1PVHA 4WIQA 1ZVHA 2R2HB 1F2XK 1UYWH 3SDCA 5IMMB 1T89A 4ERSH 1QZ1A 3GMQB 3B9EA 3F5WB 1WUNT 4U0RB 4D9RE 3OKLB 5IVXA 1XCQA 5EO9A 1H9VA 1FFPB 2Z4QB 3VD7A 5ANMA 5C0AA 1CGSH 3NZ8B 1QFWL 2XRAH 4QRTB 2ADJA 5ABDE 4HKZB 2X44D 3MLWL 4D8PB 2KUTA 5T1KD 4PUBH 2BVTA 3T3PF 4X6DA 3U0PA 1KJVA 2WW8A 3LAFA 5J89A 2YZ1A 3A6OA 3N0PB 1FDLH 3HS0A 4OLYL 3EIFA 4LOUD 3PGCB 3C60D 4KU1A 4C83B 3MFGB 1PKQE 3V8CA 2P5ED 3MRNA 2OZ4A 4O9HL 2FSEB 5E8PB 4P2RE 5GRWA 5SWZB 3GUTA 2BSRB 3VA2C 1MHCA 1UADC 1KCSL 4JFEE 1DQDH 2Z8RA 4P5KB 1IQWH 1A4JA 4M02A 2HAZA 4UBDC 1PYWB 3IKCA 2VXUH 5GS2H 1HKLL 1T21A 3M1BA 1TVBB 1DJSA 3UAJD 2F54A 3SE4A 4CJ0A 4RZCA 2ZJSL 1T2XA 2AJXL 2IBGA 4NQEB 4PRPE 2APVA 2GKIA 4ZUSA 5FM4A 4JLRA 2F19L 4OFPA 4UT7L 1F8TH 1PZ5A 5LGJA 3VGGA 4NO3B 3N50A 2DQTH 4EI5B 1ZWIA 3P11L 1FP5A 1T1WA 1D5IH 1TTUA 5C0AB 1T04A 3B9KB 2CKBL 1MCLA 2H2SD 5DVLA 3K1DA 4XWGH 4OF6A 3WJJA 4WI8A 4HC1A 2DD8H 3VXMD 3FQXA 2V2XB 5DJAA 2XN9D 5T1MB 2NY5H 1BM3H 3PWJB 4P5TD 4P3DA 4EUPA 4OLZH 4TSBL 1WAAF 1WIOA 4X6CF 2FJGB 2VH5L 2PO6D 1FZMA 4QOKA 3WEXB 3FQTA 1WZKA 4RX4D 2YWYA 4XAKE 4LP4A 2IGFH 4XP1L 1GIGH 3Q6GL 3PWJA 4U1LB 4NC1E 4LASL 1FVEB 4IMKA 1JTOA 2F74A 2G60L 1EAPA 3KPRB 3VXSE 3WIHL 5DSCA 3D0LB 4XPTH 1SY6H 3I6LD 1XF3B 4N8VB 3UPCA 3ARFC 1JRHH 5H8DA 4R96A 4MCYB 3MGOA 3FHQA 4LQ1A 4FQ1H 2ZUQB 1D9KA 1A7OH 1D5BB 2R2EB 3FO0H 2R69H 4XVSH 1ZT7A 3B2VH 2VDLL 4DKEH 1UM5L 3VI4F 1T7XA 3T2QA 4G80A 3ARBB 3GIVB 4HEPG 4LOUC 3CFEA 4M7LL 1QA9A 3VWJC 2VSDA 5I18H 2NY3B 4GW4A 5IQ9A 1D6VH 3K0WA 5D8JH 4PY7B 1AI1L 1MSPA 4FQJH 4L8SA 3QUXB 1QTYT 4PP2B 1R5IB 4KWUA 2FR4B 4NQCE 4E5XA 4H8WH 5J1AB 5ITFA 2CO6B 5FV2A 1RSFA 4BZ2L 1KCUH 5FEBA 1DLHB 4PGCB 3IJHA 4X6DE 2Q87A 4G7VH 1NGPH 4PB9L 1XGTA 2D3VA 4M61B 3OKOB 2VLKE 2VXTL 5C08D 4WU5A 2YMXL 1T83A 3VXOB 5DYOB 1DBJH 4XNXL 3WE6A 5BMFL 2QQLH 4ZMAT 4KI5D 3MRQA 5DD3H 5HYSA 2SEBB 1BQHG 2VRAA 3EYQC 3G5ZB 2BDNH 2AVGA 3SCMA 2PYEB 4OZFA 1YEIL 4G9DB 4M4RA 4NNXB 1INQB 3OKLA 3CMOH 5IVXB 1FRGL 1PX3A 2XPGA 1YEEL 4PJ8A 4P57A 2DM7A 1LO3L 1RJYB 5ID0B 5IQ7H 2HT4C 4MAYC 5DHVH 4QTHB 5HPOA 1A6WH 1PGRB 3BN9D 3DX8A 5JNYB 1ZGLP 1MNUL 1JHTB 4JREB 2FWOB 4PGDA 4Q2ZA 1S3KH 2XPGB 4JM4H 4O51B 5AWNL 2CDEA 3CXHK 1P84J 3MRMB 4P3CL 2PYEE 3V4PL 5DQ9A 2ILLA 1DN0A 4JZOB 1JTPA 3DUUB 5GGTA 2FX9H 2VAJA 3Q0HA 2A0LC 1BQUA 4PRAA 4OV6F 5H35A 2CIIB 3B8SA 35C8L 1PEZA 4FFYH 1JMZA 2QHRL 4UQ2B 2F8VA 4YHYB 3D2UB 1UWXK 2Z8WC 4OGXL 5F89B 1G7HA 4JANA 3IDXL 3BH9B 3SCMC 2R0ZH 2A9NL 4E42A 2E7HA 2K1MA 1T4KB 4KH2A 1J1XL 4F3FB 4DTGL 2A9ML 1FVDB 4UI2A 3OKEA 2GUOA 1FYHB 3HTLX 4ZFOA 2Q8AH 4GW1A 1BD2D 3U0TA 1LEIB 2HMIC 2G9HA 4QRSA 3BFOA 3MRBA 4U3HA 3GJFH 3N1MC 2FGZA 3MRJA 4NYLA 1BGXH 4NGHL 1L6ZA 4K9EC 4NO0A 4IBLT 3BQUA 1TXKA 1FZOB 1HH6B 2IAMB 4YZFE 5BQ7A 1YDPB 3DUUA 1KB9K 2JB6A 1KV3A 1X7QB 4FXGA 2DTMH 4LCUA 4NM8L 5CP3A 1VERA 4CMHC 1RUPL 3Q2CA 2W9DH 1W2KT 1JNNH 2FIKA 5C0FA 1SEBA 2XZAH 1J1XH 2ZUTA 1DP0A 3DYPA 1A3QA 1OTSC 3RY6A 3EZ8A 4PJEF 2UWEB 3GRWL 1FN4A 2MQCA 3QFDB 5CMAB 4LSPL 4LLYB 3K8KA 5AZ2H 3BDYL 2F58H 3QXAA 4U1LA 1KLFA 5F1IA 4Z76B 1ORSB 5I15H 4I2XB 5CEYB 3GEWB 5C0JB 5C0AE 3NGBC 3MLZL 4TVPH 1U3ZA 5I17A 4PGBA 1FZMB 4PGDB 4PJXF 3X13B 1UB6B 4GAGH 4TSAH 3AS1A 3LIZH 3PDOB 3WFHB 4NQVB 4YPJA 2EZ0C 3RX8A 2XY2A 3QG6B 2ZSVA 3R1GH 3RWCA 3UAJC 5T1MA 2ZCLH 1T7WA 3C6LA 4UT7H 4GRLD 4ZSOA 4NQCD 3FN0H 5EPMB 3P11H 4XMPL 3FOMA 3GMNB 1B9ZA 1CLOH 4CVZA 3UJTH 1DL7L 4U1MA 4UU9A 4MCZA 1AO7B 3BQUC 4MD4B 1XGQA 1OAKH 1WSST 3WUZA 3KYKH 4OD1L 2VZSA 3KJ6L 3BIKA 5BV7H 4WUUA 2EDQA 4UQ3B 3O2WL 4YK4C 4OLUH 3SE9H 3DI3B 2W0FA 5D2NC 2OJEB 2VWEC 1KEML 3O2VL 4F58L 2DQEH 3GFUA 4NZTL 1JPSL 1UT9A 4XHJD 3QIWC 3IKCB 1QBAA 1NDGA 4X4XB 4G7VL 1M05B 2FD6L 4OGAC 2ZOKA 5HI5D 4F33A 1N0LA 1J87A 1OAQH 4E41D 1U93A 4XPGH 1NDMB 2YHGA 2ADJB 2GHWB 1VPOH 4HUXB 3V0AC 2XXMB 4HUVB 2EC9U 2AAVA 4OI9A 2VDMH 1WZLA 2UY6A 3VH8G 5MERB 2AJUH 3G6JE 5FO9A 2DM3A 2F8XC 6FABL 1Q9OB 5EC2A 3CFEB 5C2UB 2Y07L 4BQ6A 5E9DD 1YEDA 4HGKC 1A7PL 1UKQA 3IFPA 3V9FA 3AB0B 4MA1B 2ZUUA 4GG6A 4KK9C 5LG1A 4CAGA 4ODVL 1QRNA 1WICA 1Q0YH 4LLUB 3MRIB 1F6AB 1CICD 4Z95H 3QBTB 4OZHB 1HNGA 2L0DA 3IDYB 2V6HA 1MOEA 4HMEA 3TBTA 2H3NA 4JPIB 3LN5A 3B9KA 4HGWB 5ISZB 1IKNC 1LEGA 4XAWL 5DJXB 3LN4A 2DS4A 2AEQL 1M6OA 3BKML 4JRXE 3BIAX 3T4AB 4NRXB 4S1RL 4ZFGL 3HI6H 4CN4A 9CGTA 4Y5VC 4TQEL 4FQHB 4U6YB 3BT2H 4ZD3H 2JB6B 2Q8BL 3WYRA 3QEUB 5IHZB 2AEPH 4JDTL 4YDKH 1LK2B 3MLSL 4UT6L 5I73C 2WANA 2HLAA 5ENWA 1S7UB 3L95B 3WMSA 3EOTL 3OPZH 4WUKL 5ESAB 4I3RH 3REWB 2YXFA 2CK0L 3JWOC 4JO3L 4NQTA 2XACC 4L9LB 1DE4B 3CX2A 3OGCA 3U1SH 3ZZ1A 3PWVB 1AKJA 4QEGA 3MRFA 4OAWA 2MKLC 3SY0B 1QNZL 3AAZB 4Y19A 3MPCA 4IHOB 5CFHA 2ED9A 1ZOXA 4F7TA 3TN0D 4JRYE 4ZUVB 3U0PB 1MHHA 3WLWC 1ZTXL 3ULSA 1T2QL 2J8OA 3G5YB 5DMGC 5TF1H 3KYOB 5IT2H 5E9DE 4P46C 1G6VK 3H9SB 3QQ9D 1JWMA 3WO4C 5T1LB 4Z8FH 3WIHA 3C6SA 5EC1A 1EERB 3MRNB 1UWGH 1U3HA 1NAMB 3DLQR 4CDGC 5HHOB 1IILE 2X9YA 3PGCA 5MI0B 1CD1A 4YGVB 1UZ6E 2VZUA 1Z5LA 3C87A 4O2CB 1S9WB 1U92B 2JJTC 4E41E 2XKUA 1MCCA 4I9WE 2J8UE 5AYQA 3TNMA 4ODSL 2CD0A 4WJ5A 4GAJH 3CXDH 3IVKB 4Y5YB 3T4YA 2Y23A 5IT2L 3QEHA 2VXVL 4ODXB 4ZO7A 1OLZA 2VQTA 4PJ9C 2O5ZH 3RDTA 1NBVH 5C0NC 4TN9A 1F02I 3DNKA 4Y5XB 4IOIA 5JOPD 3O4LA 3B2UC 3C8KB 3EO1B 4HK3J 2GY7B 4HLZH 4A2MA 4JM2B 4HT1L 3U6RA 4JHAL 2VQ1A 4I18C 1XR9A 2PYFB 4KI5C 2IANB 3QIUC 5BS0B 2HG5A 4BUGA 3BKJL 4D0BB 4DKFH 4NFDA 4HKBB 2MHAA 1TETL 4XWOD 4WCYH 3H9SA 4KVCH 3T3ME 1W0VB 1KIPA 5T3XL 5DURD 3MV9E 3WFDH 1CU4L 1HOCB 4QY8A 3LOWA 2BVPB 4MS8D 4WEBH 3KYMA 2AQ3A 3OKDA 2C3HA 3QJFB 4KHTH 1O7VA 4HX1A 4JY5H 1CXLA 1GHFL 4XVTL 1MCPL 1K4DA 2NLJA 1UACL 2WQRA 4K3HA 4P59H 3MRFB 2XQYG 5T1DL 2DM4A 3ZHDA 1P7QD 2DOCA 2W65A 3EKCA 3KXFB 4G42B 1CL7H 5SX4H 2VJXA 3TC9A 1MCNA 1NQBA 3QFJE 4P2OC 4WFED 3IAGC 1DQJA 1KCUL 5GGUA 3ZLQC 4LSRL 2G2RA 1KFAL 3V5DA 2Y9RT 4PG2A 1GGYA 4MD4A 4PIRF 3WCYA 4XCCL 1C5DB 2ZUSA 4XNMB 4ZFOL 5JOPE 3DTXB 5ADPL 4Z78B 3F6LA 1B88A 1F4WH 1IC5H 4BH7B 4G8GA 3HZKA 2OJZL 1J1OH 1FL5A 4UV7H 3NCMA 4I48B 3NGBB 4HUKB 4YR6B 4PFEA 1U2HA 4FQPA 5IWLA 2GITA 3QFJA 4GKOA 4S0TD 4Y8AA 4NBYB 4KZEL 1IC7L 3JWNC 3JWDH 5CWSA 4I2XE 3VCLA 2AV1A 2J12B 4HGWA 5HVHC 4LPWA 3JV6A 1V3KA 4LVNB 3D25A 5LQBL 4OCYH 1X5IA 4DK6A 3MRKA 1E27A 3L5XL 5DJAB 3SDYL 5C0CE 4YGAB 1VADA 2Z91B 1JIBA 1ZHLA 4R8WH 4ODTL 2HFGL 4A6YL 3JV6B 1LE5A 5I75C 4B7IA 2IJ0C 2XICA 1JPGB 5GJSH 5FGRA 4WI3A 4C56A 5JQ6L 5L2KA 3H8NA 3VXNA 2AJ3A 4YBQD 4GBXB 2J6EL 5D1XD 1KOAA 4FFZL 4UV4H 3HNTL 2DQEL 4LEOB 4ZTOL 1BMGA 3BZ4B 3GIZH 5FKPA 5L7XH 4PTTB 2W60A 5F9JA 5JUEL 1BEYL 2GJ6A 2FR4A 4DEPC 2L7UA 4LF3A 1I75A 3FT2B 5D1ZB 4OD2A 4PJHE 4XXDA 1M05A 3PWPB 1JFQL 4WW2F 3B3IA 5F1NA 1RUQL 4F2MB 1PG7X 1YQVH 4WI7A 3B9DA 1JL8A 4X9GA 2CKBB 1JGDB 4M43L 4XPFH 2VAAB 1CXIA 4DUXA 3CDCA 1KACB 5FA4B 2R1YB 4RGMB 5LJYH 2VLKD 2XZCH 1AD0B 4QRTA 4W70A 3F65A 4ODWA 3MFFB 1A4KA 2ICWB 3O6LL 4DVRL 4HWZA 1NUDA 3EJZC 4B41A 1AP2A 4O51A 1V8HA 1HQ4A 3W39B 3BPCA 2C4FT 4ETYA 2ICWI 3OPZL 4WUKH 5IJKC 2XG5A 3GSQB 3MNWA 3S36H 4NWTL 5HI3D 3JTTB 2VR9A 2EICA 3UYOD 4X5LA 4ZS7H 3WXWL 4QRRA 4HIIA 3T8XB 3ZT7A 4HIXH 1AHWA 4KKBD 4ETQA 5L6YL 2AJXH 25C8L 4JFYB 2M8XA 3VXRE 1RZ7H 3KXFE 4L8BB 3V4PH 3GSQA 4AENA 2AJZA 1U8LB 1WT5A 4MJ6A 1ADQL 3BP7A 3LKPA 3ZYIA 5E99L 2R4RH 4RRPG 4RMWA 5E2VH 1S9WA 1U92A 1WFUA 3ROLA 1BQLL 1J0JA 2R2CA 3FRUB 3NIDF 4G6JL 5AZEH 2NTFB 4NO3A 4JRWA 5MEQB 3O2DL 1JWUA 2AJVL 2XNAA 5T1LD 3KXFA 4G42A 1FDLL 4JY6B 3QQNA 5C6PB 3QUXA 2D7NA 3QCTH 5FUOH 4QXGH 4MQ7B 1LP9A 1S7WA 3VMPA 2NR6D 3MRBB 4MDJB 5FO8A 4HAFA 3T0EA 4YDJA 3D9AH 4NZRL 4NZRH 3RZWA 5KVGL 1IARB 4EQ3A 4R0LB 5GGUB 4JRYD 3TH4T 4JY5L 1HILB 1OAYL 3W9DA 1BFSA 3AREB 3O3AB 1YN6A 4XVTH 1LO2L 4H88H 3L3DB 4YEEA 3DIFB 1OP5H 1WISA 4KKAD 1Z6JT 2K7QA 5E6ZA 5EU5B 4S1DC 3OSKA 2H3NB 3GMRB 5F7WC 1IAII 2H8PB 4HJJH 3C2SA 3BXNB 2M2DA 3NIFE 1VFAB 3MV8A 4MJ6B 4OZHA 4KKLD 2VDNH 3MOAL 1S9YB 3GJFA 5JPMB 3EFFA 1EFXB 1MJUH 1BVLA 5IHLB 3T4AA 1DTUA 4L1DA 4P2RB 2PTTB 4X98B 4JM2C 1U3HC 5FFLA 1K8DB 1XIWD 4HIIB 2HP4A 3JWOH 1S9XA 4NQDD 4OD1H 4OV5A 4FP8L 4JPVH 2PW2B 3DSFH 1NL0L 2XWTA 5DVMA 3RNKA 1DEDA 5I19H 5GRXG 1I85C 1FO0H 2EDYA 3UYRH 3PJSB 3RWEB 3HE7D 2MWCA 5F9OH 4RAHA 1I8LC 3GSNB 1JK8B 1MHPH 1CGVA 3KYNA 4JPKL 5DEZA 2H41A 2YUXA 1REIA 2WBJD 3WHXB 5DO2C 2P5WD 3QUZB 2NY0D 5D8JL 4HUNB 1N64L 4EUPG 4HS6B 3QCVL 4PJ5E 5JHDD 4F33B 1AXTH 4UT9L 4ZUSB 2Z8VC 3UTSD 1MHHB 4O2FB 3MLUH 1MREH 5FK9A 3EDDA 5DI8A 1KCLA 1FAIL 2ZOLA 2GTWA 5DF0A 1C1EH 4D9RD 4I3RL 3W0WE 1OF2A 3RL2A 3M17A 3C5ZC 1QR1A 2CR6A 4KK8D 1N26A 3EJZD 1IC1A 1Y6MR 3HE6D 4R4FL 4O5LH 4TVPD 5LAXA 5JTWA 4JKPH 1Q0XL 3F8UB 2V5TA 3QEQA 1R3JA 2XTJB 2DQUL 3IU3A 2HT2D 3SGEI 4J4PC 3LKQB 4WEUD 3KPLB 3H0TB 5ALBL 2BVQB 3H2WA 4LU5L 1BBDH 5J11C 3QEUA 15C8L 2EDWA 3BGFC 1W0VA 2J88L 3UPAA 4W68A 3VD9A 3UTTB 3KR3L 1B6UA 1M71B 4J3VA 1DDHA 3DRQA 4HKBA 5FUZH 5LXGL 1RJZA 3MO1A 2MCPH 3B5TA 4I0PA 5ILTH 1CFVH 1E4WH 4HKZA 1MCFA 5GS0C 2QSQA 1RZ8B 1WVZA 3HG1E 1YQ2A 1BZ9B 4LRNL 4BUHA 3WS3B 1QPXA 1T1ZA 4OB5L 1IAMA 5D9SB 4HWBA 4JDZA 1P4IL 2Z93B 5D5MB 1I8MA 5EUKA 2VQUA 5D6CB 4EDWL 2FX9L 4M6AA 3HAEH 4HLZG 3AB0C 4MA1C 4U1SB 4V2BA 3TBVA 4ODHH 4GLRH 1U2CA 1LEGB 1QHPA 1M7XA 4NWUH 4J8RB 5EO0B 1D6EB 1SM3L 4J4PA 2JJUA 4PJAE 5CSZB 3EYSH 5D7IB 4G6JH 2O5XH 3QDGE 4WFFD 3IS0X 5E2WL 4X7FC 1JF5A 1I1AA 5E6YA 2HVJB 4KZDL 4LSTL 3HE6B 4JM4L 4AEHH 1S7QA 4LKCB 2P8PA 2NX5A 4KRLB 5FCSH 2IPKB 5GIRA 2ICCA 2BP3A 3QDMB 1BOGB 1FJ1A 4G8GD 3VG9B 1T22A 5HI4D 1ZWIB 5CJOH 4XHQA 5AYUH 4OQTH 3V5DB 1OL0A 1H8NA 1XGPB 1MFAH 1OM3L 1RJZB 4RIRB 4ODHL 3SDCD 1CICC 2HKFL 5E5UB 1NSNL 1QBLL 4EXPX 2EO9A 5HYFA 3GI9L 2JCCB 2NY4D 2W9EH 1ZE3C 3VFSB 4R97B 1T0NA 2ZG2A 2X4TA 3BRGC 3MRJB 3B3IB 1F42A 4ORGB 1ZLUH 3TVMC 4UOW1 4OZ4B 3O3EB 1SJHA 1P1ZB 4G9FB 8FABB 4Z7QE 5F3HA 4ZAKB 4DVRH 3KPMB 5FOJA 4UIMA 4HFWB 1JPSH 4Y88A 1U8IA 3AXLB 3HPLA 3RA7H 4E0RB 5KS9B 4U0RC 1YNLL 4AMKL 1BD2E 3MROA 2IPUK 1T3FA 4L4TE 2IPUG 2QQKH 2LTQB 5JXAL 3GM0A 5ESVB 3O0RH 2IFGA 5IB2B 5T3ZD 2J6EA 4HCRH 6CGTA 4HIXL 1MY5A 5DJZB 4Y2DD 4XGZB 5A3IC 2X6MA 1YPZE 3DSNA 1XGPA 4JFFE 4KUZH 5DQDL 2R9HD 3O6MH 1BJ1J 3TIDB 1FNGA 3RDTB 1AGFA 3PGDA 1ND0B 3VXME 4NKQB 2YUZA 3KPNA 5K93A 5C0JA 1I3RA 1CD8A 3D0VB 4WCYL 3QRFM 2P5WA 4U6HA 3MRCA 5EBMA 1MJJA 3G9VA 4F9PA 3CMGA 3F5WA 1KPUA 2FWOA 1ONQA 2V2WB 1MI5D 1W0WB 2XKSA 3NN8B 3WIHH 3GSRB 4I0CC 5IOPB 5GGTL 5GGVY 2C3WA 1WBYA 2PN5A 5DD5H 1SBSL 5D4QA 4L8DA 3C09C 3T1FA 3OKKB 1BX2B 3C60A 2A1WL 4XPBH 4J6RH 2WMPA 2DL9A 4PY8I 1YMMD 3QDHA 1C16B 3BRFA 2N1KA 5EOQL 2BOBB 3I2CH 4U6XA 2Q1EA 3BHBB 4KRPB 3SN6N 3ROOB 5IKCB 5I1HL 3WBDA 3CDGB 4R0LC 1LNUB 1TJGH 4JKPL 5F96H 5MEOA 4I3SH 4IHOA 3QUKA 3VRJA 4OUUB 3RL1A 2P24B 2YD6A 1VKXB 4TUJA 5C08E 2A0LD 2HFEB 1FNAA 2NZ9D 4F7PB 4JFHE 1NBZB 3B2UD 5DWUL 1NBQA 4KTDH 3H9YA 1JWSA 1H15A 1FO0L 5E8EB 4QHKI 3L95A 2KZ1B 2DI8A 5F3HB 5GZOC 1G7LB 5K9KB 4O02H 2X4OA 2FATL 2CK0H 4YHNA 2CGRL 4R6UA 5DMGD 1MPAL 4HG4K 5H35B 3ZKMD 1F4WL 1RZJC 1EHNA 3W81A 3UO1H 4RMUA 2LU7A 4XB8A 3MXVH 2HMID 5TDPA 3RWIB 3B5HA 3SDAC 3KPQB 3WKNA 2Z92B 5DUPL 4MXQD 4X4ME 1C16A 5FYKU 4QNPF 1WBZA 2FX8H 1OGAD 1K8IA 1YEJL 3NCYP 3RVTC 3TZVB 5JXEA 2Z31D 2NR6C 2EEBA 2XT1B 4LSQL 1A5FL 1LNUA 2Q7NA 4X7CC 3CFCH 1BIIB 3GKZA 4ZFZA 3C5SA 3PQYA 4JFDB 4K07A 5IV2A 1RHHB 1PSKL 1TJIH 4PGBB 4QRPD 2MMXA 2YD9A 3DUSB 3PV7A 4RMQA 3T0DA 1OD9A 5I9QC 4PJAB 1EEYA 3TJEL 3ZE2E 4PJIF 2C4XA 3PQYB 4P4KA 3CSBA 5DK2B 4V1DA 5CJOL 1W8OA 3O41A 2FCBA 4Y4HA 4PLKC 4TVPE 5DS8A 4BZ2H 3OG4B 1U8QA 1U8NA 3DOSA 3S37H 5MEPB 3MRDA 2DF3A 1T1ZB 2DMBA 4OCRH 4PJIA 3SQOL 3CVHH 4NHUB 3O2DH 4OF0A 5GRVK 2VDRL 3GSUB 3N1GC 2YMXH 5JORB 1KTLB 3U36A 4XVUD 4FXGB 1R24B 3VFUA 1ES0A 1RUAL 4Y5VB 3G9AB 4NO5B 3HC4H 2VMFA 3BQUB 4JFDD 3SO3B 5FA4A 5KS9F 1AQKL 1Y6NR 2MTPA 5D7KE 4JO2L 3M8OL 4JQXC 2VE6B 5CZKA 1A64A 1CS6A 3DVFA 5M95B 1FNEA 1FH5H 3B83A 2Y25A 4YHNB 4OZGF 4HC1L 4MJID 5FGSA 5SWSE 4ZFOB 3ARBC 4M3JA 3PWUB 5IVXE 1TPXC 2WQ8A 1EH9A 1EUUA 5C0GB 1OQXA 3KPMA 4POZC 4BKLB 4KDWA 1Q9KB 4QYOB 5LGHL 2C3GA 5TE4L 5IIEA 4MXWL 4J3XA 3VFRA 1ZA3B 3TWCH 5FO7B 4XH2A 1FZJB 2HFFA 1ZGLA 1N8ZB 4MZ3A 4C56D 3QP3A 4PRHD 4JRYA 5F6HJ 3DMMB 1SBBA 4KDTC 3UJTL 5KSVB 5SWSD 4UTAL 1GAFH 2A6KB 2CDEB 4PJ8C 4EDXB 1ZHNB 5E8NA 4LCWA 1JPGA 2WIIB 4PJ7E 1MQKH 1XCTA 5E2UH 2X4RB 3QNYA 1HZHL 2FB4L 3GSRA 2I07B 3HUJB 1INDH 2M26A 3KPRE 4PLJD 4C4KO 5EZOL 4HS8H 1T5WB 5J1TC 2EDXA 3FT3A 4HJGA 1JZ4A 2BY2A 4JFFD 2AK4D 2ESVE 3CFKB 3D5OF 5TQ2H 1BBJA 2FH8A 1VEMA 3NZHL 4PJDF 4HF5L 4YE4H 1KEGH 1AHWB 4NKDA 1JGVL 4EI5A 1QHOA 4XWGL 5C2BL 2XA3A 2FEEL 4KQ4L 1ZAGA 5D7LB 1CFNA 3GJFB 3G6AA 3F58L 5EUKB 1MQ8A 4PBWD 5D1QB 3OG6B 3ARGB 4QRUB 1JNNL 1NC2D 4KVNH 4GKZA 5FV1L 5DVOA 3RWIA 4OLZL 2QR0B 1JN6A 1CDJA 2ERJC 2VXSH 4NN5C 1H8SA 3BPOC 1F8TL 4KGJA 3G08A 3H42H 1AIFA 5EOTA 3IYLW 3KNBA 4HBCL 3DX7B 3T0VA 3BD5A 4YHOL 2E9WA 4KXZH 1WZMA 4XP4L 1IAOA 4PTUB 4FA8A 3EJYC 1NDGB 4X4XA 1YMHB 1OT2A 1X4YA 4FMKA 1HE7A 3MRHB 4HWEH 1PJ9A 1J88A 5GGQH 4FP8H 4JPVL 4XNZC 5MENB 3GKWL 4XBEH 5I0DA 2G75A 1BVKA 3OHXB 4O2FA 4MSWA 5A2FA 3FT2A 3RAJH 4UILH 1MHPL 4D8PA 4OKVA 5EN2B 2VERN 3G04B 4JZOA 4F7CB 2P1YA 3PL6A 4XCNA 2AEQH 3BKMH 1DQQB 1QSFE 5ALCL 3RL2B 3WIIL 2YXMA 5FYKH 1RZJL 4J3SA 4R7DA 5C6TL 4PJIB 5IJVA 1JN6B 1UYWL 1KNOA 4UAOC 3T2NL 4I18B 4FOMA 1N6VA 3GMQA 4JFHD 4DWHA 5E4EB 3FONB 1AD9A 3DHJA 3MUGA 3SDCB 1KIRA 1OAXL 4P4KB 5DK2A 4JFEB 5FYKE 4X4YB 3TBWA 4DQOH 1H0DB 3GMPA 5B39G 1VEOA 3TN0B 4CW1B 1AJ7H 5EO9B 1FLRH 4LSVL 4PJCE 1IC5L 1FFNB 5CEXB 1YMME 4AM0A 5L2KD 4LLMB 3Q1SH 4X4YA 1CFTA 3JTTA 1T03H 3HMWL 1BIIA 4ZFZB 5E5MA 3OMZA 3WN5C 1KTKE 4M1CC 3PIQA 2XKNA 1J18A 4DZBA 5I16A 1OTUC 1SEBB 5F1OB 2Q76B 4OJFL 2J88H 1C12A 2ZCKH 3NFSL 4UAOB 3ZKSD 4GT7A 3RWGA 4PB9H 1KG0A 4X8JB 2VZOA 3TO4C 5F9DC 2MKWA 1FL5B 1KN2H 3G5XA 3MBXH 4OCSH 3TT3L 1R5WB 3DYOA 1G9EA 2DQUH 2ORBH 4Y19E 4RCAA 3DURB 2F54E 3E8UH 1A7QL 3ZSSA 4HXBL 3HFML 1QFWI 4WGVB 3GRWH 1I9IH 4K8RL 5HY9A 2ATPA 3FAWA 4X0KB 4RGNB 1E4XI 4L9LA 3GJEB 2XFXA 1BQLH 4GMTL 2MCPL 2RR3A 4S0SD 4C83A 3RWFB 5HGHB 5J56B 3VH8B 5CSBA 4B5EA 4G3YH 1CZ8L 3WNKA 1FNEB 1KB5H 2BXYA 2KH2B 3I75B 1EFXD 4ONGH 3QULA 1I7TB 3BD3A 1A6UH 1A6UL 2A83B 2CKNA 2H26B 2RB8A 2XTJE 3IF1A 3SPVA 3LB6D 2DI7A 3NIGE 3P9WB 4JY4B 4PRPA 2OR9H 2CSPA 1NFIA 4JHWL 1GOHA 5CGMA 3IFLH 2MHAB 4PJAF 1UWXH 2XNAB 3T08A 4DN3L 1GGBL 3N1PC 1KT2B 1MAML 2VR4A 3VXNB 3U46A 4AL8H 2E7MA 3MYZA 1N6QH 1T7VA 1WAAA 3O4OB 5MENE 4L3AA 3TBVB 3MZTA 3QNXA 2HH0L 3LHPL 4M6OH 5AG9A 4MHHI 3T77A 4Z7VF 1NMAH 4G8GE 1MH5A 5EBWA 4Y7MA 2GYSA 3EBAA 4ZS7L 5I2IB 1F6AA 3S88H 5CBAB 1EHXA 3DGCR 3I9GH 3ZYZA 5I8KH 1FL3A 3OKMA 4HS8L 5JPNA 2GSGB 3DV6A 1ZTXH 2EE6A 2WIIA 2W1NA 2IQAB 3KS0J 4HWBH 1T5XA 3QPQD 1Y18B 3GNMH 3C5SB 4JFDA 5CZVH 5EU4B 1T7YA 1SHMA 4WU5B 4FHBD 3GMRA 5T5FL 1HXMB 3RPIA 4KRPC 1CFQA 3PG2A 4GBXC 4QTIH 3SJVA 3T2PA 1XIWB 4DGYL 4YLQT 1IC4L 3IFOA 2BVQA 1T3FB 4HWZB 3WFCH 4NCC1 3IS1X 4IMLB 4XNUH 1AGBA 5DFVC 1G1YA 3SE8H 4GRLB 2QADC 3HG1D 3WD5L 4ZAKA 4ONFL 5BW7A 1FQ9C 3VWKB 1UB5A 1D9KC 5EBLA 2HA1A 3E3QE 3RIFK 1QR1B 2DQTL 3X11B 3O6FB 1NEZG 3TBSA 3C9NA 4NQXA 5KVGH 4KTYA 3NBNA 3QUYC 5ICXB 4A2LA 5D72L 1PFCA 4KKBC 3LDBC 4NM4L 2OJZH 2GFBA 5J12C 4PJCF 1UB5B 3DO7A 4KZEH 3HI5H 1AO7E 1X4ZA 2A77L 5C09A 2L4OA 4NT6A 3RIAF 3VRJB 2DQFA 3B8YA 2HLAB 1AIFB 3FFCD 4F37K 4PJ7A 5ANMB 4AQ1B 4UILL 3RHWF 1HSBA 3TA3D 1LO3H 4N0CD 1JV5B 4WTWA 5IQ7L 2JELL 2DWDA 4KJQC 4YHPA 3BP7B 3LKPB 3OJMB 4NN6C 4XC1L 4BM7A 1A6ZB 2YK1L 2HKHH 1RULL 3VXQB 4GBXA 3QA3B 3RNQA 3VXUD 3CXHJ 5E03A 4APQA 2YBRA 5CIPH 2XTLA 2IAMD 2AXFB 4PGJA 1HK6A 3UTZB 3S9DB 1U6AL 5JHDE 4U1JA 2FEDD 5JW4N 2E9BA 3U7WL 1XFPA 4JFFB 3CSPA 2HJLB 4RGNE 4N0UB 1L7TH 2JJSC 3C6LC 5F3BB 1I7UB 5D5MA 5I1DB 1EX0A 1X6LA 3BPCB 3HNSH 3SQOH 4WO4B 2CRZA 3KDMB 1U91A 1QLEH 5TH2A 1MWAL 4XTRD 4LASH 1HSBB 2VTFA 4YHOH 3WIIH 4XVUC 3RTQA 3FB6A 3UXFA 2J3SA 4MJIA 1G9MC 4N0FB 1RY7B 4RNRA 3IFPB 4EDXA 3TEUA 1LO5B 4UIKH 2WWKO 1JGEA 1IGCL 3QIUB 3L3DA 4RMSA 5E94A 4JLRB 3PABA 4X7EC 3DMMD 4JN1H 5FOBB 1B6DA 3P9LA 5TDPB 5SWZE 3RZCB 1NC4B 3L7FB 3OR6B 1N5YH 4Y2OA 4BK5A 4JFOA 4X6BB 4IMKC 5IBTH 1I8IA 1G9MH 1BQHB 5HGBB 1G0XA 1CDCA 5GS2D 4E0RA 4I5BB 4YO0A 3QRGL 3HLAA 1NJ9A 4GW1B 1DANU 2VXTH 3W5NA 1NC2B 4P2QB 1DUYB 3U2SB 1QQDA 4ORGA 3H3PH 2OTWB 5IB3A 4PJBE 4LARH 3VFSA 2JB5H 1HEZA 5IB1A 1TQCC 1QLFA 5AEAA 3NCBB 2HFTA 2CDGB 5J13B 3QJHB 1BF8A 3SJVE 1YEFH 5FB8A 3A6CL 1EGJA 1NCNA 1OGTA 5D1ZD 4X7SH 3BZFB 1R3LB 3OF6D 4P48A 5C7XH 4KK5C 3MXWH 4GRWH 5C08B 2D4FA 3S88L 4GXVH 2Q20A 1A0QH 3O4LD 3I84A 2ADFL 2C