2OX5A

The soxyz complex of paracoccus pantotrophus
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
108
structure length
108
Chain Sequence
ADDAKPRVKVPSSAKAGETVTVKALISHKMESGQRKDADGKLIPRSIINRFTCELNGVNVVDVAIDPAVSTNPYFEFDAKVDAAGEFKFTWYDDDGSVYEDVKPIAVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SoxZ protein
publication title The SoxYZ Complex Carries Sulfur Cycle Intermediates on a Peptide Swinging Arm.
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Transport protein
total genus 19
structure length 108
sequence length 108
chains with identical sequence C, E, Z
ec nomenclature
pdb deposition date 2007-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08770 SoxZ Sulphur oxidation protein SoxZ
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ox5A00
1TENA 5FYKU 2ED8A 4HK3N 5FM5M 1DLHA 1YEDB 4G7YL 5HI3D 3DUUB 3VU2A 3GMNB 5DJZA 3VCLB 4WU7A 1FZMB 1DVFA 1Q9OA 4LCWB 1GHFL 4APQC 2J2ZA 1ZA6A 3OKDB 4HKJA 1E4XL 4HIXL 1UH2A 4WO4C 5D6CA 2VISB 1U8IB 3A67H 1IAKA 4RFNB 1J1PH 2ARJQ 2JIXA 1YYMH 3MRLB 5IWLA 2NY7L 1G7JA 1U9KA 2YD5A 3BDYH 4L9DA 4EUPB 3L3HB 3P4NA 4YPJA 4KRPD 1FGVH 2F74B 1CIUA 3AS3A 5FO7A 4R8WH 4M62L 4GQ9L 2BC4A 3GHBH 2G9HA 4QRTA 3VGDA 4IEFB 5EWIH 2AS5M 5D8JH 1Y6KR 1BX2A 2BSED 4LARL 1LO4L 1MCSA 2QSQA 2ZP0T 5HYJD 5JIPA 4G9FE 1WF5A 4M8QB 1P4LA 4QRQB 1CWVA 4S1SL 5F9OH 3T8XA 3RY6A 3KYMB 4PP2B 4QOKA 1DR9A 1RUPH 4L5FH 5KSVB 2X9XA 1YMMD 4ZPTB 3ILPB 3LY6A 1YPZF 2VH5L 4I48A 5MEPA 4X8JB 4DEPB 4BFIB 2R1YA 2QSTA 4OUOA 1ERNA 5EC2B 1KCKA 4M8VA 5F71A 2D03H 2G75B 5DRZB 1NGXA 5F96L 3MO1A 3FB5B 4H1LA 5IJKA 1MJJA 1QFWL 2V9QA 2F53D 5E2UH 2VLKD 4NRYA 1C1EH 1CFNA 1X5JA 3BXNA 2GCYB 1INQA 3GSQB 2VOTA 3ZLQC 4AG4H 1ZHLB 2P5WD 4KRPB 3KYOA 3WXVH 3FAWA 1T6VN 2Q6WA 3G6JE 3NFNA 3CX5K 3VXOB 4MNGB 3VXRA 4UIMA 4OZFG 1CGVA 1AP2A 1Q94B 1QO3A 2FH8A 2VQ1A 3PXJA 2DQHH 1EJOL 1L9MA 2J1KA 3VD3A 5HYJB 2IG2H 3L3JB 4ZFGH 4K9EH 4U6HA 2R1XA 1MLCA 1XF1A 3N1QC 3C60C 3QIBA 4AT6A 4JPIA 5HHOD 4MHHI 2BVPB 4CL7A 2BJML 2BVYA 2DM2A 4FQXA 4OUUB 3VXMD 1OP3H 1CD1A 5LG1A 1YMMB 1MHEB 5IHZB 4D0BB 5DK2A 4X6DE 2HLAA 1H3TA 2PTUA 1DBJL 1IAII 1NAMB 4DVBA 3NZHH 3QPXH 4XT1C 5SV4A 1XZ0B 5KVFH 3OHXB 3LKOB 4UNUA 3EYQD 4P4RB 2ZJSL 3WUZA 1L0QA 2F53B 4PJIF 3BP5B 2FX9L 3P73B 1VFUA 3K4DA 1NAKL 5BRZA 1CICA 1J0KA 4LNVA 5BVPH 4XPTH 1KIPA 5DD3H 3L3DA 1KELL 5DQDH 3SE8L 1T4KA 3KPRE 4RZCA 4KRLB 1OHQA 3U4BH 2IADB 2CJUL 3SDCA 1R3LA 5GRJH 1UM5L 3OB0H 2HJFA 1T1YB 4G43A 2EDQA 3VFTB 3B2UD 2FLRT 3OZ9H 4OIAA 2AK4E 1B6UA 1YECL 4HS8H 4X7CC 3FO2B 4YHNA 3WS3A 4JKMA 2GKIA 3QDMB 1KN2L 1JMZA 1K9TA 3KWWA 1YEKH 4J12A 3ULUC 4RSVA 4GG8B 1CE6A 3RX5A 3S5LA 3M17A 1Q9LB 1YA5A 3FQTA 4GG6A 1A22B 3VXMB 4LLYB 1H15A 5AG9A 2EIZA 3U1SH 4L3EE 4LPYA 5E95B 2FO1A 3EDFA 4U6VH 2DQIL 1I1CA 1JGVL 1LK3L 4Y4HD 3W39B 3RUGB 5J6GA 3I50H 1D5XA 4FQ1L 4P2RE 2QHRH 2XY2A 1NGZA 3RHWF 2PYED 4W4OA 5C3TA 1KCRH 2OXHA 3MYJB 3RL2A 4G6JL 1E27B 2I27N 5KW9H 3AB0B 3ARBD 3E6HB 2YPLD 4U1JA 1BIIB 3DTXB 3LN5B 1IGFH 4MVBD 5GS1B 3MJGX 1HNGA 4D0CA 5AWNH 1BD2D 1FIGH 4M7ZB 5KOMC 4XVTL 1FSKB 3RJDA 3FN9A 5F3HB 5F88B 1CFQB 1EMTL 1AE6L 2VSCA 3DVFA 4YHMH 2CIIA 2YUXA 2H3NB 4ZFZA 1CLZL 4L3AA 3BWAB 4K7PY 5J1SC 5F21B 4A2MA 3IXAB 1I7RA 4O51B 3TWCL 1CL7L 4HWZB 2HA1A 3JWDL 5D7IB 1CTNA 1ZWIB 3FMGL 1JTTA 3WDIA 4D9LL 2J3SA 4FFZL 1WIPA 1U3HD 1UM6L 3MRDA 4HBCL 2ZUQB 3EO0A 5GGSA 3TLRA 5D5MA 4JFFE 3S35X 1LO2L 3C09C 2VLRA 4FNLL 4PJDF 5IB2A 4GW1B 1BQHA 1XCQB 2N56A 5LAXA 5F7YC 1DBKL 4BH8B 5L0QC 3OPZL 4U7MA 2YPLB 4GQPH 5DC4B 2A77L 3MRFA 4L4TD 5TDNB 1B3JA 5C2BH 3EOBA 1QBLH 4OD2A 1FE8L 3BPNB 1W72H 1BD2B 4X4ME 4JDTH 4PG9B 1HN1A 5ICYB 3Q48A 4XPBH 1BLNA 4QHLB 1U91B 3BQUD 5FKAB 3HE7C 2FBJH 1K2DA 1VENA 4JFEB 5J6HB 1ZT7B 1KJ2L 2HRLA 5HHPB 2UY7A 3C2AL 2V7NA 1VADB 3L7FA 4LPTA 4MZ3A 1ZANL 4JQVA 1J9CT 2HFTA 43C9B 3HR5A 1FORH 1B9ZA 3ALWA 3IKCA 2EIBA 3HI1A 2J8UB 4K3DL 1DVFD 4HIEB 2X5PA 4WFFD 2B20A 4FQCL 2K7PA 3P11H 4G8GB 3RL1B 4U3CA 4HUVB 4OQTH 1WCBB 1YUHA 4E41E 4I18B 4PJGA 2VE6A 4GMSL 5EORH 2JIXD 4QRRA 2XA8H 1BBJB 1UH3A 1A9EB 1KEMH 4YXKH 3MLYL 4R4NC 1UB6A 1KTLA 2EIEA 1YY8B 5HY9B 2IPUG 3VFSB 1TTFA 1UJ3B 1KFAH 3NZ8B 4XBGB 4ZFFB 3NA4A 3DX7A 5J56B 4LDLB 3BQUB 2X1WL 2X4SA 1HSAB 3BESR 5ETUB 5JHDD 2FHBA 4DK3A 3TEUA 5B39B 5C0GB 3O6ML 3CAFA 4JRYB 4QOKD 4LF3A 4RWHA 5I1KL 1DLHB 4WW2F 5LWYH 4YE4H 5CEZL 3THMH 5DJZB 1RSFA 4WU7B 1G7PA 3BN3B 1DVFB 1Q9OB 5GZOD 3RAJL 1Y18A 2J5LB 1ZA6B 4AH2A 4HKJB 5D6CB 1RZFH 2X1QA 4J4PA 1IAKB 3NH7L 1FNAA 2JIXB 2XYCA 3KXFE 4MQXC 4XI5C 1S7WA 1G7JB 1YJDC 3DMMC 4P5TC 2HG5A 3P9MA 1NCAH 4HT1H 1J0HA 4Y0GA 5DMIH 4CDGC 3NFPA 3P4NB 3RQ3A 4U3HA 4WEMB 3W11D 4OM0H 4CGTA 2ZSWA 3DX6A 5FO7B 1PBYA 2BC4B 1IGYA 4PJIE 3HC3H 3VXRD 1E4JA 4H88H 2G9HB 2RR3A 4QRTB 5F8RC 2IGFL 1MAKA 3VFGH 1L0XA 1BX2B 3UTZA 3BN9C 3A67L 1T5WA 5FV1L 2NXZD 5JHDB 3BMVA 4HIIA 1J1PL 1P4LB 1YYML 3HI5H 1UWXH 1Z6JT 4LRNL 2VXTH 3T8XB 1R3HA 1WBYA 2EXWD 2EC9U 2VNCA 1LGVA 3QIBD 1Z9LA 2DLHA 3TT1H 4QOKB 2GTZA 3AREA 1JZ7A 2E3VA 4FQXD 1FGVL 4OF0A 5H2BA 4R8WL 3TFKD 3EYUL 4FABL 5DRWA 4I48B 4EIGB 5MEPB 2APVA 1RJLA 3GHBL 2NX5E 1TVDA 2R1YB 4DOHE 1A02N 5EWIL 1JWSA 1TXKA 3DVNA 5D8JL 2Q3AA 5IROC 1NGXB 4MNQE 3MO1B 1DBMH 4H1LB 4PB9L 5KANG 1MJJB 1U95A 5D1XA 4OV5A 5DHVA 3B6SA 4NRYB 5F9OL 1CFNB 2AJVH 5BRZD 1CICD 4PGBA 3BXNB 2WLZA 1INQB 1P84J 4KQ4H 1FDLH 1RUPL 2XKNA 3V5HA 3KYOB 2MKWA 4DGIH 4NKDA 5F6HI 3ESUF 5E5UB 5F9JA 2Q76A 2Q6WB 3SDCD 3MMEA 3NFNB 1A6WH 3VXRB 4WY7H 4UIMB 5ESAA 4UNVA 5HI4C 1AP2B 4OF7A 1QO3B 3V6OE 4OCXL 2D03L 2VQ1B 1DP0A 4GKNA 5JUEH 3LPGA 4HKXA 1F4XH 1BBDH 5IB5A 3TBSA 5FEBA 2NXZB 4GKZA 4C57C 5E2UL 5HGAA 1YC7A 4U6HB 1IGML 2R1XB 4DKAA 5B38A 4PJ8A 2AERT 2JJVA 1BECA 4AT6B 3QIBB 4AG4L 4JPIB 2E9BA 3IDNA 1QLFA 3T0ED 3WXVL 4FQXB 1F45A 1CD1B 3BX7C 3RKPA 1Q0XH 4BZ2H 1ACZA 5DK2B 2HLAB 1OOAA 4AIOA 4DVBB 2FBOJ 5CHNA 2DQHL 5IG7A 4PJFF 2NNAA 5IJVA 4ZFGL 1JP5A 1PSKL 4APQA 3PWLA 5I1IL 4WO4A 4KZEH 4PJHA 5BRZB 1CICB 5J0BA 1NGWA 1M7DA 2X1PA 1KIPB 2XZCH 2MHAA 3VFUA 4Q74A 3L3DB 3VRIA 2BHYA 1J0JA 4Y2DD 1T4KB 4RZCB 4RWYH 2R29H 4PD4J 3SDCB 2GJJA 1R3LB 4OKDA 5H94A 2R39A 1BFTA 2HJFB 4PJDE 4G43B 4JFDA 3QPXL 4YWGL 4HPOH 4J3UA 5I1HL 1N4XH 5KVFL 2HTLD 4YHNB 3WS3B 3VRJA 5IT2H 2XI9A 3AM8C 5C0BE 1A7NH 1FYHB 4C56E 5I66A 3F7YA 3KWWB 4DAGH 1OM3L 5BVPL 4Q9BA 2IH1A 1CE6B 1MEXH 3S5LB 3M17B 3FQTB 5DQDL 3S9DB 2ZCLL 4GG6B 1EGJH 4I3SH 3U4BL 1QR1A 1H15B 2EIZB 5D7KD 3UAJD 3DHJA 3W9DA 5HI5D 1OAYH 4JY4A 2CUIA 5F9WB 2IPKA 3OKOA 1P1ZA 4HS8L 4PJBF 1JZ8A 4NNPL 5J6GB 1YNLH 1D5XB 1L6XA 4UT9H 1HK6A 1NGZB 5T3ZL 1OAQH 5IESH 2EE2A 1YEKL 4KJWD 4Z7UA 5ANME 3RL2B 5TPWH 3RA7H 2FZ3A 1X4ZA 1YMHA 5CEZE 4PG2C 3TM6A 4U1JB 3ZO0A 3PV7A 3P0YL 1HKFA 1Z0MA 3ZKXC 4D0CB 1FNHA 4QXGH 4AZ8A 2DKSA 3IS0X 5DFWH 4M7LT 1RAMA 1GGCH 1LEIA 2A9NL 4OZHA 3I50L 1JUFB 2OZ4A 1MQKL 2D0GA 2QHRL 3SJVE 3UTOA 3RWDA 1WISA 3ILQD 3QRGL 4EI5C 4HDIA 3BPOC 2CIIB 4ZFZB 3IAPA 2EDNA 4OD1L 5D2NC 1NCUA 2P46B 1I7RB 3ARDC 5D7SH 3I3EA 3C60A 1CFVH 4NUGH 1IGFL 4BUHA 1M71A 5AWNL 3ALXA 2LAGB 2UZIH 1M1SA 3D39E 4NZJA 4ZMAT 2WQ8A 1CGTA 5C6PB 3MRDB 5GGSB 3EO0B 3T0AA 1ZAGA 5D5MB 3TJHC 2FDBP 3S6CA 3SOBH 2AEPH 2VLRB 5IB2B 1BQHB 4BJLA 5LAXB 4QRRD 3MRNA 3QT2A 5F6IB 1NFKA 4TTDD 4IRZH 2ESVE 4YK4C 2AEIT 1NQBA 1S7UA 3A6OA 1FVEA 3MRFB 4ZNEE 3EOBB 3ZYZA 1OY3B 4MX7A 2BVQA 4OD2B 1ZT4A 2WW8A 3QDGE 4M5ZH 3FB7A 5CIPA 5F8QC 1BLNB 3ARPA 3QEGH 5BQ7A 1A6UL 2EH7H 1K2DB 4LPCA 2UUDK 5FUZH 3SE3C 3VD5A 3BMWA 4KK6C 2VDLH 1G9NH 3L5IA 2HWZH 1KPVA 4MXVF 2V7NB 5D2LA 3L7FB 3VWJC 3Q1SH 2PYFA 2WP3O 3CSYA 1KCVH 1LILA 3DXAE 2YA0A 1EBAA 5J11B 5C2BL 3HR5B 1P7QA 3IKCB 3PHOA 4NGHH 1W72L 1CD0A 4JDTL 3HI1B 4XPBL 4XCNA 1IKFL 1KJVA 5HGBA 2EDXA 1X4YA 2FNBA 3TJEH 2ZCKH 1YUHB 4BELD 4PJGB 3KVQA 2VE6B 4QRRB 1QBBA 5I0ZA 2VZVA 3UZEA 1NMCB 3GSNA 2GJZA 4HC1L 4ODXA 1FVDA 1FORL 1UB6B 1KTLB 4PV9A 4RIRA 4OM1H 2O5XH 3PQYA 3DX7B 5EBGA 4CU7A 3N1PC 1DQML 1UA6H 5D1QC 2X4SB 3RX7A 2ZWLT 5ESVA 5EORL 2XA8L 4ELKA 4XAWH 3WNLA 3IB4A 2Z8WC 4K8RC 4OLEA 2A6KA 2BNRA 4YXKL 4LF3B 4MS8D 1ZEAH 3OG4B 3ARED 3ARGC 5KSBF 2Y25A 2ZSVA 4HXBL 3OG6B 1KFAL 4R4FH 4TVPE 5J13C 2OS7A 1MWAL 1G7PB 3HB3D 4RMVA 1J12A 1SVCP 4DQOH 1Y18B 3K4AA 1C12A 4AH2B 4LIQE 2BMKA 3EO1A 1ZV5A 2OJZH 3HPLA 5DVMA 4HFUH 5D1XD 4JFOB 2XZZA 4HLZH 4NWTH 4YC2C 2HJLA 1DFBH 1QSVA 1S7WB 3RIFF 43CAA 2HG5B 3HG1E 3P9MB 2VDNH 1IAIM 2Y06H 3NFPB 4ZD3H 3QG7H 2EE6A 3IDUA 2ORBH 4F7MA 5LWYL 1HHJA 2ZSWB 3DX6B 4YE4L 3THML 3CMOH 5I6XB 2HRPH 3NTCH 2BZDA 1IGYB 5A40E 5T3ZE 5D9SA 5LCVH 5I75B 4QXTA 3UTZB 4FFVC 1L6ZA 1FYTE 1RZFL 1X5XA 1T5WB 3HE7A 4HIIB 3BPCA 3LHPH 2DQEH 3OSKA 1GJIA 4U4BA 1IGCH 2VN4A 1WICA 1R3HB 4PJ8D 4ZG1A 4HT1L 1NCAL 2X6MA 3QRFM 2GTZB 1SEQH 3AREB 3RKDC 4OM0L 5H2BB 4KROC 4ZUSA 2EDHA 2DI9A 2OTWA 5DRWB 3D1MC 1S7RA 2I26N 1RJLB 3HC3L 1G7MA 1UXSA 1JWSB 5GGRA 3DVNB 3VFGL 4JY6A 4K2UH 4BQ8A 3MFGB 2NW3A 5DDHA 1MH5A 3DOSA 1U95B 2JCCF 5D1XB 4APQD 4JFHD 4OV5B 3HUJA 3TV3H 5DHVB 3B6SB 3D0LA 4NNYA 3O2DA 2Q20A 3CH1A 4DVRL 3Q5YA 4PGBB 1ITBB 3TT1L 4HXAL 4L8BA 2XKNB 3V5HB 2RJMA 4PJBE 4NKDB 4V1DA 5F9JB 2Q76B 4F7CA 3MMEB 3H7BA 5ESAB 4JFDD 1IVLA 4GKNB 2C9AA 1DBML 4GXVH 4HKXB 5IB5B 2YSSA 2X1OA 4RAVA 3TBSB 4YDLC 4GKZB 4N0UA 3RPIA 5HGAB 2AJVL 4KGJA 2AGJH 5B38B 3D2UA 4PJ8B 5IBUB 4KQ4L 1JNHA 3IDNB 4O00A 1QLFB 3OAUH 5HTSA 5C8JA 2XTLA 1A6WL 4KVNL 1W8NA 4WY7L 3U36A 2MWCA 4M3JA 2LQRA 5KAQF 3K3QA 1WEJH 4JREC 5CHNB 5DVLA 5IG7B 5GS0C 4NQUA 3NN8A 1BBDL 1CDJA 2NNAB 5AG8A 5IJVB 1DDHA 4APQB 3PWLB 3OWEA 3R0MA 1OTSC 2A9MH 2CSPA 4WO4B 4PJHB 1NGWB 5IV2A 1M7DB 3VFUB 3HZMA 2MHAB 4A6YH 1SEBA 2IMNA 1OB1A 3VRIB 3WIHA 5E24E 3DMMA 4RGOH 1XF5A 1N0LA 4BZ2L 5SX4I 1RHFA 1YEGH 3L5HA 2SEBA 2XXCB 1UZ6F 4WTZG 4JFDB 4AEIH 2GUOA 4MA1C 1MFAL 2UWEF 2R2EA 3VRJB 4KZEL 3GKWH 4NT6A 4ORZC 3F7YB 4HMDA 5I66B 2XZCL 2IH1B 1KYOJ 2XQBH 1D3CA 2YUWA 1WAAA 4RWYL 2R29L 5E8EA 1KXQE 1QR1B 1X3DA 1MSPA 5DEFA 1IAIH 4EOWL 5D7LD 3W9DB 1JPTL 4QRSA 4JY4B 2H45A 4NN6C 5A3IC 5FHAH 4HPOL 4MXVE 2IPKB 5GSVA 3OKOB 1P1ZB 5JQ6H 4B7IA 4PY8J 3IU3A 4WFEE 5IROA 3RWEA 5IT2L 4KUCF 2PN5A 3D5OF 1F58L 1A7NL 4DAGL 4Z7UB 4WNQA 3IFOA 1MEXL 3UTTD 4WI9A 3C8HA 2FZ3B 3IFNH 3T3PF 1YMHB 4I3SL 4HUUA 3FT3A 3K81A 1AXIB 4IDJH 2OK0H 1OAYL 3L3KA 4EVNA 5F7UA 2G5RA 5GGQL 1YEIH 3P0VH 1ZOXA 1AIFA 4RISL 4OZHB 4P5KA 1DSFL 1AGEA 1K8IB 3RWDB 1OAQL 4HDIB 5IESL 3EDKA 1B0GA 1IL1A 3QHZH 3FQNA 1T22A 2R0KH 5TPWL 3GKZA 2YPKA 1W2KT 4LSRH 5JQHC 4LPWA 3ULUD 1A7OH 1CDGA 1PZ5A 3NMEA 3HCVA 3C60B 3WDJA 1GRWA 2X4QA 1P7QD 1M71B 3SDDC 1UZ8A 1I8MA 1SJVA 4N8CL 2IC2A 3FZUC 4QXGL 5DJYA 3KHOA 1KXTB 2JELL 5CEXA 5KSBE 2CKBL 5J57B 2DQJH 2GSGA 3T65A 3MRNB 5E6IC 5EPMA 1RURH 5DMKA 2OM5A 5C09A 3PIQA 2X89D 3BJLA 3NGBC 3C6SA 1S7UB 4Y5VC 2DTSA 4MX7B 2BVQB 1FL3A 2UZIL 1ZT4B 4GMTH 3QFDA 3FB7B 5CIPB 1N5YL 3ROLA 1JHLL 5BQ7B 1G0DA 4F7TB 4LSQH 3C6LD 3EJZC 2AEPL 4PRHD 1KPVB 4X0KA 1JV5A 5D2LB 3RGHA 2C1OA 4IRZL 3ZE1E 4QF1A 4KJQC 2PYFB 3CSYB 4UV7H 3SCMC 2BNRD 3GRWH 5DUPH 5L88H 4J3XA 1P7QB 3QA3A 3PHOB 3OGOE 4JM2F 1JGDA 4ETYA 4M5ZL 1VPOH 4XCNB 1FFRA 4YAQA 1KJVB 1YEJH 1RPQA 5HGBB 2EH7L 4I5BA 3CFCH 4LSSH 5FUZL 5ABDE 4C55A 1Y6NR 5CILL 3JBG7 3ZKNC 2VDLL 1G9NL 2HWZL 2OI9C 4LLVA 1BZ7A 3MCKA 1JNLH 3GB7A 3Q1SL 3GSNB 3T2NH 2GJZB 4ODXB 1FVDB 1SBBA 4OAWA 3ZL4H 2YXFA 4NGHL 4PG2A 4PV9B 4RIRB 2P24A 2D9QB 4RGMC 3PQYB 2JCCE 2AJSL 4UINH 3FCTA 1SJXA 3TJEL 2ZCKL 3Q6GH 2Y4SA 5BZWA 3HE7D 2F53E 5ESVB 4AIXA 4MQSB 4ELKB 4EI5A 2VLKE 1PKOA 5F1KC 1JPST 5EOTA 4PLJC 2A6KB 2BNRB 4PYGA 3TIDA 5D2NA 2P5WE 2VRAA 4OM1L 3ARDA 2O5XL 3RVWC 2ZSVB 3WNOA 5C0EA 1MCRA 5JZ7D 2VXVH 2DLIA 3SKJL 2B7DT 1BJ1J 3CK0L 1UA6L 1XIWC 1FAIL 3H9HA 4LP5A 4F58H 2BFVH 1RFDH 1C12B 5SWZE 4UQ2A 2BMKB 3EO1B 3FQUA 3N9GH 3HPLB 4LCUA 1AO7E 4HIJA 4XAWL 2VO5A 2HJLB 5DR5H 3C09B 4BKLA 1M6OA 3DYPA 4GFTB 5HHOE 5FECA 5L0QB 5FF6A 1TZGH 1IM9A 2MNUA 2YXMA 1RIUH 4NZUL 4F7MB 1HXYA 4V1DD 1HHJB 4R4FL 1XEDA 4R4ND 3QNXA 5GISH 3EKCA 3MGTA 3QH3B 2DOCA 5D9SB 1B0RA 4DQOL 4QXTB 3HE7B 3OKEA 4HFUL 3SE3A 3BPCB 4NWTL 4FZEH 3I6KA 2XWBA 4ZQKA 1QR4A 4Z9KB 4PRIA 1FG9C 2VDNL 1IBGH 1UZ6E 1W0VA 4ZD3L 3QG7L 3IRZA 3VWJA 4FQJL 2E9JA 4YR6A 2ORBL 5I8KH 5DHVH 4H8WL 4ZUSB 3CMOL 2OTWB 3S8WA 2HRPL 2QBWA 1S7RB 1WC7A 3MXWH 1G7MB 1UXSB 2R0WH 3BD3A 5GGRB 5LCVL 4I8DA 2AK1H 2K7QA 1C08A 4OCSL 3MCLH 4IRJC 4JY6B 4NQCA 3GHEL 2NW3B 3WHE0 5DDHB 1MH5B 5IW1A 1A7BA 3LHPL 4JN2B 2DQEL 3HUJB 1IGCL 1P7KA 5TQ0H 5HDQL 3D0LB 4NNYB 3CH1B 2PCPA 2VLME 3NFSH 3A6CH 4MQXD 4L8BB 2F9BT 1AD9A 3DMMD 4P5TD 1U8MA 4V1DB 4F7CB 4PJAA 2DLFH 2AXJA 4GW5A 1HKLL 3H7BB 2H1PH 2OTPA 4I0PC 4IIQC 4WIQA 4K2UL 3QUXC 1QPXA 4NBXB 4HUKB 2YSSB 4POUB 3MBEC 4RAVB 2X9WA 5D1QA 3BZ4B 3RPIB 2PYEE 4N0UB 3TV3L 3BI9X 3TP4A 1GGIH 3S34H 3BN9D 5I1AA 4F33A 4MJIA 3DI2B 3D2UB 4N0FA 4PJEA 4QHKJ 5CJXC 5EB9A 3KPSD 4Z7WF 3HZYA 4ZOCA 5C8JB 4YHZH 3MTRA 4YPGA 3U36B 3JWDC 4ZXBD 3NN8B 4OQ1A 4GXVL 1EJ6A 1MHCA 3GZKA 4FS0A 1DDHB 4QWWC 1JNNH 4RAUA 2AGJL 5HYSA 1WCQA 4OF5A 4FQQA 1WBZA 5IV2B 4ENEC 2W9LA 3HZMB 1SEBB 3WKNA 5IMOA 3V6OC 1OB1B 2AJYH 3DMMB 3OAUL 2NY0C 5EBLA 1V3KA 1XF5B 2J6EA 2SEBB 4YFLF 2NTFA 1WEJL 3PWPA 2GUOB 2B2XH 4OLYH 3X3FH 3R1GH 2R2EB 5HI4D 4NHUA 3LSOA 5GGVY 4GRWF 4LLQA 2EIDA 3E8UH 2A9ML 4F3FA 1MCKA 1T0MA 4NT6B 3LKSA 3MBXH 5E7BA 4A6YL 3BRGC 1YN6A 4M7KH 4ERSH 3JWNC 4JO1H 1TZHA 5GGTA 4RGOL 4ONFL 4L4TE 5E8EB 5FGCB 2EICA 1JGUH 5DEFB 3LEYH 1S7QA 2VZTA 4QRSB 4AEIL 1K4DA 1GH7A 5GSVB 3JV4A 2AQ1A 5DJ6A 5MI0C 3ARTA 3IU3B 4MLIA 1KCLA 3G5VA 3RWEB 4JGMA 3GKWL 1NBVH 1ZT1A 4WNQB 3IFOB 4P57A 2XQBL 1OSPH 5C09D 1MCFA 4HUUB 1KSRA 3FT3B 3V4VH 4I2XE 1KC5H 5AUMA 1MF2H 3C9NA 4X7FC 1CQYA 3L3KB 4EVNB 1AGFA 4G9FA 4G6ML 1AIFB 4WFFE 4BK5A 5JQ6L 4P5KB 5DUBA 4P99A 1AGEB 2XIDA 1NKOA 3QZWA 5KG9A 1B0GB 1IL1B 3FQNB 1T22B 3UZQA 2HMIC 3GMLA 2YPKB 2DIBA 3IFNL 4CVXA 2BRQA 3TYFA 4GRMA 1PZ5B 3HCVB 2EC9T 2AEQH 1QRKA 4N0YL 2X4QB 5F89A 2QHLA 1XGQA 1F4AA 5FAAA 1UZ8B 4XPGH 1I8MB 2OK0L 4NIKB 5DJYB 1OTTC 3P0VL 2AJ3A 3MACH 5CEXB 1GZQA 4DWHA 1CR9L 4Z78A 1BF8A 1R5WA 2DI8A 5JHDE 2QR0A 4GRLD 2GSGB 3T65B 1T7VA 5EPMB 5DMKB 3G6JA 2AXHA 1A7OL 5C09B 3PIQB 2VR5A 3C6SB 2DAVA 2X10A 3BE1H 1FL3B 4WI5A 1NDMA 3ULUH 3BYYA 3QFDB 2P49B 3MRIA 4U3XA 5CEYA 3S7GA 4LOUD 1IT9L 3ROLB 2YA2A 4MD4A 5J06A 4ODVH 5EH1A 3GMRA 2NY3D 4X0KB 4BA8A 1NMBL 1BAFL 1CIDA 1JV5B 1RURL 5HDBF 2DJ4A 4FTVD 2C1OB 3S3PA 4QF1B 4X6DA 1NEUA 4BYHA 5FB8A 4Q97A 1WTLA 5EA0L 4NM8H 3FQWA 1R3IL 2HKFH 4X4YA 3QA3B 5D96C 2DM7A 1JGDB 4GMTL 4O2EA 2ICWI 4XVJH 5GQBA 3QHFH 3T1WA 4OF6A 4XMKH 4EDWH 4YAQB 3MRBB 2WINA 3F58L 4JGJA 3TH4T 1E4XI 1CCZA 2FEDD 4I5BB 4OZGF 1C5BH 3QG6A 4LSQL 3GJFK 3CNKA 5CJOH 3UC0H 3KPRA 1BZ7B 3MCKB 4M4PA 5F7KC 3TJHD 4JEGB 3GB7B 4UV7L 1TCRA 3GRWL 1T7ZA 5JW4M 2ZUSA 3RBSA 1W0WA 5L88L 4OAWB 2AK4A 2LV4A 2P24B 4ZUUA 2JE8A 2X4OA 4YHYC 4KPHH 1VPOL 5E8DH 4LHJB 4EQ2A 3O6LH 3ZKXB 1YEJL 4HQQH 2DKMA 4LSSL 4UT7H 3QJHA 3FCTB 4JVUA 2NY6D 1H3GA 2NXYD 4K3JL 1WFUA 2BY0A 3GFUA 5BZWB 1FNGA 1UENA 3V0WH 2EC8A 4EI5B 4KK6D 1P84K 3ULVF 3BPOB 5EOTB 4PRID 4L3EA 1J05A 3TIDB 2PTTA 5D2NB 1PZUB 1F11A 4KDWA 1RUAL 3VWJD 3ZL4L 1DQQA 3ARDB 3HC0A 5C0NC 5C0EB 1HHKA 2Z93A 1I7UA 3MYZA 4P2RA 1A6AA 4HH8A 3SDDA 1L0YA 2X4RA 5ALBH 4UINL 3MUGA 3H9HB 5DF0A 5IMMA 1FZOA 3ABZA 4NQCD 4UQ2B 3UCRA 2DTMH 3FQUB 4LCUB 1JZ6A 2YD3A 1EBPA 4X4XA 4HIJB 4P2OC 5JOPD 2WIIA 4Z7WE 2ICWA 4BKLB 4YHOL 1M6OB 5FA3A 3BEVA 5FECB 5E6IA 1KV3A 4QNPF 3MLRH 4WEBH 1PD6A 5FF6B 3T0EE 3VXUE 1WWAX 4ZFOL 1IM9B 3OKNA 1A7PL 4N1CA 4DUVA 1HXYB 3HE6C 4YK4B 5TF1L 1RK0A 3VFOA 4F37K 4Y5VA 3V9FA 3QNXB 1RHHA 3UYPA 3MGTB 1B0RB 4F58L 3RZCC 2BFVL 1RFDL 2P8LA 1RVFH 3N9GL 4NC1E 1UKSA 4PLKC 3OKEB 5D1QD 4NQSA 3TN0D 3I6KB 2XWBB 1MFNA 4ZQKB 4MJID 1OAXL 4NN5C 4PRIB 2OMBA 4M02A 2G2RA 5DGQA 4NWUL 3IYLW 1W0VB 1TZGL 3VWJB 1YEHH 4PD4K 4YR6B 3SCMA 3S4SA 4WV1C 1LQSR 3ARGD 3LB6C 4Z7QE 4JFFA 3VD7A 5ICZA 5GISL 1LEGA 1WC7B 3RWFA 3D69A 4BSVA 3IDGA 3C5ZC 2FX8H 5MHSD 1C08B 2DLEA 4NQCB 4YXHH 5IW1B 7CGTA 4FZEL 3QI9C 4I13B 4S1RH 4WFGD 4R97C 5DLML 1U36A 1P7KB 5EZLA 4PY7A 1TPXC 1MREH 2PCPB 4PY8I 4Q7DA 5I8KL 1AD9B 4L3CA 4NCC1 3IS1X 5EUOF 5GRVK 3U7AA 1U8MB 2FSEA 2WNGA 2EDJA 3LMJH 2H8PA 4XP6H 4PJAB 2Y5EA 4GW5B 3BH9A 2R0WL 3MXWL 3PWPD 3O4LE 4MA7H 4XNZC 1F4YL 4S10A 4POYA 3MCLL 1K3ZA 1MIMH 4KKNA 1BFVH 2J88H 4G80A 5D5ME 5D1QB 3MGOA 2RQ8A 1I9RH 4FFVD 5I1AB 5TQ0L 3ZT7A 4DK6A 4F33B 4MJIB 3D6GA 4N0FB 3NFSL 4PJEB 4M6AA 3A6CL 4BFBD 1S3KH 2ATPA 5EOQH 2BOCA 1LE9A 3DUHA 3HZYB 1T7WA 1A2YA 2DLFL 3ARGB 5TQ2H 2BY3A 4GH7B 3RKDD 4TRPH 5FYJE 1EFXA 4YPGB 4NO0A 3ZYJA 4KROD 4J8RA 2WBJC 5L6YH 4HCRH 2Q87A 4E41A 1CGXA 2EYTA 5J13B 1MOEA 2HT2D 4GOSA 1MHCB 1XIWA 5IW6A 3MCG1 1GGIL 3QUMA 3VMPA 3WLBA 1VA9A 4RAUB 4TSCH 5HYSB 4PJ7E 4GUPA 4P3CL 4FQQB 1WBXA 4YC2B 5IMOB 4UT6H 3QYCA 5EBLB 5TFSH 3NIFE 4HD9A 6FABL 1OAKH 2NTFB 5SX5K 3PWPB 4IM8A 3GBMH 4ODHH 1RD6A 1X5HA 4NHUB 1PW3A 3LSOB 4YBQC 3UROR 4LLQB 5BJTA 1URLA 4F3FB 5IF0A 1T0MB 3HAEG 4PJGE 5DRNA 4NSKA 3KG5A 3KYKL 3LKSB 1U8OA 3ROOA 1YN6B 1CL7I 4CMMA 2X42A 1TZHB 4K23H 3ZSSA 4YEFA 1G7QA 3QQ3A 4ZO9A 5I2IA 1S7QB 2OL3L 1GGBH 3UDWC 4JFPA 5GIRA 4KROB 1UT9A 2F8OA 1F6AA 3B9AA 4QXUH 3X3FL 5MERA 1K4DB 3KXFA 3JV4B 3R1GL 2W38A 2CH8A 5DJ6B 5CJBA 1QQDA 4IRJA 4KV5E 3G5VB 3FO1A 5GS0D 4YX2H 1QNZH 3IDXL 3QCTH 1ZT1B 4ZUTA 4HAGA 3MBXL 1A47A 4P57B 2KPNA 4M7KL 1OTSD 2F54E 1BQLH 4JO1L 4PJIA 5FGRA 3VFWA 1FLRH 2E8ZA 5AUMB 1RZ8A 3C9NB 3LEYL 4RBPH 5DHXB 4CN4A 3C08H 3SN6N 2EE9A 2EKSA 1AGFB 4G9FB 2NR6C 4I3GA 1N2RA 1QYGH 4JG1H 2PR4H 2KZ1B 5DUBB 4NOBA 4I0PA 1L4IA 4IIQA 4P9MH 2CDFA 4X6CF 4Z0BH 3L1OH 2AJZA 3QUXA 3CFIC 3QZWB 5KG9B 2D7OA 1F6LL 3MBEA 4LAJH 3GMLB 4YDLB 4QT5A 1OSPL 4CVXB 3CZFA 3TYFB 4NQDE 4GRMB 2NX5A 3SBWC 4G6FD 3V4VL 1KC5L 1MF2L 5F89B 1OVZA 5CJXA 1XGQB 2YHGA 4MNQA 3PHQA 2A0LC 3WO3B 1SY6L 1IQDA 1GOGA 2AJ3B 5IR1A 3NCYS 4J3OC 2GK0A 4I0CC 5GHWH 1U92A 1GZQB 4Y16D 5LBSH 4JREB 5JO5A 2RAMA 4Z78B 3CIQA 1R5WB 3G5XA 2QR0B 3KPRD 5C0AE 5I8CA 5I73C 3G6JB 4V2CB 5GPRA 3S88H 1II4E 4NKMA 4DCQA 2AEQL 3MLXL 1AQDA 1J8KA 2CXGA 3V6OA 4D9RE 2CUMA 2AK4D 4MMZC 3JV6A 4XPGL 3HMWH 1NDMB 4QHUA 3MACL 3MRIB 5CEYB 4HV8A 4UTAH 4MD4B 1BREA 4MA1B 3K7UA 5DC9B 1P6FA 5CGYC 3LIZH 1QSED 4YBHA 3GMRB 5CLTA 1R3KA 2FH6A 3TNMA 3FAXA 4X6DB 4L3ED 4G6FB 5FB8B 3B3IA 3F7PC 1KJ2A 3FQWB 4UOW0 3F7VA 4IDLA 4R4BA 1N26A 1Z9OA 3D9AH 4NN7C 4OTXH 4EXPX 4X4YB 3BE1L 4XMPH 3RGVC 3ULUL 4P2RD 4O2EB 5A2FA 1EEZA 3MRJA 3V0VA 3SDDD 2WINB 2EE3A 4MD5A 4NN6B 1JN6A 4ORGA 4BM7A 4FRWA 5ADPH 1H8SA 3UBXG 3QG6B 3VI4E 2DJSA 3H0TA 3MA9H 2JB5H 2CDEA 1NCWH 1JTOA 3KPRB 3KPNA 2NYYD 5HDLA 3KPLA 2KZWA 4JAMA 2QLVB 1TCRB 4OI8A 4X7SL 3IJSB 4PJDA 5E6ID 4NM8L 3ARFC 1W0WB 1G9EA 4JPWH 4YDVA 2IANE 2J4WL 2AK4B 4HBQA 4ZUUB 2N1KA 4RMTA 2X4OB 5KSUA 4XVJL 3QHFL 3FKUS 2WLYA 4FXGA 4XMKL 4EDWL 3MROA 3N1FC 5C0BA 2VSDA 2E9IA 3R06A 3FRPA 4C56A 2IJ0C 3ALPA 3QJHB 5IHUH 3LH2L 3W9EA 3VGEA 3EOTL 1ZTXH 4JJHA 5CJOL 1OWWA 1FNGB 3UC0L 2P1YA 5E2TH 5EUOE 5M95B 4NKOA 3EJZD 5K59F 2V9TA 1I3GH 4L3EB 5C7XH 3TPKA 2FB4H 1F4WH 1J05B 2PTTB 3STLA 1HQ4A 1LO5A 4KJQD 1DQQB 3HC0B 1QVOA 3SCMD 3PV6A 4KPHL 5E8DL 1HHKB 1I7UB 4P2RB 1A6AB 4JFFD 4PS4H 4OFIA 5DC0A 3SDDB 2X4RB 2ZUUA 4FZ8H 2OQJA 5ANMA 4GAGL 3D18A 3MUGB 5IMMB 1FZOB 4Q0XH 4MAYC 1NCTA 2VDPH 3VXPA 4PRAA 4XPFH 4N5UA 3V0WL 2P45B 4X4XB 1Q8MA 2WIIB 1CDCA 2ICWB 3ZKND 4MXQD 3BO8A 3BFOA 5GZND 1GAFH 1JCKA 5FA3B 3BEVB 4HG4J 4KHXH 5E6IB 1A3LH 3OKNB 3K8LA 5T1DH 1RK0B 2JLLA 3HNTH 4P9HL 3SJVA 3VFOB 3ARYA 4Y5VB 4F7EA 1RHHB 5ALBL 4LKXA 2CUHA 2MOVA 2P8LB 1UACH 2DTML 3RTQC 4JKPH 3TZVC 3VXSE 4NQSB 4W4NA 3NIDF 4JVPA 4WUKH 1ZVYA 5I1DA 4UUJA 4EBQH 2G2RB 4WEBL 3MLRL 2V2XA 1HHIA 3N50A 4ONHA 3D39A 2X4UA 3SDXF 4PLJD 4XCEA 3SCMB 3S4SB 1I1YA 3IDYC 4JFFB 5ICZB 2C26A 1Z0NA 2O5ZH 5E99H 3RVWD 1LEGB 1IC7H 1EFXD 3RWFB 3D69B 4NO0D 4BSVB 2AKRA 3IDGB 4E41D 4HAFA 4X6FA 1VFMA 1RVFL 3Q5TA 2VDOH 3H7LA 1XIWD 1T80A 1N3NA 1FP5A 2ESVA 5J8OA 1I7TA 1FBIH 1P9MC 4ZNEA 1KYOK 4R96A 4PY7B 5EZLB 2OI9B 3MJ9H 3QDGA 1I1RA 2D7TH 3S36H 1YEHL 4L3CB 2CR3A 2XICA 2FSEB 1AXSA 3C5JA 4CKVX 2H8PB 2YN3A 3BH9B 3GI9L 4UV4H 5D7LE 1S9KC 2R15A 4RGMB 4N90D 4S1DC 2NZ9C 3O11A 2FX8L 4Y88A 2XV6B 2AQ2A 5FM8A 4QO1A 3VI3E 3TCXA 5HHQA 2I9LA 4YXHL 4OGZA 1UCBL 4G80B 2I9TA 4G8IA 3QQ4A 4TSAL 3MGOB 3DXAA 4S1RL 1J7VR 1QSFD 3KR3H 3FL7A 4C83A 1A6TA 1MREL 1RUQH 3GNMH 3UTTE 5J4MA 1MJ7H 1U8PA 5C0IA 2ATPB 3VDCA 2X40A 2BOCB 3LMJL 1LE9B 4XP6L 1A2YB 4NRXA 5C70A 2MMXA 4X6CE 1EFXB 2FWOA 3MRKA 4H0HB 4NO0B 2ITCA 3MUHL 4J8RB 1QA9A 4MA7L 4E41B 2Z35A 2EYTB 4XBEH 2DQGH 4TSBH 1MIML 1FH5H 1V7NH 3T09A 2J6EH 1U41A 1XIWB 2YR3A 5IW6B 3HKFA 4XTRC 1I9RL 3QUMB 3WLBB 3EYSH 4GUPB 5D2LE 4P2OA 1WBXB 2D0FA 4JY5H 4Y4HC 2O61A 5EOQL 2FECI 3V4PH 1FGNH 1UFUA 3FRUA 3QDAA 5CP7A 5TQ2L 4OI9A 3X3GL 3UPAA 3WLWC 3D0VA 3HE6A 5L6YL 4HCRL 1O7SA 4O9HH 5GGTH 3ARBC 4I0PD 5CZVH 3RZCA 1RULH 3QUXD 5BJTB 2GFBA 5FM5O 4HGMA 4TSCL 3AMLA 4GKSA 5IF0B 4PPTA 1CYGA 5DRNB 4NSKB 1U8OB 3ROOB 4UTBH 4X6EA 4KRMB 4CMMB 2NX5D 4ZUWA 5IVNA 4KXZH 3UMTA 4XHJC 1G7QB 5TFSL 3UJJH 4P23C 1T66C 1ZHNA 5I2IB 5C07D 1QLEH 1OAKL 3LOWA 4JFPB 5GIRB 2BY1A 4WV1A 3AS0A 4WDIA 1F6AB 4ODHL 3HRPA 5MERB 5A2KH 3MRPA 5ACZA 3KXFB 3C5ZA 3HG1A 3GGWA 4JDZA 1QQDB 4IRJB 3O45A 3FO1B 1I9IH 3G5YA 4PRHE 2VXQL 1NL0H 5IVZA 4ZUTB 1F42A 3QI9A 4M00A 4QWWD 1SVZA 3ZDZF 3RHWK 1NBQA 2YA1A 4PJIB 4K23L 1U3HC 4P4KD 4MZ2A 3VFWB 4ENED 2I24N 1RZ8B 3G5ZA 4J1UA 2NY0D 4D94A 1GGBL 1FYTA 2EKSB 3LVEA 4QXUL 1N2RB 4L4JA 2X05A 4KH2A 1LDPH 1UADC 3BKCH 4R2GC 4I0PB 4IIQB 4L4VE 3T2QA 2CDFB 2AJZB 3QUXB 4YX2L 3ZTJG 3MBEB 4DTGH 5C9KA 2B1HH 2XZAH 4QT5B 2PXYD 2Q7YA 3CZFB 1EVTC 3OR6A 1Q0YH 1CS6A 2NX5B 5GS0H 4DOHB 4K7PL 1NH6A 3KJ6L 2AQ3A 3HTLX 2I5YH 3T3MF 5EOCL 3PHQB 2E7CA 4I77L 2WBKA 1IQDB 1EO5A 4JM2C 5IR1B 1QYGL 4I0KA 2GK0B 1CK0H 1ADQA 2ITDA 1MUJA 1XGRA 3WFBH 1U92B 2WBJA 5K59E 5E94B 4Z7NF 5EN2A 2EDWA 4WFHD 5JO5B 4Z0BL 1Z5LA 2FL5A 1F2QA 3G5XB 4PJBA 1F2XK 5I8CB 4YO0A 3MNVA 3S96A 1IAMA 4NKMB 4DCQB 1HHHA 2B8OT 4KTDH 1AQDB 1FRGL 1N5AA 3RPKA 2NY0B 3JV6B 4QHUB 1A6PA 3W82A 2V7HA 1HNFA 4C56D 4HV8B 3VG9C 5LBSL 4K3EH 3O6KH 4YNYA 4AM0A 4DGYH 2FX7H 1R3KB 3UZVB 1IC4L 2DD8H 3TNMB 5KVMC 4XPAL 2HMID 5EU6A 3B3IB 1KJ2B 2AI0H 2ENYA 2R69H 1OP5K 4OF3A 3F7VB 3J7HA 4R4BB 5IHLB 4NQXA 4AIZA 1PKQA 1EEZB 3MRJB 3V0VB 3NIDE 4H8WC 1P4BH 4U6TA 3UDWA 2R56H 1EAPA 4LSPH 4MD5B 1I3RA 4UTAL 2R8SH 1JN6B 4ORGB 1Y0LA 3H0TB 1W72A 4JRXA 1OGAD 3LIZL 5CEZD 5MI0B 1GVIA 5DZLA 3SDXE 3KPNB 3KPLB 4JAMB 3MZTA 3MRQA 4WTWA 4PJDB 3U7WH 5GS3A 4YDVB 1PG7W 3D9AL 4XMPL 1FL5A 1X9QA 5KSUB 1DANU 5JORA 3P9WB 4FXGB 3TBTA 3MROB 3GBNL 4HC1A 5C0BB 3R06B 1WZLA 4G7VH 4C56B 3O6FC 4YHKH 2GITA 3W9EB 3A0OA 3AFLA 3MA9L 2JB5L 4GAFB 4NC2B 1MJ8L 4RFOH 2R9HC 3W11C 1NCWL 1IM3A 3O3EA 3VRLF 1KLUA 5I18H 1G6RL 4NKOB 1R6VA 3DECA 3VFVA 3B9KA 3STLB 1HQ4B 3D39D 1LO5B 1X5GA 1QVOB 3SBWA 3L9RA 1MLBA 2ATKA 3PV6B 1GHFH 1I75A 4HFWA 4OCLC 1E6OL 3PL6A 4P5MA 2EXWC 1CGUA 2OQJB 1UC6A 5ANMB 3D18B 5IHUL 4P48A 5SV3A 3F7QA 2NY7H 1ZTXL 3VXPB 4PRAB 1TITA 2AAVA 2ESVD 4D8PA 1MWAA 1LD9A 3MLVH 3SY0A 4M5YL 3BO8B 1I3GL 3FB8A 5DJ8A 5C7XL 1WT5C 4P59L 2FB4L 5C9JA 4FHBD 3F7RA 2JKXA 1WZ1L 3KPSE 4NZTH 4QGTA 4OCYL 1EDQA 4TUKL 4YHIA 4PS4L 3SJVB 4KAQH 4DN3H 4F7EB 3EAKA 4HMCA 5CBEA 4LKXB 3IFLL 3DIFA 4Q0XL 5A1AA 2VDPL 3QXDA 4XPFL 1EUTA 1NCNA 5E00A 3IETA 3GI8L 2NY5C 4GG6F 5I1DB 4GSDL 4UUJB 5DJDA 4DN4H 1QHPA 2V17H 4KHXL 5HVHC 1AI1H 2V2XB 3EOYG 4ONHB 1A3LL 3D39B 2CK2A 2X4UB 5T1DL 1S5HA 4XCEB 3WE6A 3BZEA 3HNTL 3CCHA 1I1YB 4M3KB 5K9QG 1ZS8A 4AEHH 1JZ4A 5C0ND 1UH4A 5D96B 1XGUA 4FOMA 3RGVA 5KSBA 2AKRB 2M26A 4X6FB 3RY4A 3KS0H 4M48L 3ORJA 1T2XA 1UACL 3T0EC 4X98A 2V9RA 1PG7H 4JKPL 3OXRB 3UYOD 4BSJA 3EZ8A 4IOFD 1N3NB 4RDQG 3D85A 2ESVB 2D3VA 1I7TB 4WUKL 1CDBA 3F6LA 4RRPA 4P46D 3SE4C 4KUZH 4LPUA 4R96B 1TVHA 4IJ3C 3PE9A 4HMEA 3QDGB 4PJ9C 4Z6AT 1H3UA 1YY9C 1R5IA 4NCDA 4NC1C 4JFXA 1AXSB 3C5JB 4YZFF 2FATL 4ODBD 3ARFA 1P5UA 3SKNA 2O5ZL 5E99L 5E8NA 1IC7L 1I4FA 1ZA3A 1EO8H 5DJAA 3HE6D 4HGKC 4YHPA 4YHYB 3RVTD 3O11B 2AW2A 1DEEA 1X6LA 3RIAK 4JPKH 2VDOL 5HHQB 2I9LB 4Y2DC 3S37H 3ZDZE 4WUUE 3HZVA 2I9TB 5HXMA 4G8IB 4PFEA 3QQ4B 3RZCD 1KJMA 4PRPE 2W9EL 1FBIL 3DXAB 1XMWA 4CN6A 4QXWA 4U1KA 4C83B 1A6TB 3MJ9L 3N0PB 1U8PB 4TVPD 3S36L 3QEHA 3ULSA 3QUMH 5C0IB 4Q6IC 1DBJH 1JYXA 4AY0A 4W6YB 5ACLA 1OARH 2FHFA 4NRXB 2FWOB 1SJEA 3MRKB 5D70H 2BDNH 5CMAA 2ITCB 1QA9B 4WEUD 2ZJSH 1NSNL 3LB6D 2Z35B 3VFNA 1QHOA 4P2YA 2R2CA 4NZDA 2YWYA 4FFYH 3HG1D 3OB0K 4FQLH 1IILE 4JB9H 2IH3A 4R6UA 2BXYA 3UAJC 3KR3L 1AC0A 3SE8H 1TQCC 3QI9D 4P2OB 2CJUH 1XAUA 3CSBA 2JCCA 1UM5H 2O61B 4LPVA 5T3ZD 1NEZA 3FRUB 5CP7B 5I15L 3GSUA 4M03A 4H0IA 1LP9F 3EFDH 1JNJA 4KJWC 3D0VB 3HE6B 3G04A 5CGTA 4XBEL 2BXZA 3IDJA 4TSBL 2VLKA 1V7NL 1FH5L 2J6EL 4IRSD 2XFXA 1ACYL 2A6JB 5HSFA 3RZCB 3K74B 3MRRA 1Z9MA 2GFBB 2P5WA 3PABA 2YK1L 5TE4H 3RTQA 4GKSB 5I17A 3EYSL 3TZVA 5L8KB 4LLWA 4FMKA 4X6EB 4JY5L 1CLCA 3U0PA 4N9GA 4XH2A 4NN5B 4ZUWB 3V4PL 2APFA 1LO0L 4C4KO 3ZHLA 2C3VA 3RVUD 3ILQC 2ZNXA 1JJUA 2ADIA 3VH8A 1ZHNB 5SWZA 5E5MA 2JK5A 3STZA 3FO2A 2DQCH 5GGTL 4WV1B 1BGXH 4WDIB 1AO7A 3WKMH 1EA9C 3MRPB 5ACZB 5ECJE 3FONA 2WBJD 1T21A 3C5ZB 4P2QE 3HG1B 3GGWB 5HHOA 1A64A 4JDZB 3O45B 3CFDA 3G5YB 4ZDHA 4DUWA 8FABA 3QUZD 5IVZB 2VC2L 3QI9B 1P9MA 4FTVE 4NFDA 4UTBL 4R97B 3CVIL 1TPXB 3FN0H 4X5LA 3UJJL 1KB5B 1CZ8L 5C1MB 3S97C 4W70A 3G5ZB 4J1UB 1QLEL 5IVOA 1EMTH 4Y2OA 1FYTB 2K1MA 2IQAA 3R8QA 2YMXL 1MY7A 4Z7VE 4LEXH 4U1SA 5CSBA 4XNZB 2VXSL 1I9IL 1VFOA 1NL0L 3NPZB 3TWCH 2UWEA 1CL7H 4OLXH 4MGXA 3MV8A 4YBQD 2DQTH 2Q7YB 1GOHA 3LKNA 1D5IH 3OR6B 5J7CC 5EU6D 4JHWH 4XCYA 3BDXA 4HEPG 4FFZH 3U4AA 2VQTA 4LHUA 4U7SA 4FQPA 2ITDB 1MUJB 1XGRB 5IMKA 2WBJB 3BKCL 3UTSE 5EN2B 3QISA 1I8KA 1JZ2A 3OPZH 4JRXD 1Z5LB 4WWKD 2FL5B 1WIOA 35C8L 3RVVC 4QHNA 2XWTA 3AMKA 2CLRA 3GK8H 4PJBB 1EHAA 1RZIA 4DTGL 2A77H 3U46A 2B1HL 2XZAL 4YO0B 3WD5H 3MNVB 3S96B 1UB5A 5GS0L 1HHHB 4OCWH 4YHLH 5I9QC 3M45A 1N5AB 3QPQC 2CKBA 3TESA 4Y4HA 4PJ5A 3K4ZA 4HUMB 2PYEA 3EW3B 3WUWG 1CK0L 3WFBL 3QFJE 2IMMA 3MJ7A 3C2AH 2NR6D 4M6NL 3ARBA 4YNYB 3RNKA 5F7NC 4M61A 2AVGA 2YD1A 4MA8H 1VSCA 2YEZA 5IGXL 2EDTA 2R4SH 2CRMA 3UXFA 4KTDL 5JHLL 1BVLA 5EU6B 2Y36H 1A9BA 4K3DH 4NQXB 1GSMA 3BUTA 4AIZB 5GRZA 1PKQB 4P23A 4RX4A 4LCIL 3I6LE 1NC4A 2A0LD 2DRUA 1EAPB 1I3RB 1SBSH 5F72S 4K3EL 3U83A 1Y0LB 5EIVA 1C7SA 3O6KL 1W72B 2M2DA 4JRXB 1BJ1H 1BQUA 4DGYL 2FX7L 3CLEH 2QJDA 12E8H 1XH3A 3BIBX 2DD8L 5CFHA 4KMTH 3CDGA 4HK3J 4E42A 3IVKA 5EU5A 3MRQB 3ARWA 2AI0L 4GT7A 5CAYB 1U3HA 1FL5B 2Y5TA 4UMGA 5K9OA 2W91A 5KBNC 3BISA 5B3JE 5JORB 3TBTB 4XB8A 5EDXA 5MHSE 2GITB 4LKCA 3K80A 3WNNA 3UPRB 1VEPA 2ZUVA 3VDAA 3ZE0F 1IM3B 3O3EB 5HPMA 2CR6A 1KLUB 4L4TA 1YC8A 4WFGE 5CGYD 5KVDL 4JQXC 4HZAA 4OLVH 1ETZA 3EFFA 3U7WL 1PAMA 3B9KB 3MPCA 3VFVB 1AY1L 4CUCA 5CEZH 1B6DA 3IGAA 4L8SC 1MRFH 3L9RB 2F15A 3P4LA 2HN7A 5IBLD 1MLBB 2ATKB 1FFOA 1NFIA 2D31A 4HFWB 3MREA 3RGVD 1ZLSH 4P5MB 1WJ3A 4YHKL 3WFHA 1J1OH 4JM2A 4FQHA 4PJHF 3O0RH 4QKXB 4WU5A 4RFOL 1I3UA 1HILA 1S7TA 4D8PB 1MWAB 1LD9B 3SY0B 3WCYA 4QTHA 4I2XA 1X5ZA 3FB8B 5DJ8B 4D9QE 5C9JB 2MTPA 5AZ2L 3LAFA 5I73B 1I8IA 1UWXK 3RIFK 4YHIB 3ARFD 4WI3A 2IGFH 2XT1B 3CFEA 1KOAA 5L8JB 5HGGS 5CBEB 1V3MA 4F15C 3DIFB 1NMAH 4WENB 3MLUH 3ME0A 4LRNH 4ZS6C 3DHMA 3QXDB 2XTJE 3MLVL 4IS6A 5E00B 3IETB 2APWA 1UQSA 1A8JH 5CINL 5DJDB 1VKXA 1LP9E 3V6ZA 4TNVK 3EYUH 3DRTA 4FABH 3HNVH 4NZTL 1S5HB 3WE6B 3BZEB 3CCHB 4KAQL 1KT2A 1ZS8B 4DN3L 4NN7B 1J8HA 4JVWA 3QO0A 3RGVB 4PB9H 1XGUB 2W0PA 2EDRA 5KSBB 5JHDA 5EO1A 4PGCA 4X98B 3CU7A 5B3NA 3D85B 3GO1L 3KPQA 4MAYD 2YZ8A 4H26A 5DYOA 3CVHL 1QBAA 1MCEA 3V2AR 4DN4L 1TVHB 2V17L 4XP1H 1AI1L 4TUJA 2KL6A 1R5IB 4NP4H 4JFXB 9CGTA 4K7FA 3ARFB 4OCXH 4AEHL 4MQTB 3SKNB 5E8NB 1IQWH 3AC0A 1I4FB 1ZA3B 5DJAB 1BFOA 4F7PA 4YHPB 4LASH 1DEEB 3MOQA 5GJSH 1IGMH 1PG7L 4X6BA 1H9VA 3HZVB 3O6FA 4X9BA 1AHWC 3DLQR 1KJMB 3TO4C 3GIVA 2MFNA 4X5WA 3QJFA 1MHHA 4U1KB 4KUZL 4NYLA 3RTQD 4JCLA 3TZVD 2D7QA 1QEWA 3KLAA 4UIKH 3QEHB 5J1AA 3ULSB 4Z76A 2NY2C 1YDPA 5SWZD 1EO8L 1SJEB 2XY1A 3HS0A 5CMAB 1MVUA 1PSKH 3ECBA 1AO7D 5I1IH 4JPKL 2QQQA 3VFNB 5DJ2A 4AJ0A 1D9KD 3S37L 1G7IA 1N64H 2VDMH 5LKNA 2O93L 5CD3A 2IH3B 3H3KA 5DQJA 1QACA 2ICES 2MQCA 3C87A 1UGNA 1HZHH 2JCCB 2LE9A 3QUML 1IEAA 1WT5A 4OB5L 1NEZB 1ES0A 4YFLI 4YWGH 3GSUB 5I1HH 1OARL 1INDH 1QSZA 4TVPH 5D70L 2BDNL 4UNTA 3P30H 2C1PA 3G04B 5CCKH 3IDJB 5J9PA 1V8HA 2VLKB 4S1DD 2NZ9D 4FFYL 1OM3H 3TGXA 2XFXB 5KJRH 4FQLL 1CGSH 4LIQH 4JB9L 3MRRB 2P5WB 3PABB 1F02I 3RTQB 1T2JA 4TOYH 5I17B 1CLOH 2ZCLH 3RJQB 4OSUL 3TZVB 1P69B 3MV8D 4Q58C 4LLWB 5C0CD 4G42A 1JMXA 3U0PB 4N9GB 4XH2B 2WM0A 3CFJA 4N0CD 2C3VB 3B4NA 4GXUN 2ADIB 3EFDL 4NHCH 4NNPH 4MB4A 5SWZB 3VH8B 5E5MB 4A6YA 1YEFH 1U8HA 2JK5B 4LHUD 5F9AC 3STZB 2J8OA 4ONGH 1J87A 3TBWA 5A2JH 3IDYB 1AO7B 5T3ZH 3UP1A 1C5CH 3PGFH 3QQ9D 4Z7WA 1KB5H 1ZLVH 1EHNA 3FONB 1CXKA 1T21B 5HHOB 2VLMD 3VXUA 2X4NA 5TE4L 3T0EA 3CFDB 2AABH 3BHBA 4I4WA 3REVA 1QSEE 3S98A 4B41A 5ID1A 4ZDHB 8FABB 4XTRD 3P0YH 1IGJA 3SE4A 1QFOA 4KUCD 1MCNA 4YUEH 4KKBD 4PJ9A 2I07A 4PJ5D 1ZLWK 3VGAC 4DGVH 2A9NH 4JKLA 2DQCL 2IQAB 2X09A 1MQKH 3MR9A 4QCIB 1BGXL 3WKML 3QRGH 4YDJA 5EFIA 3WLWD 4U1SB 1FVCA 2F19L 5DRXA 4C4KT 4OD1H 1UEMA 2C3XA 1RZKC 1GGUA 4Y2DA 2UWEB 1ADQH 3DI3B 1B2WH 3MV8B 1PX4A 3FN0L 3LKNB 1OQXA 1GGYA 5SWQA 5CKGA 4XCYB 2CQVA 1NBYA 3C6LC 5T33H 5M94B 4Q6IA 1JUFA 4XHJD 5I30L 3VXNA 4LHUB 5BMFH 4PREA 3BEWA 4P23D 3ZE0E 4RX4D 1T66D 2XRAH 2IFFH 3MOAH 4KJYA 2X70A 4LEXL 2DI7A 5JW4Q 1NC4D 1XF4A 5IMKB 5M7QA 5DMGD 1INEH 3ZYIA 1I8KB 1HDMA 1B4JH 1U8KA 1S78C 5DXWA 4QHNB 2XWTB 4F8QA 3X17A 3GMOA 2CLRB 4OLXL 4OZFA 1RZIB 2DQTL 3U46B 5T1KA 5J89A 1D5IL 1UB5B 3LQMA 1JL8A 4JHWL 3O4LA 2AV7A 2CKBB 1KCSH 4Y4HB 4PJ5B 2IEPA 3IU4H 5I76A 1A6UH 4UDTA 3BIKA 2PYEB 2R4RL 4YFDB 4QEGA 1YN7A 4CBPA 4P9HC 3MJ7B 3HPJA 2GW5A 1O0VA 2PKDA 3SGEH 3ARBB 3RNKB 4HUWB 4MDJA 2DICA 4R2GD 5EOCJ 3GK8L 3UO1L 1XGPA 4M61B 5TGBA 3WD5L 4HG4K 2YEZB 4ZTOL 3GBLA 4PJXF 4OCWL 4EZMA 1BVLB 4YHLL 5LGHH 3HC4H 1IKFH 4KI1A 1A9BB 3UX9B 2W65A 2GYSA 1S9YA 1U2HA 4CVWA 2LU4A 4P23B 1GXEA 4HS3B 1JTPA 1NC4B 1BVZA 3HUJF 4PJ7A 2H32A 1SJHA 4JM2D 2YS4A 1B88A 1EZVY 2P47B 2Q7NA 2ZUWA 4HC1H 5JZ7C 4MA8L 1OF2A 1XH3B 3CDGB 2R4SL 4E42B 2E6QA 3IVKB 1AQKH 3I3BA 1YNTA 5D1ZC 5EU5B 2Y36L 1NGYA 3W0WA 3BH8A 1J0IA 4CAGA 1U3HB 4FMFA 2Y5TB 5K9OB 4KK8D 1DQMH 1MI5E 3EDEA 4J3VA 3GRWA 4LGRB 3UEZA 1PFCA 1SBSL 2BSSA 4N8PA 4LKCB 1JPGA 1DQDH 3PGCA 1YPZE 3DBXA 1OD9A 5FYLL 2D2OA 4PRBA 1M05A 4BK4A 4C58B 4R2GB 3MXVH 5HPMB 3CLEL 3G08A 4L4TB 12E8L 1E28B 3ZTJH 3OQ3B 4KMTL 4HXBH 3BJ91 4I1NB 3RVXC 1ETZB 1KNOA 3EFFB 1K4CA 4JQIH 3MFFA 1MWAH 3IGAB 2YD4A 2DM4A 2HN7B 2YUZA 1FFOB 2Z0BA 4ZAKD 1NFIB 2D31B 1J8HD 3MREB 4O02L 4N90E 5E9DD 3S3JA 3WFHB 1OCWH 4JM2B 2MCG1 4FQHB 4QRPE 5DD0H 2UYLA 1BIHA 4WU5B 4ZO8A 2F54A 1AGCA 1HILB 1S7TB 4PYHA 5LQBH 4QTHB 4I2XB 1QSFE 3QCUL 4OZGA 1Q9KA 3QQNA 4OLVL 3V95A 1KPRA 4XHQA 5IHBA 1I8IB 1MPAL 1MRFL 1VFAA 3UJTL 1Q38A 4L1HA 3CFEB 3MLWL 5FGBC 1ZLSL 1S7SA 1G6VK 3WDHA 4JFOA 1J1OL 4LFHD 4ZFOA 4M6MH 4OLZH 4YH6A 5GJTH 3O0RL 4EN3C 5BXFA 4OJFL 2W0KA 2E6JA 4NQDA 3O6FD 3VG9B 5CJQH 1G9MH 3WMSA 2BERA 4IS6B 4Z77A 4KZDH 2R9HD 1UQSB 2OR7A 3FOLA 1VKXB 3AXLA 3V6ZB 3PF2A 2MPAH 3DRTB 4ONOA 5JIHA 3PDDA 2BVUA 1N59B 2L7UA 4ODTH 1ZE3C 1DQTA 1KT2B 4ZOAA 1YEEH 1J8HB 1I7ZA 3QO0B 2A6DA 4TPRH 2QSCL 1NMAL 5EO1B 5C0AA 3MLUL 5BCAA 3VFPA 4TULH 1FCGA 5HPOA 4PGCB 1F3JA 4DVRH 3NA9L 3KPQB 3FO0H 4H26B 4HXAH 4XVSH 5DYOB 3I2CL 1KJ3H 3A6BL 2HLFD 3QUKA 4XC1L 2D9CA 4TUJB 3FT2A 4PTUA 3HNVL 4U6YA 4ZXBC 4GS7C 2GSIA 2DDQL 4K7FB 4N5ED 4LLDA 5C07E 2EDFA 4J3WA 4HJ0C 1BFOB 4F7PB 1NFDF 3CSGA 4ELMF 3T0VA 2HVKA 5CBAA 5DA4A 2P8MA 4X6BB 5HD8C 1E4WH 3O6FB 3GIVB 4X5WB 3QJFB 1MHHB 4NYLB 1MQ8A 3OJMB 4XP1L 1XF3A 1QEWB 3KLAB 4JQXA 4KVNH 3LN4A 5J1AB 5JNYA 1KTDA 2ADGA 1KN4H 4NP4L 4Z76B 3QDJE 1YDPB 4L8SA 1IQWL 5F7MC 5CGMA 4JANA 2LVEA 1RUMH 3HS0B 1MVUB 4LL9A 3LQAC 4LASL 2FO4A 3ECBB 3OF6A 3MSPA 3TBVA 5GJSL 4ZNCD 5DJ2B 1S9XA 5BVJA 1G7IB 4NOFA 3VXUD 5CD3B 4J6RL 3SDAD 1OWRM 3LKRA 5DQJB 2IANA 1NLDL 5MEOA 4LVNC 3CC5A 4Y19E 5DK3A 4AEEA 2NY1D 4UIKL 1AGDA 2A1WL 5GRYA 1DEDA 4OGAC 4TNWK 1IEAB 1HH6A 3AUVA 1ES0B 4PJ9D 1MFAH 4KC3B 4BQ9A 1IKNC 1YY9D 3QEUA 3U7YH 5FM4A 3B9EA 2C1PB 2YD9A 1VERA 4HUXA 5EUOA 1DANT 5GRUH 5J9PB 4XBPA 2DM3A 2W59A 3OL2A 1E4KC 1N64L 2VDML 5KANI 4U2YA 4WFHE 3RY5A 1V05A 4DJMA 5C3LD 2BHUA 5IFHH 5GGVL 1ZSDA 1MHPH 4ZS7H 4G42B 1HZHL 3MV7D 3E1F1 2CIKA 4EOWH 1JPTH 3W2DH 5HVHB 3CFJB 5DEZA 5H8DA 1INDL 1JWMA 3ARQA 4EUPG 5BOZG 4TVPL 3GJEB 4PLOB 3H9ZA 1MELA 1RZJC 1U8HB 3P30L 4LDOB 2ZUXA 4A6YB 3U0WH 5CCKL 5FYLE 5HHVL 3TBWB 4AL8H 2B39A 1WIUA 4Z7WB 1F58H 3UTPE 4LGPB 4G5ZH 4ACPA 5KJRL 4LIQL 1CGSL 2VQUA 4PLNC 1RU9H 1R5VA 4PJXE 3VXUB 2X4NB 2OL3A 3T0EB 5GGSY 1HI6A 2YBRA 3BHBB 4I4WB 4TOYL 3REVB 1CLOL 5ID1B 5IOPA 1F5WA 5T1KD 5EO9A 1IGJB 3QAZC 1A7RH 1F13A 4ZPVA 1FLTX 4IJ3B 5C0DA 3BOVA 3O4LD 5GGQH 4PJ9B 1DTUA 2I07B 4RISH 4N8VG 4NHCL 1YEFL 1DSFH 3Q2CA 4NRZA 4ONGL 3MR9B 4GRLC 1QG3A 3VXSA 4G6KH 5I1JH 1C5CL 3PGFL 4YDJB 4MJ5A 1KB5L 5ALCL 1B90A 5EFIB 1FVCB 5DRXB 1X5LA 5TE6H 1R24A 5C92A 2N7BA 4OBSA 1OGAE 2AABL 4D3CH 4NQEE 4Y2DB 1AHWA 1F4HA 3ZSTA 3TO4A 2FECL 5F1IA 4XVUC 1A3QA 5E56A 2P8PA 5ERWA 4HKBA 4LOUC 2DL9A 4KJPD 5FYJD 4N8CH 4YUEL 5SWQB 5K33A 2WZPD 4JKWA 4HSQA 4KK9C 4OZ4A 1NBYB 5MEQA 2JELH 4DGVL 4Q6IB 5AZEL 4GAYA 2WWKO 1P53A 1K8IA 3VXNB 1T7YA 1DQLL 2NY3C 4PREB 4L9LC 3BEWB 4OCMC 1LVEA 7FABH 4KJYB 4X80H 2X70B 4HJJH 2CKBH 1XF4B 5T5FH 1OD7A 1ZLWH 2DWEA 1HDMB 5CSZA 5IB3A 4DW2L 1U8KB 4K55A 1SY6A 3GMOB 5FOBA 1ADQL 1B2WL 3MNWA 4OZFB 5ITBL 3VFRA 5T1KB 5E2VH 5D7LA 4Y4KC 1TQCB 4LCCC 1XFPA 2FEDC 3O4LB 4R0LC 2AV7B 1N5YH 2NCMA 3W0WD 5T33L 3MUZ1 1JHLH 5BMFL 5I76B 2IQ9H 5HHME 2WWMC 4UDTB 2XRAL 2IFFL 3BIKB 3MOAL 3ETBF 5HBBA 1YN7B 1CXHA 5D71L 1INEL 3HPJB 3UTTA 3HZKA 1B4JL 1YNKH 2VAJA 5C0JA 3CFBA 1O5DT 4MDJB 4TUOA 1XGPB 2FGWH 5TGBB 4X6CA 2VN7A 1EVUA 1REIA 2IAMD 4NBYB 3FQXA 2HYMA 4KKCD 1KCSL 2NY6C 2NXYC 1KTKE 3IU4L 5IW3A 2W65B 4WI8A 1S9YB 4F7TA 5CILH 4WW1A 4GLRI 1JPFA 4OGXH 3R0NA 3G9VA 1JRHH 3HI6H 4PJ7B 2H32B 1SJHB 3BZDA 4KDTC 3ZHDA 4U1MA 5HVFB 1MCCA 1CDYA 2I60H 4OFDA 2WAHA 2F54D 5CUSL 1UM4H 5L2KE 1HIML 1OF2B 4OZIF 2XWJA 3NCEB 2LTQC 3RVVD 4FP8H 4Y7MA 5LGHL 3V5DA 5ADOL 1YNTB 3HC4L 4F37F 1NGYB 3W0WB 1VACA 3BH8B 4KMQA 4RQQA 3QEQA 1CVRA 1A3RH 2AJSH 4AENA 2PO6D 3QPQD 1M7IA 4OD3H 5KS9F 3WIFA 3K2UH 3BT2L 2BSSB 4Y4FC 1LE5A 4O58H 2BHZA 1JPGB 4UDUA 3PGCB 3DBXB 4PRBB 1M05B 4NQDD 4PJEF 2X89A 3G08B 4MXWL 4G8EA 2V6HA 3ZE2F 5INCA 1AQKL 5TH2A 4N8VA 4RFEA 1KNOB 1S7VA 1K4CB 5CD5D 3SKJH 4LLMA 1NFDE 3MFFB 1GL4B 4ELME 4LAQH 3ULVD 3CK0H 1T5XA 4JHZA 1QOKA 5EZIH 3VMNA 1FAIH 3TN0C 1EUUA 3OV6A 3C6LA 2VL5A 4AYFA 4PRHA 4M7JH 1ZGLM 1OPGH 4JO4H 4M1GL 5C0AD 3NABL 4S11A 1DQDL 1CXIA 4NKQB 2UYLB 2F54B 3MXVL 3R8BB 1AGCB 3B83A 4JZJC 1MCOH 4D9RD 1JF5A 4NZUH 4OZGB 1Q9KB 3NAAH 3MRCA 4JQIL 3WXWL 1KPRB 3D25A 4B50A 1UWGL 1VFAB 1C8PA 5I9QB 4L4VA 2ZOKA 1S7SB 2HAZA 5L7XH 5HHNA 1OCWL 3BP6A 4ZFOB 5DD0L 1D5ZA 5I8EA 5BXFB 5GRWA 4NQDB 5LQBL 1KIQA 2XKUA 4Z77B 3L7EB 4FQJH 1NLBL 4H8WH 3FOLB 1I3VA 5IEHA 1TVBA 3AXLB 4PJFE 2XOTA 5A16A 4KKLC 5J12C 3QH3A 3SKOA 3PWUA 1AD0A 2QL1A 1JZ3A 5D93B 4HGWA 4OCSH 4Y1AE 5AEAA 1I7ZB 1KENL 3GHEH 2A6DB 1H5BC 1FHGA 4OV6F 4M6ML 4OLZL 3OF6D 5GJTL 5C0AB 3OR7A 4X9GA 3VFPB 5HDQH 3LV3A 5E5RB 2ICWJ 1F3JB 2K3TA 4JM4L 5CJQL 1G9ML 2AJUL 5DFTA 4KZDL 1JIBA 3TT3H 4U1HA 2IAND 4KK5C 1N6VA 4OGYH 3QUKB 2MPAL 1OGTA 3MLSH 1P4IH 3FT2B 1HKLH 4PTUB 4U6YB 2GSIB 4ODTL 5F7EH 2HT2C 5KVGH 5D1ZA 5IMLA 2XTJC 25C8L 3IF1A 3TYGH 1KULA 1MCBA 4LLDB 1TNMA 1ROWA 1YEEL 2P43B 4ETQA 4F57H 4TPRL 4JN2A 5ILTH 2HVKB 5CBAB 4TULL 2GIYA 2P8MB 1VFBA 4JZOA 5E6YA 5FCUH 4K7PX 3FO0L 3CSPA 2VUOA 1U3YA 4XVSL 3LN9A 1TDQA 4ZS6D 1KJ3L 3JTSA 1XF3B 4P3DA 2BNQE 5JNYB 3LN4B 3V6BR 1KTDB 2ADGB 5JDJA 1FC1A 3JUYA 5I19H 4L8SB 3EIFA 4JANB 3BZ4A 4IHOA 2FO4B 3SDXA 1JHKL 3ZZ1A 3TBVB 1S9XB 5BVJB 1E4WL 3G6JF 5CSGA 5J3HC 3PWNA 3LKRB 2IANB 3CGTA 5MEOB 3CC5B 1T03H 2X41A 3I02A 3N85L 2R2HA 3KS0J 1AGDB 1KN4L 5EU6E 1HH6B 1K5NA 2WIMA 3EBAA 3DJ9A 5FK9A 2H2PC 3MJ8A 1A0QH 2NY5H 1RUML 3QEUB 1NBZA 1PKQE 1CF8H 3VXSD 4HUXB 1N6QL 5EUOB 1ZXQA 2APXA 5FGBA 4XBPB 3LS5L 1S9VA 4F15B 4EN3A 4JRXE 1J0YA 5GRXG 4YQXL 4HWEH 3JWOH 4HCRA 4P5TA 3OAYH 1V7MH 1ZSDB 4RDQF 3VA2C 4ONFH 3TO4D 1SHMA 3BGMA 2CIKB 4WWID 3CDCA 3BKYH 1JWMB 5L2JA 4HWBH 2JJTC 1KTRL 2LAAA 3U7YL 5GRUL 2NY2D 2GEEA 2OCFD 1T1WA 3B8YA 1IGIH 5CKAA 1R5VB 2OL3B 1HI6B 2YBRB 4HLZG 4O2CA 5IFHL 5FDWA 5E7FA 3KPSA 1J18A 1MHPL 5IOPB 4ZS7L 5EO9B 4Q9CA 5IB1A 5DO2C 3ZDXF 5FGSA 1RUKL 5K93A 3W2DL 4HLJA 4ZPVB 1CFBA 5C0DB 3SQOH 4Y16C 5TDPA 1HCVA 2WQRA 4G6MH 1T1ZA 4ZXBA 3U0WL 4NRZB 4PJCF 5I8OH 4GRWH 3VXSB 5I75C 4AL8L 4NBZB 1U3ZA 4MJ5B 2DIJA 2XKSA 3DGGA 5ISZD 2ZOLA 4G5ZL 4DZBA 1R24B 1RU9L 5D6DC 1QUNA 4KTYA 5GGUA 4PR5B 5FUOH 1AHWB 3UYRL 1ITCA 4N0YH 1QFHA 3TO4B 4PGEA 5F1IB 5E0QA 2EYRA 1P5VA 4H1LG 3WFCH 1A7RL 2P8PB 4GKOA 4HKBB 5ERWB 5KS9E 3Q5OA 2ICCA 3G6AA 3QSKB 4OZFH 4G9DA 4OZ4B 5MEQB 1EEYA 1MFDH 3WN5C 2X4PA 4GAYB 3MV11 5L8LB 2EEAA 4G6KL 5I1JL 1CR9H 4OI7A 4XNQA 2NY2B 2PTVA 2VMFA 5CJ5A 3JXAA 1U8JA 5TE6L 2FJGA 4WHTA 2DWEB 4K94H 8CGTA 5CSZB 5IB3B 1G1CA 4XPHL 4D3CL 3FTGA 4XRCA 1CFTA 1J5OH 2Y9RT 1HYSC 5FOBB 3MNWB 2G5BA 3VFRB 2AV1A 1TJIL 5D7LB 3W5NA 4UB0H 1XF2A 5CLWA 2UZXB 5DJ0A 2DMBA 3BZFA 3S3SA 1IT9H 3QEQD 3ZKSD 4WUUA 5FYJH 1UKQA 2GHWB 3NBNA 1Q9WA 4O5LH 4PRPA 2NYYC 7FABL 4X80L 4U05A 3MRMA 4HJJL 5KSAC 1IKNA 3T0BA 5T5FL 1ORQA 2IPTH 5B22A 1F00I 4R9HA 1NMBH 3UTTB 1BAFH 2V2WA 3QXAA 3HZKB 5T5NG 3CFBB 5C0JB 1E4KA 2WWKT 3GSWA 4TUOB 5DT1H 4MQ7A 5EA0H 1T2QH 2H32H 5E2VL 1R3IH 1EPFA 3B9DA 4X6CB 1BZ9A 1CT8A 3FQXB 2B4CC 3QULA 3VXTA 3F58H 4NPYA 2IQ9L 2Z91A 3OGCA 4WW1B 1A1MA 2VUYA 5B4MD 1JPFB 4Z0XA 4LSVL 4UILH 4U1MB 2VITA 5DHYA 3ES6A 4WI4A 3AM8A 2PETA 1YNKL 1AH1A 2Z31C 2FGWL 3OKLA 1AFVL 4WTZA 3JV5A 2XWJB 3BGAA 3B8SA 1S78D 1ZMYA 1J10A 2FHCA 2VDQH 3DRQA 1A5FL 1CG9A 3V5DB 1R0AH 3SPVA 3WYRA 1MCIA 3MRBA 1VACB 5AYUH 4RQQB 3QEQB 1UG9A 4AENB 3S5LG 1YQVH 4L4VD 1M7IB 5BV7C 2AP2A 4F9LC 4TTGA 3VGAB 4OGXL 4MXQC 4K3JH 3WIFB 5GZNC 3HI6L 1JRHL 2R2BA 2YKLH 3HFMH 4LVHC 4GRLA 3T2PA 2ZUYA 1LE5B 3ARVA 3B5TA 4UDUB 5IVXF 2I60L 2ED7A 3BD5A 3S36X 5EBMA 3O4OC 4WHDA 2QADC 1UM4L 3QBTB 4MHHG 4UBDD 1RUAH 4G8EB 5CWSA 1U3JA 4FP8L 5INCB 5TH2B 4N8VB 4RFEB 4U6XA 1S7VB 1WWCA 4YEEA 4LLMB 2Y6SD 1H0DA 2WP3T 3NCJH 1A3RL 4LSDA 1T5XB 1AR1C 5CJ8A 5JLZA 1G6RA 4P2QA 4EDXA 4M1CC 4OD3L 3IT8D 3C6LB 2VL5B 3K2UL 4PRHB 4O58L 2GJ6E 4L9LA 2P7TA 3MJ6A 3WEXA 4FTVA 4QYOA 5GGRY 4YHOH 3IKKA 1DN0A 2H41A 2NW2A 3IRPX 5H37G 1UKTA 3U9PH 3RI5F 1A7PH 2VZSA 1FO0H 3F65A 5TF1H 1LK2A 3MRCB 1FJ1A 1Z9SA 1GOFA 3D25B 1A7QH 4LAQL 4Y4KA 4Z7VA 3O41A 1M4KA 1MCWM 4LCCA 4PGZA 5D1ZD 5EZIL 5IFJA 4JJ5A 4L4VB 4R0LA 2ZOKB 2JJSC 4DZ8A 1S7XA 4M7JL 1OPGL 4JO4L 3SGDI 1DUZA 1BVKA 4U1GC 5HHNB 3BP6B 3ULVH 3MNZA 1D5ZB 5I8EB 4OCRL 5FA4A 1OAXH 4NWUH 3FB6A 1BQSA 1KIQB 1MCOL 1JHTA 5FUCC 3QDMD 4AMKL 4CW1A 5FFLA 3MV9E 3NAAL 2CLVA 5IEHB 1TVBB 5D7JC 2B0SL 5A16B 1BQHG 3RVXD 4NUJA 3SKOB 3PWUB 3AAZA 1AD0B 3UTSA 4HGWB 4U1LA 2JB6A 4ZOBA 5L7XL 2NQCA 3TF7C 3OR7B 5DLMH 5C2UB 3LV3B 5DD5L 2BSTA 3QNYA 4KMLB 3VJ6B 1TTUA 4KDTA 1KCUL 2H26A 3I3DA 4LLUA 4U1HB 1B0WA 2UWEE 4F9PC 1MCWW 3MV8E 3NCBB 1BJ8A 5C0CE 1OGTB 3MV01 1E6JL 3QFJA 2J8HA 5D1ZB 5IMLB 1F4YH 3IF1B 2P5EE 4ETQB 3X12A 3MUJA 1LNUA 2ADJA 3SEPA 1ZKAA 5B8CC 2R0ZH 5A43C 5JXEC 3QB7C 1VFBB 3ZDXE 4JZOB 3LKQA 4Y4FA 3SO3C 4EN3D 4YBLC 3TT3L 1D6VH 1BEYL 3JTSB 1NKRA 4OGYL 4P3DB 3SGJC 2ZG2A 3MLSL 4PJCE 2VTFA 1P4IL 5DEGA 1CD9B 5DVNA 5ID0A 4LSTH 5F7EL 5KVGL 5JOFA 4XZUA 3TYGL 5L9DH 2ERJC 4PJ5E 1R3JA 4YLQT 4F57L 3MJ9A 3T3PE 5E1AA 5ILTL 3TN0A 2LABA 4IHOB 2A73A 1EHXA 1PX3A 3SDXB 3SHSA 1DE4A 1OT2A 4G3YH 2NZIA 2DQUH 4JO3H 4P3CH 5FCUL 2YD2A 3PWNB 4MNHA 3LRHA 4JZJA 1MCQA 3DARA 3KHQA 3ARGA 1HXMA 1WVZA 2F58H 3I02B 4KXZI 2R2HB 4P49A 3F62A 1X5KA 1FG2A 5HGHA 1U0QA 6FABH 3LKPA 1K5NB 3TBYA 5FK9B 4XCFH 4YDKH 5I19L 4HPYH 1MY5A 3MJ8B 4CRPA 3CDFA 1NBZB 2X1XR 2WV3A 3ZDYF 4XXCC 4HJ0D 1A4JA 3L3OA 4WCYH 4P4KC 3KYKH 1S9VB 1BM3H 2O26U 1YYLH 4JFED 4EN3B 1GC1L 1IC5H 2HKHH 5EULV 5HD8D 4P5TB 5IBTL 2KH2B 1V3LA 2A6IA 2Q1EA 3HNSL 1T03L 4NO5A 3BGMB 2VXUL 3O2VH 5I1LA 5JW4N 2OL3H 4R26H 1A0QL 2NY5L 4Y5XC 5L2JB 3FHAA 1CF8L 4FQIL 4K3GA 2PXYC 1T1WB 3IDXH 1H5BA 4JPVH 4RBPK 2LU7A 4G8GD 1MAMH 1A14L 5B21A 4HWEL 3JWOL 4O2CB 3WFEH 5FDWB 1V7ML 3KPSB 1QPPA 2J12B 1OP9A 1EH9A 3D87B 2CLZA 2F5AH 3CXDH 4DKEH 5IB1B 2F5BH 5TDPB 4S1QL 3BKYL 1GZPA 2K9UA 4HWBL 1T1ZB 2ZZUT 4OGAD 4ZXBB 4GS7B 1G84A 1YZZA 4WUUD 2IF7A 4PRPD 3SKUD 1FNEA 5F93C 3DGGB 1IGIL 2ZOLB 3TIEA 4DZBB 4ODSL 1LP9A 1K8DA 4JRWA 4YGVB 4U1NA 1C16B 5GGUB 1T7XA 1EHLH 4PGEB 3TVMC 2EYRB 1UWEH 1SM3L 2X9YA 4Y8AA 4JRYD 1SY6H 2QQKH 3SQOL 1NJ9B 3G6AB 3WL9A 5I1EL 4XC3H 4G9DB 2Z8RA 5IVXE 1EEYB 1ZLUK 2X4PB 2WUBH 5I8OL 3GSRA 4XNQB 4NJAH 3OBAA 3QNZA 3OJDA 3X13A 4HIHA 1U8JB 2FJGB 4WHTB 1EV2E 3FTGB 4XRCB 1CFTB 5FUOL 3MLXH 2KUTA 3I6GA 3KYNA 2G5BB 3WFCL 2AV1B 3BP4A 3G6DH 4LVNB 1XF2B 4Y5YC 5C08A 3WO4C 2Y1VA 5B38G 5DJ0B 1MFDL 3BZFB 5IBUG 4WUUB 4MJ4A 5DVKA 1J88A 1Q9WB 4GXUM 4PRPB 5AAMA 1J8HE 3GM0A 3MRMB 3OX8A 5E9DE 3DPBA 1ORQB 5BS0A 4ZUVA 4K94L 4JG0H 3JTTA 2V2WB 3QXAB 2BNUA 4KWUA 1J5OL 1LO3H 2DYPA 3GSWB 1OAZH 4MQ7B 1QRNE 3NPSC 4UB0L 2HVJA 2VL4A 4XX1G 5IEKA 1BZ9B 1CT8B 1JI1A 2ZPKH 4XVUD 3QULB 4JCMA 3VXTB 1N7MH 4X4ZA 4NPYB 3EYVA 2OLDA 2Z91B 4P2QD 5FYJL 1U8LA