2OXEA

Structure of the human pancreatic lipase-related protein 2
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
452
structure length
435
Chain Sequence
KEVCYGQLGCFSDEKPWAGTLQRPVKLLPWSPEDIDTRFLLYTNENPNNFQLITGTEPDTIEASNFQLDRKTRFIIHGFLDKAEDSWPSDMCKKMFEVEKVNCICVDWRHGSRAMYTQAVQNIRVVGAETAFLIQALSTQLGYSLEDVHVIGHSLGAHTAAEAGRRLGGRVGRITGLDPAGPCFQDEPEEVRLDPSDAVFVDVIHTDSSPIVPSLGFGMSQKVGHLDFFPNGGKEMPGCDGIWEGIGGFVSCNHLRSFEYYSSSVLNPDGFLGYPCASYDEFQESKCFPCPAEGCPKMGHYADQFKGKTSAVEQTFFLNTGESGNFTSWRYKVSVTLSGKEKVNGYIRIALYGSNENSKQYEIFKGSLKPDASHTCAIDVDFNVGKIQKVKFLWNKEPKLGASQITVQSGEDGTEYNFCSSDTVEENVLQSLYPC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of human pancreatic lipase-related protein 2 with the lid in an open conformation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Pancreatic lipase-related protein 2
total genus 127
structure length 435
sequence length 452
chains with identical sequence B
ec nomenclature ec 3.1.1.26: Galactolipase.
pdb deposition date 2007-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00151 Lipase Lipase
A PF01477 PLAT PLAT/LH2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.60.20 Mainly Beta Sandwich Lipoxygenase-1 PLAT/LH2 domain 2oxeA02
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2oxeA01
2ZJ7A 3V92A 3WA7A 4X92A 4AZ3A 1DQYA 4BTLA 1OCEA 4DYHA 5A2GA 1CQWA 4UBLA 4Q1VA 5ALUA 2W6CX 3PFBA 3WZMA 5ALXA 4LXIA 4U2FA 1W52X 3RM3A 1RRLA 1ORVA 5CT6A 3WIBA 1G42A 3G9ZA 3FCXA 2XMDA 3WYNA 2WXTA 4Y2PA 3BJMA 4BAUA 4G4IA 3FG1A 2D5LA 4S0XA 2BGNA 3IBTA 4MYSA 4E46A 1K6EA 5LZ5A 4Q3KA 2XT0A 1WPRA 1EI9A 2BKLA 2WILA 2YH2A 3DDUA 2WFZA 5K3AA 3WA6A 2OGSA 3KD2A 1PJAA 4EA6A 5KWJA 3PUHA 4AO8A 4AZ0A 1VZ2A 1H22A 3AINA 4OB7A 1W4LA 3VXKA 4M0FA 4UHFA 4UHHA 1T4MA 2EDCA 5K3DA 1FGMA 4P08A 4AB1A 3V9AA 1P0MA 5E4JA 2OG1A 4BZZA 4DSAA 3DEAA 2EDAA 1A88A 3V99A 1CUUA 5AOAA 1F8NA 2XDWA 5CXXA 1XLUA 3NGMA 4KACA 1XZJA 4O08A 1QGED 3C6YA 2WSLA 4L72A 4P93A 3M82A 5LKAA 5JIBA 5D3ZA 1HKHA 1QIEA 4G9GA 4LKOA 4MWSA 4Q3OA 4N5HX 1IVYA 3R3WA 5ALFA 1VA4A 5I8PA 1QTIA 5AKIA 1YAJA 1CUDA 3I2JA 1JMYA 1EH5A 3DYIA 4C4ZA 4GI1A 1Q84A 4DNQA 1CUYA 4B84A 2WHRA 1QIDA 1QFMA 2AJDA 5ALYA 4Y2YA 2WLSA 1I6WA 4X6XA 1CUIA 1EHYA 4F21A 3N2ZB 1Y7IA 2HA7A 1MTZA 2VAVA 1DWPA 1R9MA 1R1DA 3QH4A 4LYEA 4U2GA 5D3KA 3MGAA 1ZOIA 5AKHA 1E8NA 5AKZA 3WWEA 4A23A 5EFZA 5JANA 1YGEA 4GDMA 1VZ3A 3BWXA 1GYGA 5AIBA 4H18A 1EB8A 2JGIA 3DCNA 2OPHA 4IH9A 1P0IA 3HYSA 4B6GA 4YASA 4BDTA 5AK3A 1IK3A 2Q0XA 1UK6A 1XQWA 5HFAA 3FLEA 4BVKA 5BWCA 2GYUA 2IX9A 2V96A 3B5EA 3CN7A 2EEPA 2ACKA 1SC9A 2DHEA 2PSHA 2Y2VA 3BDIA 4EZIA 3GZJA 5AM0A 3HC7A 3MUOA 3WL7A 3BF7A 1RRHA 2XUGA 4J0KA 2ZJ6A 2CJPA 1EK2A 2QJWA 4ZRDA 1FGTA 1JJBA 4IQ4A 1ACLA 1ZI8A 1GZ7A 1TIBA 1VXRA 3U0VA 3H2GA 1FGRA 4OYYA 4OCZA 3FYUC 5ALWA 3R40A 1NO3A 1ZD3A 1VA5A 3SX4A 4A5SA 1FGQA 2ZVDA 1QIIA 2PKYX 3B3QA 4CI9A 2QJRA 2R8BA 1HBJA 3R3YA 1XRNA 5AO9A 4B7ZA 4UBIA 4G4JA 4F0JA 5AKJA 3QBJA 1BN6A 1Z68A 4MEAA 3WJ2A 4MEBA 3W9UA 4X6YA 2WKWA 2Y2UA 4P9NA 1AQLA 4CIBA 5CXUA 3T4UA 1ACJA 2XLBA 1C7IA 2WTMA 1EDDA 4PV7A 4C88A 3PUIA 1TCBA 4BBZA 1F0NA 4EY6A 3FLAA 4FBLA 3ZI7A 5C7YA 4J0GA 2O7VA 5LZ4A 2BFNA 3V1LA 3L1HA 1XLWA 4IH4A 3QVMA 2XMGA 3DYVA 1SFRA 2XUQA 5ALKA 3V98A 1K5PA 3H2HA 2FJ0A 1A8SA 4H7KA 4PSCA 1CIJA 2QKYA 2WIGA 1XZDA 3ICWA 1N8SA 1ORWA 1UK9A 5IKXA 5ESRA 5ALOA 4AMYA 3L1IA 5ALTA 1GKLA 4B9EA 4BVLA 3VDXA 5FXMA 5ALJA 1THGA 1UOOA 1QTRA 4H35A 4W1SA 2V98A 4FLMA 2ZYRA 3C6BA 1RP1A 2QUAA 4OSEA 3GELA 1WB6A 5LZ2A 3F8SA 2Z8ZA 4G8CA 2XUOA 1LZKA 3A2NA 4LHEA 2VJAA 1HDEA 2BGRA 4BP8A 5EHXA 1NU6A 2P0MA 3EQ8A 2PSFA 5JAUA 3ESDA 3TJMA 1AZWA 3FYUB 3QMVA 3WK8A 2BJHA 2QM0A 1MX9A 2CEKA 3AFIA 4C4XA 1XZAA 3D5EA 1KHOA 1IUOA 1UKAA 1XKLA 5LYYA 3MVEA 4YK7A 4J3JA 1EB9A 5HKBA 1W1IA 1CLEA 3IURA 2XMQA 5T4HA 1XFDA 5FLKA 4FOLA 2OGZA 4J0DA 1XZCA 4GBGA 4NREA 4Y2JA 5BWBA 3C87A 3H2JA 4WY5A 4X93A 1BU8A 3R3UA 2OCGA 3K2IA 2WUEA 4XWGA 1K63A 3ANTA 2XI4A 4ITVA 3W06A 2VEOA 1EDEA 4Y2UA 1Y37A 2VJCA 2OCIA 1XZIA 3A70A 3ILSA 3WK6A 4DMKA 4J0JA 4YX9A 1L7AA 3WK7A 4G9EA 4PW0A 5A62A 2RHWA 2CUTA 4UHCA 5F4ZA 1X2BA 3BL8A 4ZWNA 5JD6A 4FFVA 2XMZA 1ETHA 3I6YA 2JBWA 3FCYA 2DHDA 1GKKA 3KDAA 4X71A 1ZIXA 2QR5A 1KU6A 4X7BA 4GECA 3STWA 1U2EA 1QIGA 2HL6A 5IH7A 1DX4A 3WL6A 3I6ZA 1LPSA 1AC5A 2I3DA 3FOBA 3OURA 4U2EA 1XQYA 2XB6A 1UK7A 2WHPB 3ZLTA 1A8UA 5JASA 4DMFA 3OOSA 2J4CA 1LZLA 3WWCA 1FFAA 1FJ2A 4FLEA 2HM7A 5A6VA 4KE8A 4FKBA 4K6KA 4PSDA 3V1NA 4QDZA 3SC2A 5DYWA 4NMWA 2GBFA 2XUJA 1HPLA 3H2KA 1UK8A 1WOMA 2BAGA 4AQDA 4AN0A 2J4FA 3F96A 1JFRA 5HCUA 2HA2A 3ESAA 2XUIA 1R3DA 2BCEA 1JJIA 3LS2A 1XZBA 3EQ9A 3GBSA 3E4DA 3O4GA 4FMPA 3WK4A 4WFJA 3UMJA 4OB8A 4BCCA 3WMRA 3O4IA 2Y1KA 3BXPA 3OG9A 2XQFA 4LIPD 5JZBA 4HS9A 3F67A 2AJCA 5K3BA 4DMCA 5T4FA 3I2IA 4PO3X 4IO0A 1SOMA 4FTWA 1CUSA 2HA5A 3I1IA 5ALHA 2C0PA 2GBCA 2JGKA 3HJUA 2IIVA 4UUQA 2XUAA 2G63A 1ZD5A 2V97A 1VLQA 1CUCA 4OB6A 3QYJA 3IIIA 1DU4A 1WPXA 3C5VA 4KE6A 4EUSA 1BE0A 2QS9A 3D2AA 1VE6A 3IVMA 1HL7A 2GZSA 5JZSA 3R3ZA 4RE5A 3DL7A 3C6XA 1GPNA 4Y2RA 1RYYA 2PUJA 1QE3A 5DTJA 3IA2A 1QZ3A 4CCYB 5DNUA 1F8UA 3ZLUA 2X76A 4Q05A 1GQSA 3L1JA 1XKTA 3I1YA 2VA9A 4HVTA 1UWCA 2YYSA 2C5GA 1IUNA 1MNAA 3HACA 1ZD2P 4V2IA 5DTIA 4AXBA 5A7GA 3WWDA 3G02A 5AK5A 5LIPA 1ISPA 3VVMA 3O9MA 1DQZA 2PVSA 2HIHA 3NOXA 1TRHA 4Y7DA 1FFCA 5AKKA 5HQ3A 2JGJA 1QFSA 4JNCA 5ALZA 4UFOA 4NS4A 3C5WP 3AIOA 5FKJA 2IITA 1GPLA 1VOTA 1WCYA 3LIPA 4EY4A 2WUDA 1CR6A 4M0EA 2WIFA 1JNQA 1XZEA 5T4EA 3W05A 4HXGA 5AI6A 1UZAA 2J3QA 3DNMA 3EIOA 5J3JA 3M83A 3WL8A 4QE3A 5KBYA 1X2EA 3W04A 1MX1A 3H19A 4DMHA 3AUKA 3BDVA 1P0QA 1QMDA 1N5MA 2H7YA 3ZWQA 4UBJA 4QA9A 2GBGA 3O0DA 3STYA 4FNGA 3JWEA 3O4JA 4K6HA 5C8ZA 3C70A 1EA5A 3D2BA 2OCLA 2HA3A 3JYHA 1ODCA 5AKYA 2RAUA 4G8DA 3I2KA 4KR0A 3KWFA 3UUEA 4FWBA 2HU5A 1G4HA 3WQHA 3STTA 4BP9A 1E3QA 3C43A 2WIKA 3O8YA 1AKNA 2ORYA 3HI4A 1ZJ4A 2WFLA 1XRPA 4FDMA 1IZ8A 2WU3A 4KJXA 1QO9A 4PF1A 1X70A 2H1IA 2P8SA 5FDFA 1LPBB 3ZLVA 2XMSA 4RPCA 4WJLA 1CUFA 2HRQA 2DHCA 5AK4A 3W2TA 3CCBA 3PZWA 3KSRA 1N1MA 2XQJA 4H7IA 4GHWA 1BCSA 5EHNA 2XMBA 3AILA 5CT8A 3GA7A 1CUBA 2WQZA 4QDXA 2XUDA 5CT9A 5A71A 1LPAB 1U8EA 4PNZA 4WDRA 5JALA 3DOHA 3FVTA 5JD5A 4WFOA 4I19A 5FPQA 4OYLA 4MJ3A 2B61A 4Q3LA 1OILA 1CPYA 1XRLA 1JT2A 1JI3A 2GBIA 2JEZA 3G8YA 2ZJFA 2H7CA 4E14A 4F60A 2RI6A 1TCCA 2UZ0A 3BIWA 5AM1A 7YASA 5A7HA 2CBGA 5FRDA 1TAHA 3E1GA 5AICA 4QWMA 4ZI5A 3LP5A 4QDOA 2CZQA 4JYMA 1J06A 1G66A 2FUKA 2PBLA 4X3CA 1QIFA 3V1KA 3WWOA 3FNBA 1YR2A 3WLAA 1WM1A 3F98A 3BIXA 4KRXA 1CUXA 5ALRA 5ALMA 3K6KA 3BJRA 3WJ1A 4WFIA 4FNMA 1EDBA 4INZA 4MXDA 4U2CA 2HDWA 3R41A 5AHXA 4P92A 3BE8A 4E15A 3D4LA 1CUWA 4IH1A 4L3WA 2DR0A 4KAAA 4CG3A 1BCRA 3HRHA 4C01A 3VJMA 1MJ5A 5BOVA 1BEZA 2VSQA 4BCBA 2HFKA 1K4YA 2J3DA 1AGYA 2DCMA 3O9VA 2Z3ZA 2LIPA 4WY8A 2I78A 4CCYA 4GW3A 2DQZA 5HK9A 3I2GA 3TEJA 1YS2X 2G5PA 3FYTA 5FPPA 1YS1X 1NX9A 2WXUA 4UBOA 1CQZA 3PI6A 1FFBA 1PV1A 3GUUA 1LLFA 1EXWA 3D0KA 4B83A 5ALGA 4D9JA 4YPVA 2QVBA 2H7XA 3EBLA 4H77A 2C4HA 5ALDA 3QZUA 4BAZA 4KEAA 1MN6A 3G0GA 3PICA 3HABA 1XZGA 5AKLA 2QT9A 1UFOA 1XLVA 1MAHA 1O6FA 3N0TA 3K9BA 2VQ6A 4A16A 4DNPA 5YASA 5ALVA 1H2YA 5I7UA 4BB0A 4X94A 5HZGA 3OM8A 2PSEA 4HTAA 4MWTA 1AURA 1MNQA 5AOBA 1QM6A 1XRMA 2GZRA 5FOQA 1SCKA 4MYDA 4DSZA 1Q83A 1A8QA 1CUHA 2V9ZA 1AUOA 1DX6A 3EQ7A 3FAKA 4N8SA 3T52A 3AZPA 4ARBA 1QO7A 4MQLA 4G5XA 2Y6VA 1LPNA 2CMFA 5AM4A 1CRLA 4UHBA 4CG1A 2PPLA 1Q0RA 4EY8A 1YA4A 3H04A 4Z49A 4OU4A 4AN1A 5T4BA 3WK9A 1QOZA 4FFWA 3GROA 5HFNA 1XZHA 2G4LA 1BROA 1J1IA 2XQKA 1JKMA 3KOOA 4UPDA 1XZFA 2H9YA 5E2IA 4ZGBA 3CCCA 3RARA 1U4NA 4ARAA 4C87A 5JADA 3RK4A 1O6GA 1CV2A 2VTVA 1LPPA 2GYVA 3BNDA 5E4TA 1XQVA 1IMJA 5C8VA 3WKDA 4F5ZA 3PFCA 2I03A 5CRIA 4BRSA 2WG2A 2HFJA 4X97A 1Q0ZA 3CXUA 5CH5A 4C6HA 5D7BA 4GEGA 5JATA 5JAOA 4X00A 4C89A 2WY6A 3RKSA 4BAGA 5C8XA 2Z5GA 4FHZA 3R0VA 5CMLA 4B81A 4KE7A 5LZ9A 1DWQA 1EVEA 1GGVA 3X3HA 1Y7HA 1XRRA 2Y6UA 3PF8A 4AO6A 4L9AA 4Y2VA 3SWWA 4BE4A 3H0CA 1DT5A 3A2MA 5AJHA 3E0XA 1OLPA 1K8QA 3STXA 3BNBA 4XJVA 3H1BA 4LYDA 2WUFA 3I6MA 1CUVA 5EIHA 2WIJA 5A7FA 4BATA 4W9RA 5LLSA 1TKRA 2OQIA 5ALLA 3H18A 3FSGD 4UBKA 4ZREA 4QDUA 4Y2XA 3V1MA 4N8DA 3SK0A 2JGMA 5IVKA 1VXOA 3QMMA 4XVCA 1KU0A 3IUMA 3NUZA 1B6GA 3H17A 1TCAA 1ZICA 2W22A 2QTBA 1FFEA 4DM7A 3FWHA 2WU4A 1N5RA 1R50A 1F6WA 2C0QA 3DOIA 2DFPA 5LKRA 3QPCA 1YB6A 3VF1A 5AKGA 2WHPA 3DLTA 1PFQA 3I2FA 3QPDA 4HAIA 2B20A 4BCDA 3ESBA 4UFPA 5HF6A 3LIIA 4OUKX 5FUMA 4J7AA 4EY7A 3VKFA 3ESCA 3DQZA 2HU7A 1MAAA 2OLEA 4B80A 1LPOA 5BV7A 3O95A 3WZLA 5ALEA 5AIAA 1ROVA 4B0OA 2PUHA 1UKCA 3KXPA 2HA4A 4Y9SA 2WTNA 1XZKA 5AM3A 4L0CA 5AKEA 2ROQA 1R4ZA 1YA8A 3AIMA 5DLPA 3IUNA 3WKBA 2DSNA 1ODSA 2FX5A 4HXFB 3VJKA 1Y4KA 2BUBA 1MO2A 5ALPA 1JU4A 3F97A 1ODTC 2WIDA 4AX4A 4DNFA 4H7HA 4QZVA 2WJ6A 4BC0A 4UBNA 3WIOA 1JMKC 1S8OA 3FBWA 2VJBA 4RGYA 5AKXA 2BUAA 5AI9A 5JARA 2SBLA 1CUEA 2OGTA 3DKKA 3FSGA 1JJFA 3A6ZA 3IULA 4GXNA 1H2ZA 4TPKA 1ZI6A 1QIKA 1RWQA 1LPMA 5AP9A 4G1FA 1EK1A 5JD4A 2ZSHA 3OPMA 4Y2QA 4DNOA 2WJ3A 3I2HA 2AJLI 5ISMA 2OQVA 5DNVA 4OD0A 2C7BA 1VE7A 3OC0A 1EINA 1XZMA 3IDAA 5FV4A 1FGOA 3LCRA 4B85A 1THTA 3M81A 4AMZA 1DTEA 2XLCA 3H2IA 3WK5A 2VF2A 3S2ZA 4GLBA 3I28A 2XUKA 1IUPA 5KWIA 3PF9A 1XRQA 2RONA 3GFFA 2WFLB 5AI4A 2K2QB 1QONA 4QWTA 4KYVA 2WFMA 4WCVA 2JF0A 1VJ5A 1FSSA 5K3FB 1TQHA 4X90A 2XMCA 5EIAA 4U2BA 5LZ7A 1ZJ5A 4BVJA 2PL5A 4B82A 1HLGA 4ZXFA 4HRXA 3ANSA 4B0PA 1YB7A 2WHQA 4B9AA 1DT3A 4W1PA 3AZQA 1USWA 3P2MA 1UOQA 2ZYIA 5AI5A 2QZPA 1ZGBA 5EIEA 4X95A 4H7DA 2VT6A 5DYTA 2R11A 2B4KA 5IVHA 1YASA 2O7RA 3AJAA 2PSJA 4CG2A 5C81A 1C4XA 2VATA 3KWJA 4TGLA 5SYMA 4JH0A 4K6GA 2B9VA 1L7QA 2JGLA 3DL4A 4G4GA 3FG4A 1LBSA 3V48A 1J07A 5HF9A 3WKCA 4BE9A 4QWWA 1CFJA 5JAHA 6YASA 1H2WA 1AX9A 2QUBA 4FBMA 1G5FA 4DIUA 3S8YA 3C8HA 3WWPA 2IUKA 2AJ8A 1MPXA 4Q82A 3FLBA 2VAXA 4BYMA 1UOPA 1ZI9A 1LNSA 2AXEA 4HZGA 4QEKA 1CVLA 3EF3A 4UFNA 3ZPXA 1TK3A 5EGNA 1L7RA 4Y2SA 3D3NA 1YCDA 4WDQA 4QDTA 4NVRA 1LNHA 3O4HA 3HLKA 1YAHA 1A7UA 4NZZA 3IB3A 5K3FA 4PQEA 3YASA 5JZ9A 4N8EA 2DQYA 3QMWA 1SCQA 2XUFA 3R3VA 1W75A 3WKAA 2QMQA 4J0IA 3IUJA 3MUNA 3PE6A 4EY5A 2CKMA 1QIHA 3ZV7A 4DTCA 3W9BA 1C7JA 3H1AA 4QNNA 4LXHA 3HZOA 2O2GA 1WB5A 3CWZB 1HQDA 5CT5A 5FP0A 5EHQA 1VKHA 1NU8A 3F9CA 3STUA 2ZYSA 2D0DA 2WJ4A 4BDSA 5CBKA 3U1TA 4LXGA 3G0IA 5CTAA 2JEYA 4UHEA 1CUJA 2OAEA 3Q0TA 5ALSA 3WL5A 1ZIYA 1IZ7A 3BF8A 1KEZA 3VVLA 2Z3WA 3CN9A 2HA0A 5HF8A 4C4YA 5KREA 5DWDA 2JGEA 4FLFA 5I9IA 1XZLA 2ZSIA 5IVDA 5JAPA 2QOEA 1BN7A 2QXTA 3G0BA 2FJPA 4U2DA 5AH0A 4OPMA 2ONCA 1MT3A 5CH3A 5K3CA 3D59A 3G7NA 4EB0A 1CUZA 3ED1A 1EVQA 5AM5A 4X91A 5CW2A 1P0PA 3AZOA 3G0DA 5DJ5A 1DINA 2JGFA 4JEIA 4M0MA 4CCWA 4XX1A 3Q8WA 3C6ZA 4MQMA 2BUCA 1MX5A 2PU5A 4K5QA 3WKEA 2WUGA 2PU7A 2OCKA 4QLAA 3BNEA 1SCIA 2I3ZA 5D6OA 3FVRA 4BC1A 3DS8A 3VISA 3WYDA 1GT6A 3WI7A 5H3HA 1WHTA 4EHBA 4J0CA 1QLWA 3BNCA 1E66A 4ROTA 4TVKA 3DD5A 1XQXA 4AO7A 1YSCA 4JUIA 5HQ3B 5K5EA 2RGUA 1E89A 4I3FA 5AI0A 4Y2TA 2X5XA 2XMRA 3AIKA 4ZV7A 1WB4A 5HF5A 1CA1A 1UXOA 1F0PA 3A2LA 2NW6A 4X6UA 3C8DA 4RNCA 5HKAA 4G8BA 2JIDA 4ETWA 4W1QA 3TRDA 2HRRA 4H7FA 4KAJA 1BS9A 3VJLA 4JYPA 1LOXA 4H0CA 2RIPA 2ECFA 4H7EA 4BTVA 1EX9A 2VT7A 1CUGA 2C5FA 5HK8A 1DWOA 5IVIA 4XIIA 3C45A 3R3XA 2XE4A 3ICVA 2YASA 5EHZA 4W1RA 4IHAA 5CH8A 5ALQA 4J03A 1T2NA 5AI8A 5LZ8A 2PSDA 1BRTA 2AJBA 2QRUA 1QJ4A 5ALNA 3IUQA 2HA6A 2C58A 2HADA 4HXEB 2X8BA 2IUJA 3G9UA 3LLCA 5SYNA 3OTQA 1UKBA 5AM2A 2XUPA 4Q34A 4K2AA 5AOCA 1WHSA 4PSUA 2G5TA 1CUAA 1GQRA 3UUFA 4I4CA 5AK6A 4J0HA 5LP1A 4CIAA 1H2XA 4KE9A 3HSSA 4WFKA 2HHAA 3G9XA 5ALIA 2Z8XA 3G9TA 5CURA 3QM1A 2HU8A 1H23A 2PX6A 2WM2A 3STVA 1JU3A 1GPKA 2WG1A 4ZV9A 4QLOA 1UT6A 4RE6A 1R88A 2XQIA 1ZGCA 4OU5A 1MU0A 3QITA 3QPAA 1E8DA 2XQGA 4WHAA 4BRZA 2ZYHA 2GYWA 3DJYA 5E4YA 2QXUA 1LBTA 4E11A 1AMNA 2WG0A 3PDCA 2OAGA 3HXKA 3D7RA 5DYYA 4DGQA 1M33A 4HRYA 4KAFA 4EBBA 3RLIA 2CB9A 1BEEA 2RHTA 1B41A 3HEAA 3FYUA 4BZWA 1GXSA 4CFSA 3M3DA 3JW8A 1HU9A 2PM8A 5EEOA 4KRYA 5DNWA 4UHDA 3FG3A 3TGLA 4N5IX 4H7JA 1E5TA 5EI5A 1XROA 5JYCA 4GWLA 1N8QA 2O2IA 2ACEA 3B12A 2OXEA 1OXMA 4UBMA 1D07A 1R9NA 1CEXA 3D2CA 2XUHA 5CT4A 3NWOA 3E3AA 2VJDA 1LGYA 4DLNA 1E8MA 4X85A 2YXPX 2FNQA 1W6RA 1W76A 2E3JA 1ZD4A 1J2EA 1QIMA 1FFDA 2ES4A 4W63A 1U65A 2O2HA 5K3EA 3DKRA 1QIJA 3G0CA
chains in the Genus database with same CATH superfamily
3S4YA 1BDHA 2I3GA 4RSHA 3VSCA 1UPTA 5CK4A 3W5VA 3T35A 5KWEA 3SN6A 1XJQA 4QBHA 4NV1A 4X92A 1NOKA 2RHCA 4K40A 4NG4A 4PGHA 4F92B 4CVNA 1WXDA 2GHRA 5AHWA 1XWIA 3MHTA 3MTGA 4PTZA 1OCEA 3OQ6A 4U3JA 3TAUA 4DYHA 4DA0A 4O3FA 4KIWA 3AUFA 3FHCB 4X84A 6NULA 2O5VA 1PZGA 3OOJA 5EY5B 3V4SA 3N8IA 2VUUA 1UMBB 5ALUA 5IDXA 3RYIB 3KKQA 3TRIA 3PFBA 3WZMA 3R9WA 1VE1A 1Z8HA 5JI2E 3B20A 2WINI 3ETNA 1GU0A 3PP8A 4FT4A 3LHSA 4LXIA 3SJBA 5HQTA 3RM3A 3BWBA 4EITA 4RKYA 1WLSA 2FSFA 4MUAA 3DE0X 3D8TA 3WIBA 5IS2A 1Q77A 1LK5A 1TIPA 3CPEA 4KGXA 3R7AA 3NAQA 7AT1A 1G42A 1E2BA 1ZIOA 4YDHB 3G2LA 1ZNZA 1KVTA 2IIPA 4WERA 4K9KA 4F85A 4WUVA 5LP6A 1HQCA 1YQ9A 3OX3A 2F3RA 2ZPAA 4I9FA 3KSBC 4BAUA 1ORRA 1QUFA 4LJLA 4G4SP 4TSRA 3U40A 2J9GA 5LMZA 4XB2A 4S0XA 1OV4A 1IIRA 1MR3F 3IBTA 5G3ZA 4WFQA 3RVOA 3B2EA 5LZ5A 2X13A 2WB2A 3DWGA 4EFNA 1FIUA 5H16A 4U7HA 5LCXA 1N6RA 3HYLA 3OTGA 3F46A 5TDHA 3DDUA 3WGZA 1DDOA 3VSBA 4F11A 2FSVA 3CWCA 1E1QA 2B4RO 4AK9A 5DM0A 5TS3A 3WA6A 2OGSA 3KD2A 3P4YA 4ALNA 1SCUA 5GWXA 1PJAA 1Q44A 3IIJA 5DGTA 4XQ0A 4Q7JB 4EA6A 2BEUA 3PK0A 2OHOA 1WO8A 2GA8A 2OXCA 2ENWA 2JFVA 1OOEA 3KQWA 1ZKMA 4KAXA 4JGIA 1JWBB 2QUHA 3QRWA 2C2WA 3A9VA 3MYYA 2E5LB 1W4LA 4RENA 5KX5A 3WLHA 3VXKA 4M0FA 3MLAA 3DZKA 2CXPA 2Y05A 4BO8A 2H5JA 1X7ZB 4FFPA 2EDCA 3K09C 3QBDA 5FWNA 4DB4A 3SFZA 1SXGA 1O87A 1LXCA 3OHMA 3OQIB 3QYAA 1SD2A 1OF1A 4B3TB 3KEOA 1O6CA 1FGMA 1XMXA 4P08A 5BVHA 5JMWA 3VVBA 4MWZA 5LQDA 3TTWA 1B8NA 1YCFA 1GPBA 4XJXA 3VC2A 1GLNA 2JZCA 2B1IA 2VWGA 4DSAA 5AVVA 4X8MA 1KZ7B 4Q48A 3WMXA 2G77B 3PSHA 1GDHA 4ZO9A 4W5TA 3GDOA 3S2FA 2C5SA 1EVKA 1XTRA 4DM3A 4L73A 3U4MA 3TOZA 1TK9A 3PPVA 2P3OA 4AY2A 1JFSA 2PJDA 4CGYA 2GKGA 4OBEA 2Q41A 5CXXA 1WMAA 2WK1A 3BVPA 4ZQIA 3NGMA 5I7OA 3V8PA 2JA1A 3GOQA 4RLQA 4O08A 1C7QA 1QGED 3V46A 4CV1A 1G1MA 5IDWA 5F1YA 3M82A 3ND5A 4MIEA 3RYHA 5JIBA 5LKAA 2VDNB 2P2SA 2RH5A 3LY9A 1LD3A 1HKHA 3FOWA 4RGBA 4BLPA 1M2NA 5I01A 3ADDA 4TLEA 4BNDB 2Q3HA 1QHNA 2ZBRA 5MFZA 7REQB 2VTKA 4FYPA 3ZLJA 3UJ7A 3R3WA 1L4MA 1WVIA 3DJFA 5AKIA 2VEDA 2FY8A 1NF2A 1LBIA 3I2JA 2EG5A 4R83A 4WXYB 1L7DA 1GUBA 3B78A 5DEIA 2QN9A 3BGVA 3S55A 3DXXA 1RQGA 2Z57A 3VAYA 1HYQA 3WBJA 5J1SB 1B93A 4GSKA 3NUQA 2TMDA 4CEJB 3VR1A 3DYIA 3X2FA 4GR4A 4E1AA 4MP6A 4GI1A 1YF3A 1Z2CA 1I33A 3OZBA 3G0HA 5KJ6A 3PA6A 2JRLA 3CH4B 4KP7A 4RAQA 1FSGA 1X39A 5IH3A 2NSDA 2WHRA 3G7SA 4TXLA 2V6BA 4WESA 2Z43A 2PYZA 4HVLA 3D0RA 3ZWVA 4ZOBA 4A6EA 5BYKA 3LRPA 3UT5B 2O5EA 1H8EA 4E33A 3UT5A 4WX2B 1CUIA 4F8YA 4MVJI 4F21A 2C59A 4UC0A 3N2ZB 3R9IA 4QUDA 4EJSC 1TMKA 5TPZD 5DK6A 1E9DA 3TO5A 1RCFA 1NVEA 2WWIA 2VP3A 3QH4A 3CHYA 4LMPA 4LYEA 2E1PA 4U2GA 4D8XA 5A3RA 1Y81A 3GLUA 1Q1BA 2W6JD 1T0PA 3EPKA 2ACVA 3VYVA 3SCZA 2FR8A 1L5RA 3IEIA 2VR1A 3RG2A 2WFAA 3DUWA 1OFUA 1ZOIA 3KZCA 3OA0A 1N2CA 1U8ZA 1NXWA 2AEEA 4F3TA 3WWEA 4PTLA 4NF2A 1W88B 4JVSB 3EUWA 1KDOA 4A23A 3UBMA 5F23A 4MOWA 4UHJA 4CIWA 1GQFA 1KBOA 3I0NA 2V3CC 5LOVB 2O4UX 4OH7A 4QX6A 4A26A 1UAYA 1VLMA 4MNTA 1GYGA 5DX8A 3T3PB 1G2IA 3DE6X 3UG6A 4R71A 3HKBB 5EJ7A 4DB2A 2DQKA 3RVNA 1M2GA 3F47A 3G6KA 3EZ7A 1Y6QA 4H7PA 2NTVA 3GJTA 4CFYA 4O4IF 2M32A 3K1AB 3TLBA 1LJUA 3EQZA 4CTKA 3DCNA 4OQ4A 3M1IA 3KSUA 3VNQA 4H1VA 1ZCAA 4EKGA 3R20A 2EFYA 2QE7A 2GARA 1EESA 2GK4A 4YASA 4BDTA 4GI3A 2VN8A 1V8PA 1T34A 1SA0A 3AWIA 3TD6A 1GDTA 1MC8A 4G41A 3FJYA 1IK3A 3LT1A 1HNZB 4FIZA 2R4UA 2E4UA 4MHOA 4FZ3A 1ZK0A 4WLVA 1SD1A 2NU6A 2RJOA 4BVEA 4LE2A 1D7OA 4CV3A 4MGKR 2L19A 1ATIA 1MDFA 2GF0A 1YK1A 2PBZA 3B48A 5HFAA 1UWLA 4QO7A 1P7CA 4BVKA 5K0SA 1FX1A 3OLYA 2A9VA 4AP6A 3T9BA 1CVIA 2V96A 4TUYA 1XE3A 2EEPA 4D4HA 3DAFA 2PSHA 5F7JA 3BE5A 2ZRPA 2P6UA 1YONA 3VOBA 1CJVC 2YN4A 2C4WA 3LHFA 2QZ4A 3BF7A 8ADHA 4JC8A 3I8XA 1FPMA 3COPA 2YR0A 1YDGA 2XNHA 2XUGA 1HRDA 4GNKA 4O4IA 3RUAA 3TMYA 2BFDA 1JNXX 3L0ZA 3IUEA 4KQEA 3JTMA 3CKKA 3GEHA 2PANA 5F77A 4DEYA 1OAOC 2BEVB 1EK2A 3MJ4A 1FW6A 1PNVA 4UUOA 3ER8A 1MZVA 2EX0A 4ZRDA 2BHSA 3WE7A 2AG0A 1BQ3A 4IOKA 4F45A 1YS9A 1ACLA 4LBWA 2BFFA 2ZTLA 2BZGA 2OR3A 2HW8A 3N70A 4ENRA 1C9DB 1ZI8A 1Y1QA 4F6LA 1AKYA 5TARA 3JQFA 4KTVE 4Q00A 1TIBA 3NOVA 3JASA 4P3NA 2P9GA 2QJTA 3I12A 1MB4A 1LFDB 1JIIA 1V26A 5L4NA 3LT4A 5HIAA 3GJRA 2I62A 1GNPA 3DHYA 2JLXA 3O7WA 4OYYA 3RTEA 4REQA 1U3UA 3Q5GA 1NMYA 5EERA 1UBGA 5CA1A 1RVV1 2LUOA 1ZRSA 3BZWA 1HZZC 5CA1B 2YY6A 1EXMA 4ZO6A 3DE3X 3AEUB 1HMPA 4OQDA 5J4LA 5JDCA 2P9ZA 1YR9A 3LF2A 4OQMA 5C46F 5CDSA 3EY9A 1RMYA 3P52A 3GHHA 5FT9A 4W7IA 3SX4A 1Z4MA 4JLNA 2HJ9A 4A5SA 4KIUA 4IQ0A 4AKGA 3CFYA 3NTLA 1D2EA 1YS6A 1U1CA 4L8LA 1ZMRA 5CFRA 2PLRA 1J21A 5DXFA 1VHJA 5LJLA 2DFVA 3B9RA 5IXSA 4DQKA 4CI9A 3I61A 4LZNA 2A6PA 4IIJB 1XJ5A 2R8BA 5EXXA 3C6MA 4JUFA 5EWMB 1WCIA 4L02A 1YDWA 4YBRA 2AB0A 3I3OA 4QGBA 4HAVA 4X9XA 5B6IA 1QPGA 1NFQA 3LNTA 3OOWA 4AG3A 5I9LA 4ZAGA 3ENKA 2XTNA 2XYRA 1ODFA 3P26A 4YAIA 5AKJA 2AKYA 4YUVA 1JVSA 5HUQA 2YX1A 3TVTA 5AW4A 1HRKA 2DLDA 1VSQA 3A1DA 4MV6A 3DZ8A 1HXHA 1ZL2A 1Z68A 3ZE7A 2XWBF 4P3OA 5GIPE 1KP2A 4ZFNA 1AHPA 1RSZA 1VC2A 2H1VA 3HYCA 1V25A 4NCBA 3WJ2A 2X5NA 3GOHA 4MEBA 3DCIA 4CCSA 1K92A 4F1JA 2XVAA 1YU9A 2GN2A 1GO2A 2WKWA 2Y2UA 3DBLA 4H59A 4HFNA 3KPYA 4M86A 4P9NA 4Y9RA 5AUPB 1I2BA 2IS2A 4D26A 2D8MA 4B75A 4CIBA 5CXUA 4NYIR 1UZUA 4OBXA 5B6JA 3FWKA 1NUQA 1W5EA 4A3SA 1FP4A 1SHUX 2XLBA 3AFOA 4OG2A 5LBIA 1ICIA 1RE1A 3QPWA 4B4DA 5KTMA 2V55B 5KQGA 1A95A 2OGWA 4BBZA 3GG2A 1F2UA 4B2LA 5JU6A 4OHYA 1IULA 1G9XA 3HXLA 2Q0SA 3DDCA 4MUJA 1KRXA 3KLMX 2X8JB 5GP1A 2GPJA 3ZCXA 3HBJA 3LOQA 3ENNA 2C4NA 1JZSA 3FLAA 4FBLA 1VBFA 2FEPA 1Y3AA 1ZGHA 2F43A 1UBOS 3A0UA 3EZNA 2R66A 4LI0A 4D0LB 4XYLA 2PUVA 2O7VA 2IHYA 3ED5A 3EPPA 4IX1A 4MW2A 1JPUA 1RLOA 3DG9A 3HA5A 4P2GA 5E7MA 3V1LA 5DNYB 3EFOA 1NUHA 1QM5A 1XTKA 3NORA 4U7DA 1RWXA 2OLKA 4KH0A 1Q7TA 1M76A 4ZCRA 1IBMB 5I51A 4NU0A 1M2VB 1V8ZA 3B89A 1R0ZA 3MD9A 4AJ4A 1KMMA 1GGKA 4DJJA 3IJRA 4RU1A 2LKDA 5ALKA 1E6WA 3FYCA 2RK6A 3ZK7A 5K0JA 3C3WA 2CBXA 4Q37A 5DNEA 4H7KA 2Y4OA 4PSCA 5EJ6A 3PE4A 2Q1XA 3LV8A 4RQBA 1Q20A 3GJZA 2WIGA 1OFUX 1XZDA 2ERXA 3BJIC 4OQPA 5JQGF 1XU9A 3E9CA 3HGMA 3U7GA 2GEKA 1C50A 4Q7MB 4UUMA 5TJ9A 4ZT6A 2FB9A 3L07A 4ZPJA 3L6RA 4FT2A 4D9CA 1A4RA 3DQQA 4RADA 2X15A 5ALOA 3RTCA 2QZJA 1JFLA 3BREA 4AMYA 1QDUA 3KE8A 2QMEA 2IVZA 3AKDA 3LKDA 2G1AA 2ZIGA 1EGHA 3ABOB 3K0BA 3VDXA 4YCLA 1M7BA 5B4VA 4XASA 3O4VA 2TMKA 4PRZA 1QTRA 2W6NA 3IT3A 3K73O 1HO3A 2FMUA 3PDHA 3NTXA 1AK2A 4XIJA 5FR2A 1GQQA 2V98A 1XD2B 4MVXA 1TTQB 3QKIA 4FLMA 4ZAWA 1MG5A 4YROA 4D0RA 3ZVNA 3NBYC 1F9AA 2O52A 4IP0A 3P27A 4OSEA 4RL6A 4CLOB 4KXXA 4R9VA 5DHPA 2FHPA 4JEMA 1FU7A 2XUOA 1F5NA 2FW7A 4PC3A 3T1TA 3SXUB 2CHEA 3A2NA 1BKDR 2X7XA 2I2XB 4DR6B 2OLJA 3A1CA 2OZPA 4RJ2A 4FQ5A 2JZNA 3ZDDA 2H2DA 4OM7A 2H0QA 4LGYA 5SZIA 4BP8A 5B30A 4NBTA 1KJQA 3IMKA 1I3CA 1EM8B 3EQ8A 1DOZA 1UPCA 1VCIA 1PR3A 2HO5A 3CO0S 5T3UA 3TJMA 1PQYA 4KVGA 1L4UA 4C1BA 4KPGA 1GM5A 3QW4B 4MYCA 5K9ZA 1V1RA 3LPCA 4J7CA 2QM0A 4I1RA 4IG4A 2RKOA 4A2PA 5BYJA 1Q6ZA 4DREA 4KOAA 4RESA 4F96A 2YHSA 1G8GA 2QU7A 2ZWPA 5FBWB 3SLKA 4C4XA 2VLIA 2OTCA 1GN8A 4RCZA 1FP4B 1KORA 3PC7A 1DI0A 1SAYA 2XCUA 1N6IA 3GBPA 3IBYA 4X44A 4IDAA 5LYYA 3TTSA 3NVAA 2R85A 4YK7A 5DCWA 1OXKB 4TROA 1ABFA 3FHTA 1H0RA 1R5JA 2REOA 3IEUA 2RHOA 2GM5A 3F90A 1T3HA 1WY5A 2XIJA 421PA 1X9GA 2PGXA 2AZTA 4BMDA 5FPKA 5GIOE 5EJ8A 5JH7B 1X87A 3P2JA 3K0KA 3OA2A 4QVKA 4FOLA 1OI4A 3RS8A 1TYCA 2ZXFA 3FRIA 2H2HA 2HNKA 2TMGA 4PZ0A 5J2TB 4O02B 5HIIA 4I08A 1BYIA 1H9CA 1Q7EA 3WDMA 1N9GA 4ZXPA 3QIVA 1OYWA 2ZAOA 4KBYA 1XZCA 4D79A 4F4UA 4V3BA 4NREA 2WT9A 2C7OA 5I8WA 4RELA 1HYHA 4ZPXA 3AL0C 4LDJA 1WXWA 1OTYA 2PBFA 3FE2A 2ATVA 4QAQA 5BWBA 2WM8A 5F35A 3H2JA 4WY5A 1RABA 1G6Q1 3GWGA 4C9BA 1P9LA 3KZVA 1R7RA 6PFKA 3UN1A 3G0OA 3R3UA 3ZQ4A 3H5WA 3K2IA 3TPZA 4D0NA 5H0IA 2VJOA 3L4SO 3E5NA 3W0LB 4D46A 1E5QA 4XWGA 4ZYTA 3P5SA 4LYGA 1I2CA 2BOVA 2HYDA 2IXBA 2VDMB 2Z58A 3A6KA 4HWKA 4LPKA 3DEIA 4AFNA 4WECA 4AS2A 1NFRA 3RRZA 3Q10A 5KZMB 1T3GA 2NU9A 2VEOA 3ZBTA 4NZNA 2V9CA 4Y2UA 1Q0TA 3H05A 4IWYA 2WWFA 1QRSA 4LJ9A 1BGXT 2W2VA 3FFTA 3FPAA 1WZ2A 1BXGA 3QLUA 1TAQA 3FGZA 2OCIA 3NUGA 1Z4LA 4RW0A 4YCAA 2A9JA 2W8BB 5DX0A 2WA2A 3HMQA 3OZAA 4J0JA 2R1VB 3AJRA 3UGJA 1BXRA 1KEEA 4KIFA 5C9ZA 1UOEA 3CG4A 5IJXA 5H1YA 3UCXA 5LWQA 4G9EA 2ICAA 5DISB 4B40A 2JLCA 3S5UA 3L4BA 4JBGA 4BLUA 1Q11A 1O4WA 2BMJA 3GDFA 5F4ZA 3OHPA 5JD6A 2W48A 3C3KA 1XDZA 5JNLA 5TJHA 1PJ3A 1ETHA 1KIMA 1I7SB 1PRYA 2JBWA 2O7NA 3FCYA 3OZGA 4LRXA 1QHSA 4BBAA 1Q21A 1U5BA 4MRVA 5BPFA 4RLFA 1C80A 3I2YX 3PFGA 1DXOA 1UM8A 4UM9D 4X71A 1ZIXA 4EHFA 4OYHA 1DC3A 3ZI4A 1II8A 1B1AA 1T6YA 4IAOA 4LSWA 4RH3A 3ZQUA 1KU6A 5MN6A 3JQGA 3NWEA 4Q15A 2W0SA 3A6DA 2A0WA 4R5MA 4DDWA 5L6LB 3STWA 3KQLA 3PJGA 1ZW1A 2FQ1A 4L74A 1P17A 3ONWA 5JSKA 1PNTA 3GUYA 4ZQCB 3T8YA 5BRJA 3WL6A 3C3MA 3NHAA 3GA5A 4ZHQB 2FEMA 5ERXA 1ULSA 4JIGA 4ZEXA 2V4MA 1D3AA 2O8VA 5EUCA 4DUGA 3MLBA 4UNIA 3U3RA 4XVUA 4FFNA 3T1OA 3DEZA 2WOJA 4I36A 4U2EA 4UVDA 1IHYA 2C98A 2GMWA 3GCGA 5F33A 1SZDA 5L3VA 1QSGA 2ZWIA 3CG0A 5IYZA 3EJWA 3JQBC 2C1ZA 4UCFA 4ECEA 1WG8A 3GQBA 5C8YF 1Z0UA 4RS3A 3W2IA 1DKLA 5FUBA 3GYGA 1GEEA 1R0KA 2FPXA 3OOSA 3EVCA 1SM4A 3DHVA 5KTPA 1TXGA 2P6OA 1SCNE 2PKCA 3O26A 4Q4DA 1MAVA 4EYQA 1K8ZB 2I2FA 4S1VA 3NBKA 1PWEA 3AG5A 4RKQA 1FMFA 1NJ8A 2GZDA 1R8YA 2KWIA 1LZLA 3U1BA 4RZHA 4BV8A 1ZNYA 1VECA 4IJMA 1GA6A 2V7EA 4IEFB 1LW7A 2B37A 1P7ZA 4C5BA 1FDRA 3PHIA 2XXJA 4PU0A 3O93A 2JANA 5LNK6 4Y6LA 2H16A 1VP3A 1GZ3A 1QRRA 4K6KA 1X1SA 1XTPA 2BEUB 1VL2A 2REQB 2XT6A 1MT0A 1B0ZA 1GCOA 1O9GA 3MRXA 3OIGA 4Z8YA 4NMWA 4O1MA 4YP1A 3SC2A 2JS7A 3TLEA 3LP6A 4XYGA 4EW3A 2OC9A 2RI1A 2VK2A 4TV9F 1WS6A 2XBMA 1HPLA 1IU9A 2OESA 1O89A 3DHWC 1SQSA 3H2KA 3IS3A 4PYNA 1WOMA 4C7OA 2BAGA 4CR7A 4AN0A 5KNCH 3MYRA 4O2RA 4BEJA 5L3SB 4WI1A 1ZOSA 2XA1A 2HEGA 2WVHA 5TY0A 3TZHA 5B1EA 2Z4SA 1FF9A 1R3DA 3COZA 2GPBA 4RLSA 4TTRA 1L5KA 4KITB 4QRDA 1NE7A 2ENUA 3TW8A 5JYEA 3DCJA 1Z2OX 3DULA 4KLNA 2EF0A 1XZBA 5DNAA 1H2AS 2P11A 4OQNA 1RMQA 5HM6A 1W2GA 1YCGA 3HP7A 4C21A 2F1KA 5CNJA 5EQJB 5FBZA 2EIXA 2XYQA 2C2OA 4HN9A 4B46A 4LIPD 2DQ4A 1NVVR 4HNQA 1NE2A 1G5IA 1U2GC 3EHDA 1CSEE 3PR2B 4P54A 3GNQA 4M87A 4WKCA 5K3BA 4B6RA 1FNCA 4JBWA 1U8XX 4MMYB 4Q18A 4BGUA 2CYCA 3A9SA 2ZULA 4QPPA 4UTZA 2JFHA 1VKOA 2FP4A 3L0OA 3QFCA 5IBQA 2HHLA 3CRW1 2QRGA 4PO8A 3FMGA 5JO0A 2O0LA 4XDHA 5EXTA 1GDDA 2C0PA 3O2QB 3SSAA 4KSBA 4OIFA 2CHFA 3QMPA 1E18A 5FOSA 2G63A 3ETLA 3MG9A 4FGJA 3GLHB 1NVMB 1WE2A 2IP2A 3R0IA 4IGAA 5T41A 2OGUA 2V97A 3K5IA 1FDSA 3E3MA 1A7JA 2H3HA 3TK1A 3DEFA 1LV7A 2R7LA 1ZMXA 4GZLA 4LY6A 2RAPA 4N3NA 4YJDA 1V8FA 4OB6A 4X1YA 4NARA 1P1BA 3ONVA 1B7GO 5FUVA 1X7XA 4G07A 4K81B 2PXAA 4HRVA 2GZ2A 3WB2A 3H6KA 4EFMA 1N5OX 1T8TA 1FUYB 2FW1A 2GEFA 1ZCJA 2HLNA 3DZHA 3H86A 1VE6A 1NGSA 3QA9A 2P5TB 1EFVB 1JPNA 2RBEA 3C16C 2YWGA 1AIPA 3UK6A 2WHXA 4RK1A 2Q1YA 2WDZA 2DGDA 4CIDA 3RANA 4DR4B 2IUYA 3TSYA 4K05A 2HRDA 3TECE 4EB6B 4ZAYA 1NNI1 1Y8RA 5FAKA 3TAHA 3CF2A 1TLLA 1OQAA 2WI8A 3KUCA 3NM4A 4MAMA 4X8LA 4BJ1A 1UT5A 2GJ9A 1H85A 3NAMA 1KFJB 1WPQA 4E5SA 2C5LA 2XCQA 3NEPX 1XWWA 1XEFA 5LXTB 3D31A 2ONJA 5SY6A 2TS1A 1SVOA 1O95D 3TGWA 1Y3BE 1MKYA 1P4SA 3LUKA 4AJ9A 1OFVA 4OX9B 4J1TA 2CF5A 4UNPA 4UU8A 3L1JA 1TUGA 4KNVA 4YT4A 3MJRA 3N53A 1QB8A 5BN5B 4EAAA 4HVTA 3ZDYB 1UWCA 1WUIS 4YLEA 2I87A 3AXTA 5FULA 3TZCA 3D8RA 3BE4A 1GADO 3H65A 1G2QA 2C5GA 2GAOA 3CM0A 4KIGA 4OP1A 1TD1A 1MNAA 4Z0TA 3EPJA 1NSYA 1ZD2P 3EPRA 2HREA 4PS1A 5DTIA 1NI4A 4UXIA 4GP9A 2QD5A 3ZNQA 1C4WA 1Q92A 3FMFA 4DRXA 2ZUFA 3DLAA 3IXMA 3NASA 3ZQKA 4QSMA 3KUKA 3CT6A 4L8FA 1XV5A 1Z15A 1SUEA 2RGDA 5FB3A 1JECA 2SICE 2FK7A 1NVGA 3KTOA 2E5WA 1P91A 3BXXA 4LOJA 1XEWY 3B9BA 1TRHA 2PR2A 1NUPA 2O3TA 2Q9UA 3FNEA 3KYCA 5HIMA 3T95A 3WQBA 4AC9A 5HQ3A 3FPHA 3PGVA 1O54A 2A0XA 4U9HS 3SS7X 2FU5C 3N75A 4P7JA 4ZVTA 2CLLB 2XCIA 4B6FA 1PQWA 1GSAA 5JSUA 3D8NA 2Z1DA 2JGJA 5LNK1 3WLNA 4D25A 4JGGA 1E7SA 5I3CA 3WAKA 5HZKA 3H4VA 3SBDA 1Z2PX 1KYVA 3OZFA 5GZ1A 4A8HA 3BILA 1TX4B 1TT7A 1WHTB 3RTBA 1GPLA 1VOTA 4QQ8A 3OWXA 4WNCA 1I36A 3L40A 3FWNA 1ZH8A 3BH0A 1T1RA 2R86A 2I4TA 3A1NA 5IAOA 3FX2A 3TTYA 1A97A 2ON6A 2VBGA 4AKIA 1AUXA 3A4IA 3KKEA 4FKMA 3C7AA 3C1AA 5I9SA 1BW9B 4FPXA 3GT7A 3BGSA 3LT0A 3DBHB 4BLVA 1Y3CE 3GEDA 1LSUA 1DJOA 2ETVA 1E1KA 1UZAA 1V9CA 3EIOA 1GGEA 1S3FA 2YWHA 4Q93A 5KBYA 1L4EA 1ADBA 3W04A 2WJHA 3PVCA 2BBOA 3EQ2A 2G0NA 3B6MA 2C4KA 2W2LD 1NW3A 5DBEX 2HJHA 1PZHA 5EMNA 4J3NA 2I65A 2IK8A 2YIVX 3SIRA 4MQFB 4E12A 3ZD7A 3AUKA 3BDVA 1QMDA 1SGWA 2DH5A 2EZ8A 2WWXA 4OFZA 2F6RA 1EZZA 4TZTA 3SVLA 1VJDA 1JDVA 4H15A 2JGRA 2J3HA 3MJVA 3QKWA 2B3DA 2CVHA 5JDIC 1M1YE 3IOYA 4BLRA 4QA9A 2CJFA 1FP2A 2GBGA 2X3FA 4FN4A 2ZSKA 4LBYA 2G3YA 3O4JA 1F8GA 4ICIA 3NT2A 4PNPA 1EA5A 3JYHA 2OCLA 2ZREA 4E2FA 1ODCA 2DUMA 2A5LA 5AKYA 1AZTA 3G13A 4R1LA 3CNLA 3OIDA 5HE8A 2HGSA 1PGNA 5DP1A 4JKOA 1W48A 4QUJA 2C4TA 3BB1A 1T3ZA 2CUKA 4FWBA 4QJ3A 2HU5A 3PG5A 4HDMA 1M6EX 1OZGA 4L8YA 3D3JA 3MD0A 9GPBA 4CKCB 2F1IA 1U0LA 4BP9A 4KXUA 1EDOA 1DTWB 3C43A 4RVFA 5A03A 1II9A 1L5HB 4ZARA 1HYGA 3OBIA 5H5JA 3BIJA 3T1NA 1PJZA 1DHRA 4K9SA 1SXPA 2OAQ1 2ZBDA 1L0BA 3HI4A 2AT1A 2XR1A 4PYKA 5B2FA 1FB5A 2WFLA 4FDMA 2NOAA 1G98A 3MTAA 5THKA 1IZ8A 1C0PA 3JPYA 3PT5A 2YIDA 1E5DA 1O08A 1GT91 3P0JA 3NTRA 4AJ1A 2I7XA 1A9ZA 1SNYA 5K2OA 1QO9A 4PF1A 4FR2A 2FVXA 4MQ6A 4HCJA 3JAMA 4YAKA 4S3MA 4EQ6B 1KJYA 3WNVA 4X20A 4Y1EA 2XMSA 3B1KA 1Z5NA 3B1JA 2R6FA 1ZBDA 3GZ4A 4XWOA 2JC3A 1SVWA 4G2NA 3MQ2A 4TTJA 4DPKA 4ND5A 1VIVA 2ZDHA 3D6AA 3IA7A 3KSRA 4H7IA 3R76A 5BUSA 3EQ6A 1Z5OA 2QNIA 5EHNA 4Y0VA 3HKCB 3ZZ1A 4CMJA 3AILA 1GSIA 2J7PA 2EX4A 2HC9A 1RJWA 3V7UA 1KQNA 4B8WA 4U9UA 2DRIA 2FG6C 3AUYA 3GA7A 4FFDA 4LHXA 2PUDA 1OPRA 1ZY2A 2OZKA 1IUKA 2FQWA 2IEGA 4YJKA 1JDBB 5H3CA 4MIOA 4JHXA 4MQUA 1U8EA 1PCXA 1ZEJA 4CKZA 1YBMA 4WDRA 3HVKA 2XYPA 3LXMA 4LQ4A 4XFKA 5B12A 1XXHA 4JWTA 5JD5A 1G21A 1S2OA 1JAZA 2P4UA 4LAFA 2VFAA 4QGSA 4I8XA 2FQQA 3KSMA 4NPCA 5IAEA 4ZOQI 2QI9C 1P29A 3HP1A 4QRHA 4TXMA 1KVRA 2O3RA 5KHLB 3NLLA 4ZDJA 2NVWA 4N65A 3CF0A 1SU7A 3LBNA 3GO4A 2GBIA 4B3FX 5HE9A 2HKIA 4D92A 4XOUA 2CXUA 4P8RA 3FY4A 3HKEA 1IXZA 4X1KA 1YZ3A 3NTQA 2X1LA 4DRZA 2EZUA 5K01A 2VF4X 3O1JC 4JP2A 5AJXA 4TVOA 2GN8A 2H7CA 2KMLA 4I6GA 1GSOA 2MYNA 4J0EA 1G8YA 1VG1A 2UZ0A 3OKCA 4F60A 1TKBA 4YRSA 3BIWA 2ZPTX 2QVCA 3INYA 3N8GA 2DLCX 3REGA 1E3EA 1IZZA 1SOWA 2GNPA 2FYTA 4LYYA 4MDYA 1SCAA 3WICA 3GLFE 1H69A 4LJYA 1L3BA 3OY7A 3AVPA 1JTEA 1FS6A 2TYSB 3Q5DA 4JEUA 1DEHA 3E3LA 3FGNA 2IPOA 5JJIA 3HBFA 5E1BA 1TAHA 1TADA 1WMSA 4QU5A 3JX9A 3NV7A 4QWMA 1XN1A 3VPSA 1UMBA 2O2YA 2CZQA 4JYMA 2O23A 1MOPA 1G66A 2FUKA 2BBWA 2QD2A 3NBMA 3R5TA 1C2TA 4GLLA 2OO7A 2RKBA 1JN0A 3QVTA 3JATB 3GI1A 4OAOA 4DLKA 1QIFA 2ZRIA 2GD6A 4N4AA 5GONB 2Q1TA 1YMQA 3ACDA 1YHNA 4FHEA 2Y0DA 4TTQA 2F8TA 4H3KB 1TJPB 1UEXC 1NBAA 4ZVNA 3BFVA 2CNWA 2PS1A 3F98A 3H0KA 3JARB 3K30A 4GQAA 1D6NA 4R2XA 3QWBA 2EZ9A 5I4BA 4XD7A 3A3KA 2BR5A 3BJRA 1KMIY 3SF8B 3U37A 4QU9A 1O57A 3SNHA 3UYLA 4R51A 4FNMA 1RR6A 1AN0A 4Q66C 2H1OA 1WSBA 2W00A 5DBIA 1SUDA 3DOUA 4N5MA 2Z95A 4U2CA 4LC9A 4DLBA 1J4AA 2DUUA 3M4JA 2FXIA 3BL5A 1N0VC 4ILKA 5AHXA 721PA 3NBUA 3BE8A 3CUWA 3M6IA 2H48A 3PD7A 1E3WA 2GBLC 4ESOA 5B3AA 4S1OA 2RAVA 1Z25A 3IBSA 3WLEA 1OH6A 1XDDA 2WMNB 1KAOA 2I3BA 3HV2A 4IH1A 4B1FA 1DUIA 3L01A 5D1HA 4MWEA 4IXDA 3SEFA 3O94A 3OKFA 4IM7A 3HRHA 1G8SA 3SHTA 4QUGA 1N2CB 3JCZA 4HNGA 1C9MA 4I50A 4QDKA 1RXEA 2DG2A 3DBRB 2X4DA 3R0JA 2ZRKA 4XPIA 2GEDA 5BOVA 4R1TA 1RC0A 1Y9ZA 1K4YA 4GKAA 3DLIA 2DCMA 2JD0A 4C0LA 1XP5A 3RYFB 2ZYWX 1LRLA 4QXOA 3GVHA 3AT1A 3RDPA 3VC7A 5C51B 1QH1A 2VYFA 2LIPA 1K75A 1G20A 1TA4A 1F17A 1UKVY 2BKAA 4GW3A 5KNBD 2PD4A 3BMNB 3L18A 4Z9XA 5K51A 3G68A 4X1OA 3FYTA 5GY7A 4POAA 3T99A 3RR2A 1OH7A 1YE3A 3I5MA 3K6SA 2BGWA 2P2YA 2FEWB 2O48X 5FH9A 5TMBA 1NX9A 1G5QA 5KYGA 4JWKA 1MC1A 3W5BA 5EEHA 2H4WA 2JFFA 1O7JA 4NXNB 4IHKA 1Y3DE 4HFMA 3UANA 1EWVA 3RC9A 5F7OA 2VT3A 1Z2NX 3PITA 2AHOA 1QPZA 3MJDA 4QXQA 4REMA 5A4MS 2IH2A 4HWGA 4NDAA 2G9RA 4WLUA 1EVIA 1IPEA 3A4VA 4RY9A 4C4SA 4YJ2A 3S7TA 2GVDC 1PN3A 2BC9A 5ALGA 4AUNA 3EC1A 4B83A 2WD8A 1I1OA 3NR2A 4U5XA 4HWPA 4EPYA 3GRVA 3TF5A 2FE1A 1ICEA 1RM5A 5CCXA 5HQJA 4TWIA 1PUJA 2QVBA 3BS4A 2BHRA 2H7XA 3EBLA 1MJGM 3GW8A 3G3EA 4BAZA 3Q8LA 3NANA 3FLMA 4KEAA 4ZI7B 1O96B 2QTAA 3BTVA 1S9DA 3G0GA 3MTJA 3RNOA 4BX9A 4EECA 1PV4A 1NLMA 1IBRA 2GK6A 2C77A 1Z0JA 2OORA 5HKOA 2ECKA 1K0UA 1NXVA 3PICA 4EI7A 4C6TA 3ZNPA 4NJMB 3NW9A 1MAHA 1O6FA 2BEWA 2QIOA 3CSDA 3N0TA 3LUFA 3PEUA 5B1SA 2VQ6A 5YASA 2CDNA 4GSYA 3VAZA 3KLBA 4PC7A 2YTZA 3E8XA 2C9ZA 3FUCA 2ZQYA 1DL5A 3KPJA 4RDHA 1OHHD 1EIWA 3LXXA 2BELA 1A5ZA 3WV4A 3TGPA 1AURA 3MCZA 1LBEA 1ZUHA 4QGFA 4LRYA 1MNQA 4W7SA 3TVDA 4LJAA 1N7JA 1SQ5A 1WDKA 3T7SA 1HUQA 2VPZA 3II6X 1VSUA 3WYBA 1NUTA 3DF7A 1IDN1 2X9VA 1C4KA 2J31A 3W7VA 3CLUD 2O8FA 2FPIB 2J48A 3CBGA 3U7QA 3B7WA 2V9ZA 3LUDA 4JX8A 1IZYA 3B1ZA 4MS4B 3RFTA 3KAJA 4YRJA 3PC4A 2VSXA 3L02A 1J0EA 1SXJC 3L0PA 2XCTB 1DX6A 3EQ7A 4Z9FA 3AZPA 3DPIA 5IMBA 4D3ZA 4O59O 4MQLA 1YR3A 3FYDA 5MGBA 1QFZA 3TG8A 1WUKS 4MH0R 1S3IA 4RJJA 5EEGA 5ULLA 2XFDA 1ESZA 2X0IA 3B5JA 4KV9A 3AETA 2F3UA 2CMFA 1V45E 3RU9A 4J4HA 1N2OA 2HWXA 2I91A 1Q0PA 1JZQA 1IYZA 2CFOA 3K9HA 3RW9A 4CG1A 5LUAA 4JJ4A 4WBNA 3BXGA 1OX4B 3EZGA 4XUGB 1X1RA 4ZVQA 4DR5B 1WUHS 2ZOSA 4X41A 2G08A 2I2WA 2Q4TA 3OLQA 1YA4A 5LDGA 2DBYA 3GQBB 1ZK4A 3UHAA 4W5QA 3B3GA 3HBNA 4ZCPA 3CUKA 2GHIA 2MSDB 3AF3A 4AP9A 1L4GA 1BS2A 1NI4B 2M6SA 1Q57A 3KTAA 4FFWA 2XOKA 2IEIA 1KKUA 3CZ5A 3ZK8A 5K7SA 3BA1A 3HR4A 2G9VA 5HFNA 3WNCA 2IXAA 1T43A 1VPWA 1U9ZA 2W2KB 4WGFA 5TSDA 5JSZB 3TFQA 4LHWA 1JKMA 3LGXA 1QHFA 2FX3A 1B2RA 5GV7A 3GRZA 3R74A 1M6VB 2XHEA 3PEFA 1H1LB 2H9YA 4IXWA 3ZUGA 4Q4AB 4ZGBA 2R6ZA 4IJQA 3JQDA 4WLOA 4HADA 4M1WA 3GVXA 3DBLB 4GNRA 1C7EA 2B0CA 4CM4B 1E0DA 1VKNA 4JA2A 3ZDQA 3ITKA 1CV2A 4ER0A 5LYJB 2R79A 2X5JO 1QRAA 2VTVA 4I4IA 2FFHA 1LPPA 3QOFA 4LXYA 2GYVA 5ESXA 4CQNA 1BXZA 1L5YA 4DJAA 1ULTA 1V7CA 1U2DA 1XHEA 4MK4A 2R7MA 3SHOA 2HH9A 4N3CA 1ZS9A 1V8DA 1IMJA 1RFGE 4CKBA 4DCPA 1QE0A 1I5EA 1VHWA 4Q1BA 3HCNA 4J6FA 4Z8XA 3VU3A 4CLXA 3GD7A 4J90A 4PY2A 4FDUA 1XL0A 2WG2A 1OAAA 3QU2A 4C7XA 4LQLA 5HOEA 1KY4A 2HO4A 2CCKA 4PLTA 5CHYA 5DHTA 5L3RA 4F4HA 3S68A 1YB5A 1XAIA 5IJ9B 2FGJA 3OLCX 1ORDA 2ZS8A 3KYDA 4X97A 4RFSA 3M70A 4Y6QA 4UPEA 3RSOA 4L3VA 1NNUA 4QTTB 2EERA 2D2FA 3HLYA 5IZCA 2G4VA 5CH5A 1J8VA 2IYNA 3F5QA 1JSLA 4KXQA 3RUEA 2DVMA 1ZVQA 3JQAA 3K4HA 3L7AA 3U3DA 4HFRA 3VYUB 4GEGA 4RFLA 4EUHA 1VHLA 1ZAKA 2J0EA 3TLGA 5EJ9A 3UMVA 3F6RA 4X00A 2QYOA 1E92A 3T0FA 4M1YA 3TXAA 2A9OA 2PQ2A 2VYNA 1BA3A 1FRQA 2XYHA 2Z5GA 4FHZA 1HLFA 2B8TA 1HT3A 3KYBA 1BS1A 1T6ZA 2AZMA 1HSZA 4H1UA 3WZ2A 1HX7A 3LFTA 3R0VA 5CMLA 1SWVA 1PG5A 2FX2A 2ZCVA 1DWQA 1EVEA 1GAEO 2POQX 4M37A 4Q9JA 4LV8B 5BR1A 3PHJA 3V2UA 3WGMA 1M0TA 3RVPA 1Q7CA 4AO6A 2EW8A 1UP7A 4JUDX 1TMGE 1MJNA 2XKBA 1QOQB 3TBKA 3VVCA 1S1CA 3DHNA 4HB0A 2FF5A 3QFRA 2VDOB 1TDJA 5AJHA 3H11B 2C8VA 4LWOA 1SOUA 5H83A 5C1BA 3A4LA 1JG4A 1CJCA 1XG5A 1VIYA 2IOHA 3FKSD 4CN9A 5CA0F 3I6MA 1ENPA 1CUVA 1NVXQ 3SZLA 4ZI7F 1KKMA 3ZDXB 1MAWA 1W1WA 5C32A 2GAFA 4O2AF 2GZMA 2NTJA 4B09A 3ZHTA 1FJXA 2XGMA 3G5LA 5H8WA 1TQ8A 1FA9A 5LLSA 1TKRA 5KYXB 2V74B 1S8NA 1JW9B 2OQIA 4NHOA 4NULA 1W9MA 5ALLA 4R2JA 1E7YA 2YWRA 5I4CA 3ROEA 2B2NA 3E48A 1U8AA 3HJFA 2EW1A 1R6VA 3WSVA 5CB8A 1E3MA 1UPUA 4AG5A 4M49A 4WH0A 4N8DA 3SK0A 3UHFA 4I1PA 2JJMA 1MVLA 2KB0A 1W8DA 1G2OA 1OU0A 1P6QA 4RTJA 3LQRA 3B7PA 3OQMA 3TJRA 4MDFA 1DIGA 2D5CA 3LPMA 4Y0AA 5JTUA 2CXTA 4FYWA 4G3XA 1WVGA 1VXOA 4UKDA 3NT5A 5IT4A 3KB1A 3MQFA 4N47A 3JYNA 4EG8A 1CW2B 2OFFA 3M34A 3IUMA 3G1WA 4IRXA 4FEAA 1LS6A 5A9TA 3HMKA 2PYDA 4HJRA 4LRWA 4EPTA 1JQJC 4J2HA 1ND6A 1JR3A 4R2LA 2I6XA 1FQKA 1ZICA 1N2GA 1TCAA 2GHTA 5EA2A 1D2GA 1K1EA 2C9DA 2NLOA 2R68A 4PLVA 4XYMA 5IN5A 3TNYA 1X1CA 1N5RA 1R50A 3G82C 2G25A 3GFVA 3KUDA 3NIGB 3F2VA 4HDQB 1NM5C 1U3GA 2DFPA 4OHPA 2PRYA 2Z2JA 5MHTA 2YY5A 3CLSD 2R8RA 3DAOA 3DLTA 4NQRA 1PFQA 4XWYA 5ECDA 3WGTA 1WCIB 3I2FA 2NO7A 4Q3CA 1BWPA 3M5PA 4TYPA 1WEHA 3JQPA 4PVDA 1KARA 3IAFA 2VZ9A 2CLKB 3OM1A 3D43A 1ZA2A 2W6OA 1C3OA 4KZKA 2MCFA 1KETA 3W9YA 1FVFA 4BWGA 4YJHA 3EMDA 2YBDA 1RI3A 1WKBA 4WJZA 4A6DA 4MKHA 4XA8A 3DE2X 3HADA 3TX2A 3EEYA 2C7QA 3K70B 4ZYYA 2C8KA 1T35A 3H5AA 3K70C 3BZBA 3ZJUA 4OSPA 3UCFA 3JQ7A 5J9FA 5DN6A 3MBOA 1RP7A 3HB7A 2P2CA 1HT2E 3O82A 4TYMA 1BDIA 2MWMA 3I1FA 5IP5A 2C9MA 1OASA 1IBKB 2HMWA 3DZIA 2HJVA 5E6RB 2OLEA 3ADBA 4TT3D 3K0FA 3HXTA 5K0ZA 2IPXA 4URFA 2JCXA 5BV7A 4WKNA 3HDYA 1SXJE 2GVZC 1QHHB 3DONA 2VXYA 3O95A 4GYKA 1VDZA 1XB2A 3HQ4O 3OQHA 4NV0A 5ALEA 2OV2A 5EJAA 3WZLA 4ARZB 4MO9A 4F4FA 1O3YA 4LY3A 5AXAA 5GM2A 3NC4A 3NH9A 3ROKA 2CC2A 4Y9SA 4M0UA 3U3ZA 4UEOA 2IU0A 3RIEA 1GL3A 5LPNA 4ZEOA 6ADHA 1HZJA 1QRTA 3QE3A 4F3YA 3MUFA 4IRMA 5CDTA 3G2JA 3I09A 4TTSA 1JFVA 1NYTA 3KV3O 5AHKA 3WLRA 3I4CA 3QLVC 5BNTA 4V0OA 1PZNA 4X8HA 5IBRA 1X77A 3RRJA 2BUBA 3SC4A 1PX0A 4DZRA 5JZMA 1VI2A 1K97A 1HR0B 3HV0A 2LG7A 1ZFNA 1UWVA 2ZBFA 5E1MA 3V34A 2IEAA 4S24A 3I6QA 3F97A 4XFJA 2DBQA 1JDNA 1NZDA 3EAFA 1Y8QA 2GN0A 4QZVA 3LVFO 4LJSA 4BC0A 3A6HA 3A05A 4M0KA 3L46A 2NZJA 3QP9A 1W2WB 4MA4A 3WRWA 4B3JA 4UBNA 1M0WA 1FFXB 2EL7A 4UARA 3TKYA 2O57A 1TCVA 3DMYA 1S8OA 3GCWA 4YMVA 5KNLA 4JI4B 1UBCA 1QQTA 5IAJA 1T29A 4RGYA 1ZISA 5CIWA 1NA5A 4G84A 1S8AA 4UULA 1RAIA 5H82A 3UWDA 4IX9A 1D0VA 4JCCA 5B7GA 1TM4E 2YZMA 3LMKA 3TPFA 3V5NA 5JARA 5GADl 1U9YA 4BB6A 2ZJ5A 2FV8A 2Y9PB 1M83A 3HWX1 2YYZA 2VPPA 5DIFA 4WKOA 3T6KA 4HYTA 1WZNA 4L7VA 5C0OE 3FSGA 4D43A 3SQXA 3WLFA 3TI9A 1V16A 3HFRA 1AQNA 3IULA 3LSTA 1ZONA 2NV2B 2P9BA 2X4IA 4G81A 4HN4B 4PHGA 4S35A 4HRAA 4EB6A 4LK2A 3HCBA 4UAUA 1X7ZA 5BOSB 1TU0A 5KKAA 3DB2A 5KSWB 3EWIA 4M1MA 5FO0A 1NBEA 5F5NA 4D9KA 3E53A 3T7RA 1H2ZA 1PJ8A 2J6CA 3O2SB 1BTOA 3R75A 4EX7A 1COWA 4N39A 1E99A 2EZTA 1RWQA 1W5FA 1GCGA 1XZPA 1H1TA 2NPOA 1SXHA 1EVYA 3MMPA 4U5QA 5BV0A 5KYYA 1OR8A 1XO1A 5FOVA 1GQ2A 2PT9A 3D81A 1SEVA 3GFQA 2YQ4A 4V1CA 5JRDS 1X13A 3C98A 5TQ0A 4ILEA 1A77A 4BNWA 4O1HA 3UENA 1JDTA 3DXYA 4HY3A 5EXEA 2H2GA 5KYVA 1B42A 5TQVA 2K4MA 1CR1A 1RJ9B 3C3AA 2ZWVA 4HOYA 4JL6A 4OD0A 5D00A 4LNHA 3RRYA 1VE7A 1I30A 1Q1AA 1NX6A 1R4MA 3RB8A 3ZCSA 4KGDA 1EINA 4F6CA 3MELA 1FGOA 1LU9A 1VQ1A 2C82A 3H84A 1THTA 2CCJA 5JDCC 3C48A 2XIQA 2D00A 4FP9A 4UXJA 1WP9A 3HRKA 4EVSA 4G4SO 4CMHA 1MXHA 2FR1A 2YBEA 4Y6PA 5DO9A 2OKCA 3ZE9A 4JCOA 1SIOA 3SXJA 4EY3A 1R3UA 2VNJA 2A4MA 3S2ZA 1U81A 5DSXA 1FMCA 1IUPA 2XUKA 4Y6SA 2G9NA 1RPTA 3E9ZA 2VJLA 3O9ZA 3Q7IA 3PF9A 3QXXA 5LA6F 1KO8A 3E18A 3ZU5A 1I5OA 3KJQA 4C6SA 4DV3B 1CJKC 1NTRA 2G6TA 2LGJA 2ZGVA 4YCCA 2EQAA 4CLHA 2ZI9A 3IQHX 3KEQA 1ONOA 4TWZA 3VHLB 2UUAB 4TSFD 1GRQA 1QONA 2WU1A 3VRHA 5AW1A 5JISA 4KDRA 1J9GA 4LCEA 1FCJA 1LFAA 3S7ZA 1K3FA 4NNOA 4Q1CA 5DGCA 1VJ5A 5DM60 1NXSA 4NS1A 1FSSA 4X64B 4E51A 1SXIA 1PO7A 1BMDA 2ZTUA 1QGOA 2PAFA 4ER7A 1C2YA 1CF2O 3V4PB 1PL0A 2GXUA 4DANA 2RBKA 3AEKA 2J6IA 3ZGXA 1U3DA 1XPUA 3RVLA 2HSWA 4I5EA 4BMXA 5I9MA 4GPIB 4XM0A 1E1YA 4U9IS 3E22B 4JB2A 3TTXA 4CXMA 1NJFA 5JFGA 5LBTA 2WHQA 4LVOA 2YHIA 3HE3A 4R1MA 2YJ3A 2Q6KA 3P9ZA 5ADWA 1J20A 2OT3B 2VHJA 3D54D 1FLAA 1OX4A 1UBHS 1IM2A 2QGNA 1DCKA 1ONBA 1T26A 2QW1A 2XB4A 1ISSA 3BG5A 3F3YA 1YDHA 1JDZA 1ADGA 1FBTA 3PNSA 4G8JA 3CUYA 1IQ0A 4ZZ2A 1R0LA 3U31A 1WNTA 2QZPA 4Y18A 4KQIA 5KKNB 1G291 3LQQA 3S8EA 1J42A 1T3LA 4R2IA 5JCJD 3M6XA 3VUFA 1T5BA 2PDAA 4RJIA 3W5UA 4JYAB 3RYFA 4XW2A 2GTIA 4H7DA 2VT6A 4UU7A 3TI7A 5JNSA 4C4OA 1YASA 3ZS9A 5GONF 1QF7A 4BWFB 2O7RA 3AJAA 5EJ4A 3DB1A 4AJOA 3C24A 3W1EA 3DFUA 4URVR 3LL7A 4XQEA 2FWRA 5JCZA 2HHHB 3NDIA 1HDZA 1YIDA 2QTFA 4JX9A 4JT9A 4LXXA 4AT1A 1L7QA 2C0CA 3AETB 3OEED 2P1RA 3OIYA 4MPPA 4KO3S 1J07A 1RCUA 4K46A 4M9SA 5BN5A 1CK4A 1INLA 4M36A 1OROA 2BD0A 3M49A 4NR0A 4RO0A 4BE9A 4ZMSA 4HLCA 5EAIA 3ZE8A 3FMOB 5A02A 5BMVA 4QWWA 3U9SA 5BRAA 2AFIB 1E1RD 5AMXA 2P41A 1H2WA 1AX9A 1ZXLA 2G88A 2ZI6A 5H70A 5ADVA 1YRWA 2WVJA 3QQPA 1R8QA 2E0IA 4MUYA 2EP7A 2FOXA 3QUQA 4UNNA 3OZWA 3B85A 2G1JA 2JHCA 3R5KA 1MQ8B 3MW8A 2QUIA 4GZ5A 4PGAA 3E82A 3ORHA 3U3JA 1BJTA 1C1HA 4R4JA 5IMSA 3HU3A 1KJJA 1X8KA 2OG2A 5GGXA 1H4VB 2DJIA 2JAOA 1TM3E 4Q82A 1K66A 2NACA 2XEXA 4BNVA 4DL9A 1RYMA 4FILA 2AL7A 1X1DA 3KPVA 1W47A 2JD2A 3NDRA 3UMRA 1N34B 1DIOB 2OYSA 2ZIWB 4M99A 2VAXA 2HMYB 3IIMA 4FBGA 3UK1A 2G09A 4QEKA 1N2ZA 3DC2A 3PRYA 5BR8B 1RHJA 1JFTA 3CUSA 5EGNA 2B5OA 3F8TA 2CJXA 5G4KA 3DDNA 2VZ0A 3B8HA 2NSYA 1BH6A 3DTNA 4HUJA 4UVIA 3A28A 5D3MB 4RDXA 2ORWA 2I99A 3AEYA 3DDSA 1JKXA 2B8EA 3S6JA 1SZJG 3VMFA 1VLJA 4YIHA 1LNHA 1FRNA 5FX2A 1NJ5A 2QEQA 3N86A 3OE7A 2GPWA 1PFUA 4TMYA 4EB3A 3Q9NA 1ZWKA 4CNQA 2PMFA 5KDLA 4TS4A 4E70A 1CDEA 1Z88A 3OTHA 3T94A 3IB3A 4R2KA 1JKJA 4PQEA 1TM5E 3PUWA 3BTOA 3TSAA 2VZEA 4D8VA 4RSGA 4N8EA 2IYVA 2X5KO 4DCMA 2DQYA 1BAPA 2JLVA 3LBAA 3ORRA 4M1OA 3CLSC 4QJ4A 2R6GA 1E2UA 2FPPA 1Y6JA 1P75A 2JIPA 2XUFA 3R3VA 1K4KA 2A5FA 4PRYA 3MINA 5A1TA 2QMQA 3R8CA 3TKAA 3KOZA 1CZOA 5TQ2B 3VHXB 1IDOA 1U98A 2B99A 2Q3MA 1NBMA 2NAPA 1EEXB 3A9WA 3MUNA 4EOGA 4EY5A 2A33A 4FDLA 2CKMA 3M4NA 4OHVA 5JQGB 3MERA 5KTSA 2VH1A 1AS2A 1F8XA 1SO8A 1SK8A 3AJ8A 1C7JA 3W9BA 4DTCA 3QSYA 1QQAA 2FPOA 3R8XA 2NU7A 3SPXA 4DT1B 1NL3A 1ULUA 2OILA 1UODA 5TVKA 3QE2A 4HL6A 1PNOA 3A32A 1HQDA 1UXJA 4IEEA 4RMHA 3LA6A 5CT5A 3OE4A 4QBTA 4ZYLA 1NU8A 2H4HA 2D4HA 2GOYA 4JKYA 1FTSA 4ALIA 3QVWA 3TIIA 4M9UA 3PENA 1DEXA 1P4JA 1D0SA 2VLBA 2VRWA 4WOBA 4ZOLF 3SYTA 8ABPA 4C7KA 5JSZA 2HUPA 3SAJA 4GOJA 3BRWA 3ZJYA 1UINA 2RGYA 1UDWA 1CQJA 5KSPA 4BMOB 1KYZA 1ZIYA 4Z7OB 4G5QA 1DOAA 1KEZA 4HQKA 2IYXA 3VVLA 1LH0A 3CJQA 3CR7A 2EFCB 3C5CA 3PRJA 1B6RA 1JHUA 1VE3A 2G0AA 2R97A 3B6JA 2DPYA 3QHAA 1UKEA 5HF8A 4LW8A 4J16C 2QX4A 3LWDA 4Q9HA 3LVRE 3ZD6A 3NHJA 3BK2A 4XIYA 2IPNA 4UQLA 1OFIA 1SJ9A 1Y34E 2Q6OA 2NPFA 5HR5A 1PNQA 4E2WA 2YRXA 3CZAA 3TXYA 3W5IA 1MEEA 4PYMA 4IMPA 5M5BA 2ZJ8A 4KDEA 1U9JA 4MTCA 2QOEA 4BEBA 5IBCA 2Q0HA 2WWRA 1V3QE 2QXTA 4YCBA 3RVKA 1X8JA 4FZ5A 1R66A 5SZKB 1T0HB 2P3SA 4LOAA 4OPMA 3PXUA 1MT3A 1YKFA 4Z53A 3CMCO 3BXEA 2ZB4A 3AEUA 3UC9A 4B87A 3U7HB 3ADPA 2ARKA 1LBHA 1CUZA 1KBZA 3O3MB 2ZXUA 3UPUA 4G5OA 2BEKA 2YXBA 1Y82A 3CX7A 2J3JA 3OIVA 3T3MB 4C43A 4P4UA 4PZUA 1IJFA 4FVTA 2NQ2C 2RFLA 1YZQA 2CLMB 3IQEA 4MV5A 4LWQA 1YDEA 3EXIA 2C8JA 1XU7A 2X0JA 2P5SA 2D7CA 4Z99A 1G8AA 3W6PA 4DIFA 3WLOA 4Z3OA 5CW2A 5F3RA 1P0PA 5ARDA 4MLPA 5KOIA 3LRTA 4BUJA 4ZN6A 2I7TA 1DP4A 1DINA 2P4QA 4P35A 4BQEA 4EABA 1XD9A 1L5OA 4RXTA 4EUNA 5L9AA 4XGRA 1XIVA 3MJHA 5IABA 4PZYA 1L2TA 4PHHA 1RI1A 4FYIA 1DXQA 3BULA 3CW8X 4WIAA 5AXBA 2M6KA 5KNBA 1QO0D 4M21A 1OV6A 4XX1A 5F98A 3Q8WA 2J41A 2NO4A 5HA5A 4JQZA 1KQOA 1KDYA 4MQMA 1D9ZA 1N2IA 1P9RA 2R8EA 4JB0A 4Q3EA 1DMRA 1D2RA 1I9CA 1NRWA 2I29A 2B82A 3H16A 1NTOA 3JWHA 3L84A 3WKEA 1NOJA 5IF9A 1WAMA 2I6TA 4Y98A 4LNUA 5JH7F 5JS2A 5KHAA 4F2WA 3UOGA 2XMPA 3AFMA 5DTRA 3BICA 4FE3A 1O1YA 3WYDA 2DECA 3ZHVA 2O0MA 1URPA 3KTDA 1GA4A 4JJ8A 5D3QA 2RG1A 2P0YA 3NHRA 3REQA 1IONA 5H3HA 1N36B 1WHTA 1XDSA 3LO8A 4OGKA 4US2R 5KTNA 1TU4A 2FWJA 1Z2EA 2WHYA 1GGJA 3BNCA 3HDQA 4WTOA 1WVMA 5BV2P 2O6HA 5CNIA 1NR1A 1FRVA 3OT5A 3VYWA 3GFGA 3R23A 1F2UB 4ZA2A 2Q45A 3D4IA 2V1XA 1YSCA 4MRPA 4CL2A 3KJIA 4EEKA 2ZRQA 2HB6A 1BD3A 3FB1A 4BNDA 3FDZA 3DV0A 2I2AA 1YS7A 4D6YA 1KVQA 4RM3A 5HQ3B 1QVWA 4JYCA 5CX4A 3K6SB 4WNYA 2ZYVX 3Q9UA 3OPYA 4CKXA 2PYIA 3DKVA 3ORSA 4ZT3A 4FI3F 2MT9A 4ENSA 2A59A 3VHXA 1CY7A 3N8NA 2G7ZA 3JAKB 3VZSA 5IFLA 1CF4A 1YH3A 2QLMA 3VDQA 3WC4A 3FHLA 1QH0A 3U17A 2RE8A 2XMRA 4ZV7A 3VA7A 1NYRA 1W2HA 1U7OA 2JDIA 4IMJB 1D1TA 1JG3A 4ZI2A 1UXOA 5KWSA 1CIPA 1UDAA 4H1HA 1P81A 2QE6A 5TVGA 4BASA 3PC6A 4R41A 1W29A 1XR3A 3QFTA 3AXSA 2WJZB 3GEGA 4L0QA 3RK1A 5EKXA 3OZDA 4Z4GA 3PEVA 3UH1A 3UK7A 3T61A 1GUZA 5BSHA 3IV9A 4DA4A 5IULC 2G76A 4B2YA 3D3QA 3IDFA 4UZSA 1IHDA 4IIJF 5ITZB 4PANA 2D7DA 3UJAA 1BZYA 2WTAA 3LNCA 1QTQA 4B3MB 3QE0A 1GCAA 4QTXA 1UBMS 5EHGA 3BPSA 5KVSA 1TVKA 2VNAA 2EATA 1S4MA 1TQDA 2REBA 2WJPA 3HUTA 3JALA 1T0IA 1POXA 4KQKA 5EJGA 4P2BA 1M5RA 2GZ3A 3EFBA 3ENWA 1EG7A 2ECFA 1SHJA 1YQQA 2I7DA 4H7EA 4BTVA 2QI9F 3GJ7A 4GVXA 4ENQA 2QMZA 4WADA 3ZWCA 4NH4A 5ELMA 2CVPA 4F4IA 1ZESA 5IVIA 1WB9A 1GIAA 1UPFA 4WOKA 3T7CA 1U28C 4JJFA 4CHTA 3A2KA 1E2IA 4L27A 2NZ2A 4XIIA 1X1AA 1UZMA 1O5OA 1P5JA 3C45A 3N2EA 4BYGA 4CEHA 1JHZA 3KS9A 5G1NA 5C7OO 1Y8RB 1XF1A 4IHAA 4W1RA 4DCGA 3AV0B 1YL5A 3BFPA 1WTAA 1KVSA 3MOGA 4M7WA 1U9IC 2YRWA 2PNJA 3SE7A 3AI1A 3UT6A 3L8DA 3WBKA 5TGTA 4EG3A 1M0SA 5AI8A 3V1NA 3EZXA 1FJHA 1HV8A 3PBKA 1Q17A 4PC1A 4D97A 1G8PA 3IMCA 4XARA 1VSVA 5MGNA 2ODPA 2VI5A 2IV2X 3VBEA 1JA9A 2AJBA 2Y1EA 1E9CA 3FZNA 3HDTA 3KNZA 4GWKA 4H6XA 4Q1EA 5B2EA 4NZPA 5ALNA 1UCFA 2WRZA 4ND3A 2C58A 2HADA 4J16A 4A4DA 4Q3DA 4JT4A 2X8BA 2XDQA 2PJZA 2IUJA 4PPQA 3T06B 5SYNA 1MJFA 2XDQB 2CFTA 5AM2A 3LY5A 4A15A 1JHVA 1CY8A 2AFRA 3WVNA 2G5TA 1CUAA 1GQRA 2FW6A 4G5HA 2YUIA 1PL7A 5AK6A 1T0UA 4KB5A 3T4EA 2H1FA 2HXSA 2YHUA 3V8EA 2L0XA 2X6TA 3PVZA 2ZI3A 2Z8XA 3G9TA 5CURA 4PO9A 1YL7A 1STOA 2IODA 3WOHA 4ZYZA 3H9UA 1P7PA 3I30X 3AP2A 1TLFA 3U44A 1U02A 3BIOA 2FPSA 2EFDB 1HA3A 3AHCA 3KDPA 5BW6B 5E9WA 2BPOA 4J0QA 3WYGA 2Z09A 1C1XA 1UXIA 3WHKA 1O95C 4RVHA 4TWRA 4AI6A 4FS3A 8AT1A 4MIYA 1RI2A 2IDZA 4RYDA 4RE6A 1EVZA 5FI3A 4AS1A 4NQZA 2ZPUA 2RB5A 2XQIA 3B52X 3C1OA 2HZBA 4HB2A 4OU5A 5BN1A 2GLUA 1KI8A 1UBNA 3D1JA 4NJEB 3E7XA 5HUHA 1AKTA 4Z4IA 1MABA 1JIVA 4XWKA 1Z9BA 3ZJ4A 2BJWA 4BGEA 4WHAA 4BRZA 4F12A 3T5TA 1DKNA 1EFDN 2V0CA 2ZYHA 2J9FB 4DUZB 5KB3A 5AUOB 4E11A 1AMNA 1O5IA 1PGQA 3ZU4A 3PDCA 3HJAA 5I6DA 1E61A 4QARA 4OJMX 1M33A 1P7VA 1X0XA 2ZZKA 3OQIA 4W5HA 3UKOA 1T15A 2YWFA 1NRJB 3AB3A 4LRUA 4MCHA 4TKUB 4C7JA 4DRXB 3DWEX 4RANA 4ZO7A 3RYCB 3OQ1A 1XTZA 2WSIA 4OXXA 4EBBA 3U80A 2CKDA 1Y4SA