2OXEA

Structure of the human pancreatic lipase-related protein 2
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
452
structure length
435
Chain Sequence
KEVCYGQLGCFSDEKPWAGTLQRPVKLLPWSPEDIDTRFLLYTNENPNNFQLITGTEPDTIEASNFQLDRKTRFIIHGFLDKAEDSWPSDMCKKMFEVEKVNCICVDWRHGSRAMYTQAVQNIRVVGAETAFLIQALSTQLGYSLEDVHVIGHSLGAHTAAEAGRRLGGRVGRITGLDPAGPCFQDEPEEVRLDPSDAVFVDVIHTDSSPIVPSLGFGMSQKVGHLDFFPNGGKEMPGCDGIWEGIGGFVSCNHLRSFEYYSSSVLNPDGFLGYPCASYDEFQESKCFPCPAEGCPKMGHYADQFKGKTSAVEQTFFLNTGESGNFTSWRYKVSVTLSGKEKVNGYIRIALYGSNENSKQYEIFKGSLKPDASHTCAIDVDFNVGKIQKVKFLWNKEPKLGASQITVQSGEDGTEYNFCSSDTVEENVLQSLYPC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of human pancreatic lipase-related protein 2 with the lid in an open conformation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Pancreatic lipase-related protein 2
total genus 127
structure length 435
sequence length 452
chains with identical sequence B
ec nomenclature ec 3.1.1.26: Galactolipase.
pdb deposition date 2007-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00151 Lipase Lipase
A PF01477 PLAT PLAT/LH2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.60.20 Mainly Beta Sandwich Lipoxygenase-1 PLAT/LH2 domain 2oxeA02
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2oxeA01
4J7AA 3DDUA 5ISMA 3OPMA 1YASA 2WHRA 2R8BA 2H7CA 4UBKA 2AJBA 1OCEA 2CZQA 3WKDA 1ZGBA 5HKAA 2IIVA 3WK4A 2XUQA 4FHZA 4G8BA 3AIKA 1HQDA 1YB7A 5ALWA 4HXFB 3IUNA 2PVSA 4ETWA 4J03A 2XQJA 4NS4A 4H7IA 4QDTA 1G42A 3EQ9A 4Y2JA 1GXSA 1THTA 2B9VA 4OB7A 4H7KA 1VJ5A 4BVKA 3WL6A 2QS9A 1T4MA 3C6YA 4UHHA 4W9RA 1MU0A 3H19A 4GHWA 3HSSA 5BWCA 6YASA 3AZPA 4F5ZA 2GBFA 1ZIXA 4ZV7A 4DMCA 1BCSA 4MWTA 2C7BA 3CN7A 1MO2A 3WKBA 1H2WA 2FJ0A 2Y2VA 4JNCA 2ZSHA 3AIOA 4Y2QA 5LYYA 3I6ZA 4BVLA 5BOVA 1XRQA 5DNVA 2VJDA 4OB8A 5AICA 5ALMA 1CUAA 3JW8A 5EHZA 1JT2A 3FSGD 5JD4A 4EY4A 4XWGA 4X71A 3ESDA 3STVA 3G9TA 3E0XA 4DNQA 2C0QA 2WIKA 2C5GA 3FBWA 5HKBA 4J0CA 4N8DA 4Y2UA 2DFPA 3SWWA 3I6YA 3ZV7A 2Y6VA 3CXUA 2VT7A 4QE3A 3O4GA 4FNMA 3GFFA 4QEKA 5FPQA 4X93A 4MQLA 3VJLA 4BCCA 4FLMA 2AJ8A 1ZI9A 3ANTA 1GKKA 2XUDA 3C87A 1QZ3A 1X2BA 3K2IA 1H2ZA 4M0MA 1CPYA 2WFLA 3STYA 4BZZA 1MX5A 1X2EA 1W75A 2DHDA 1XZLA 2O2GA 3WL8A 4QZVA 2ZYHA 1JMYA 3H04A 1DINA 4CG3A 4WDQA 4AO7A 4Q34A 4KACA 4BCBA 4Y2RA 4BE4A 3G7NA 4BTVA 1LGYA 2QJWA 4GXNA 2FX5A 4Q05A 3BDIA 1CFJA 2WFZA 1WHSA 3UMJA 1XROA 4DNPA 2FUKA 4BRSA 5HF5A 5ALHA 1MN6A 4D9JA 3DLTA 3C6ZA 4ITVA 5JD5A 1JFRA 5E2IA 2QXUA 2DCMA 3WK5A 1J2EA 4B0OA 1QLWA 2XUIA 3M3DA 5FXMA 1HL7A 4WY8A 3C5WP 2VQ6A 5AI9A 2WG0A 4PSCA 4AB1A 1BCRA 2PUJA 2XB6A 3HC7A 3I2KA 3I6MA 3WKAA 3T52A 3KWFA 1VXOA 4EY5A 4H7DA 4X95A 5CBKA 4X92A 3CWZB 1NO3A 2BGNA 1VXRA 5K3FA 1IUNA 1PFQA 2QTBA 2V97A 4K6HA 4TVKA 2O2HA 4CIBA 1J1IA 2BUCA 1ZD4A 3LP5A 1CUBA 5HQ3B 4B80A 3V92A 5FV4A 1LPSA 3IUQA 2OG1A 2C58A 4XJVA 5AKEA 4UHBA 4KAAA 4HZGA 5AHXA 4G8CA 1T2NA 3IIIA 3V48A 5C8VA 1QIKA 2FJPA 3ZPXA 1FFAA 3AIMA 1PV1A 4J0DA 3I2JA 4H35A 3EF3A 3NGMA 4IH1A 2XQGA 5ALUA 5HZGA 3QMVA 1CR6A 1E8MA 2WLSA 1SC9A 3D2AA 4Y2SA 3Q0TA 4GLBA 4WY5A 1MX9A 4ZXFA 3BWXA 5IVKA 1Y7HA 4CI9A 5ALIA 4B84A 1S8OA 5EGNA 2WTNA 4P08A 3FLAA 5C8XA 1XQWA 2YYSA 3OC0A 2WHPA 1UWCA 1W6RA 2CKMA 4KAFA 5JANA 1XZHA 5EEOA 2CEKA 4YK7A 1O6FA 2XUPA 5CT6A 4HS9A 1TCBA 4LXHA 5CT9A 2I3DA 1EA5A 1CUYA 5AOBA 4YASA 1DTEA 2G63A 4AXBA 1E66A 2QMQA 1QIEA 3FSGA 1R50A 2ZSIA 1BN7A 2XUGA 3G0IA 5AM2A 1JI3A 3V1NA 4M0FA 1FSSA 1CUCA 1CUFA 2E3JA 4RE5A 3P2MA 3BNBA 1N8QA 5DYTA 3QPCA 1K4YA 2WUGA 3BIWA 1CEXA 2JGLA 2PU7A 2GBCA 1JKMA 3QPAA 3WK6A 1CUVA 4W63A 4NZZA 1EH5A 3W05A 1R1DA 5JADA 1WB6A 1MPXA 4S0XA 4EUSA 5DYYA 2WUDA 4PF1A 1UKCA 2XMRA 3H2IA 1Q84A 4UHFA 2RIPA 1OILA 3GUUA 4LIPD 4Q3KA 4GECA 5CW2A 4JYPA 2BJHA 5EHQA 3IB3A 2VJAA 1W76A 1C7IA 2C5FA 1GGVA 5AI8A 3GZJA 4Z49A 4PQEA 5LZ4A 3G9XA 2BUBA 3QM1A 2XQIA 2GYVA 2HL6A 4BTLA 4C87A 2EEPA 4G4JA 3HXKA 4I19A 3S2ZA 1ODSA 3ICWA 1XRLA 4INZA 4G1FA 5HF9A 1SCKA 2VAXA 3RM3A 1XRPA 5LLSA 1H22A 4Y2XA 3WIBA 4EY7A 4QWTA 1WPRA 4QLAA 4G5XA 3FCXA 3QBJA 3BIXA 3M83A 4DMKA 3G0CA 3AZQA 2HA6A 3IVMA 3OG9A 1TAHA 2CMFA 3G9ZA 4JYMA 2CB9A 5JARA 2CUTA 4WFOA 2ZYRA 3E3AA 2OQVA 2JIDA 5IH7A 5AKYA 3YASA 4EA6A 5D7BA 3H0CA 5KBYA 2WY6A 1VZ2A 3H1BA 3I2HA 2O7VA 5CH5A 3BNDA 5K3DA 5EFZA 1NU8A 1F8NA 5ALQA 1X70A 2BUAA 3H2KA 3PICA 4J0JA 2Q0XA 2V9ZA 4MWSA 2ROQA 2PSJA 3D7RA 5ALNA 2PSEA 2PUHA 3ESAA 5FRDA 4IHAA 1QOZA 4KE8A 3GELA 4Y2TA 4C4YA 4PV7A 1ZGCA 1EB8A 1W4LA 1GPKA 1Y7IA 3UUFA 3WWDA 2IX9A 4HXEB 1EVQA 1SCIA 4U2DA 1ZD2P 3DKKA 4OU5A 4BC1A 2EDAA 1EINA 1MNAA 1WOMA 3ESCA 4E11A 2WG1A 4FBMA 2DQZA 5LZ5A 3O95A 2B4KA 4UHCA 4CCYA 3D2CA 1KU6A 3FG4A 2WHQA 4X94A 4AZ0A 3I28A 5AI0A 4FTWA 4KE6A 3WL7A 4HAIA 4WFIA 1GT6A 2DR0A 5CXUA 2D0DA 1QFMA 1ROVA 2QXTA 2WILA 1R88A 1CUHA 2HHAA 4K2AA 1XZFA 4Q1VA 3AUKA 2AJCA 5CTAA 3WKCA 4CG1A 1G4HA 4PO3X 2Z8ZA 1K8QA 3LLCA 3R3YA 2YASA 5AKLA 2WQZA 2JGEA 2P0MA 2I03A 3WK7A 1P0QA 3HI4A 4Y2YA 3DD5A 3WIOA 1ORWA 5SYNA 5AKHA 4DYHA 3W2TA 3PZWA 1ETHA 2CJPA 1ZI6A 1XFDA 5CT4A 3R3WA 3WWOA 4QNNA 2I3ZA 5JZ9A 1QGED 1UK8A 3WLAA 4BAUA 4FWBA 3DKRA 4RGYA 4F60A 5T4BA 2H9YA 3QZUA 2VJCA 4G4IA 5IVIA 3AILA 1CLEA 2VT6A 3A2NA 1ZJ5A 2VA9A 1YR2A 4AN1A 3V1LA 4Y9SA 4Y7DA 4AMZA 1CUGA 2QOEA 3FYTA 4KE7A 1XZGA 4BDTA 2XLBA 2ZYIA 1AUOA 3V98A 1IUPA 2QUBA 4WJLA 3WL5A 1HPLA 1IUOA 1TKRA 1GZ7A 2HIHA 3G02A 5CT5A 4KJXA 1IZ8A 1GQRA 4Q82A 4GDMA 1SFRA 1ZD3A 4HTAA 5ALOA 5FPPA 4BVJA 5E4TA 4DMHA 2PKYX 1YS1X 4P93A 5ESRA 1N5RA 1NX9A 2XUKA 1DWPA 1A8SA 4I3FA 1YB6A 3C45A 1KEZA 4CCYB 4UBMA 3EQ8A 4QDUA 1MJ5A 4Q3LA 1LLFA 2PM8A 4BRZA 1LZKA 3ANSA 4CCWA 1ODTC 1TQHA 3IDAA 3VF1A 4UHEA 1XRNA 1BROA 4JUIA 4W1SA 4C01A 4NREA 1L7AA 1EVEA 1HKHA 2WJ4A 4EY8A 2V96A 4BZWA 1LPOA 3HACA 1XZJA 1R4ZA 1YSCA 4E14A 3O9VA 3WJ1A 2XMDA 3O0DA 1RRHA 2PSHA 4DGQA 4UFNA 2XT0A 5AI6A 2WJ6A 2HFKA 3MUNA 3SK0A 1A7UA 4LXIA 5DTJA 4UFOA 1XQVA 5IVDA 5AJHA 4AO6A 2OXEA 3D2BA 3MVEA 3O4HA 4ARAA 4OB6A 3MGAA 3SC2A 3JWEA 3G8YA 3W9UA 3X3HA 4DNFA 5LZ9A 5AI4A 4B81A 1MAAA 3UUEA 2AXEA 3E1GA 1LBSA 5EI5A 3QVMA 2JF0A 4C88A 1QM6A 4KRYA 3RKSA 4QWMA 2OCIA 1CRLA 3NUZA 2XMSA 1BN6A 1FFBA 3PE6A 3WJ2A 1ZJ4A 4U2EA 1A8UA 4BDSA 1UZAA 2YXPX 4X91A 3NWOA 3S8YA 4ZV9A 4Y2PA 1YAHA 2HA7A 4MJ3A 1A8QA 3IURA 2QM0A 5LZ7A 3C70A 2RHTA 2QR5A 3FLEA 1DX4A 4FMPA 4EY6A 5ALSA 3STXA 3C8HA 4MXDA 3DL7A 1FFDA 2Y6UA 3AFIA 3IUMA 1DQZA 3WA6A 3KWJA 2Z8XA 5AM1A 5AO9A 2XUOA 4IO0A 4N5IX 3D4LA 4H18A 2Z5GA 2W6CX 2CBGA 4BAZA 4X7BA 3OTQA 1U2EA 3RLIA 1G66A 2GYWA 2ONCA 3R3ZA 2OAGA 2XLCA 4B9EA 5JAOA 5D3ZA 4YPVA 1U4NA 5HK8A 3DCNA 3WWEA 2PL5A 4FFVA 1D07A 1N8SA 4AQDA 1B6GA 1USWA 4JH0A 3D0KA 1M33A 5A7HA 1H2YA 2JGJA 3LS2A 3N0TA 4Q3OA 5LKAA 1K6EA 5FP0A 4UBJA 2OCGA 5BV7A 1ZD5A 3BXPA 5JASA 2QZPA 3F98A 4AZ3A 1FFCA 1QTIA 1TCCA 1LPPA 4U2CA 4BCDA 5A6VA 5T4HA 3B3QA 2IITA 2C4HA 1AZWA 4H0CA 1K63A 3R0VA 3DOIA 2P8SA 4AN0A 1AC5A 3H17A 1U8EA 3MUOA 3VDXA 2PSDA 4WHAA 4QDZA 5AOCA 4J0IA 3H18A 1TK3A 1ZICA 2PX6A 4M0EA 4J3JA 4QLOA 5A7GA 5AKZA 3DNMA 5FDFA 1IMJA 4LYDA 1B41A 5K3FB 3VJMA 2XMZA 5ALYA 4EZIA 1QONA 1E89A 1E5TA 1DT3A 7YASA 5HK9A 1Q0RA 3AJAA 5ALFA 4CIAA 4IH4A 2WUFA 1JMKC 1QFSA 2XUJA 4U2GA 4N8SA 4FKBA 5YASA 5C7YA 5F4ZA 3VVMA 3TJMA 1QIIA 5AP9A 1EDBA 5T4EA 1UOPA 1DU4A 2HA2A 3LCRA 3IBTA 3O4IA 2X5XA 4QA9A 3BE8A 4FLEA 3WK8A 4L0CA 3WWPA 2AJDA 4RE6A 4BYMA 1CUJA 3R3XA 3ZLVA 3QPDA 4DM7A 3PFBA 2RAUA 3SX4A 5T4FA 3A2MA 3DEAA 5DNUA 2XUAA 4OD0A 4WFJA 1UKBA 4BBZA 2WIFA 4B7ZA 3HLKA 1L7RA 3EIOA 1EK2A 3IA2A 4C4ZA 4L3WA 1DQYA 1R9MA 2IUJA 2WTMA 2WFMA 3N2ZB 4G9GA 1C7JA 5ALKA 3K6KA 3FVTA 4PSUA 3F9CA 5ALLA 4X3CA 1F8UA 2HA4A 5HFNA 1UFOA 2JGIA 1WB5A 4DMFA 3B12A 5JIBA 3WWCA 3FNBA 4TPKA 3K9BA 3L1JA 4ZRDA 4MEAA 3VISA 2BCEA 5AK6A 3W06A 3BF8A 1XRMA 2HDWA 3FG1A 1UXOA 5K3AA 4F21A 4L72A 1DWQA 2R11A 3G0DA 1H23A 4FNGA 4H77A 3W9BA 5JALA 1CUWA 4UFPA 1XZIA 2HM7A 1XKTA 4A5SA 2O2IA 3U0VA 5K5EA 1E8NA 3B5EA 4UPDA 1FGTA 1NU6A 1XRRA 3KDAA 2ACEA 4GI1A 2VTVA 4TGLA 1SCQA 2SBLA 2QUAA 3A2LA 3WZLA 1I6WA 2AJLI 1QTRA 5AM0A 4O08A 1L7QA 2H7YA 5DYWA 3JYHA 1P0IA 3KSRA 4BATA 2OGSA 3T4UA 2B61A 1LNHA 5LP1A 1ACLA 1U65A 4G4GA 2DHEA 1LNSA 3QITA 4H7EA 5BWBA 1QIJA 4U2BA 4BC0A 3C8DA 5CRIA 5EIAA 3CCCA 4OYYA 2VATA 5AM5A 5C81A 1Q83A 3BL8A 1CUDA 4W1QA 3F8SA 3FVRA 4OYLA 5I8PA 3DQZA 1JU3A 3BDVA 1BU8A 1P0PA 1H2XA 3ESBA 5EHXA 2HU5A 3FCYA 4C89A 1RYYA 2ZVDA 1TIBA 4XIIA 1JJIA 1AURA 3QH4A 5AK4A 3QYJA 4NMWA 3ZLTA 3D5EA 1CUIA 4GBGA 1BE0A 1WB4A 5LIPA 3WZMA 1EHYA 2WIGA 2OGZA 4K5QA 2NW6A 4EBBA 3R40A 4WCVA 4X90A 5CH8A 2IUKA 1WHTA 4HXGA 1XLVA 1EK1A 4BAGA 1HDEA 3TEJA 4PSDA 2OGTA 5EIEA 1P0MA 3I2FA 1MTZA 2XMQA 4V2IA 4C6HA 2JBWA 4N5HX 4GW3A 1W52X 1XZKA 4QWWA 3DJYA 3M82A 1LPNA 4OU4A 4CG2A 1QMDA 4Y2VA 2H7XA 3QMMA 1CQZA 1VE6A 3FWHA 5FUMA 5LZ2A 1XZCA 4B85A 5HQ3A 1EXWA 2YH2A 5SYMA 1CUEA 4DTCA 3LIIA 1R3DA 5AKIA 3CN9A 4ARBA 1YS2X 5H3HA 5ALJA 2GBGA 4C4XA 4AMYA 4DSAA 1UK6A 1ZOIA 4HVTA 2XMGA 4IQ4A 1QIMA 3C5VA 1KHOA 2D5LA 2B20A 2HADA 4RPCA 4J0GA 1E8DA 2WG2A 5JZBA 5A7FA 4QDXA 1DWOA 3ZLUA 4B82A 3PUHA 3DYIA 5CXXA 5AKGA 3DL4A 5JZSA 4WDRA 3STUA 4J0KA 1MNQA 3KD2A 2GBIA 1LPBB 3FYUC 4UUQA 3I2IA 5ALZA 1VOTA 2OQIA 3GBSA 2RI6A 2XDWA 3FOBA 3EBLA 4UBIA 5AIBA 1VA5A 5ALTA 3WMRA 4MYDA 2Y1KA 1SOMA 1EX9A 3IULA 5I9IA 4JEIA 5FOQA 4OSEA 1LPAB 4YX9A 1F0NA 1UT6A 4MQMA 4AO8A 4AX4A 2WSLA 4K6GA 1Y37A 5DNWA 1WM1A 2QKYA 1FGQA 2BGRA 4F0JA 3DS8A 2WHPB 2K2QB 4X6UA 2GYUA 5HFAA 5K3CA 2WIDA 4GEGA 4B9AA 2DSNA 4ZI5A 1DT5A 2VF2A 1QIDA 1YGEA 3WI7A 4ROTA 4BP9A 1YAJA 5JD6A 2OPHA 1LZLA 2PSFA 2HRRA 1Z68A 5ALPA 3A70A 1YA8A 2XE4A 2PPLA 1JJFA 1HLGA 2WU4A 1C4XA 2WXUA 3I1YA 2XI4A 5DJ5A 4HRYA 1VE7A 1AQLA 4EB0A 3R3UA 1OXMA 4BP8A 1UOQA 3AZOA 1F0PA 4KYVA 4LHEA 4KR0A 2VAVA 5LKRA 3V1MA 2PU5A 1XZMA 4KEAA 5AKXA 3OURA 3BNCA 3HJUA 3WA7A 2XQFA 3FG3A 4H7FA 5JYCA 3PF9A 1F6WA 1HU9A 1ACJA 1IZ7A 1WCYA 5AKJA 5KREA 2RONA 4ZWNA 5E4JA 1BEEA 3FYUA 2QT9A 2GZRA 5CURA 4E46A 2FNQA 1QIHA 2JEZA 5DWDA 1UKAA 3O8YA 3TGLA 1VKHA 5AI5A 1MX1A 1LOXA 1FJ2A 5ALXA 5A71A 1LBTA 1E3QA 5IKXA 2QVBA 5EHNA 5JAPA 3TRDA 3ICVA 3AINA 2JGKA 4A16A 4B0PA 4EHBA 5ALRA 4OPMA 5J3JA 3I1IA 2WU3A 5E4YA 4UBOA 3HABA 4X85A 5FLKA 3FYUB 2HFJA 3PDCA 3ILSA 2J3QA 2ZJ6A 1ORVA 4X6YA 5AIAA 5ALEA 1CUZA 4FFWA 3RARA 4MEBA 1AGYA 3OOSA 3WYNA 2PBLA 4KE9A 4KAJA 3DOHA 1BS9A 1MT3A 5AM4A 3V1KA 3ZI7A 5I7UA 4DSZA 4A23A 3HRHA 1CUSA 1JNQA 2ORYA 4IH9A 1QO7A 2BAGA 5AM3A 2ZJ7A 3M81A 4I4CA 1QO9A 1XQXA 1EB9A 5K3EA 4NVRA 3BJRA 1TRHA 5D6OA 3STWA 3DYVA 4ZGBA 4H7JA 1FFEA 3F67A 2WIJA 3VXKA 3VJKA 4PNZA 3OM8A 2OLEA 5HF8A 3F97A 3IUJA 1FGMA 3C6XA 3D59A 1CIJA 5ALVA 5FKJA 4UBLA 5JAHA 3F96A 4E15A 1J06A 3L1IA 3D3NA 1AKNA 4QDOA 3R3VA 5JAUA 1VZ3A 2Z3WA 2WUEA 1CV2A 3FLBA 1QIGA 5AKKA 2G5TA 4FBLA 4X6XA 1KU0A 1YA4A 2GZSA 2J4CA 2G4LA 5ALDA 4J0HA 4FOLA 1GPNA 4W1PA 1JJBA 3A6ZA 2XUHA 3NOXA 3WQHA 3O4JA 4B83A 1W1IA 2HA5A 4W1RA 4MYSA 2HA3A 3H2HA 2JEYA 3L1HA 3HZOA 3VKFA 1GPLA 2BFNA 1UOOA 3H1AA 4WFKA 3R41A 4ZREA 3H2JA 4H7HA 4XX1A 1GKLA 5DTIA 3G0GA 4XVCA 5A62A 5AH0A 1AMNA 4DNOA 3V99A 1A88A 5KWIA 4OUKX 3BF7A 5D3KA 1QE3A 3PI6A 3U1TA 3ZWQA 2W22A 1GQSA 4GWLA 3Q8WA 2HRQA 2EDCA 2G5PA 3HYSA 4G8DA 1UK9A 4BB0A 1OLPA 3G9UA 2JGFA 4DLNA 4P9NA 2Y2UA 1EDEA 4P92A 1XQYA 5LZ8A 4X97A 1MAHA 1XZAA 2WKWA 2WM2A 1R9NA 2DQYA 1G5FA 2DHCA 3H2GA 2VEOA 1PJAA 1XZDA 2QRUA 1ZIYA 1BEZA 5CH3A 2VJBA 3V9AA 3GROA 1DX6A 3I2GA 1CA1A 2I78A 4RNCA 4X00A 2XQKA 1K5PA 1FGRA 1YCDA 3HEAA 1Q0ZA 5HCUA 3O9MA 2ECFA 5HF6A 1WPXA 2ZJFA 2ACKA 5EIHA 4KRXA 1QIFA 1XLWA 1EDDA 1QJ4A 2JGMA 1FGOA 2OCLA 1N1MA 3PUIA 1HBJA 1XKLA 2WJ3A 3ED1A 4U2FA 4UBNA 1AX9A 1CQWA 1GYGA 2HU8A 5C8ZA 3W04A 5AOAA 3EQ7A 3PFCA 2V98A 2WFLB 2OCKA 4LXGA 4L9AA 3GA7A 1UK7A 2Z3ZA 5AK3A 4BE9A 3C6BA 3STTA 4LYEA 3PF8A 4PW0A 1ZI8A 4B6GA 1BRTA 2HA0A 3FAKA 1O6GA 1VLQA 2H1IA 2J3DA 1N5MA 4N8EA 5DLPA 1LPMA 2O7RA 4OCZA 1CVLA 2RHWA 2XMCA 1EI9A 3LIPA 2XMBA 5CMLA 1RRLA 2VSQA 2X8BA 2X76A 4FDMA 2HU7A 5JATA 1JU4A 2ES4A 1IK3A 2LIPA 3C43A 4UHDA 4G9EA 2OAEA 1RWQA 3QMWA 2QJRA 4HRXA 3G0BA 4DIUA 3BJMA 1CUUA 1RP1A 5ALGA 1XZEA 5K3BA 3BNEA 2XUFA 4K6KA 1ODCA 1J07A 1XZBA 2J4FA 1IVYA 5A2GA 3KOOA 1XLUA 4LKOA 1ISPA 1TCAA 2C0PA 3CCBA 2ZYSA 2BKLA 2UZ0A 5CT8A 3RK4A 3VVLA 2WXTA 1Y4KA 3E4DA 1THGA 1VA4A 3WKEA 5AK5A 2RGUA 4CFSA 3KXPA 3WK9A 3WYDA 4FLFA 5KWJA 1CUXA 5IVHA
chains in the Genus database with same CATH superfamily
1ECPA 5BMVF 3HB0A 1U0GA 4G09A 3DDUA 2PIAA 4FYMA 1WS6A 4EK9A 2F4VB 1WMEA 2E5FA 2HWUA 4IRUB 1VE9A 2HHJA 1C3EA 4UBKA 3G59A 2JLAA 4IILA 1BDIA 2X0FA 1R5NA 2QRQA 1X7GA 2QA5A 2VH1A 1OCEA 1IH8A 3PHIA 1KAOA 2I6SA 4X7PA 3EVGA 1ST2A 1U2ZA 2PZJA 4KVZA 3MTEA 3WB0A 3L0PA 2Z9CA 2PNFA 3U13A 1ULHA 3ON5A 5HKAA 3ORFA 4KITB 3UA3A 1LUAA 2I1VB 1FQWA 5D7NA 1M34B 3IESA 4GMKA 1ZR2A 3BE4A 1DKQA 1W47A 4JKIA 4KK3A 3OE7D 2D2FA 1MRNA 3TLXA 3V42A 2A92A 1HC7A 3HRKA 4RL4A 3A10A 3DT9A 4A5OA 3NYRA 4DG8A 3HUFA 1W5EA 2VWHA 3CTPA 1KK2A 1R0CA 4UULA 2PV0A 3HQ4O 3NVDA 3VU9A 4HEQA 4ZT2A 1T9DA 4NS4A 2B8EA 3OFNA 5EP3A 5K2MA 1XHEA 4MCAA 3TVDA 3ECAA 2E5WA 1G42A 3EQ9A 1EGHA 4U7JA 2O0LA 2OZPA 4LJ8A 2Q3JA 5E0KB 3KPYA 4ZT3A 1THTA 1PG5A 1R4NB 4RKWA 1BWRA 3HVRA 3CF4A 4GRDA 5A02A 1VGVA 4OB7A 4QD3A 4BVKA 5JRJA 2GH1A 2QS9A 1T4MA 2HLDD 3KJIA 2QJFA 5F51A 1CY8A 3IIKA 4C22A 2CNLA 4Q7MB 4KNVA 5CLJA 1U1FA 1SVMA 3GUVA 3GB9A 4J7CA 4EI9A 2E18A 4A1OA 3H19A 2ADOA 2PJZA 1WMAA 2Q6IA 1FS4A 2YBEA 1XB2A 2ETVA 1ULAA 4RZSA 1DLIA 2VT3A 3QWFA 5HGJA 3UAWA 5IXYA 4XR4A 4DKJA 2HSEA 4KMRA 4WZAA 4C4OA 3GXBA 5KVVA 2V59A 3AHDA 3CT6A 3KKPA 1T15A 2WPDA 5EKSA 1E1CB 3AZPA 1XEFA 1LWNA 3MC1A 2GBFA 4DSNA 3COZA 3HNPA 1YZLA 3HP7A 2P75A 2YQ4A 3U4HA 3KC2A 3VZCA 3RAFC 1IJBA 3L6UA 2QAJA 3UJ7A 3BTSA 3BPSA 1EVLA 3HMQA 2H07A 3IILA 1JQ5A 2R5FA 1O6ZA 2YYZA 3L84A 4F4UA 4BUZA 4TV8F 3EZLA 5DLQC 5M29A 3CN7A 4YB8A 2R0QC 3WKBA 1C29B 5G40A 2EJBA 4WKOA 2JIQA 3IVAA 1E9AA 2FJ0A 2Y2VA 2ZSHA 4JNCA 3F7NA 4MR9B 2Q1YA 1WLSA 4RFSB 5BR1A 2FZKA 3ITKA 4HDMA 4WW0A 3RV4A 4Y2QA 5I7HA 3QTBA 3UAVA 2QX9A 2B6NA 2X5KO 3IP1A 4FGKA 3VH1A 3N9IA 1WP9A 2NUPB 9LDBA 5KTPA 2YOFA 1CUAA 1VBMA 3L8CA 3HBJA 3H5LA 1V9LA 5KOHB 3MQFA 3TQRA 4WZBA 3KE8A 2OVFA 3UJ9A 4X65B 5EHZA 5I5EA 9ATCA 4NCNA 4RS3A 3EVNA 2G4CA 2R2AA 4U4AA 4XWGA 4IIXA 3D4BA 4Z9BA 4MH0R 1ENZA 1RHKA 3C3JA 3G9TA 3E0XA 2K7ZA 1U3WA 1SBTA 5K0LA 3E27A 3ZWKA 5LQKA 3ACBA 2C0QA 2BHRA 1YQUA 3QPBA 1SXJC 2WIKA 2Q07A 3SHWA 4BNGA 3GV0A 1U0BB 1NBEA 2JLWA 5J1SB 2JAXA 1PZGA 4B71A 3FPKA 1EQAA 3I6YA 1TTQB 3OCVA 3FUWA 3ST7A 1YVEI 4QE3A 1NOKA 3AJ9A 5ER6A 5K4AA 4RIIA 3VI4B 4ARIA 2NG1A 2ZVPX 2H1RA 1KEWA 4FFBA 4QEKA 1FFWA 4X93A 2ZDHA 1A76A 3NNSA 5FOTA 3U0BA 1NP3A 3KVOA 3IEKA 4EJSA 2ZU0C 3G5TA 2UZAA 4FGJA 1JZSA 4G67A 4I55F 3OJCA 5EA2A 2XOXA 1SUSA 3N75A 2VPQA 3C4QA 1V2GA 4MQLA 5K0NA 1SWVA 2AFRA 3EMDA 1WWKA 3K16A 1FBNA 4FLMA 4AKEA 2BPOA 1QPZA 3UWSA 1NXWA 1U3DA 2GESA 4WFQA 1VE3A 3ELUA 4QASA 1VG8A 2BSAA 2NXNA 4H6PA 4C7KA 2REBA 3IODA 1I4OA 4TMVA 3E8XA 1G18A 2JJ2A 3FYCA 2FUG1 1CZOA 1J70A 4FM9A 1QZ3A 1A9PA 2DMRA 4RSGA 5G0TA 2COKA 3SP1A 3X1JA 1HT3A 4KXWA 4UMEA 3T9AA 4BNDB 4HLUA 2P8JA 3S27A 1PV2A 2YWDA 4L8WB 1Z0ZA 4E07A 4OBWA 3WB9A 5JWRA 2NZ2A 1K2VN 4P7BA 2H00A 1RJDA 1J7KA 1Q0SA 2QZSA 5TPZD 2R8ZA 4GZMA 5DGHA 1JLRA 4UTVA 3CEHA 4TTJA 3KZNA 3KP1A 4HQFA 2IK8A 2JLVA 4KLZA 3WL8A 5BNIA 2ZYHA 3ADDA 2JD2A 1DINA 1OFGA 1YIAA 4CG3A 4AJ9A 4D45A 5BW8A 4HWGA 5BSKA 4ZI3A 4AO7A 1SZDA 1Y89A 3GO4A 3H05A 3DMRA 5KOHA 2BH2A 3SQWA 3CRZA 4HNQA 2JLXA 1CB7A 3ESXA 4MS3A 4QUJA 1C9KA 1MB2A 1XTZA 2WU8A 2ZIGA 2RGXA 5A4KA 1KDRA 2P4SA 3ZOKA 1OW3B 1C4OA 1VLLA 1QG6A 3EFOB 1EM6A 2BFAA 4MPDA 4MZXA 1UPTA 4HWSA 3CUVA 1KJYA 1T5OA 3DQPA 1YKGA 1L4NA 2WFZA 2XHZA 3PWSA 2ZRQA 2FW1A 1AKVA 1TD9A 1X8XA 3VHRA 4BWGA 1YZFA 4C7OB 4X61A 2FUKA 1DIBA 3QEMA 5EP2A 1L5NA 3E9MA 3DPSA 2IDZA 4IIBA 5AVTA 2ZJYA 1VL1A 1JKJA 2CD9A 3PXBA 4ID3A 2IZOA 5DYIA 1PT5A 2WTBA 3CUYA 4NU6A 1JHQA 4QUGA 2W42A 1DC8A 2R8PA 2P3QA 2DJ5A 2N3ZA 2VTDA 1G4UR 2WVAA 4DLRA 1H6DA 1B23P 3U5TA 3NGLA 3WHIA 1L8QA 1WW3A 2PGXA 1JFRA 3GWZA 5JD5A 2NT4A 2FQXA 3CUTA 3FHLA 3WLPA 3MYRA 5A0FA 1OE0A 4QGSA 1FFXA 3ABRB 3UCEA 3WK5A 4YR9A 5L6MB 4HDKB 2X3YA 1QLWA 2XUIA 2C7GA 5AR1A 5FXMA 3VHQA 3U5ZB 4NEHB 4WY8A 4ZCQA 3ZK9A 1GPDG 2VQ6A 4Y6GB 2W8ZA 1RYMA 4ZHSA 5E6RB 1NNLA 3C6KA 4M9CA 2CBZA 3C7CB 3FGPA 3HY4A 2F3UA 3CJTA 5HS6A 2CHUA 5DMXA 2OWDA 1XQ6A 2XB6A 3EC2A 3ESQA 3I2KA 4G3XA 5B3JC 3WKAA 1V9CA 3HVKA 1X1DA 4YYZA 3IP7A 2B8JA 4HWOA 5HBRA 3TPFA 1LW7A 1M2OB 1VXOA 3P26A 1IOVA 2E6KA 5CX1A 3V2UA 4X95A 2BOVA 2H48A 1RZVA 2WJHA 3F1KA 3NV7A 1H1LA 4X92A 3L43A 3GAFA 5EZYA 4CL8A 3CWZB 1VXRA 5KJ1A 3DWGA 5K3FA 1N75A 3K8ZA 1PFQA 2QTBA 3QVXA 4K6OA 5FTNA 4ER3A 3L02A 1YD7A 1G6KA 1K7CA 2EJCA 4ZHQB 1FF9A 2IBTA 1TW3A 2A5YB 4O4HF 3LO8A 2Q5JA 1J1IA 4OJNA 4E09A 3ROPA 1FK8A 3B5IA 5A1JA 2FQQA 3ISJA 1W46A 4JP2A 5EJ4A 5HQ3B 3EGDA 3OUUA 3CRW1 3OICA 1G0OA 3H2BA 3Q9LA 1LPSA 4Q9IA 1RQPA 1KDZA 4GOXA 1QKJA 1YACA 1TA9A 1N2ZA 3VR2D 1CHNA 2C58A 1YRYE 3PJEA 4XJVA 3ZHBA 4DIDA 2E0IA 3CLUC 4QRHA 1VJGA 1NJGA 1U7OA 1Q95A 1WUTA 2AVNA 4FZJA 4KAAA 4RK1A 3SDBA 5AHXA 4PPGA 4D0LB 4F6LA 2R6ZA 2C4WA 1YHNA 4E13A 2ZTVA 3VV3A 1Y42X 4WN9A 1KHTA 2XUZA 4QUIA 4WKBA 2IV3A 2XDAA 5FF9A 4DMUB 5DK6A 3AR2A 3Q9UA 5BVGB 1QH8B 2AEMA 1KY2A 3UN1A 1GARA 1I30A 5JDCA 1LDBA 1CY7A 3GLRA 4JBYA 5TQJA 5DLYA 3RFVA 3ZPXA 5EQJB 1A7KA 4K40A 1IM5A 3L7CA 3WGMA 5EIBC 2AJTA 5ALUA 3BKWA 2BFEB 4IIYA 2QAIA 3RTGA 3VSCA 1DAMA 1HE4A 2OZLA 4YRKA 2WLSA 1VLVA 2XNDA 4DLKA 2OL4A 3V8BA 4MNTA 3B20A 2ZCUA 2AF3C 4MTCA 4YUYA 2DH6A 4GLBA 4CL0A 1KAMA 5G1NA 4WY5A 3ZDQA 2ZT5A 1G20A 4PSVA 1PLLA 3UICA 3VNRA 5B30A 2OVBA 4DCJA 2PUFA 3VR6A 4HNTA 1G21E 4LZNA 1RQGA 3I39X 2DFDA 4YHBA 2O0MA 3R09A 3GVXA 1C7ZA 3KQUA 4M0LA 1G3UA 1RZRD 1ZXBA 4UXIA 2CLCX 2PS9A 2YYSA 3OC0A 2B0CA 1HEYA 3MT8A 4U7WA 4WXYB 4YBRA 5D86A 5SY4A 3VR4A 4KAFA 4CLHA 1NQAO 5JANA 4D74A 4FHGA 2R7KA 1DI0A 2IEAA 4NOMA 4MVCA 3A11A 4LFAB 1P1BA 4LOAA 2GILA 4OQ4A 1ZCJA 1EE9A 1XALA 3BIOA 4YK7A 1VKOA 1RXYA 2XUPA 4MAAA 1HURA 3K8QA 3KIPA 4HS9A 4UZSA 5LQMA 3D7LA 2CZGA 4X44A 4MQEA 3S70A 1RPZA 1L7EA 4XEHA 1EX6A 1MOPA 1R6XA 4YCJA 3LFUA 4JXJA 1RJ9A 2XZLA 1NI4A 1QQTA 2HCFA 3IB6A 1JQ3A 4YASA 3AR7A 5AVOA 1E4VA 1ZS9A 2RC5A 2OBBA 5IDVA 4XCQA 1WNFA 1HDXA 4YV7A 1ZM9A 1VG1A 2CLSA 3I12A 4G9BA 1DTEA 2HDNB 4OGLA 4RPLA 2FX3A 1ZP6A 2NSHA 1E66A 3RROA 5AVXA 5EIBD 1RFLA 3HWSA 1LF0A 4GYYA 1V8ZA 2QG9A 1QIEA 3L7OA 3PDIA 3VMMA 2C4KA 4G89A 1V8PA 3OLWA 3ZEIA 4HBZA 4DDMA 2CXXA 2XHEA 4NI5A 5M3BA 2TS1A 3WRXC 1FYXA 3G0IA 1SKYB 3AJEA 4X24A 3WTCA 1PIWA 2QTRA 2ZITA 5D2CA 4YN3A 2IPAB 1GPMA 2C5LA 4UAUA 1PUIA 1Z8HA 4QUEA 3AUUA 2Q4RA 4FFSA 4M0FA 2H2WA 1FSSA 4YO7A 1E2KA 2VWPA 5J63A 4EBFA 1TUEA 1CUFA 2E3JA 2F90A 3OZTA 4RE5A 4J75A 3ZW8A 1XTRA 3JVEA 1OZGA 2BZ1A 2V74B 2VSYA 4P7FA 3EPLA 3BNBA 1P2BA 3BMCA 4JA0A 1ENYA 4ZOLF 2JA2A 3U3OA 5GONB 3VZSA 1N2HA 4EZEA 4M88A 3QPCA 1XZQA 1QLHA 3GRRA 2VPPA 1EXDA 3N2GB 4DLAA 3H3FA 5ADUS 1A9YA 1CEXA 2PU7A 2OV8A 4ITRC 3N7AA 2F8LA 2GBCA 1JKMA 5SZJA 4EL0A 4WNAA 3BD6A 3RE1A 3T5AA 2B1GA 3RUEA 3WK6A 1CUVA 4W63A 1KJ9A 4NZZA 3RTCA 3SR0A 3W05A 1DMRA 4IV0A 5EJGA 4EATA 5ELMA 4MQFA 4D9EA 1DAHA 4IIVA 3GRFA 5HYVA 1SBZA 2PWZA 4HCJA 4K9RA 1YXMA 3BDAA 4A8TA 2J87A 3MTDA 1V96A 4A0HA 3U61B 2GZAA 2R00C 4AIRA 2J3IA 2ZUFA 3MEQA 5I9SA 1UKCA 2G1AA 1JNXX 3JCZA 4D5GA 1B7GO 4HNUA 1MKYA 1PX0A 2FQYA 4TVSA 3LECA 5L4SA 5ILQA 5HNKA 2GN6A 5H9WA 4YGYA 4CEJA 1FW6A 5FPSA 5LQSA 1O5TA 5L9AA 4UHFA 4E30A 1RAAA 4RMIA 1PUJA 4X41A 5KYKA 1NIPA 3IUPA 4I9GA 1KO8A 4EP1A 2C03A 3LDUA 1YE3A 2GAIA 3AUAA 1I7NA 4FHCA 1S8AA 3AEUA 4H17A 3I5XA 1C7IA 3T5GA 5F2NA 4FDLA 5CYOA 1OWOA 2MOKA 2V7UA 1QGUA 2GN9A 2DBRA 1U3GA 3GZJA 4Z49A 1I0IA 1VC2A 2BUBA 4JVMA 3WGYA 4EQ6B 2B4YA 1OC4A 4H6XA 2XQIA 2BSXA 1LXCA 2REQA 5IJAA 4YJFB 2LKDA 3HBMA 1B43A 4O0MA 3FVVA 5IZ4A 3KLPX 4G4JA 3OCYA 1WXQA 1FDVA 3LUGA 1A2QA 3QVGB 4JLMA 4FFDA 1RI4A 4JX8A 3GLHE 2VQ3A 3OA0A 4LXYA 1N2EA 2QD5A 1JQLB 1M2JA 1VFPA 4CM7A 4G1FA 3NYQA 1AHPA 1WBJB 3RC2A 1XN4A 3AL2A 4O4JB 3CF0A 1S01A 4LDPA 3TKLA 1SCKA 2EARA 3TPCA 2P9FA 2IU3A 3R7AA 1Z7BA 1H22A 2LGJA 2YL2A 3WIBA 4LBZA 4QWTA 1N1DA 4DDWA 1E59A 4L02A 4R71A 3RCBA 3EXEB 3JAKB 3DZFA 1UZMA 2NTEA 4UXHA 3VGPA 5IWCA 1SU4A 3KZXA 1HFEL 4GLOA 5KYUB 2D1RA 3ETJA 3NS7A 4G5XA 1Z4JA 2HK7A 3QBJA 3IUEA 1AXEA 4R4JA 3HB7A 2HV9A 4AD8A 3KL4A 3KQPA 4KMOA 1Q1BA 2IYTA 3LDGA 2H3HA 1W59A 5HJEA 3GF4A 2ZJ0A 1H1DA 3OG9A 2IPOA 2PKXA 3DPUA 2ODWA 1YFZA 2ZR0A 3G9ZA 3PUYA 4JYMA 4KQ6A 4H60A 2I99A 5TMDA 2Q6LA 3WAJA 4OLAA 3OZ7A 1CU1A 1R5BA 1CX9B 3R7FA 4BJHB 3GUYA 3OT1B 1E0KA 4QEZA 1RRPA 1Y5LA 1Y1QA 2EV9A 2BM8A 3I23A 2RI0A 3E3AA 2OWEA 2X8LA 2X9VA 3LNTA 1JTFA 2OQVA 3RVJA 4A6DA 5IH7A 4LYFA 4NU8X 3YASA 3AETA 3RUPA 4POOA 5FBHA 5D7BA 2YICA 5IZCA 4ZJUA 3CVOA 4BU0A 3Q8KA 2H7VA 4PAMA 3TLYA 3JX9A 4I9HA 4FK8A 2I3GA 2O7VA 3I2HA 2V9PA 4R2JA 1TEZA 1XL0A 5K0CA 4YCLA 1JG3A 2G9RA 2JASA 1Q11A 3GLGB 2EGGA 2HMWA 3TYXA 1QF7A 5JI2E 2GZDA 2RGYA 3BG5A 3PICA 4O6VA 4PLHA 3VO9A 3DLCA 4J0JA 2ECQA 2P9ZA 3C8UA 4YUWA 3KHTA 1Y4ZA 4HT3B 3DF7A 4DUYB 1N3LA 1YR7A 4MWZA 5JD3A 1LSJA 2YVUA 4XXHA 3T34A 1E9EA 1Y7TA 3EIFA 2PSEA 2PUHA 4WLOA 5EXPA 4ILKA 5FRDA 4IHAA 4MMYB 3COVA 4XWTA 3RUHA 3RYIA 4RZHA 5IAAA 3TB6A 3AB3A 2AXPA 2V4UA 2ZTLA 3QXHA 3OFND 3HGMA 3GELA 3Q0EA 1QM5A 1S3GA 4PV7A 2W93A 2AC4A 3PXUA 1W87A 2L0XA 1EB8A 1T2EA 3DWEX 3KNZA 1MW8X 3ONDA 4Q4JB 1MR3F 1GPKA 4IWYA 2B69A 1L7MA 3GMIA 4CV1A 1T6NA 2I6TA 2IX9A 3B1KA 3K30A 4XIFA 2WWYA 2FPXA 1SCIA 4LA4A 1FA9A 2D5BA 5HRUA 1SCNE 3GX1A 3EPJA 1K08A 1ZD2P 1AZSC 2P1DA 4JWKA 4OU5A 5IKOA 1QYDA 4G0PA 5JHGB 2F8SA 3C7DB 1QTNA 1QGOA 2G1JA 1DEOA 3T9CA 1JXAA 5JXHA 1J2RA 3ITDA 3L77A 4E11A 2WG1A 2DFVA 1JW9B 1RYEA 4FCVA 4RKYA 1Q7BA 2P62A 3EW9A 2B9EA 3GARA 2VXCA 5IH3A 5GM2A 1KY3A 2PKQP 2DQZA 2FWMX 1BQ4A 4J7XA 3M1LA 2V6BA 3F3YA 1Z16A 2FSIA 2AVDA 1DL5A 2O23A 2Z2ZA 3PDUA 4UEJA 1KU6A 4AP5A 1UBMS 4WI1A 4ZYUA 3OHMA 3R76A 1EEXB 4XPZA 3FG4A 5E1MA 4YI5A 5KNDH 3QPVA 1PV4A 1W25A 2A1TS 2YY6A 2G3YA 5H59A 1TQ2A 3CF4G 3DE7X 4E4TA 2Y76A 3ROFA 4Z7OB 1T5DX 1VLJA 2R48A 1I8TA 4HQNA 4RCYA 3R6WA 4FTWA 4TXMA 2VJQA 4KE6A 2XA1A 2NX2A 1FC0A 1JSCA 2BGWA 3EFOA 2WABA 3SHOA 1WU8A 4MRMA 3SQOA 3WL7A 1KZ9A 1ECCA 2PGLA 4U7GA 4WFIA 3FOCA 1GT6A 1KDYA 1EUCB 2CDNA 2O2ZA 2VHEA 2AOXA 5CVJA 1AUQA 4KO1S 1KO7A 3NRJA 3M33A 2A5DA 4RCZA 1Y9EA 2NZUG 1CJVC 2FGKA 2WRZA 3QG5A 5A05A 4D9KA 4HZUA 2WILA 1IOLA 3VX3A 3ETNA 1UBRS 4PXYA 2GR9A 4E2FA 3WWZA 3VU0A 4CG1A 2X4IA 5B1IA 4LGCA 4YRGA 1G4HA 2FFQA 3OMXA 2BF4A 3G2NA 4US0R 4WRRA 3O75A 3PJRA 5AHWA 3CRQA 4HH0A 4Q19A 3ETGA 3L8ZA 2YASA 4KXMA 1VE5A 1JYEA 2VHZA 4QNRA 1X9HA 1E6MA 4D80A 2I03A 3BVPA 1ISGA 3M2PA 2A5GA 2JAUA 3QI7A 1B8PA 1XDWA 2IBSA 2IP2A 3O2SB 3T7JA 4FX5A 4C2AA 1KY5A 3KKEA 4ZP1A 1RNLA 1PJLA 1QGZA 3FNFA 1V8OA 4NL4H 4J49A 5CM8B 4BNVA 5JTTA 4JEHA 3TOCA 4DYHA 3HLYA 1W5AA 2REOA 2CJPA 2JVIA 1AK1A 2A5FA 3R3WA 3GLHB 3PR2B 5KYGA 1OR8A 2QU8A 3UAOA 3R5HA 1RIIA 3H16A 2VDVE 4M0DA 3GPLA 2Q41A 1QUFA 3T0FA 3EPKA 2I54A 3PQ3A 1N7GA 3DTVD 3PWZA 4E5PA 2CL7X 2V7QA 4PX3A 1QGYA 2IOYA 2IH5A 3CLSC 4XH9B 1UQTA 2JJ2D 1WSDA 3DKRA 3L41A 2UUBB 1OXUA 4RGYA 2QNRA 4F60A 1YL7A 2J5QA 4HEA6 1AF4A 4YUZA 4B3TB 5H7XA 5TRTA 1WY5A 4TS3A 3NJ8A 3ZOZA 2FOIA 3IR6A 4KO8A 1R18A 1E4EB 3ORQA 3RAPR 2KS6A 3NBQA 4HB0A 5IVIA 1CLEA 1E6WA 2NO5A 2ZSUA 3KDSE 4DAEA 4EYEA 3A6HA 3ZYCA 3HTXA 2NVWA 3DP9A 2E4YA 2F3PA 3LCVB 4AN1A 5AW1A 1KNXA 4WESA 4QNMA 3RC7A 3KSDO 4ZOCA 1MPTA 1K8YB 1SURA 3P32A 2FN8A 2J9GA 3RFCA 2VRNA 1SRQA 3SSNA 4AUNA 1T26A 2BTQA 4OHWA 3HJTA 4DJFC 4DY4A 2RMKA 1W9MA 4X84A 3WB1A 2VYFA 4KE7A 3BCSA 3JD4A 4H4EA 4LTNA 5KYVA 4YAGA 2W37A 4BUCA 3CUUA 1V8DA 1WUJS 3OM0A 3NBFA 4TWJA 1MVLA 5CDHA 3AR4A 4YP6A 1C7QA 2PHZA 4N40A 4ZXPA 1O94D 2G04A 2ZIXB 4H1TA 3KJNA 2IEIA 5IWAB 2E6UX 1ZMTA 4AL4A 2KB0A 3NUGA 5H4GA 1KAEA 1PF7E 3QFHA 1V8BA 3ND6A 2IDKA 4G01B 5L4LA 5GIOE 3NPMA 1WXEA 3Q3IA 1V0JA 3FUXA 1SRRA 1CQJA 5EIFA 2G6BA 4HN2A 2GVZC 5HDBB 2I8CA 2PXAA 5C2JB 4PRKA 1A0OA 1TKRA 3LRPA 4XSHA 3MWFA 3CWZA 2HIHA 2VOEA 1JR3A 1RLUA 5JMTA 1BW9B 4BJ1A 5CFNA 4BZPA 4ESEA 2ADFA 2XRYA 4J07A 1GQRA 5G53C 4X54A 4TQUS 1BGVA 3LPMA 4Q48A 5DHFA 5ICFA 4RHFA 4HTAA 5CLQA 1I2CA 3UMBA 3KZ1E 4XX0B 1MC4A 3QVLA 5E4TA 3DHVA 2PJRA 4B3MB 3O90A 5JH7B 3I8SA 3TIGA 2OQRA 5TSDA 1YS1X 1E1LA 4KBFA 3GJ4A 3KAJA 5E6RA 1DVRA 5ERYA 2YNMA 2PSSA 4PGGA 3IT0A 3D43A 4OJQA 3SYKA 1OLUB 1P7PA 3GCXA 3N5CA 2Q3MA 4LXXA 3TAHA 4E2YA 1YDMA 2NSJA 3NAZA 2IDMA 1DWPA 2NM0A 4FFOA 2FV8A 3Q40A 4GMFA 4MWOA 5HZMA 1A8SA 1E92A 2NLOA 1QVWA 4LMRA 5COAA 1DGQA 1R5JA 1IONA 1Q12A 1TIKA 4FDUA 1XNHA 1G4AE 1O6BA 4O2RA 1L3IA 1JEQB 2I33A 4RTPA 5LMCA 1MJ5A 2AZ4A 4ERNA 1LLFA 3ZGNA 5HZKA 5KNCH 4RHTA 1E3JA 2YVAA 4F93B 2B4AA 5A9SB 4CCWA 1ODTC 1X8JA 2A57A 2IQ5A 2QMZA 2WVHA 4LOKA 2RCNA 3SIXA 4DCMA 4YCMA 3CNEA 4JENA 4TWRA 5HE9A 1WVMA 1CDEA 1ZM4A 3JQGA 1XRNA 3EXHB 2XODA 4U7DA 3IE1A 1N3IA 4JUIA 2AWOA 3NXKA 3HCBA 4EJSC 1AKEA 4W1SA 3TRIA 3BXFA 3IGFA 3GPBA 2GETA 4NREA 3EXFB 1L7AA 1ORHA 4LY6A 4YGXB 4C01A 4B3IA 1HKHA 3DYBA 4DJAA 3QUTA 2MINB 1PN3A 3EQ6A 3HBNA 3HACA 4LE1A 1XMXA 5JYEA 2AZXA 3UK2A 1KH2A 1HDOA 1RBQA 2YUIA 5EXSA 2CHGA 1ZM7A 1GUFA 2JIOA 2X41A 3B9RA 3H0KA 2D7CA 3CMMA 3I58A 2XMDA 3O9VA 4Q01A 4X63A 5LB4A 2PSHA 3IAEA 4YAFA 1GCIA 3ZGZA 1AJEA 1SVIA 2G1KA 2F64A 4NTZA 3ZNOA 1R8JA 2PUEA 1FNSA 2P2LA 1N33B 2G17A 3O47A 2XT0A 5AI6A 4HY3A 2E2WA 3U4IA 2HFKA 3MUNA 6ADHA 4J2TA 2ZEJA 3KZCA 3HM9A 2MJLA 2WSYB 4BECA 4JHLA 1M1YA 2Q6KA 2NU9B 1NIJA 3UXMA 1XCPA 4KLAA 4R2LA 3TMAA 3VH4A 2GM3A 4PZUA 2OUKA 1L9XA 3CPJB 5IVDA 4YAUA 3QOFA 1N0WA 1NW3A 3A1CA 1VL2A 3FI9A 1D09A 1FUEA 3C85A 4UJ5A 5L3VA 3GGPA 3MVEA 1JYFA 3O4HA 4ARAA 4TYWA 3CMCO 5BP7A 5DEOA 3GFQA 1U0EA 5MN4A 4HWPA 1Z83A 4IICA 2IP4A 2P9BA 2BMAA 2PZKA 3VC3A 2QK4A 2VJLA 3D3EA 3HJGA 1DKRA 3THSA 2J1LA 3W9UA 4OI4A 1XMPA 5ARDA 4Z3DA 5DNYB 2GWRA 3VAYA 2W98A 5K99A 1AHNA 2HNKA 1UT8A 3T3NA 5JDIC 5DW3A 2BSQA 1K0FA 5EI5A 1F5NA 1YOVB 1RZRA 4R0VA 4ZOAA 2CXSA 2VJKA 2PX8A 1W2HA 3S40A 2X8JA 4KRYA 4RYLA 1N3BA 3DMTA 4LJ5A 4Y7CA 3WLNA 5KTTA 3JVIA 1E7WA 3PQ2A 3EOBI 3BK2A 1DKMA 4CYMA 1CR0A 1U0RA 1U2PA 1T8WA 2AUMA 2NWQA 2ZR9A 3QE2A 4Q1FA 4JI7B 3PE6A 2GNOA 4KLCA 4GOLD 4U2EA 1A8UA 4BDSA 3L1KA 2BGUA 4DR7B 5ER9A 4NX2A 3RBXA 1HFKA 1GT91 3AEQB 3PUZA 3RJMA 1DBIA 1NBMD 3DZJA 3RT7A 1KVSA 3GZTB 2HMTA 3DT6A 4MJ3A 1TFRA 4RU1A 3SZMA 2WJWA 2DSTA 3ASUA 2I71A 1M6HA 4BO1A 2HWXA 5J4LA 1AO3A 1GKYA 3N2LA 1B15A 1O77A 2FXVA 4OMDA 5AJUA 1R3UA 2AR9A 2FUG6 1JEAA 4QU5A 2NYVA 2DT8A 1JPNA 2P9JA 3JQAD 2ZSBA 2CJXA 2RK3A 4BFLA 2HDOA 4EW6A 2P35A 3C4JA 4EY6A 4GBJA 2D74A 4KN8A 3STXA 3U3KA 3UH0A 1MAVA 3E1KA 3C7AA 1GD1O 3B6EA 3EW7A 3SM3A 4MAMA 2J5XA 2VG8A 4QVGA 3CURA 3BGVA 3GAZA 2QV7A 2UVPA 4TWBA 4HLQB 3VVCA 3OWOA 4OJTA 2O8CA 2ZI6A 3IUMA 1NAHA 1XEXA 4EUNA 1BOFA 1EFKA 4H16A 3Q9SA 4OO3A 3EIUA 2JBAA 3K09A 1RS0A 5CA1A 1C7EA 2AZTA 3K1ZA 1KZ1A 2PX5A 3N74A 1S2OA 2XUOA 3KOUA 3OT1A 4RA9A 1YK1A 4FFLA 1TTHA 3G79A 3UJBA 2Q4DA 3PA6A 2WIBA 3ZWWA 2LZ0A 1RHRA 2C2GA 4L0MA 4MB6A 2ZE8A 5FUWA 1WTCA 2PWBA 1U81A 5T6MA 5BV0A 3K9NA 1SVSA 4NZ9A 2JZNA 3KZKA 4R2WA 2X3UA 1CEQA 1KTVA 1WHTB 2GKOA 1MW9X 1BHSA 3O82A 4LC9A 5EGSA 1XXHE 2J09A 3T1QA 5INTA 4RUKA 2XA2A 4HLUC 3T9FA 1E94E 4B3RB 3OTQA 2YN2A 2C84A 4IQGA 4G85A 1KMHA 1U2EA 2AQIA 2GN8A 3TL3A 3K1AA 3LF1A 3H1TA 3N1UA 4IZOA 1NVGA 4ZJYA 5A4AA 4YJ2A 1I3CA 2QD3A 2Y1WA 2IIPA 5DISB 1BZYA 2HSWA 3AEKB 2ONCA 3AV0B 3NC4A 4FGSA 4GYWA 4OEHA 2QEQA 3L8HA 4LZOA 3KJGA 3ZK8A 3KJHA 3E81A 3FCCA 1U4NA 3LQKA 2AZDA 3S81A 5HK8A 1QRDA 1GRQA 1R0YA 2AI1A 2WE8A 3KJFA 4OHRA 1HX7A 3CKKA 4ARZB 2P4UA 1OFIA 4MQEB 2I29A 5GGYA 3E2PA 4PNPA 3MT9A 5ESDA 6CHYA 3MCZA 1RWMA 2PL5A 4RPKA 4FFVA 1D07A 3P2KA 1N8SA 1P7VA 3SVTA 2F8MA 2WKSA 2C77A 2GS9A 1B6GA 3KZMA 2Y1LA 2GUWA 1EIZA 3D0KA 4K9OA 2FW8A 2VC2B 3O8CA 4XE5A 1IXSB 2Q50A 1YBAA 1G8HA 1BDJA 1J2YA 1LLQA 1YK0A 4QYSA 5HIAA 2O8DA 1WHSB 2G08A 1S2LA 1IY0A 5BXYA 5FP0A 3A14A 3QVKA 3KSUA 2MU1A 2J6HA 3WFJA 2VTKA 4UM8B 4HGNA 1FLNA 2FWRA 3BXPA 4KQCA 4D81A 2QZPA 3X2SA 2DTXA 2AN5A 1ZGJA 3CPEA 2Y1OA 2NAPA 1W4CA 4W5OA 3AX6A 3WGQA 3DHYA 2XYVA 1QTIA 4W6QA 1PHRA 1ZH0A 2BFBB 1WV0A 4BNKA 5HIJA 5B7NA 4KSYA 1RQLA 3D8UA 5BMVB 4U2CA 2YYYA 3VNAA 4BNYA 4D44A 2C2KA 3HO1A 3OCZA 4QOIA 3W2GA 2VS1A 4GMDA 1BWQA 4HLCA 4IGFA 3OESA 4UNRA 4JI3B 4EFNA 2FXIA 5AVRA 4J4TA 1Q0HA 3BXOA 2R1VA 5EESA 3MCUA 2IITA 5CAEA 3U7GA 4JKOA 3IV7A 3K71B 1AZWA 4E2WA 1XYGA 4NXNB 1WVGA 3II6X 1Y4AE 1RWVA 2IZ6A 4TS9A 2P8SA 3OF3A 3L93A 4DWJA 2VTBB 4B31A 1U8EA 1VHJA 3U6KA 2FYTA 5CA1F 3UHJA 1Q6YA 4J0IA 3H6GA 4EFMA 5BQ5A 4M9RA 1G1MA 5BPFA 1TK3A 4LNUB 1VCHA 4ISCA 3AVTA 2FEWB 3VYVA 4FYIA 1ZICA 4MVJD 4M0EA 4MGEA 2DHRA 5CJ2A 5CCXA 4K9SA 3U2QA 1UZUA 5CJJA 4D9NA 4JL6A 5AOVA 3AC0A 3P2EA 5AKZA 2VBFA 4D9MA 2VHXA 1RYHA 1K06A 4LZWA 5LMUB 1FDIA 2CLKB 5DNAA 4HB4A 4ME6A 4LYDA 4QFDA 2ZAGA 4OLHA 4RK7A 3K70D 3QVVA 4CUZA 1GNSA 3QFTA 1ESEA 4MGHA 4M1ZA 1SR8A 1M8PA 2I0FA 3OZBA 3IBFA 4F85A 5AJZA 1HNXB 2PLWA 2XB9A 2FPIB 2PUVA 1E89A 3QENA 1E5TA 7YASA 4BZXA 3WNVA 5CNMA 5TE9A 3HCRA 4MDYA 5EJ2A 2HJWA 2WYHA 3BN3A 2D0PB 3LV8A 1NHWA 3ZE7A 5JY1A 3AJAA 5ALFA 1XNRB 2GN2A 3UHFA 3D3KA 3AKEA 1JMKC 5DEIA 3EXFA 2I8LA 4F4DA 3V1TC 3AWIA 1YKSA 2LUOA 3BGDA 1QB8A 2JFUA 4U2GA 4QOSA 4EO9A 4PS0A 1MHPA 4HDKA 1DUIA 4N8SA 4MRAA 2D7JA 3HH8A 1ML4A 1O87A 4IY1A 3GGCA 3P9IA 5C7YA 2GJ8A 4JT9A 4Q9LA 3QVWA 3OLCX 4PBTA 3UK1A 2RHHA 2HEGA 1FDOA 3ABSB 1J09A 4A2WA 4JZKA 1ZRSA 4M9UA 3EULA 2C2BA 2HA2A 4I9UA 3CEPB 2O2EA 3E0QA 2NO9A 3LCRA 3MJFA 4HDSB 4PWYA 2YZKA 3O4IA 1SKMA 1QVVA 1JEEA 1GOTA 1YJAA 1GGEA 1I33A 3C74A 2PGNA 2QL6A 5ICCA 2Q62A 4M1QA 5E6UA 3UWOA 3PXEA 3WK8A 5IABA 1U7HA 3WWPA 1PWYE 3VC1A 4CMCA 4C03A 4HJXA 4J0EA 1A7AA 1OFUX 3B3FA 4YREA 2Q21A 1S7CA 1CUJA 1AMOA 3ZLVA 1G6OA 1CFZA 3QPDA 4HATA 1QYCA 3ZZUA 3NEYA 5A3QA 2W4MA 2FY8A 4ZYYA 4XFKA 3FLMA 1PSDA 1TEXA 1OIWA 3TW4A 3DEAA 4YAKA 1LSUA 2ZJ1A 3BCUA 3MCAA 4OD0A 3WLHA 4AT1A 4Q4LA 1RRGA 4WFJA 5BV2P 4BBZA 4HWRA 4DCGA 2WIFA 1QPBA 4B7ZA 1IRIA 1DBSA 1ETUA 1JDBB 1QHYA 1L7RA 2QUZA 1M5UA 3MRVA 3NIBA 4FS8A 4NZMA 4NABA 3IA2A 3MTBA 2B78A 4Y2GA 5E1DA 6GPBA 2GHTA 3C97A 2IELA 3Q3VA 3VPBA 1K5GA 1RAHA 4DMRA 1QZXA 1ZVQA 2HMAA 1PS9A 2I4NA 1V1MB 2PRZA 4J0QA 3HVUA 4JJEA 5AT1A 3T54A 4YCDA 4ZT4A 1BJRE 4O5OA 1QH8A 3N2ZB 1ZFNA 4RTKA 1NBWB 4HLNA 1M1UA 3TOXA 2OHXA 1ZK2A 3OZGA 3FVTA 1L6IA 2ZB4A 1NBMA 1G8FA 1PDOA 3F9CA 2A0KA 4MYTA 1F9AA 3TLBA 3UOWA 3GK3A 4AJLA 4RH1A 3K6JA 3QBTA 2HA4A 3K4HA 2Z83A 5LN1A 2JC3A 3MS4A 1BFDA 2AB0A 1LK0A 4LHVA 5HFNA 1PFVA 4FZ5A 2JGIA 3DM9B 1P62B 4KQFA 4YFVA 3AKYA 1F2UA 4B76A 3G2IA 4DMFA 1L4LA 2AS0A 3NC0C 3OU6A 3DOOA 1N6IA 3ZDRA 3FVWA 2O48X 3OQHA 2VDLB 4TPKA 3WWCA 2XYRA 1UP4A 4WBNA 1HR0B 1TLLA 3RF6A 3L1JA 1MJGA 4R1NA 2XWPA 4A2CA 1ZSVA 1C2TA 2EFDB 2W8BA 2YBDA 3VISA 1YI1A 3PI7A 2BCEA 3PQ7A 2Z2JA 4GXQA 3U3XA 3TZCA 8AT1A 4MVJG 2G25A 4PPQA 3W06A 1IWOA 3L07A 3NWPA 4GUAA 3L8YA 1XRMA 2ZJ2A 1Z5NA 3EFHA 2D5IA 2OZEA 1R6VA 1NWHA 3FWPA 5BNWA 4ASUD 2C1ZA 4W5TA 2QX6A 2R9VA 4OSPA 1FRFS 1JGTA 3PPYA 4F8YA 1PL8A 5JQGB 3Q1KA 3G2OA 5IFLA 2PT5A 3IPLA 2XSZA 2UXCB 2FMTA 3TUJC 2GCPA 2R11A 3QFRA 4U5QA 4DCSA 3ZNPA 1AKYA 3OY2A 5TNXA 2ODEA 3EDRA 1BE8A 4OXKA 4UFPA 2BZSA 4P8RA 1TDJA 1RM5A 3U0VA 4PYJA 5JDCC 4TZTA 3X1ZA 2O2JA 4D97A 5EZ5A 1FX0B 1O7JA 4KTTE 1XRRA 3K8OE 2Y05A 1F12A 1NRXA 2ZB2A 1ARZA 3FE2A 2YXLA 4LWOA 5J59A 3ZY5A 4C3OB 2VTVA 3W5BA 1GNQA 1QGAA 2JDIA 4UNQA 4QLBA 1SCQA 3WOVA 3EEYA 3EJ6A 3BX1A 4PLVA 1IJFA 1NYLA 5HJ5A 1SIOA 4FS3A 2W48A 4GBED 1I6WA 2AJLI 5I9TA 4MPJA 5AM0A 4O08A 1L7QA 4BB9A 2XNKA 2I3BA 3UJAA 3EVEA 1ZBDA 2WYIA 2Q99A 1LI4A 3LXXA 3KSRA 4MV8A 2QVLA 5TQ2B 1KOJA 2OGSA 4IWXA 4Z8XA 1Z7GA 4NJEA 1Z6QA 1C8KA 5B2EA 4MROA 4AJPA 3RREA 4ED9A 5LP1A 3KTAA 3L8GA 4OHFA 1UBUS 4H4CA 5KNBD 1PS0A 3AL3A 3PJFA 3QITA 4H7EA 4KU4A 3VHXB 2FG6C 5BPHA 3G2KA 1MZVA 4BKPA 5D84A 5BWBA 3ZGOA 5IARA 2EKQA 3I9MA 4FQ7A 4RV4A 1WUKS 5KOIA 1VE1A 2E49A 2NQ2C 1Y5MA 2GN0A 2P41A 3PPIA 3U19A 1P29A 2IYEA 2C97A 3GT0A 2AKYA 2Q3BA 3NTLA 3L6DA 4RD1A 2UU9B 1XCGB 2BGTA 3QF4B 5B6PA 4WD3A 1ZY2A 3E5RA 3EFBA 3CCCA 5EY5B 3UWKA 3ZY2A 2QQ0A 4L4ZA 2VATA 1HYHA 1SXPA 1M76A 2Y99A 2A1IA 4P33A 4KCGA 1E4OA 4L6CA 5CXQA 1O9BA 2HQOA 1R9GA 2ONYA 3LG2A 3T7TA 4C6TB 3OPQA 3D1LA 1U7ZA 2VLIA 1PYOA 4HWTA 1EG7A 2ZDQA 3OTOB 3OQBA 4OYLA 3T41A 2YJNA 5C5CA 3PTAA 5I8PA 2BGKA 4P3OA 1F38A 2I2FA 2ZR7A 5J2TB 3JVUA 5F7JA 3F73A 4MR8A 5IF3A 2KBEA 1JU3A 3FF1A 4BTEA 4C43A 1YJ5A 1H2XA 1QHHA 2I2WA 2WB4A 4AJJA 4EPXA 1K1EA 3FRJA 3IH5A 1Y82A 3E3MA 3E3LA 4CKBB 2BVNA 4TLMB 4XQCA 3WYFA 1BHO1 3MELA 3DVRX 3K8YA 3DOJA 4JSRA 4LRWA 3QPWA 3W90A 3AVPA 2H16A 1NLZA 1A9TA 2HSDA 4L7QA 4OYRA 3UHPA 2PEYA 2X3FA 1QNLA 3DEFA 4YV0A 2BGLA 3PC8A 4G41A 1T34A 1D4ZA 1CLUA 1TM7E 4FEEA 4XIIA 1NOIA 3WFZA 1E6CA 1Z2CA 3M3HA 2DQ4A 3KM0A 1LNQA 1VL6A 2AEFA 3FZNA 1HE1C 5C1BA 2EATA 2PR2A 2VZ0A 1J2UA 3A05A 2H4ZA 3F7TA 3NWBA 1U2QA 4PC1A 5AK4A 2RHGB 3ZLTA 2DETA 4RZ2A 3D5EA 3HBAA 3EGXA 4GE3A 3WL3A 2WOJA 4QBHA 5FFMA 3HSKA 1G2IA 3IOCA 2W6ID 1WB4A 5CDTA 2IHNA 1YRLA 3TW8B 2P78A 3L7YA 2FH5B 2GHRA 2KXVA 3JXEA 1R8SA 4II7A 4JIMA 3TQFA 4B4UA 3ELWA 4E08A 3T3HA 1R6DA 4EM6A 2JAQA 1NXVA 3ENWA 3R40A 3UMMA 4QU0A 5CH8A 2GMWA 2IS6A 3K0AA 1T0IA 1LH0A 4JUFA 2G7MC 1KYQA 1NZJA 4JDUA 2Z57A 4IIDA 4R9SA 3WG9A 2XPCA 1KC3A 5C4GB 1KVUA 721PA 2FR8C 5L45A 3LBIA 3PFHA 1NJ6A 4BX9A 1B3BA 1GGJA 1N6OA 1RWWA 1CJTC 1SVKA 1Z28A 1P5ZB 2A5LA 2OGTA 3EN0A 2ZK7A 3L0OA 4I8DA 4M9SA 3RTDA 1CC1S 3H86A 4DT1B 2WJPA 1E2QA 1E3WA 2CUNA 1K97A 4RVNA 3V3KA 2G8LA 1KI3A 1DXHA 2BI8A 1KR5A 1FU7A 4LJAA 2WM8A 1MTZA 2TMKA 1XF1A 2GCNA 3RF7A 4IEFB 3UEOA 3FTFA 5EWLA 2B2XA 3E9RA 4QM7A 3KQKA 4R1OA 3RVRA 5JAZA 4CLEA 3DDWA 4OGKA 1KSGA 1FYDA 1L0BA 1Y48E 4UDXX 4V3CA 1IUKA 1FQKA 4MTLA 1ZK0A 3FJOA 4A0QA 2Y4NA 3IIEA 4TN1A 5LQJA 3QRWA 4ZOLB 2C31A 4C3VA 4Y2VA 2I80A 3QMMA 5IKPA 3WADA 1CQZA 2D2XA 2B7CA 3FKSA 4PFSA 1SOWA 1EU1A 1BA3A 3R8FA 1XZCA 2QMYA 3CYFA 4RSRA 2XAAA 1K88A 1GTJ1 4G25A 4KO2S 3SC3A 2CZCA 3LGSA 1EXWA 4FU0A 2R7NA 1C8LA 1X80A 3RLFA 3G13A 3FCSB 4H6VA 5SYMA 2ZRDA 1OLXB 3IPRA 2QZ9A 1EK5A 1R3DA 2R6R1 4PG7A 1Z3IX 4D43A 4EMSA 4ARBA 4JP8A 1YS2X 2H5IA 3AEQA 4S1VA 2GBGA 3U62A 3UAGA 2IOFK 4G37A 3PKJA 4Q9AA 4PG8A 4RZXA 4AMYA 4O1IA 2A33A 3L7JA 1U8AA 3LT5A 3L6CA 4JR1A 3RO7A 2HOQA 4JUBA 2BM1A 4FKZA 1OTXA 4CDMA 3NDJA 2X4GA 3C5VA 2IZ5A 4HAZA 4Q0MA 4JFAA 2TMDA 4RIEA 1G16A 1Y3BE 4UCFA 5CVVA 2YCLA 5KOYA 5DBOA 2IW1A 3T12A 4AJIA 4DR1B 3IBSA 5DRTA 2EJVA 2PO5A 5CB6A 1ZW6A 4I9NA 4YROA 5D5PA 2ABWA 2C7QA 1GZ5A 1HEUA 2K5UA 3ZLUA 2QYHA 2PIDA 3ZKWB 3F8WA 2WHYA 1PBTA 4MK4A 2B5VA 2M32A 2CMKA 4Q12A 5CXXA 1KZYC 1NPDA 3LOPA 4J1SA 5E1BA 2I6XA 4S0ZA 1NUUA 5JLAA 2MHCA 1GTMA 4HRAA 3DL4A 9LDTA 5JZSA 3QQPA 4J0KA 5JR3A 4NYJQ 2VSOA 3OQMA 4YLEA 2LG7A 1H6CA 1FYVA 1KMNA 2P6NA 2V7EA 1D1TA 3I37X 4BWVA 4ES6A 4CTNA 1FP2A 1GL6A 4RDHA 4FMCF 3WBFA 3VR3A 1HTWA 3AXSA 1UJ4A 1TXGA 1HOTA 4KRGA 4RF3A 4XIYA 5KWVA 2F00A 3UJDA 3NXSA 4G5SA 1M72A 4M1KA 3TW0A 2ATXA 2QTVB 3HDVA 3PGXA 4WXHA 4FHDA 2EZ9A 2JHFA 5LXTF 3P45A 2VDUE 1UT5A 3UXEA 3U7HB 3RHTA 3LI2A 3MYYA 1GVNB 4TVOA 5DP1A 4TOIA 1NY6A 2BFCB 2VHYA 3CF6R 5I9IA 2WAXA 4XYMA 3S2FA 5FBWB 4URUR 2EBUA 2ZIZA 4ZAFA 4DQVA 4ZZ1A 4RFLA 4P81A 5JBNA 4MP6A 4F5WA 5FH9A 2P67A 2HNAA 1HFJA 2QPTA 2VBIA 1QX3A 1LVGA 3DOEA 5CD1A 1RMYA 4WNAB 3PD0A 2ZZNA 1MXHA 1RSZA 3I0ZA 4R8MA 1JTVA 1QBKC 4AO8A 2WSLA 4LWPA 4TQGA 1QX4A 2FE4A 3LY9A 3E9YA 2POQX 1RQRA 2BGRA 2P6OA 3VYUB 3DS8A 2QSZA 2YRXA 1BKYA 2F2TA 2Q29A 4U8GA 3LC0A 3TLGB 3FYDA 2A0WA 1I2BA 4X6UA 1DEKA 4OQDA 4EX6A 4D8VA 4GEGA 4DR6B 4TYMA 2GZMA 2BBWA 4ZVMA 4BGIA 4GICA 4I55A 3DBIA 4Q21A 5FTKA 1ZHOA 4QFMA 5ELLA 5HJ7A 5JNRA 2FOLA 2QBYA 2YRWA 1YGEA 1M7HA 3B1VA 2OCAA 4ROTA 4CG0A 4F3YA 4RJLA 4F4IA 2JFGA 2A30A 4BP9A 5JD6A 1W44A 2WNIA 3IDFA 1YQTA 3IVRA 1Q7EA 3DDZX 3DNFA 4LF8B 3MJTA 4RKEA 5I7OA 1Q77A 2PSFA 4IM7A 1NM5A 3ZTWA 1EKXA 1OI4A 1S8FA 1Z68A 1ZC4A 5ALPA 4CTOA 4F6CA 1M8JA 2MSDB 3CIFA 1K68A 3UTCA 1CR2A 1FPQA 2IYXA 3TUIC 1BHJA 1I3LA 1JJFA 3ADKA 2R7AA 1JX6A 3HHPA 1S2MA 1HLGA 3MERA 4XLZA 4YR7A 5LUBA 4Y0NA 3L7IA 3KUKA 3LQ2A 3SF0A 1CF4A 5DJ5A 3W3AA 3KSBC 4HRYA 1VE7A 2IHYA 3FYSA 3KTDA 1RJ9B 1YE8A 2XTAA 1L1FA 3M6UA 3ZKAA 4TLEA 3LHDA 1H2RS 1OXMA 3PPWA 4BP8A 1GTL1 2CUZA 4WNCA 1NVEA 4QDJA 5BYKA 4M7OA 4BLOA 3WSTA 2JK1A 4JVOA 4KYVA 4KR0A 5TY0A 2VAVA 5T7BA 1CVRA 1SCUA 5LKRA 4QYWA 2R6HA 1KGDA 1U3FA 2VF7A 3H84A 3SLRA 2PU5A 5FNVA 2QZZA 4QPPA 4CMKA 3IMFA 5I9MA 5B55A 4GZ6A 1X1SA 1CY6A 2A9JA 4HEJA 4PM4A 3TX6A 1AY0A 1SVNA 1IXYA 1QG0A 3EBOA 3FG3A 4H7FA 4UE3S 2WSIA 4DA6A 1JFTA 3IOMA 2C7PA 5JYCA 3GLIA 3OAAA 4MLZA 1F6WA 2BLLA 3FMGA 4ZO4A 3W79A 3DJFA 4WXMA 1IXKA 1ACJA 4MCHA 1HLPA 1PWEA 4PAWA 3UBTA 1FU4A 4Z86A 1UC8A 5C80A 2CJWB 3MD0A 2Z5FA 3CO0S 5E4JA 1O9HA 1SN7A 3HDGA 3H5NA 5D5HA 2A1UB 2N0SA 1PHPA 5IANA 3T94A 4UASA 2QT9A 4QXAA 2HU2A 1L7VC 2GZRA 3FY4A 2I2XB 4JOQA 4P5PA 5E9QA 1IOZA 5GMOA 1WSAA 1RYNA 4KXLA 3WICA 4GNKA 2J6BA 3TGLA 5AI5A 3FSRA 1ZH8A 1LOXA 4IF6A 2WNHA 2O59A 3LUBA 4OY3A 1UKEA 4DT1A 4DLPA 4DLZA 1G5QA 1JQEA 2REXB 3K72B 1DJQA 2IS4A 3HYTA 3T3OA 1VDZA 3NTQA 1V16A 4C14A 4AWAA 1LI7A 3HS3A 2CVZA 3AINA 3W1VA 1UM8A 1V43A 3DFFA 2ZBDA 4BO2A 4ACBA 1N9ZA 4BQFA 3TUZC 4EGJA 1PJ2A 3F4LA 1ZL2A 4NDAA 1VJTA 1KAQA 2FX2A 2YV4A 2H9IA 3VPAA 2E48A 5BN3A 5HIIA 2EG5A 5I7RA 1DKNA 2O8DB 1T5HX 4DWWA 2WU3A 1TJ3A 3UHAA 2ZT6A 2Q2WA 5FLKA 2UZ1A 5E0OA 1SOUA 4M8SA 4DR3B 2ZBPA 2F7SA 3WWYA 1OV4A 4R83A 4N6GA 3BH0A 3SCZA 2LV8A 1I94B 2G88A 3BERA 3VNSA 4B48A 4X6YA 2HSZA 3GJXC 2XCRB 4DG5A 5ALEA 2YZ2A 4UW9A 2FAXA 1BMTA 2OILA 2D6FA 2ZLBA 3DAHA 2WVGA 4KQGA 4TXHA 3G68A 3NRBA 1WKVA 3RARA 3O31A 1EM8B 1W4ZA 5DW0A 4Q6WA 2YMMA 2D1TA 2J7PD 2Z1MA 3AR5A 4KE9A 3TL6A 4N0EA 1ECBA 1YQDA 2QD1A 2ALJA 3HY3A 4KAJA 2H1SA 1V2HE 2IYLD 3BWCA 4J8PA 2YIJA 3DOHA 4Q3BA 4BB5A 1SY7A 1KTIA 5ENDA 5AVUA 1M2WA 2G5CA 1P77A 1FE8A 2CFIA 2VJNA 3M8KA 1H4QA 3I6QA 4M89A 4GQAA 4HQ0A 5TARA 2C8KA 4DXAA 1ZJWA 3KFVA 3Q0IA 4DSZA 5I7UA 1EUCA 1CERA 4QTXA 4UOQA 2IKQA 4G6ZA 3SR4A 1QDUA 2O8EA 3H4VA 5ICSA 1TL7C 1B74A 2WWXA 4PN7A 5CB4F 4KIUA 3ZZTA 1XGKA 4IH9A 2ZBUA 1L4BA 3W5SA 4XR9A 4YP5A 2ZJ7A 3P4YA 4I4CA 4A6PA 4EHNA 1EB9A 2A0XA 4B32A 2ZPAA 2WQ7A 1DAOA 4FB5A 3BJRA 3P2OA 1T2DA 3ZCSA 3H1GA 1JNYA 1XTJA 3OU7A 4TS1A 3RK0A 3VKHA 2C1XA 5LP6C 1VKNA 3EGOA 1QP0A 3F67A 2YXEA 3FCEA 2P91A 1U2TA 2WIJA 3EODA 4J1QA 4XYEA 3VXKA 4D4KA 4PNZA 3AHHA 1G63A 1F0KA 5HF8A 1XR3A 5DBGA 3FNQA 1Z5OA 3MUEA 3C6XA 1XCMA 4J90A 5FKJA 2YWGA 2Q6TA 5JAHA 3F96A 5KOJB 4B3HA 1OC2A 1EVZA 1J06A 4OP2A 4E15A 1F9EA 5JO0A 5U9CA 1HLDA 5BYBA 1GIAA 3C24A 2MWMA 3BD8A 3LYAA 3R9XB 1XHLA 3A3KA 5EJIA 3R5FA 2GCGA 1D6MA 3UWMA 1GRNA 2IY7A 1KU0A 4CQMB 1YA4A 4DLWA 4CMEC 3I1JA 3FUCA 2IH2A 4F9EA 2GZSA 1TZJA 3I04M 5E6UB 3UAZA 3ULKA 3BWBA 4DC9A 2JFBA 2HEIA 3HJAA 2G4LA 4BWYA 4QREA 2OO5C 4J0HA 2JHAA 4IJKA 5AVQA 1GPNA 4FOSA 3DTTA 4B46A 5LYJB 1JJBA 3A6ZA 2P79A 2DRIA 1C30B 2G67A 4G1MB 3E35A 3L0SA 2QW8A 2C3MA 3TSCA 2XW6A 1W1IA 3W8EA 1EFDN 4BO9A 1WX1A 1QO0D 1J56A 2Z95A 3CY6A 1UINA 3D2LA 1YL5A 3HZOA 5H80A 2E21A 3Q98A 3P2JA 4GGPA 1ORDA 2ZS8A 3STHA 4P4UA 2R1VB 4WFKA 2WSMA 5CAEB 4PZPA 3JYNA 2NN3C 2XOKD 1M2VB 2VTEA 3DMTC 2W2XA 1CP2A 3DR3A 4JD5A 2O1EA 1Q6ZA 4OQYA 3ZCXA 1UL1X 1N6PA 1RTKA 4AZSA 1USIA 1Z63A 5JH7F 1GNVA 5KEIA 4XX1A 4U7PB 4I1YA 1VLZA 4ND4A 4JLOA 2AHOA 2FLVA 1QC5B 2BFDB 2X5OA 3AB7A 3ID6C 5JWOA 1OV6A 3G0GA 2BGGA 3TTWA 2W90A 5A62A 4DNOA 4ND5A 2HQRA 3QEJA 4QYTA 4MB0A 1BX1A 3IERA 1MIOA 4TZ0A 1QE3A 3A1WA 1ZUHA 2NZYA 3T6KA 2ODPA 4HEA1 2EFCB 2R6CA 2B8WA 3IDSA 3ZZNA 3E9ZA 3K2EA 3NQ41 4GWLA 5HSGA 2GAJA 4BL5A 4Z99A 3TBFA 4W5NA 1OUMA 1X77A 421PA 3P52A 4JQOA 3V4ZA 3CB4A 4OXYA 2CKDA 3KAPA 5CDFA 3ZXXA 3C41J 2JVJA 1P5HA 1XE3A 2YC2C 3KVNA 3RI3A 1RHUA 1FTWA 5K8JB 3FBTA 3T7SA 2IYFA 1MO3A 1HDRA 1SBQA 4BO8A 4L0DA 3NM5A 1XZAA 2EFJA 4HBGA 1T1GA 3VR0A 3CLKA 1E0AA 2H2DA 2WKWA 2OP1A 1DX9A 3BEOA 3IBGA 4X20B 3ZH2A 3W3AD 3NORA 1UBJS 3U4QB 4XGKA 3AVVA 2UYYA 2JGDB 2UVDA 2DHCA 4KBYA 1MDBA 4MR9A 4N1AA 3U7RA 2IYAA 5CFQA 4X1YA 4R9VA 2B7LA 2ZB7A 2OPBA 5FOSA 3HKEA 5T8KA 4Z3KA 3K4QA 1N1EA 1PJAA 3NKVA 1JEDA 4KOEC 2HJRA 1PAUA 4MKGA 3DZDA 5CYGA 4MHTA 2CV0A 3N3BC 2YS7A 4WHMA 2PKQO 2XVYA 1SKQA 4NRDA 1BSVA 2ZI4A 3PD1A 1XCJA 3E7WA 1V3QE 5K4GA 2CL6X 4ATNA 3B48A 2BWJA 4LGYA 2YN0A 3DLPX 1G55A 2GJKA 3K0BA 3GROA 2WHXA 4Y8VA 4PNEA 2FRDA 1P7WA 1Z26A 3CO5A 3IPCA 3N8DA 2CL5A 1DG3A 1CA1A 2INGX 3BRCA 3IQZA 3WQBA 1GL3A 3UMCA 4BQRA 1K5PA 3TOZA 3IIJA 4NATA 2R5NA 1R74A 3BAZA 2W2KA 3FMOB 1FXUA 4Q9DA 5U1PA 4JU8A 1LCIA 1AGRA 1T1EA 4FE7A 4RK0A 1MJFA 1ZJJA 4UVIA 5HF6A 1R4MA 5LFAA 2IYWA 1PT8A 1WPXA 2ZJFA 4W5WA 2V8BA 4DJDC 1AQJA 2NUTB 3EISA 4WOJA 1JF8A 5K0EA 1KI9A 1QIFA 4YVFA 5F76A 4B47A 4QYIA 4K05A 5AJTA 1QJ4A 3OIDA 5TDHA 5K8IA 4FFRA 2BCGY 3UQZA 3B13B 3PK0A 4CQMD 3AP3A 1LVUA 2C00A 3ROXA 4CBVA 3NCHA 3M9XA 3WGNA 4LYYA 1HBJA 1ZIPA 4JMPA 5KIAA 4DTIA 5JS1A 1UUFA 3IEXA 1NQVA 2IEDA 1NXPA 3QFSA 1KJIA 3CZ5A 1LK5A 3RS9A 5LXTB 3SDSA 2JKYA 3QYAA 5IYZB 4CF5A 4YRIA 1M74A 2DBZA 4FZRA 4U2FA 3ER8A 2A84A 1JH8A 1FVFA 3GNTA 3QFCA 4LX0A 2HU8A 2Q1UA 2QRZA 1WNTA 3JQAA 1IHYA 2OFPA 2Z4SA 2G0TA 2E4AA 4TRMA 3W04A 1UPXA 4WY2A 1F2TB 1E5QA 2OCKA 3V7YA 3QUCA 4L9AA 3EPRA 4ZZIA 1YOBA 2IOFA 3T0GA 4HQKA 2AQ8A 3E1SA 1F6DA 2GN4A 4R81A 1JHMA 1Z2NX 2OC4A 3BMXA 4AKSA 1G17A 1A4XA 1I2ZA 1TMGE 4LPSA 1T5BA 4LYEA 3CX6A 4AJ4A 2ZI3A 5BWNA 4PW0A 1YJ8A 5K8LA 3LY5A 3ILYA 1BRTA 2JKVA 1G41A 2ZUDA 1O3YA 2PWPA 3QELA 4KDCA 3GLFE 4L15A 1LBIA 4DIMA 4A6EA 1M6VB 1VLQA 1XXHA 3LLVA 3O8BA 1QU3A 1G5RA 2JGDA 4MVWA 2GFHA 1N5MA 3LKZA 2VNAA 5LUAA 1RM0A 3R4VA 1NKTA 3DG9A 2NGRA 1PJQA 2F59A 4RPJA 2ZAMA 5AVJA 3QOXA 4JXKA 1T2FA 2WF9A 3CUWA 4JB2A 1UJ2A 4IZ6A 4L6AA 3KK0A 2QUIA 3G82C 4UDNA 3DBOB 3GAAA 4S1WA 5KJFA 3HB9A 3L8DA 4A2PA 4I2NA 1NVVR 3OZUA 2J31A 1L7NA 1P19A 1TA0A 1ONPA 4JEMA 2PKWA 4WK4B 4BNXA 5JATA 1G8SA 4Q4DA 3FKSD 4FYXA 4IXDA 1NI3A 4FC6A 1JU4A 1YZKA 1GPBA 2LRGA 2ES4A 3VTAA 4P36A 3AOGA 4CEIA 3ZJYA 1XAHA 4MS4B 4FD2A 4MGZR 4OAQA 3LCJA 3TFWA 3TR6A 3O8OA 1H2EA 1N6HA 1QF9A 1RWQA 1VECA 3L6RA 4HNAB 3NCTA 4PINA