2OXEA

Structure of the human pancreatic lipase-related protein 2
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
452
structure length
435
Chain Sequence
b'KEVCYGQLGCFSDEKPWAGTLQRPVKLLPWSPEDIDTRFLLYTNENPNNFQLITGTEPDTIEASNFQLDRKTRFIIHGFLDKAEDSWPSDMCKKMFEVEKVNCICVDWRHGSRAMYTQAVQNIRVVGAETAFLIQALSTQLGYSLEDVHVIGHSLGAHTAAEAGRRLGGRVGRITGLDPAGPCFQDEPEEVRLDPSDAVFVDVIHTDSSPIVPSLGFGMSQKVGHLDFFPNGGKEMPGCDGIWEGIGGFVSCNHLRSFEYYSSSVLNPDGFLGYPCASYDEFQESKCFPCPAEGCPKMGHYADQFKGKTSAVEQTFFLNTGESGNFTSWRYKVSVTLSGKEKVNGYIRIALYGSNENSKQYEIFKGSLKPDASHTCAIDVDFNVGKIQKVKFLWNKEPKLGASQITVQSGEDGTEYNFCSSDTVEENVLQSLYPC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Pancreatic lipase-related protein 2
publication title Structure of human pancreatic lipase-related protein 2 with the lid in an open conformation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 127
structure length 435
sequence length 452
chains with identical sequence B
ec nomenclature ec 3.1.1.26: Galactolipase.
pdb deposition date 2007-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00151 Lipase Lipase
A PF01477 PLAT PLAT/LH2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.60.20 Mainly Beta Sandwich Lipoxygenase-1 PLAT/LH2 domain 2oxeA02
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2oxeA01
1JFRA 4WFKA 1QM6A 2WG0A 3TRDA 3VVLA 5LKRA 3VJKA 2WU4A 3WJ1A 3A6ZA 2HFKA 2XUKA 2OGZA 2DCMA 3EBLA 2UZ0A 1X2EA 3C70A 2HADA 3V48A 4B83A 4GI1A 3TEJA 3DLTA 5AK6A 1A8SA 2J3DA 2XUJA 5ALGA 2BJHA 2WUFA 2FJPA 5AKLA 3W04A 5ISMA 3E3AA 1HKHA 2EDCA 1ZD2P 3STYA 1QE3A 3F96A 4PSCA 4IO0A 4HXFB 4P93A 2I78A 3BXPA 3W9UA 1QJ4A 2DHDA 5AO9A 4B9AA 5ALYA 1KHOA 4WJLA 4ZXFA 3PE6A 2OGTA 5I7UA 3QMVA 5FV4A 3IUMA 2OAEA 5KBYA 4CFSA 1F0NA 1JKMA 1O6FA 3QPCA 4IHAA 3BNCA 1J1IA 4UUQA 3Q8WA 3WMRA 3WKBA 3QM1A 2I3ZA 2XMQA 4B82A 2WKWA 2X76A 2BAGA 5IVDA 4A5SA 1CUDA 2WJ4A 3PICA 2QM0A 1YGEA 1E66A 4BC1A 3RM3A 3OURA 4X85A 2WTNA 3ZWQA 4TGLA 1GKLA 4DGQA 1R50A 2RHWA 4L72A 4F5ZA 3IULA 4Z49A 4HS9A 2WUEA 4G8DA 4ZI5A 5ALNA 3I1IA 2GYVA 2GZRA 2XUHA 2BCEA 4O08A 1WB5A 4DMHA 2IIVA 3QYJA 4QWMA 1XZKA 5IVKA 3FCXA 4EB0A 5ALUA 2I03A 2WILA 3G0DA 2WIDA 1LPAB 5AJHA 4C01A 4LKOA 4WY8A 4FLFA 5CBKA 2VSQA 1UK7A 3R3UA 3ESCA 1W75A 2ZJFA 3FSGA 3QBJA 4IH4A 3SX4A 3MGAA 4XIIA 1UZAA 4J0JA 2IITA 4Y2QA 3RK4A 1A8UA 2O7VA 4RPCA 1YSCA 5AIAA 4KYVA 4N8DA 4XWGA 1ORVA 3BNDA 4UBOA 1DINA 4WHAA 3NUZA 1HU9A 3HC7A 4LYEA 3BF7A 1E8MA 4BP8A 1Z68A 1B41A 1QO7A 4A23A 5E4YA 2QJWA 3K2IA 1WPRA 1TQHA 4EY5A 3PUIA 1WHTA 1QIDA 4EA6A 4QLAA 2JGMA 5DLPA 1VE7A 3CCBA 3L1JA 3WWOA 5HF6A 2VJAA 4INZA 2H1IA 4KEAA 2Y2VA 3V9AA 3I6ZA 4X7BA 5CH5A 1LPSA 2HFJA 3FG3A 1CUBA 1JMKC 2WIGA 3D2AA 5CURA 1MX5A 4BVJA 4Y2YA 1JJFA 2XQGA 2XQIA 3PFCA 1J2EA 2HA7A 3PUHA 3WK9A 2HA4A 3K9BA 1UXOA 3EQ9A 1GPLA 1LPPA 3I6MA 2Z5GA 2PL5A 1W52X 4CCYB 5EFZA 3IUJA 2VAVA 5T4BA 5EIAA 1IUPA 4UHCA 1GXSA 2HL6A 2PSJA 1DU4A 2WM2A 5JIBA 2XUDA 4YX9A 3BF8A 1XFDA 1HLGA 4OYLA 1VA5A 4G4IA 1XQYA 2ZVDA 4FMPA 2W6CX 2CEKA 4J0HA 1MNAA 4N8SA 2JGEA 4X6XA 3I2KA 1BEZA 3O95A 3U0VA 5EHNA 1N5RA 2CB9A 2XMDA 3WK7A 1R9MA 3AIOA 2XQFA 3BDIA 2YH2A 2JBWA 1P0QA 2VT6A 2CMFA 5D6OA 4I3FA 5A7FA 2PX6A 5FPPA 5DTIA 5AM4A 4E15A 1K63A 3K6KA 2XB6A 3VISA 2ONCA 5HFNA 1HQDA 1LPBB 3WWPA 2G63A 4W1PA 5ALKA 1G5FA 4BATA 1GT6A 1ZJ5A 1ZI8A 3QPAA 1JT2A 5JAUA 1PFQA 1EHYA 1KU6A 1FGOA 5ALVA 1PV1A 2Y1KA 5T4FA 3I28A 4PW0A 2ES4A 1CUYA 3EQ8A 3C87A 1UKCA 1H22A 3DKRA 3HZOA 2V98A 1SCQA 1F6WA 4DM7A 4NREA 4N5HX 1AKNA 4X71A 3BJMA 5HF9A 4XVCA 1CUWA 5EHQA 2QRUA 5AI4A 2C7BA 1CQWA 4HZGA 4H7KA 1X2BA 3HACA 3Q0TA 4LXGA 1IUOA 1XQWA 4WFJA 4GECA 1QIIA 1W76A 4B9EA 1C4XA 1CEXA 3LLCA 3W05A 1P0IA 1ZGCA 4Y2PA 3VJLA 4DMKA 5FDFA 1CFJA 1LOXA 2JEYA 1XKLA 5D7BA 1ZD4A 3HSSA 1ZI9A 4X00A 2ZYSA 2J4FA 3H17A 2VJBA 2XUFA 5FP0A 4Q82A 2PPLA 1QFMA 5HF5A 2K2QB 4B80A 4G5XA 3WYDA 3G9TA 1ZOIA 5AM3A 3VDXA 1YAHA 1EDEA 3LP5A 4UHBA 3DEAA 2EDAA 4QWWA 3C43A 3ILSA 3I2FA 2WIJA 5AKHA 2WG1A 2ZJ7A 2X8BA 3WIOA 1BROA 3MVEA 1GPNA 1JMYA 4AO7A 4XX1A 1XZBA 1R3DA 2PSEA 4W1SA 1XRMA 2YASA 1A8QA 1L7RA 2DQYA 4JH0A 5CW2A 3WK4A 1QGED 4HRYA 3ZLUA 2C58A 4U2CA 2JGLA 5AIBA 4OB6A 5KWJA 3OG9A 3C6YA 5AI5A 2OGSA 3DQZA 2RI6A 2B61A 1UOQA 5LLSA 3A70A 4LIPD 3QMMA 3KSRA 2DQZA 4MEBA 4FDMA 4G8BA 1N1MA 3V92A 1THGA 1H23A 2QVBA 3DJYA 2B4KA 2RONA 1ROVA 4FTWA 2XUOA 5HFAA 5HZGA 4GHWA 3WKDA 3WK8A 4U2FA 5A7HA 2HA6A 3GBSA 1N8QA 4J7AA 2PUHA 1RYYA 4MEAA 2YYSA 1EDBA 4RE6A 4ZREA 1L7AA 4DNOA 3V1NA 4GW3A 4H7JA 2VQ6A 4X91A 5DYTA 2DHEA 4OYYA 5A7GA 5FUMA 5IVHA 2DHCA 4K2AA 1LBTA 4B7ZA 5ALHA 1RRHA 3EIOA 2AJCA 1UOPA 3C5WP 1YS2X 1VE6A 3G9UA 1QONA 1NX9A 5AI6A 1MAHA 4OPMA 1VZ2A 1H2ZA 4WY5A 1C7JA 4AMYA 2ECFA 1FGRA 3BNBA 5HK9A 2QT9A 2PBLA 4OU4A 4Y2UA 3H1AA 4QEKA 4CG2A 4B84A 2SBLA 3CN9A 3PFBA 5CRIA 2VJDA 4GXNA 3I6YA 1YS1X 4OU5A 4KE9A 2CZQA 1WHSA 5AM5A 1YASA 5KWIA 5D3ZA 1LZKA 3E0XA 3G7NA 4Q05A 5BOVA 3A2NA 2Y2UA 1R9NA 4WDQA 4YASA 5DJ5A 5E4TA 3ZI7A 1T4MA 1BS9A 4K6HA 3OPMA 4ZWNA 2Y6UA 3JW8A 3GA7A 4EBBA 1XZGA 2BGRA 3MUNA 3H0CA 2HM7A 3A2MA 3L1IA 3G02A 2BFNA 2QR5A 1OLPA 1LNSA 5KREA 1XQVA 1F0PA 1ZIXA 1DT3A 4FKBA 3L1HA 2W22A 4H7FA 4RNCA 4EY4A 4FOLA 3B12A 3D59A 4B81A 4D9JA 2WHQA 5I9IA 1N8SA 1IZ7A 3FAKA 4HRXA 2XMGA 2YXPX 3FLAA 4M0FA 3N0TA 4HXGA 5K3FA 4H7IA 2Z8XA 4QLOA 5K3FB 1W6RA 3F9CA 3D7RA 1W1IA 1CR6A 3OC0A 3AIKA 4X95A 1EK2A 3SWWA 1EB9A 2JGIA 4MWTA 4OCZA 4H77A 3IVMA 1DX4A 5A62A 1OCEA 1EB8A 4AN0A 2GYUA 2QUAA 1ODSA 1UOOA 5AOAA 3BJRA 2J3QA 4X6UA 2DFPA 4Q3LA 3FG4A 2PSDA 3ESBA 4FBMA 3LS2A 3KD2A 5K3DA 4IH9A 1BE0A 4C6HA 1IUNA 3I2HA 2OLEA 3WI7A 4BTVA 2WFZA 4B0OA 5LYYA 1UKAA 5DNUA 4PSDA 1A88A 2WFMA 5JADA 2FJ0A 5JATA 2AJ8A 4PO3X 1CUSA 3VXKA 4ROTA 3R3ZA 5CXUA 4FLEA 2CKMA 4DNFA 1YA4A 3AZOA 1JU3A 5IKXA 1DWQA 2J4CA 4HAIA 1LPOA 4Y2RA 5HKBA 3KWJA 2RGUA 4AZ0A 5BWCA 2WJ3A 1XROA 1RP1A 3W9BA 1CVLA 4LYDA 4G9EA 4KACA 3WKAA 3T4UA 3LIIA 4BZWA 3STXA 1CV2A 5A6VA 3VKFA 1CUUA 1QIMA 4MQMA 2B20A 1TIBA 4PSUA 4GLBA 4FNGA 4MQLA 1LBSA 4DNPA 5AKYA 5AI8A 3IUNA 1CUJA 4Y2VA 3F8SA 3TJMA 2BUAA 1GPKA 2WSLA 3V98A 2LIPA 4AZ3A 3YASA 3RKSA 3DOIA 2WHPA 5DYYA 2WHPB 4BB0A 3S2ZA 2G4LA 4CIAA 3AFIA 1ACJA 4F60A 2OCGA 1AURA 1LGYA 3IURA 1YR2A 3FCYA 4UBNA 4U2GA 4CCYA 1XRNA 1T2NA 3B5EA 2XQJA 3HJUA 3ANSA 2WU3A 4H35A 4G4JA 3H1BA 4KAFA 3IUQA 5AK4A 1AUOA 1MU0A 4UPDA 5CT5A 1SCIA 5AKZA 2PSFA 4FHZA 1CLEA 3HEAA 1MX1A 3H19A 3WJ2A 4Q3KA 3GROA 1QMDA 3VF1A 4PF1A 4H18A 5DNVA 5LZ2A 5IVIA 3QZUA 1EVEA 2RHTA 1PJAA 4C4YA 4J3JA 4N8EA 5AM0A 2VF2A 4UFPA 4F0JA 1HDEA 5JARA 1Q83A 5DNWA 3M81A 2XT0A 3FLBA 2PKYX 3OM8A 1XZMA 5K3EA 4X93A 3DYVA 3GUUA 3DD5A 1ODCA 2VTVA 2HA3A 5K3BA 3WL6A 2O7RA 1LPMA 3DNMA 3BE8A 1CUGA 3F97A 1A7UA 4Q34A 2HU8A 1HL7A 2XUPA 3C8HA 3D3NA 2GBFA 5HF8A 3STTA 3BDVA 3QITA 1BCRA 1Y7IA 4Y2JA 2PUJA 1E89A 1EH5A 5AK3A 1CA1A 1MAAA 1THTA 1Q0ZA 3WIBA 1QLWA 2QOEA 1VXOA 4CG3A 1TAHA 5EIHA 3WWCA 1JI3A 5JD4A 1JJBA 2HRRA 5EI5A 1EVQA 2XLCA 4FBLA 4U2BA 4EHBA 3R40A 4W1QA 3O4GA 4ARBA 5ESRA 3PDCA 3D5EA 4ZGBA 2ZSIA 4IQ4A 3GZJA 3KWFA 1H2YA 4J0DA 5ALOA 1DX6A 3WK5A 4Q1VA 1H2WA 2G5PA 3I2JA 5LKAA 2WFLB 1KEZA 4UBJA 2I3DA 4BRSA 3QMWA 5CXXA 5K5EA 2DSNA 4EY7A 4DYHA 4FWBA 2C5FA 1NU6A 1VOTA 1W4LA 5CTAA 3WL5A 3NOXA 4X6YA 1BCSA 4NS4A 3NGMA 1RRLA 3STVA 2OCKA 4CG1A 5ALFA 3ED1A 3WWEA 1U2EA 1R4ZA 1MT3A 5BV7A 3FOBA 4C88A 2VEOA 4BZZA 2NW6A 2ROQA 1UFOA 3CN7A 3H04A 4S0XA 1BRTA 2E3JA 3TGLA 4BAZA 2HA0A 1MTZA 4NZZA 4LXIA 3O9VA 2GBIA 2WUGA 1XLVA 1ZJ4A 3JWEA 3BIWA 5D3KA 3V1LA 4KE8A 2X5XA 3WK6A 5YASA 3DYIA 4UBMA 4BYMA 4WDRA 1XZEA 2ACKA 3R41A 5SYNA 1AZWA 3O8YA 2DR0A 4P9NA 4LXHA 2Z8ZA 2GYWA 4BE9A 5CT9A 2XUIA 1J06A 4L9AA 1DQYA 3M83A 3WKEA 1CUEA 3ICVA 3HI4A 3WWDA 3R0VA 1QIHA 3CCCA 3D0KA 1YB6A 1QOZA 4HTAA 4TPKA 4DMFA 4J03A 3ZV7A 5AH0A 3UUEA 4C89A 3D2CA 1K5PA 5BWBA 3R3VA 5EGNA 4P08A 5AM1A 2Z3ZA 1QIKA 4E46A 3AINA 2WXUA 1LPNA 3B3QA 1L7QA 2OCIA 5K3AA 2OXEA 2BUCA 2XDWA 4A16A 5CMLA 3ESDA 2QKYA 3H2JA 4GWLA 1Y4KA 2XMZA 3FLEA 3I2GA 1DQZA 5JZSA 2JEZA 3WYNA 5HCUA 2C4HA 2JGJA 1CRLA 1BU8A 2WIFA 5AKXA 2HU7A 2QMQA 2H7XA 4MWSA 2OPHA 5EHXA 3EQ7A 3H18A 3IB3A 4QNNA 2D0DA 1CPYA 5CT4A 3E4DA 3T52A 5AKIA 2AJDA 4YK7A 1CUCA 4M0MA 4KE7A 5LP1A 2JIDA 5AICA 5ALTA 4X3CA 2PVSA 1VLQA 4L3WA 1HPLA 4J0KA 5AM2A 4GBGA 1E3QA 1BN7A 1ZICA 5SYMA 1LNHA 3RLIA 4B6GA 4AXBA 5I8PA 4MYDA 2BUBA 1FFDA 5FOQA 3F98A 5JAOA 5CT8A 1Q0RA 1YA8A 1EDDA 2ZYHA 3C45A 5FKJA 5AKEA 3JYHA 4KE6A 4KAAA 2IUJA 2GBCA 4U2DA 1S8OA 5ALZA 3PZWA 1R88A 3QPDA 1DWOA 3C6XA 1AMNA 1ETHA 2O2HA 4DMCA 4G4GA 1EINA 4QWTA 5ALXA 3V1KA 4BCBA 1E5TA 4QDZA 3O4JA 1FFEA 1DTEA 2VATA 1U4NA 3DKKA 4Y2TA 2Y6VA 2FUKA 3D4LA 2VJCA 4X90A 4KJXA 1EX9A 2C5GA 5FRDA 1XKTA 1I6WA 1DWPA 1FGTA 2WQZA 3M3DA 3H2KA 2HIHA 2AJBA 3WLAA 5ALJA 2WLSA 4UBLA 2OG1A 4BAGA 2WHRA 3DCNA 1XLWA 3IIIA 5ALDA 4FNMA 4JNCA 3P2MA 3HLKA 1CUXA 2XUAA 3DDUA 4YPVA 1SOMA 2C0QA 1TCCA 2Q0XA 1OXMA 5FLKA 1ODTC 1FJ2A 5AOCA 4UFNA 1LZLA 1K4YA 2PSHA 3DL7A 4XJVA 5K3CA 3WL7A 1VXRA 1M33A 4MYSA 3OOSA 3HYSA 4UFOA 3PI6A 5ALEA 1YCDA 1ACLA 5JANA 3FNBA 4OSEA 1DT5A 3ZLVA 1B6GA 3BNEA 1XZJA 1XZFA 1FFCA 3IBTA 1CUVA 1MJ5A 1JU4A 4AX4A 1YB7A 2P8SA 5LZ9A 4ARAA 1P0MA 7YASA 2WTMA 3I2IA 3GELA 4F21A 4AO8A 5FPQA 3H2IA 1WM1A 1AGYA 2QZPA 3PF8A 4OUKX 5JAPA 4WFIA 4J0IA 5CH8A 4I19A 4ZV7A 4UBKA 3FVTA 2RIPA 1XZAA 5LZ8A 2IUKA 3H2HA 5HKAA 4HVTA 2ACEA 5JASA 3BIXA 2P0MA 1ISPA 4CIBA 2CUTA 2GBGA 3FSGD 1MO2A 2QXUA 4ITVA 4G1FA 2WJ6A 4IH1A 1EI9A 2R11A 2XE4A 5JD5A 2EEPA 5ALWA 1VZ3A 2XLBA 1QFSA 2PU5A 3V1MA 3I1YA 4QE3A 1XZHA 5JAHA 2PM8A 1QIJA 4QDUA 3E1GA 3FWHA 1BEEA 3ICWA 1QO9A 2XMSA 1J07A 5E4JA 4B85A 1CUAA 4K5QA 4B0PA 1RWQA 4JEIA 1CQZA 1XZLA 3G0BA 5DTJA 4KRXA 1VJ5A 3G9XA 4JUIA 2QJRA 2WIKA 5EEOA 5LZ4A 2WUDA 1CUHA 5IH7A 4DLNA 4L0CA 4J0GA 1Q84A 3KOOA 4OB8A 3WA7A 1UT6A 4BVKA 3W06A 3X3HA 2H7CA 5H3HA 3RARA 3CXUA 2G5TA 4M0EA 1GGVA 2ZYIA 4BRZA 3ESAA 1C7IA 4X97A 3H2GA 1CUZA 5AKGA 3U1TA 1YAJA 2JF0A 4I4CA 4OD0A 2OQIA 1TCAA 2HDWA 2WY6A 5DWDA 5AHXA 4H7EA 2FNQA 5ALRA 3O4HA 5JZ9A 4BTLA 1NU8A 3N2ZB 1GKKA 3OTQA 1K8QA 1IK3A 3BWXA 1BN6A 4NMWA 2PU7A 3AZQA 2WXTA 3LIPA 5E2IA 2BGNA 5A71A 2HRQA 5LZ7A 1ZD3A 2ZJ6A 1LLFA 4HXEB 2RAUA 1FFAA 4JYPA 4Y7DA 2WG2A 5HK8A 2AJLI 4LHEA 4E11A 1O6GA 1FSSA 4WFOA 4ZRDA 4DIUA 5C81A 5HQ3A 3ZPXA 5HQ3B 4QDXA 1UK8A 3IA2A 3O0DA 2V97A 5JALA 5ALSA 3QH4A 3AIMA 4UHFA 5AI0A 1P0PA 3WKCA 5T4HA 5AI9A 4EZIA 3VJMA 5AKJA 4W1RA 3C6BA 3UUFA 4E14A 2FX5A 4UHDA 5AKKA 4DSZA 1WOMA 4CI9A 1VKHA 4K6GA 4W9RA 4J0CA 2IX9A 4QZVA 1XRQA 3G9ZA 4PNZA 3MUOA 2XQKA 4DSAA 4RGYA 1GYGA 1E8DA 5LZ5A 3O9MA 3R3XA 3G0CA 1H2XA 4FLMA 1F8NA 4BCDA 5AP9A 4BBZA 1XRLA 4CCWA 4K6KA 4KRYA 1JJIA 3R3YA 1AQLA 3W2TA 5CT6A 1XZCA 3HXKA 4W63A 2ZSHA 2HA5A 3AILA 4WCVA 4KR0A 4BP9A 5LIPA 5JYCA 3R3WA 1G4HA 2OQVA 2BKLA 4OB7A 3AZPA 1GQRA 3KXPA 1SFRA 2XUQA 1JNQA 4QA9A 3C5VA 3NWOA 1TKRA 2QUBA 1TK3A 2WFLA 2XI4A 3SC2A 3G0IA 1FFBA 3STWA 2OAGA 4Y2SA 4AO6A 4Y2XA 5EHZA 4JYMA 1KU0A 3PF9A 4C4ZA 4EY8A 1Y7HA 4BC0A 5ALMA 1U65A 4V2IA 1CUFA 1D07A 3BL8A 1QTIA 2ORYA 3SK0A 2QS9A 1ZI6A 4PV7A 5DYWA 4UBIA 4BCCA 2D5LA 1TCBA 2Z3WA 1VA4A 1ZD5A 3C8DA 4DTCA 3F67A 1SC9A 1F8UA 1FGQA 5C8ZA 1WB6A 1GZ7A 5CH3A 2QXTA 5F4ZA 3D2BA 1QTRA 1UWCA 3STUA 4C87A 4G9GA 4AMZA 5ALLA 2VAXA 1MN6A 1USWA 2R8BA 5ALIA 1EXWA 2C0PA 1G66A 4KAJA 3FVRA 3G8YA 4QDOA 4X92A 2XMCA 1QIEA 3DS8A 4U2EA 1CUIA 1TRHA 4AB1A 5C8XA 1QIFA 1MNQA 3O4IA 3QVMA 1UK6A 4ZV9A 5AK5A 1IVYA 4AQDA 1Y37A 5ALPA 1SCKA 1AC5A 4NVRA 4QDTA 5JD6A 1EK1A 4Y9SA 3HABA 3WZLA 3FYUA 3KDAA 2H7YA 3FYUB 5T4EA 5A2GA 3FG1A 4TVKA 5EIEA 1WB4A 1AX9A 1ZGBA 3M82A 3WZMA 1EA5A 4BAUA 5FXMA 3FYUC 4Q3OA 3UMJA 2JGFA 3WA6A 4BDTA 2ZYRA 1K6EA 4MJ3A 3AJAA 1FGMA 2OCLA 3WL8A 1GQSA 4MXDA 1XZIA 3G0GA 4GEGA 3V99A 4PQEA 3IDAA 4C4XA 3DL4A 4G8CA 3A2LA 4BDSA 1WPXA 1QIGA 4GDMA 2V96A 4FFWA 1NO3A 4AN1A 4DNQA 3ZLTA 3VVMA 1MPXA 2CBGA 3ANTA 2XUGA 4P92A 4H7HA 5ALQA 1IZ8A 1U8EA 4BVLA 3WQHA 3S8YA 2QTBA 3DOHA 4EUSA 1XZDA 1CIJA 2HA2A 1QZ3A 2B9VA 3AUKA 1XRRA 3HRHA 1ZIYA 5C8VA 2XMRA 1ORWA 1X70A 4EY6A 5JZBA 2CJPA 4ETWA 2HU5A 1MX9A 2HHAA 2GZSA 1XLUA 2VT7A 1OILA 3FBWA 3LCRA 2H9YA 4X94A 5C7YA 1HBJA 4UHEA 1XQXA 3GFFA 4UHHA 1N5MA 1R1DA 1UKBA 2XMBA 1G42A 4H7DA 1IMJA 1E8NA 2VA9A 4N5IX 6YASA 2AXEA 2O2GA 1UK9A 5J3JA 2JGKA 4BE4A 4RE5A 3CWZB 3C6ZA 2O2IA 4FFVA 3FYTA 4H0CA 3EF3A 1XRPA 2V9ZA 1WCYA 5AOBA
chains in the Genus database with same CATH superfamily
4HLUC 1FE8A 4MR8A 1KI7A 4Q12A 4FX5A 4I6EA 5CLHA 1ISMA 4F46A 3NOQA 1MGPA 4K8RB 2WFAA 3ND8A 1LDNA 3VVLA 1KMCA 2ODWA 4JZKA 4DJDC 2PQMA 2NTNA 2QVCA 3WJ1A 5DX8A 3RFCA 3A6ZA 2OC9A 2YUTA 1NVDA 4KV7A 2HFKA 2FPPA 4Q6BA 3GRCA 1UMBA 2ORWA 4OK6A 4F6LA 4E09A 3KKOA 5JHHB 1MQ9A 2FUCA 4AY2A 5A03A 4ZMBA 4MYTA 1P0CA 1RTTA 2RGDA 3DLTA 4U7FA 2FHSA 1UH5A 4QU9A 5CFNA 4UJ5A 1A8SA 5FO0A 4JBWA 2EAUA 3W5AA 5CR9A 2RHGB 3G6WA 3NJ8A 4EG6A 5G4KB 1O95A 5DW0A 5H02A 2WUFA 4JLNA 4JY7A 1NUAA 3PQ4A 3B3JA 4XH9B 1F48A 5ISMA 2QNGA 2CMDA 2NSHA 2DWOA 2RFLA 1ZD2P 3AOGA 2XDAA 5KOIA 3WLSA 2GO1A 2REBA 3VO8A 1E6WA 3D1JA 2DUMA 3OZ7A 4PSCA 3QEJA 4HXFB 4M38A 1TAQA 1XZQA 2G36A 3DZJA 4NMLA 3BXPA 1G5IA 5KOHA 1XZ8A 421PA 1O95C 3C4JA 5DBFA 1V48A 2VSFA 1FPQA 1VL0A 5ALYA 1NN3A 2DSTA 5LLTA 2TMDA 1ZITA 2L42A 4MROA 5IANA 1AB5A 5LCXA 3C6MA 4OHBA 1NXWA 4HZUB 5FLEX 1TKAA 4ZXFA 3C1AA 3ML1A 4RX1A 1XN4A 2Q7DA 3V8MA 2BF4A 1JE0A 1N9GA 2OAEA 1RYDA 3IUMA 5HKLA 3ONDA 2WIAA 1B15A 3GNTA 1X86B 3SNHA 5AVYA 1PLKA 2FQWA 1GA6A 1U9ZA 2CNWA 2WZCA 4MQ4A 1X3SA 1R0XA 3OA2A 3S99A 3M1AA 4D56A 3QPCA 1SC1A 2ZUEA 2E18A 1N0VC 5FWYA 4MGZR 1J1IA 3RS0A 4A0GA 4UUQA 1MOSA 2VH5R 4XCQA 1NYRA 1BQ4A 2RGRA 1Q3HA 4ZANA 3QUAA 5IF9A 1ZG3A 4OXRA 1NZDA 5ERGB 1X7WA 2OCBA 4LBZA 5H7XA 1EP3B 1W30A 2XMQA 2WKWA 2FEPA 4H3HB 1D4OA 4K3VA 4PZYA 5F5NA 4B43A 4B82A 2ZWIA 1U0SY 3RT7A 2N9UA 3MXOA 2G1UA 3V4PB 4C76A 1CUDA 1TADA 2GKSA 1KBQA 2EWMA 2BKEA 2WJ4A 4HB3A 2NU6B 3KT6A 3PICA 3GLFB 4XQEA 2JFVA 4LDJA 3VX4A 2AMYA 4HAWA 2GARA 4PXYA 4EO4A 3ZXIA 4RH1A 5JWHA 3WJ7A 2B8NA 2HF9A 2FB9A 2NU8B 3ZVKA 3B1XA 4ZICA 4OG2A 1QU3A 2V9CA 2OENG 1U0RA 3FRIA 4LFCB 4BC1A 5BNZA 2M98A 1MV8A 1YMUA 3HZZA 5HZHA 3U48A 2C7PA 3OURA 2H57A 1VSVA 5K0ZA 4B3TB 1S01A 2NXJA 1E79D 1YQ9A 2OWDA 4DGQA 1GKLA 4MI9A 1UBNA 5J43A 2A57A 4L72A 5K99A 2B4QA 4FCTA 3UN1A 3V8EA 4F5ZA 3KP1A 4ZEXA 4LA4A 1KQGA 1U6KA 5FAKA 3HCWA 3O8LA 5LDDC 2FJUA 5G3ZA 1CJVC 2FN4A 2CXNA 3W2FA 3F9IA 4DKXA 1GKIA 1G8GA 4U3JB 3JWGA 3KSAC 1A2QA 2OEPA 3Q7IA 4RMIA 1U8XX 3QX7A 3STHA 1F1JA 4CLHA 1KKUA 3B1VA 3KT0A 5F77A 5IKPA 4NEGA 2Q1WA 4B8WA 3KB8A 1Z7YA 3DONA 4UREA 1RNLA 1M8KA 3GCGA 1Z0SA 3PFNA 4YECA 1GFWA 5LA6F 2XUHA 1MGOA 4O08A 5EWMB 4C1NA 3KKZA 5EXEA 4PGHA 4X9XA 5EYPB 1ZSVA 4UUPA 1RDFA 3B6KA 4I1PA 1KDTA 1OFHA 1SXIA 3DWEX 4I7EA 4P4NA 5IVKA 3EC2A 3FCXA 1PL0A 2IOQA 4E5VA 3O3NB 4U7TB 2JFPA 3L8GA 4EB0A 3U13A 1SA0A 4EI9A 1ZMRA 2C4KA 2DH5A 4JUDX 2A1UA 3C3CA 3HYNA 3QVJA 2GK7A 2I03A 2ZYGA 2NO4A 2EJTA 2WIDA 4I6GA 1MZVA 1WA5A 4FR0A 5AJHA 3CKLA 3FPJA 2PRKA 3O7MA 4C01A 4E88A 5TLSA 3A1WA 5CBKA 1GGJA 5F98A 1RJFA 1UCFA 4G41A 2R5WA 2FG7C 2ZJFA 2DPXA 4RHXA 5CYGA 1X13A 2G9ZA 2GPTA 3MGAA 3N0RA 3CNHA 5DMXA 3ICQB 1OW3B 3W3ZB 5LA6B 3E15A 3AWDA 2BEUB 2ZGVA 3C7DB 3DFIA 4LE0A 3D0RA 3N1UA 1CQJB 4MAMA 4WESA 5ECDA 3RVPA 1S4QA 4YIHA 4WLUA 2HEGA 3RK4A 3V4OA 4TYYA 3MJ4A 1A9PA 4C5BA 3I6BA 4FQ8A 4JUBA 4M37A 1KYVA 3R74A 3DP9A 2Z4TA 5AIAA 1J8VA 1OU4A 5E6SA 4RTSA 3AI1A 1GAXA 5C1PA 5BR8B 4Q7MB 3BMCA 1VMKA 1V7CA 3RG8A 3E18A 4WOBA 5C1DA 4RHCA 1PZFA 4QM6A 1R0WA 1VG9B 4P81A 2V5AA 3VPFA 1SVWA 1DPGA 3HRIA 5JEEA 1IJKA 3FTFA 3TQFA 1A0OA 2C8VA 9MHTA 1GNQA 4FKMA 5K4AA 4CF6A 4DG8A 3P2KA 3PQFA 5ADUS 4WN9A 1BWQA 1BW9A 1PZEA 2KXTA 5KHOC 2V0GA 4F4IA 2QLBA 2R6FA 3B85A 3KZXA 4C2TA 1HG1A 1QQ5A 3GG9A 2ODEA 5E4YA 1JQJC 3KOUA 4HH3C 5KNBA 2QJWA 3BXFA 3K2IA 4ME6A 4TSRA 3SJAA 1PK7A 4CV1A 2EP5A 1TQHA 1DEHA 2VUHB 5JWOA 1KYYA 2Y92A 2N47A 2G67A 3JQAD 4X8LA 5E9AA 1QIDA 4I5IA 1NXSA 4JIMA 4L28A 4PIMA 2FP4A 3NHZA 5DLPA 2TECE 3F78A 3WR5A 2A78A 4MUEA 1V96A 5DN9A 3VA7A 3ILYA 1PZXA 3GUVA 4A2CA 5T3YA 3WWOA 2VCYA 2O8NA 3OX3A 4LXTA 1K5DA 1OT5A 5IS2A 3PX3A 4INZA 3S1AA 2VYCA 4MUFA 2VPIA 3J7TA 1TJ3A 4PHCA 1NJ5A 4YJKA 5E3JA 5B55A 3NJRA 4X7BA 5ETJA 4BNZA 2HKIA 1JDUA 2JEOA 3AHGA 4BQRA 1R6VA 3JQAB 2Q0SA 3HKEA 3PJDA 1V3UA 1LPSA 3R0JA 2KBEA 5CEEA 1ZR2A 3ZY6A 4BEBA 3ADDA 3M9XA 2QTZA 2QD5A 2WJPA 2NV0A 3C98A 1CUBA 4G5RA 4B2LA 4BMSA 2WZQA 1JDBB 4JBIA 3S7TA 2EU8A 3D2AA 4KSCA 3U61B 4GPAA 4NWIA 1MX5A 5FBWB 2JAXA 2J5RA 4II7A 4Y2YA 3NEPX 1JJFA 2XQGA 5M34A 5E1BA 2BMDA 4WNAA 4HP8A 4NBSA 3VTZA 3TGWA 2PUEA 4N9WA 3PUHA 1UM9B 2X8LA 2HDNB 3E8SA 5GY7A 1X8XA 2BP7B 1HA3A 1UXOA 2FW0A 2HIGA 2IBTA 1PFKA 3ISJA 4UJ3A 1OC4A 5EMHA 3RVMA 9LDTA 1LPPA 3SZ3A 2B25A 2SKEA 1VB5A 3I6MA 2Z5GA 5JZMA 1IVNA 1MA3A 1YRYE 2P9EA 1B73A 3MTEA 3ZE1B 4YT4A 1F51E 2EC5A 1VJ0A 3GLKA 1W52X 2ZK7A 1XCLA 3PQDA 4BMOB 3RYIA 4L16A 1NATA 4D80A 3F3KA 3AI2A 5DEOA 3HVUA 4B6RA 4YRNA 3TE6A 1JH8A 4OL0A 1CZOA 3DVQX 1T0HB 1WU7A 3I6IA 1IUPA 1M6NA 4FFMA 4U2KA 1WXHA 3MWDB 1QNLA 1PGJA 1JG4A 3VX3A 3RAPR 1CYEA 3AP3A 3K53A 4WZBB 4F5YA 3ZEAA 1KDRA 3E9EA 4C07A 2PGJA 3PLNA 3VI3B 1JHXA 1ES9A 2BFCB 3A9UA 5COAA 4KMRA 2VRCA 4A0SA 4YAGA 4CM4B 1L4EA 2YXNA 1NJGA 3HV2A 1GNPA 3IQIX 3BMQB 2KXVA 4PRLA 2BZ0A 3RS4A 1XALA 2ZIFA 3K8ZA 4DL9A 3N70A 1NP7A 5FJJA 1OF1A 1USGA 2GN4A 4GBED 2RH8A 2XECA 4IILA 3ZIAD 1RADA 3ABSB 4QJ4A 5DASA 1NW9B 1ID8A 4DCJA 1SVIA 1XTUA 2QBYA 3MT7A 5C7OO 4DM3A 4FC6A 2QMYA 3K71B 3EIEA 4WGFA 4QGHA 3EIHA 2REQA 2P5YA 2Z58A 3B8EA 3HR8A 3AKYA 4GT1A 4QU5A 4X6XA 5DNDA 3WTCA 2DFDA 4BASA 3AFMA 3HDQA 4JI2B 3U0VA 2JDID 3WAGA 5T57A 1T10A 3F73A 1G0NA 1QF9A 4EUEA 4MB6A 1E2KA 2C4TA 3HJNA 1WU8A 2IHBA 4KPYA 5C9ZA 3QBEA 1E1RA 2CB9A 5TF0A 2XMDA 1X6VA 3GLIE 1QCCA 1T15A 5F73A 1WXQA 2XODA 2IZ5A 1DZIA 2WKSA 3CZ5A 3PC2A 1E5LA 1JI0A 2QI9C 3DMHA 3BDIA 3IXQA 3OKPA 4MTLA 3OP1A 2ZKLA 2PKWA 1DCFA 1YFKA 1CZKA 3GT0A 3BZWA 1BXZA 3LWNA 3ZH9B 4HJXA 1G4AE 1WUJS 5FI0B 2NSDA 4I3FA 5FYDA 4B76A 3QEOA 2F2TA 5AW1A 5FPPA 4E33A 2RGNC 4DADA 5CEFA 2OB2A 3TEMA 1YE5A 2DWUA 1EUCA 3M5PA 5FUXA 4ND3A 4NE9A 4AD8A 2RCNA 4ND7A 5EJ2A 4BOYA 3W1VA 4DCTA 1DJOA 2X9NA 1V8OA 1QORA 1I4OA 2Q5QA 3I9JA 2XB6A 4H6VA 2IBMA 4JLSA 5HFNA 3REOA 3RFFA 1HQDA 1EHIA 2WB4A 1LPBB 2WINI 4MYRA 1R4NB 3EEQA 3P5BA 4KZPA 1UBFA 3TOCA 2W83A 3WO1A 2EBUA 2IRWA 4S12A 1TT7A 4FX2A 4G25A 2C5AA 4BO7A 1T2AA 3M33A 4RVCA 1Y6JA 2BSXA 3I3OA 5AW5A 4CKCA 2QAIA 1Y4UA 2J85A 4J2HA 6LDHA 1GT6A 4ABYA 1ZJ5A 1ZI8A 3QPAA 3GF4A 3HO1A 1W47A 5CG1A 3HXOA 5IJ0B 1ND6A 1PSWA 1EHYA 2G77B 4Q1DA 3UAOA 3WLJA 4ENWA 3OCXA 2YYZA 3K1AB 2XWQA 2BM8A 2LKCA 3JQ9A 3U3DA 2Y1KA 1YQTA 3WLRA 2IYXA 3LT2A 2PXAA 3HP1A 2W6PA 3G88A 2X2EA 2OE2A 2OD9A 5F21A 2ES4A 1UFKA 2NIPA 1G98A 3GLTA 1N8NA 2C3PA 3DEZA 3V33A 3GP5A 3DTVB 1U2PA 1NVUQ 1GRCA 2PXXA 2VJOA 1II8B 4KQIA 4KOEC 1UKCA 1WCV1 3DKRA 3A6KA 3L0OA 1ORIA 3S7ZA 3O8OB 4BNGA 4TWZA 1F6WA 2F1KA 4JGGA 4I36A 4XVUA 1KIMA 4FS8A 1VBNA 3FMPB 4EEZA 2XCRB 4GWGA 1FNNA 1LI4A 1DI0A 3PNQA 1DAOA 4N5HX 1AKNA 1RQ2A 2YNMC 2WVJA 3CVVA 4O4IA 4FP9A 3ESXA 3IEKA 1D0SA 3ZXXA 3FGNA 4O6VA 3GA0A 4R1SA 3UOWA 4XVCA 5EHQA 3FOEC 1X7XB 1N4AA 3LM8A 1Y4SA 3ASUA 4ID3A 1Y9ZA 2OV1A 4C5CA 6NULA 1CQWA 3IT3A 2WMNB 4RPIA 2OYSA 1Z06A 2H1VA 3TFWA 6REQA 3DBOB 3CRZA 4URXR 2IYUA 2OP0A 2CK3D 4N40A 4IOJA 5THQA 3SZUA 4PX3A 3HACA 4WOCA 5COQA 1IUOA 3N5CA 4DQDA 2HSEA 3SBDA 4TLLB 5IXYA 3QKTA 2Z56A 4WFJA 5BN5A 3QFTA 3ZDFA 3R6LA 5HXAA 3ET5A 4B9EA 4Y6GB 2WJVA 3V4VB 4D9CA 2ZBRA 3K2EA 4CUKA 1CEXA 1U2GA 2I62A 4OV6B 3ZWWA 4BJ1A 3W05A 4FU0A 3U4HA 3AX6A 1ZGCA 2EJUA 1KZHA 4CLDA 3DO6A 3QV1A 4B33A 2A4KA 4TWJA 2GF2A 5JCJD 4IDHA 2IPOA 3BB3A 3PVSA 4HH4A 4DMKA 1M2JA 4MR7B 2CDCA 5E3HA 5FDFA 2QRJA 4O0MA 3KJGA 4K9RA 1XKLA 4NV0A 3CPJB 2I7TA 1OX5A 4D8YA 1A77A 3VUFA 2AG1A 4UARA 4X5OA 3TG8A 5HS6A 1U2GC 4X00A 2H4ZA 3CONA 1RW4A 2FR1A 3UK2A 2BMEA 5JRJA 3LDUA 3DDOA 1DIHA 1TW3A 3KRTA 1USKA 3P94A 4KXXA 2B7BA 3Q72A 5FP0A 4YUVA 2QY9A 4WNCA 5IN5A 1E2BA 4LRXA 3NTVA 3U7RA 5JBIA 1VYHA 3ZDZB 3ZWKA 4JAVC 4I55F 3IJRA 2XYPA 5F35A 5HF5A 1T1SA 2K2QB 4NCAA 1DRUA 1D8TA 1T2CA 4N41A 1NNI1 1YR1A 1ZUIA 2WUVA 4L9RA 1NRIA 2ZJOA 3H75A 2ATEA 4JSYA 3NIGB 1XDBA 4BLOA 4F6RA 1CNEA 1P0FA 1U8AA 1Y1KE 2XKKA 1KQFA 1BJRE 2O7QA 2CXTA 5C5DA 3A4TA 3A9SA 3C5HA 1K6XA 1YQUA 4N7MA 3HYLA 3GFGA 3TW4A 2FSGA 4LG1A 4KKVA 5FOWA 2J31A 4IEIA 1VCMA 3NRBA 3CRRA 3H6HA 4WUVA 4YC7A 4D0NA 4MW7A 2WV7A 3E48A 4LSMA 4CVNA 2GCEA 2I8LA 3QBTA 1JLSA 3MWGA 1QHHA 3LVBA 5EVCA 2QPOA 3OJ0A 4Q1CA 1NF2A 2WG1A 2I1LA 4LY6A 2X14A 4ARUA 4ER3A 4XGIA 3IXMA 1F9EA 2OWEA 1V5EA 1MTOA 4DQLA 4S3MA 4UCWA 1Z47A 3WB2A 1PGQA 4TL9A 1ZM2A 3MS4A 1JMYA 4YRCA 3ZU5A 5IT4A 4AO7A 1KS2A 2JFXA 2AUMA 2BGJA 4LZZA 3KR9A 4TM8A 1VPWA 4F38A 3BJIC 3CMMA 4LVUA 4UD6A 1DNPA 2FR0A 4HN2A 4O2BA 1A8QA 1B43A 2AF3C 3BWBA 5DXFA 5BURA 5JXHA 4JUAA 4V0LA 5CW2A 3EEOA 1IXRC 4JYZA 2I66A 3SCZA 2JVJA 1CP3A 4GM0A 1P45A 2C58A 3PIRA 2DF8A 2JGLA 5AIBA 3H1EA 3B8HA 3C6YA 4DYDA 1EVLA 2XGJA 1QS0B 2FWJA 2YY7A 1L2TA 3DQZA 2BMFA 1MJFA 1U5AA 2HEIA 2BGTA 4IS3A 3WGNA 5TDHA 2XDQB 3R8CA 1OA1A 4WKPA 5LLSA 4S35A 3ZJUA 4LIPD 4S2UA 4FWIB 4YRAA 4Q6WA 4YFYA 2ZI4A 3NBKA 3WMWA 1FSFA 3NGXA 2CJXA 5CPBA 1HL3A 1H2HA 4Q7KA 1ESZA 4H7PA 4PRYA 4BJ6A 2AW5A 3A3OA 3OUTA 3DFZA 1Z3IX 4QTYA 3E1KA 5IJAA 1HURA 1THGA 4QJ5A 1VYVA 3A6HA 1BGVA 1Z62A 2ZRQA 3ER6A 3S2EA 2A5FA 5B4UA 4KDEA 1R0CA 1ZGJA 4UNIA 1UXJA 3D1VA 2I54A 3DJYA 1BA2A 1YZ3A 2B4KA 3MS7A 5L3ZA 2QUHA 3ZOKA 4FHGA 4RVNA 4K28A 4FTWA 4YRQA 3S3TA 1XL1A 2VTEA 5A3VA 5HFAA 4D43A 2D1SA 3G85A 5K3OA 2WJWA 5L9AA 2WK1A 4KV9A 4G2NA 1ORRA 1FFXB 1GFZA 1TD9A 1G2IA 3CNNA 3HB4X 2PO7A 2OXIA 2HA6A 1V7PC 4Y2GA 1PX2A 5EOVA 5ILQA 2OFXA 3OLYA 5AHKA 4Z7OB 5MN5A 1N8QA 3RFXA 5GJVC 1AS2A 1XOIA 4B45A 1ZVQA 1SURA 5C8YF 3JD1A 3H3JA 4RE6A 3ZI0A 3OD1A 1LEHA 3QA9A 2NPIA 4IVNA 2VUIB 4A15A 2FXIA 4JR2A 1IY0A 4FD3A 3HDTA 4TM7A 2R3SA 4ZC8A 2AK2A 2CYCA 4WCFA 4X91A 2ZAGA 3HJTA 4ITRC 4QNRA 2I3GA 1TTHA 3K0SA 4PSAA 1RHUA 4DLPA 5TMEA 1XVIA 3QJGA 3RTEA 3LHDA 1KQ3A 6AT1A 5FUMA 1FYEA 3OZRA 2AN1A 5L7YA 3SDZA 4I3GA 3REGA 4BKOA 2HSDA 4FGSA 1FS6A 4XM0A 5C2JB 4X1OA 1A4RA 4MB2A 2FVXA 1OXKB 3Q8KA 4D4KA 2A9JA 1LBTA 3Q11A 4H4DA 5HEKA 3U26A 1L6RA 5C8YB 4ND8A 3QIAA 4YUYA 5F2EA 2F1IA 3AI7A 2F6RA 2I29A 3C85A 2JVIA 5DHAA 4LXXA 1VE6A 3RSSA 1JRLA 1NX9A 1LLQA 1B0UA 1Y8AA 3DHVA 5AI6A 2FN8A 3IRVA 3PA8A 3WLLA 4MKZA 9GPBA 1X0VA 4ZN6A 1C0PA 1OXBB 1C8LA 1YKFA 1UMDB 2VCHA 2PIAA 2PAAA 2NNWB 3VR5A 2FPIB 3RC3A 2EFGA 2HBZA 3GVXA 1FGRA 1SO8A 4UMDA 3WNDA 2FSHA 1NNLA 4P82A 5IKOA 5BSKA 2VKTA 5C4IA 5HK9A 5JXIA 5M29A 2A86A 1FW8A 2GHQA 1JTFA 3R5TA 4O1HA 3H1AA 2GRAA 4CG2A 3O8BA 3NEJA 1U0OC 1VCHA 3OEHA 2ZRBA 1HZZC 5EA2A 3OETA 2O05A 2VEDA 4CLEA 4ZKDA 3JQFC 1N6NA 3PUYA 3KXLA 4NYJR 1IXKA 3JATA 1WIWA 3FDZA 3OFKA 3ZE8A 4MJLA 5JC8A 2ZZNA 3K35A 1GZVA 1UDWA 2K7ZA 2Z98A 3NAQA 1FUEA 3DR5A 4FQ7A 4GXNA 2GM3A 1YS1X 1Z8HA 4OU5A 2CZQA 1C9YA 1VHQA 1YDMA 4GX5A 4J9UE 3HV0A 2X0IA 5SY4A 3O26A 1J9ZA 3VHRA 1N7HA 2GEVA 4DPKA 2E82A 2D2EA 1OVGA 1HYEA 3EXG2 1VRCA 1W5AA 3NM4A 3E0XA 4D8UA 1PEAA 1GOTA 1F7VA 4DV5B 2Q5FA 4U00A 2G9QA 4J1TA 2X22A 1L4NA 3UWPA 2NZUG 4WDQA 3OIDA 5KC9A 4IVQA 1XFAA 2EW1A 3WOHA 1G8YA 4M1TA 3QG5A 1OZFA 4MV4A 3WVNA 1P1HA 1YZGA 2AFIE 3QLJA 4K6HA 3RROA 2A1TS 3KQSA 3K92A 2V6FA 4I4TB 1AKUA 3MIZA 3UMBA 2JIPA 1YRHA 4Y0AA 5HJ2A 4F8YA 3E82A 1ODFA 2D1TA 4LHVA 1WXGA 1XZGA 4ENPA 5F33A 1G38A 4G0UA 4R0MA 1E3EA 3HVHA 3MUNA 4LN1A 2JFGA 4J1TC 4DUGA 3GLRA 1C41A 4HZUA 4M8LA 1D0IA 3R9WA 5CD9A 4CTKA 3I73A 3LJKA 4LXUA 4RJKA 1BMQA 1QRTA 4DB2A 1ML4A 1A72A 5JU6A 3GGSA 4DARA 4LJRA 2NXCA 1R12A 2C77A 4FYJA 3TZLA 4CMEA 1Z08A 5AJZA 3LDAA 1PD0A 1ZP6A 5JCOA 4Q48A 1RPAA 5F7ZA 3AG6A 3SIWA 2C2MA 3AYZB 2XE8A 1ZSYA 1DT3A 1G8SA 4PX5A 5JLAA 5TPZD 4YMGA 3W5BA 3L1HA 3OEWA 1KPHA 2PUDA 4KGDA 4NY1A 2ERYA 4GH5A 2C0CA 2EYQA 1J0AA 4XJXA 5DHUA 2P62A 1SBZA 2X23A 3ROEA 2HPHA 4MX8A 2GPSA 2DYKA 4PGGA 2V7XA 1VE9A 4MQEA 1XVVA 5M2QA 2JIQA 5I9IA 4TYPA 4JDUA 4EYKA 1N8SA 5CCBA 1IZ7A 5HTKA 3E61A 1OA0A 4P83A 4BS9A 4HRXA 2OO5A 3L9XA 1TA0A 3RIGA 1M2OA 5KSOA 4ZYVA 4NSNA 4RGQA 3OTWA 1QRSA 2V03A 3ZNNA 1FBNA 1SVNA 1V5FA 4UXHA 5K3FA 5FEMA 2NU8A 2NO0A 1D5CA 3GGPA 4GLLA 4KDRA 1FQJA 3NQ41 2ZWOA 2ISCA 4NL4H 1OX6A 2JI8A 4G23A 3BIOA 4JBNA 4RJJA 1A3CA 1SELA 3LKDA 3OC0A 2OO5C 5A4KA 4EAAA 3AIKA 1AGNA 1KEUA 2E1PA 3R20A 1XNQB 3KYCB 5JCPA 5TB5A 3CZ4A 1LV7A 2AUTA 4KTTE 1E6CA 3GAMA 2YZMA 2Z2YA 4IDNA 3LPCA 3H5VA 1FY2A 3FUUA 4FYXA 2ZI7A 3IVMA 5KTSA 2XXAB 4U3JA 1CIVA 3CIFA 4HLQB 4EZBA 4WVLA 2G76A 4M1KA 3A3YA 4RYLA 4LFBB 3AF0A 3KZCA 2FOIA 4TLEA 1GL3A 1ZM7A 4G86A 4B7UA 1E79A 1KAOA 4AIIA 4QTXA 4R1UA 2QUAA 1G1AA 1UOOA 3L0CA 2DPHA 1N9KA 2P9TA 3E3OA 4RORA 5GZ1A 1HYHA 1PV4A 3K30A 2CVQA 2GSWA 1IWBB 2KHZA 3HY4A 2EYUA 3BE5A 3CPHA 4RSMA 4TS3A 4MQ5A 5EKTA 1RMQA 4JS0A 1ULAA 4IFTA 4MDHA 5K3DA 5KNCD 3F6SA 3LYLA 4HYYA 4IH9A 2FZKA 2ZOSA 3SN6A 4YMHA 3GAZA 5C5IA 2DAPA 4PBTA 1IUNA 3I2HA 3S2GA 2OLEA 4B17A 4ZYLA 3OF3A 3B1ZA 2QP4A 1I7DA 1OI4A 5KC8A 3JRWA 2JCYA 2O3QA 1Y3DE 2QDKA 1G2QA 3OTGA 2VDMB 4M1YA 3X1YA 2RDMA 1T25A 2W4MA 3U4AA 2FJ0A 2WJGA 2QORA 1UJ4A 4HPXB 1RXYA 2ZUDA 3D2LA 3TH5A 5GPBA 3OQBA 3VPXA 4AMGA 4EUNA 5LA6A 3AGPA 2BEUA 3IQHX 3U37A 3R3ZA 4B3CA 1M6EX 4KIUA 3M5DA 1YA4A 1JU3A 1CQJA 4KNVA 1PL6A 3P0IA 1Q1QA 3N6RA 3A32A 3B7WA 4R9RA 4F91B 1G20A 3TOXA 1XAHA 1UKEA 3FMOB 1FK8A 4I1SA 2QZSA 1XEWY 1J97A 5JBQA 1JJAA 1HEYA 1SEPA 2JH9A 1NYTA 2O2ZA 5DHTA 5B3AA 1ORHA 2HPVA 3O2QB 4HPJB 3ZJ5A 4AYTA 1Z8NA 4D41A 1D2GA 4RY8A 1HQCA 2XY4A 3D0QA 4TMZA 1JIVA 2OZVA 5LN1A 3HR4A 1P4GA 2EKPA 3KUKA 2WJ3A 1XROA 4GFDA 1EUZA 3MAAC 2HJRA 1X1QA 4G9EA 4GBJA 4LTMA 5EZQA 1BXRB 3H6GA 3Q3GE 1KPIA 4KACA 3ADOA 4HNAA 4BNUA 2JIMA 1CJMA 5LYJF 4OXXA 3MWEB 4BZWA 4H3KB 1BS1A 3IFSA 2FW7A 1PDOA 3A11A 2PH5A 5BSTA 1SXJD 2QA5A 3GXBA 3NHWA 4MGYR 2X40A 3HA7A 4R2MA 5HMMA 1OVMA 5J40A 4OQLA 4YP5A 2XB9A 3QHQA 2N0SA 5A6VA 3VKFA 2IY9A 4J2TA 1C14A 2FPMA 1Z17A 1NMXA 3GRAA 3NC4A 1NQWA 1QG4A 2E48A 3FDJA 3L6CA 4MW5A 4ZAYA 4EHNA 1VI5A 2NUAA 4JBGA 4YLGA 5B5SA 4QRHA 4P3YA 1RYEA 4FHCA 1Y6GA 4A8HA 1EWTA 3L5KA 1A95A 1FNMA 1W4BA 1MEEA 1VL8A 1XA3A 3K3PA 1N3BA 3B78A 4OKNA 5BQ3A 2Q2QA 1SXJB 5D3MB 3IUNA 5BWMA 2JIRA 2H1HA 2DWCA 3CNQS 2H9IA 3TJMA 2BUAA 1GPKA 3JQAA 5LYJB 4I4LA 2Q3EA 1AHHA 4OBBA 1RQXA 1TUBB 2XCQA 3V98A 2PZBA 2XNKA 1YUBA 3E8MA 1SIWA 1GNLA 1A9TA 3HDHA 3LNTA 4NBKA 2BM9A 2QRVB 1SCUB 3EYAA 4LI0A 1VMIA 3FGPA 4EG7A 3PKZA 4Z9FA 4AZ3B 2PBFA 1I3NA 2PEYA 5EIOA 5BRAA 3GYBA 2GD2A 1KI6B 2QVXX 4DJAA 4B74A 4AURA 3OJOA 4L5JA 4OF4A 1W46A 1L4BA 3AQIA 4OBEA 2BHTA 4Y1EA 5EN4A 3S2ZA 3SXUB 4NQRA 3WV5A 4EJSA 5CJPA 3OPYA 1UM9A 1KEKA 2AEJA 2P6OA 3NBMA 1RU3A 1IOWA 1X1EA 2C82A 1KJZA 2QRPA 3NORA 1ACJA 1WNTA 3IQDB 2WP8J 3M1LA 2N1MA 3DFFA 3F2VA 3IS3A 4F60A 1AURA 1JDBC 3ME5A 4BKUA 1C5KA 4D26A 4QDJA 4I1IA 1P5HA 4UBNA 5JCZA 2P1RA 3VU9A 3F8TA 4F4JA 2BT4A 3IP3A 2HQ1A 1JNYA 3B5IA 5FUYA 4EJSC 2Q29A 5I4BA 5L7TA 2D6FA 1M2WA 2Q4TA 2RHCA 2IEYA 3GDWA 1DMSA 2XQJA 2AB0A 3HJUA 5BYAA 4IWXA 5BR1A 5IZCA 4CEJA 5F4BA 3SP1A 1TX4B 1J39A 2Z1MA 3PNMA 2P9GA 1P3DA 1TEXA 2QMOA 3HY3A 4XUCA 4FFBB 3EGXA 1Q7CA 2V4UA 2YXEA 5JSYA 5DT2A 5H8WA 1N78A 1Z5NA 4ZZ1A 4WZBA 1MABB 5E0OA 1MIHA 3AVQA 3H6KA 2O8CB 3E1SA 3BFVA 4YDSA 3V1UA 2POCA 3QPVA 1BDIA 1QTQA 3E2IA 1V1MA 1R6DA 2CLCX 2QD2A 5CT5A 2HMVA 1H9BA 4I46A 4CM4A 2ZJYA 1MH9A 4B6QA 4M87A 3BMQA 5AKZA 3ZZMA 5IZCC 4A2WA 1GGMA 4A6PA 1EZ4A 2JLRA 1B14A 4PLZA 4XWWA 4UCXA 2IIBA 1ENZA 1OAAA 4DREA 1GTJ1 4MI6A 4HQNA 4D79A 2H1RA 1PQ4A 3KO8A 3QI7A 4H18A 4PF1A 3T3HA 5C3MA 3ORSA 4CF4A 2I4TA 4OYHA 5IVIA 1XTRA 4OKSA 3EXIB 4R01A 4B87A 1VYUA 3ABZA 1JXOA 4MV7A 3RUIA 3D4BA 1PJAA 3AEYA 3U2QA 4NPCA 1YJQA 2AN3A 4N8EA 2GZMA 3ANYB 3O03A 3A36A 3F5MA 1AKYA 1G19A 5DT9A 4B46A 4P0QB 1XNRB 2BZGA 2GEFA 2P0EA 1OHHD 2VT3A 2BEJA 3A1UA 1TL7C 1J23A 2X5KO 3KJEA 3PTZA 4XVHA 3DE2X 2PKYX 5SZKB 3QP9A 4C05A 4X93A 4OOFA 1Z6QA 3BQMB 3B60A 5HM6A 3P9KA 3TF5A 1RRFA 2QD3A 3DD5A 2JCXA 2VDRB 3FDXA 1TTTA 3DOFA 3L1KA 1GV1A 1VKOA 2JDIA 1V35A 2KW5A 2LRHA 4GZ6A 2HA3A 3KLPX 1Z4LA 4IJQA 5BV2P 1DC3A 1RWBA 2M6LA 1UC8A 1F2TA 4YP7A 1E64A 2V6BA 3CURA 2O7RA 3FSJX 2WT8A 4GKVA 2W2XA 3ZYZA 3ZHRA 5BMVF 3K0BA 4OQZA 1D04A 1VHLA 1XVUA 1CUGA 2GBLA 3F97A 4OIFA 4O2RA 4IGKA 4DC0A 4GOND 2BEWA 3AR6A 4S0ZA 1ZK1A 2DE0X 3C8HA 5IBCA 4JVOA 1KOFA 1D0VA 1JAXA 3PNLA 4HHEA 5GM2A 4JSRA 3PQ6A 5SZIA 4OI1A 1YBVA 3W79A 2RBEA 1G7SA 4CDGA 1T9CA 2Y8EA 3MN1A 4Y2JA 4KQ6A 2XW6A 3GJTA 1C30B 2ZUVA 1DVRA 2EHJA 1Z82A 2UVQA 1CA1A 1MAAA 1FS5A 1YHZA 3OLCX 5CAEA 4G1UC 1I36A 5EERA 3L2OB 4FR5A 2HAEA 3WIBA 1KVSA 4YXFA 2QOEA 1VXOA 3ZNQA 2O06A 1PV2A 4K9MA 5BMVB 4LWZA 2FSFA 2W8BB 3WWCA 4D4HA 5C53B 4NYMQ 4LDZA 3VC3A 3W5HA 1KSGA 4II2A 3H4VA 4ZQEA 1ZLXA 1S02A 3I9NA 2AX3A 5EI5A 1SQ0A 2X4LA 1II8A 4OXNA 5KTNA 2BKVA 5LJLA 5I47A 2B1GA 3O8OA 4ND1A 1O9HA 2AI1A 2J41A 3LFUA 4W1QA 1U4OA 5F3DA 3V8NA 2XYVA 1TGVA 5LWHA 4FEEA 1JN0A 1IAQA 3KUCA 3PHLA 4F45A 3BN3A 3VBEA 3D5EA 4HSGA 1J56A 2C5SA 4RL6A 3QSGA 2ZSIA 3RKUA 1X7XA 1DDOA 1DXYA 4NG4A 1H2YA 1QDEA 3RAEC 5ALOA 4XDHA 3GP3A 3NT5A 1QKJA 3QG1A 2REXB 2VSNA 3F6YA 5JZVA 3AR9A 4QUKA 1J25A 3I2JA 4PZPA 5K8TA 5U4XA 3ZNOA 3ZXSA 2HWKA 3L8YA 2WWXA 2I6UA 3FB4A 2XYGA 2WQ7A 2G09A 3F71A 2PZ8A 2WT4A 3PC7A 4GRAA 1P19A 3SOPA 2WNSA 2AYXA 3HB9A 3BE6A 2NADA 4EW3A 1P2DA 2ZU6A 3MIIA 3IPXA 4AT1A 3KT3A 4BNKA 3QXHA 5HE8A 1EXDA 2JHPA 5LU9A 2DETA 4R69A 1NJ6A 2D0IA 3PP8A 4FR2A 3WL5A 2RGBA 3MW8A 4Z4QA 1JXAA 3WLEA 3LK6A 2CK3A 4Y1RB 5HIMA 1J0CA 1GAWA 2WWWA 3L0PA 2BFAA 4UXJA 1NP3A 4S1OA 5F1PA 3PHIA 4IWNA 5TXGA 1TM1E 3NBXX 3ZZNA 1VE3A 1HI9A 3TD9A 1R4ZA 4BKQA 3P9ZA 3BC1A 4TMTA 2DU8A 1L4FA 1MT3A 1L5NA 4CQMD 2QYTA 4U02A 5BV7A 1T1EA 4JJKA 4LDPA 4RXMA 5EJ4A 1I4TD 4ZQCB 3URKA 4Q3AA 2VQSA 3RFVA 3MCZA 5EP4A 1BD4A 1HLPA 5C7IO 3R9XB 5JCJA 3RHTA 5KJCA 1UIRA 1X7DA 4YAOA 1KMQA 5I4KA 1BQ3A 2FMUA 1EG7A 3A9VA 3Q2KA 1SKYE 4JOSA 2E3JA 2O1XA 4S0XA 4BE7B 3TGLA 2H63A 3SZOA 5JMWA 3I1JA 4NZZA 4JBYA 3WLMA 4ND4A 5JJIA 2X6QA 5GOZA 5BQ5A 2C5BA 4OFBA 1FX0B 1FDRA 1JHZA 2XVMA 1A76A 5D1NA 3BIWA 3S4YA 4DHWA 1ZUNA 2G4CA 4GPD1 4IJMA 2N3ZA 3VPGA 2VP6A 4K8OA 3VKUA 3H11B 1RWOA 1BEUB 1WXFA 3Q3IA 1EBBA 1SKBA 2D5CA 1GL6A 2CXPA 2YW2A 3LZ6A 2OTCA 2ACKA 2OYCA 4YP0A 3TZBA 3ADCA 3IALA 4AWXA 4CCAA 1ZGGA 3NT2A 2D1YA 3RUFA 1ZXXA 1AZWA 2WD8A 3I0NA 1KEPA 2GERA 2ID7A 2BN4A 1XMXA 3BCHA 1NQAO 2XJ9A 3FPAA 4K88A 3FTEA 3JS5A 5K0BA 4LQLA 1L5MA 2H5LA 4AJ4A 5FJIA 2B1QA 4WADA 1N1EA 1J06A 2PKCA 3UJBA 3PEVA 4RV9A 1K5HA 3U39A 1Z18A 4WKGA 3SS9X 3M83A 1JJVA 2RGGA 5EUBA 4YRZA 3QEMB 4KMMA 5DBEX 3KTOA 2AHRA 2ZI3A 4Q03A 3ZD9A 4Z5XA 4Z8YA 1OAOA 3I62A 3WWDA 3D8UA 2CFIA 3D0KA 1NN0A 2OPBA 1GPUA 3D6TB 1YB6A 3FPBA 4KDCA 5BSUA 3SBEA 3IEUA 4FGZA 2HGZA 3L01A 4FE7A 2VNAA 3PNVA 1HDIA 2GETA 2A9FA 4REOA 3GLSA 4NJMB 5AH0A 3UUEA 3D2CA 1IM8A 2MT9A 3C8ZA 1CVIA 2C54A 2XDQA 3LWZA 1E5XA 5KJFA 1F8YA 1GNVA 1QHSA 2EF0A 3C41J 2FN7A 3WBFA 1LS1A 4TQGA 1OAOC 1UQUA 3KR2A 3OF5A 4XAQA 1UP7A 1W0CA 4GNRA 1FDVA 1G3MA 2ZRDA 4P33A 3F47A 4AYXA 3A04A 4CKYA 5A5EA 4NAVA 2QQGA 2IYFA 1XQ9A 3NDPA 1OIXA 4RDXA 2V6JA 4R1TA 4F1JA 1HG0A 4F5DA 5IU6A 3VKHA 3RUEA 1ESEA 3IP9A 4U39A 2LD4A 5K3AA 5GJBA 1ZK4A 3F3SA 2AZXA 3CTPA 2XDWA 1C8BA 1UBKS 3I1FA 4NNOA 5EUMA 1L5FA 5K8LA 3GAAA 2QKYA 1JB9A 4J4HA 1Y4KA 2E5LB 1O6ZA 2FN9A 1RYFA 3FLEA 3Q5EA 4B35A 2ZIXB 2XCSB 1SXQA 1DQZA 1MIOA 1E99A 2BFEB 3FR8A 3IVXA 4D8VA 3WYNA 4F4FA 5HDQA 3RUDA 2JGJA 2WIFA 1CBUA 1V39A 4QG7A 5AKXA 4C4TA 1XTBA 2BE9A 2XKAA 2UUPA 4OHXA 3QOYA 1NC1A 1U3CA 1NMQA 4RXUA 5HM8A 5FL3A 2ZAOA 1WMEA 1GJRA 4YRBA 4M8IA 2GJ4A 2AX4A 2XD9A 4KR2A 4RF3A 4BUZA 4CNQA 1YZHA 1DO2A 3E4DA 4ZFNA 2GA8A 3I04A 1GYQA 3WLQA 4DY6A 2A0YA 2AJDA 2IYZA 4YK7A 4ENVA 4M0MA 5BYKA 1Y1QA 2JIDA 3C8UA 2G1KA 2YVLA 3PC6A 4A8JB 5JFGA 2R87A 3VR3D 3K0KA 3U4MA 4YLEA 3D6MA 3TB6A 2BGUA 1Y1TA 2V3VA 3L6EA 2D8MA 3SSAA 1YE3A 1VLQA 4L3WA 3ZD7A 2HK9A 2XHJA 5EHIA 4J0KA 4IX1A 4EYGA 4OAPA 4LC0A 3NUGA 1E9FA 3G23A 3RSGA 1L4HA 3FIJA 4OJQA 3DB2A 2IEZA 4QYMA 2CXXA 3RLIA 1K7SN 1YQEA 4L4XA 3VNBA 4V1CA 3R09A 2D1RA 5KQGA 1SIBE 4P54A 2I2BA 3EEYA 3F6EX 4YCBA 3RVQA 3BAFA 1OLUB 1OWPA 2G06A 3HS3A 4F3YA 3FF1A 1Q0RA 3E35A 3MMNA 1XEAA 1HE4A 1QQ7A 4JR0A 1YI8A 2H29A 3TZCA 3ROZA 1U28C 3COJA 1TMOA 4RA9A 3TQSA 5CW1A 1WJGA 2BV3A 4WXYB 1DAMA 2VHQA 4KE6A 4KAAA 5JOQA 2FPIA 5F52A 1IN5A 2C59A 1DKRA 1KF0A 1L4KA 3DH0A 1L4YA 4OL9A 1TUIA 221PA 3BSWA 2DQ4A 4U2DA 5CM2Z 5AK0A 1Q95A 4JOQA 2P90A 3QNMA 4MCIA 1O94D 5ALZA 3EODA 1R88A 3NIWA 3QVGB 1QX4A 3OTHA 4TMVA 4B2YA 5CDUA 1P29A 2R8EA 3RTDA 2HWWA 3WHKA 1NRJB 2CUNA 2J67A 3I8XA 5FO1A 4DMCA 4EMBA 5K03A 2JD0A 3HHEA 4I1RA 3S0JA 5KYKA 3NHFA 4QWTA 3T3DA 3IQFA 1RI2A 4EMTA 3VKVA 1XF9A 1XTZA 2AGVA 2NQ8A 3DT6A 1E5TA 4RTLA 3A06A 1EM8B 3FJOA 4IZIA 4TOIA 4YQYA 1R18A 1QBKC 3E9MA 3RB8A 1CKEA 1DTEA 1PR2A 4N01A 1FDIA 1SVMA 3PPXA 4N1AA 4R6XA 3IBZA 1T3TA 4BO0A 1U7UA 4KQKA 4Y6OA 3ZR4B 3GEPA 3IAEA 4UHKA 3BBLA 4M36A 1T3ZA 2D8AA 3TD2A 4F7DA 3N8KA 2CV2A 5FR1A 4OHRA 5HRCA 1XG5A 2IU3A 2P6PA 4EB6A 4HX9A 5BOSB 4E31A 1JAHA 1OC2A 3VR6D 1SUIA 1XKTA 2DT5A 2RHRA 1YRQA 5CTJA 1DWPA 4XPIB 3K09A 1FGTA 2CF6A 4R9VA 4UULA 1Z4NA 4BV8A 4EVQA 3W2HA 2WQZA 2VYND 1NOJA 4XJSA 2HIHA 1KFCB 2R2GA 2FWBA 1VL2A 3IPAA 3DM9B 3I72A 2VJMB 4HWOA 2WM3A 4PS1A 3W8FA 1TTQB 3EUFA 1EM6A 4TVOA 3ORQA 2VBGA 4BAGA 4QEDA 4Q4DA 1YIOA 4PC6A 3KPVA 5KNBH 3DOJA 3LKZA 3H05A 1QP0A 2I91A 4URZR 1QDLB 3JPYA 3ZK7A 3EFBA 2TMKA 1Z2OX 2DUNA 1M72A 2ZSEA 3K09C 3KZOA 1LS6A 4G5SA 1B8VA 5ALDA 4FDAA 2ODQA 1E3SA 4EYSA 2NZ8A 2LWIA 3G8BA 1Y9EA 1YRBA 3B5JA 2YHIB 4UU1A 3GLVA 4JCCA 3KSUA 2XUAA 2Z6AA 2NZVG 3DDUA 2VQEB 5CBPB 2QRQA 3ZOZA 1BH2A 2E9SA 4LFAB 5EJGA 3H9QA 3ND6A 4YPVA 3I0MA 2GF0A 3FHLA 1NI3A 2FR8C 2GNPA 4P4LA 1OXMA 2ZJ2A 1K75A 1W8IA 2P8JA 1ODTC 2OV6A 2UYQA 2JHAA 2ZETA 1VKNA 3UAYA 1DKUA 4D4JA 4UFNA 3VU3A 3KUDA 1D2MA 4C0QC 3VHXB 3U19A 3KZ1E 3W8DA 2AMFA 1KNXA 1MD9A 3DL7A 4M6WA 4CLRA 3QEAZ 1XHLA 5K3CA 3WL7A 3FUWA 3AVXA 1I9GA 1LA2A 3AL2A 1QMPA 3OQ6A 3ORRA 2ZUTA 4BNDB 3UMGA 2CC2A 1VI2A 1NSFA 3EW7A 4BZQA 3BT7A 3KVVA 3P97A 4XEUA 2WJIA 3V32A 3RQSA 4JLBA 5L40A 4L57A 3VMMA 2P2LA 3K8QA 4HD8A 3TIGA 4RVUA 4KW7A 1GL9B 1MB9A 1YCDA 1PN3A 2PGXA 2FLWA 2W6ID 2CBXA 3HWX1 4V39A 3ZNPA 4D9BA 3FCEA 4MPTA 4ZDJA 3IV6A 3PS9A 3FPEA 3RH0A 1E1CB 1SU7A 1XZJA 1KH3A 2FHPA 2I2XB 3PT9A 3GZNA 3II6X 1QB8A 1B0ZA 2QTCA 3IBTA 5LP6F 3HDYA 1F9AA 4BXOB 2CEAA 2IWHA 4C0BA 2WUWE 3ZWNA 4A5OA 1UDRA 3GCDA 3L07A 4JELA 4XDGA 2FZWA 3CVXA 5DOZA 3GCXA 4AX4A 1Z2DA 2R62A 4OQPA 5LZ9A 3UICA 2Y05A 1ELOA 4H2DA 3ZI4A 3LLUA 4O63O 1BC5A 4ARAA 1Z5UA 4WV3A 5HTOA 2HV8A 2XXAA 2OBBA 4PQYA 2IHVA 1P0MA 3DO8A 1QOQB 3WBBA 1V37A 1VIDA 4GPIB 4BJHB 7YASA 1ZHHA 4EKEA 4OLHA 1FSGA 3A25A 3TQHA 3QUTA 5FPQA 3H2IA 1UWKA 4URYR 3ZK9A 2W6OA 5LP6B 8ATCA 1WM1A 3D4OA 4FT4A 1PT5A 3UAGA 3PF8A 4OUKX 1V1RB 5KWVA 1L7EA 1Y7PA 4TTSA 4J0IA 3UJHA 2TRSB 4DWJA 2G6BA 4ZV7A 1DXQA 3P2EA 3O1IC 4OP2A 4PFSA 4DEYA 1W88B 1ZVJA 3MYRA 3KQHA 1N57A 1IBRA 2RAFA 4S1NA 2RIPA 1DC4A 1YOBA 1RHJA 3EHDA 5LZ8A 2A0UA 3LUBA 3OCVA 1U7WA 4H15A 4KRGA 4G67A 2DKOA 3IVCA 5FNVF 3PGKA 3HO6A 1U8YA 1V47A 2FMHA 2PVCA 3LHKA 5DGDA 3MTQA 1T9BA 3LL4A 4A6DA 1WMFA 1B2LA 3NS7A 2BTQB 5KNCA 5JSHA 2GJ9A 3BIXA 3CM0A 4MPRA 4JT9A 3R7NA 4D9FA 5I9NA 1QOPB 4BQPA 3IQWA 4HWTA 3WMGA 3FFBA 1UDAA 4F56A 1XKQA 5JNUA 5BUZA 4U7WA 5G0TA 1U1GA 1ZBDA 4ITVA 4MS3A 5EAIA 1AUQA 4WA7A 5L6MB 1AQJA 4A36A 2CD9A 3GJ8A 4OI4A 1STOA 4Q4JB 5CA1F 4KP7A 2ZXUA 1NE7A 1ORTA 1X3LA 2XE4A 2O57A 4WBSA 5KJEA 4ZEWA 3R5HA 4NARA 3TKYA 1P44A 1QUFA 4DE5A 2EOAA 3NBZC 4UHJA 2WZBA 1AO3A 2OOKA 4TMYA 1J2TA 2A59A 2ZB3A 3LTEA 3NBUA 1KTIA 5FNVB 3QU7A 2FSVA 2JANA 2NG1A 3MB5A 4QE3A 4ZEOA 4NU6A 3K6SA 3AR8A 1ZAYA 1DO0A 1PGNA 1LTQA 2ON6A 4MS4A 1JFSA 4P98A 1ZHOA 1Z5PA 2AXQA 2Q7XA 5K3SA 1BXRA 5EUQB 2FMXA 4QHYA 4QDUA 5CXQA 1WCXA 3FCUB 3E1GA 3NDIA 1HOXA 3D8NA 1Z4MA 3JVIA 4R8LA 3RHZA 5H0IA 3MWEA 3LK7A 3Q6IA 3MWYW 5C80A 1BEEA 1ECJA 1ZAKA 3BMXA 4RTJA 5CA1B 1TKBA 2EBWA 2FSVC 1Z13A 3ETHA 1SOWA 1GNRA 1XTSA 3AHIA 1R0SA 3GLFE 1RJWA 2ICAA 4B85A 5IYZA 4PLVA 4UTZA 1CCWA 3PQ7A 5TQ0A 5CITA 4B3IA 5GVRA 3B36A 3NHUA 3BGWA 4RV5A 3U62A 1RHMA 3I8OA 1DAEA 1WX1A 5JH7F 3G0BA 5DTJA 3OU7A 1HETA 1Z4IA 4M1SA 2ZAYA 4UUMA 4X64B 5GZ3A 3DF9A 1T2EA 2X9VA 5EEOA 1TDJA 4PHHA 1AZLA 5SZJA 5LZ4A 4QL3A 1CFZA 5CK5A 2O8FB 4DLNA 3P32A 4L0CA 4J0GA 1Q84A 3WA7A 5KKCA 1TUBA 4WCDA 3HXTA 8ADHA 3ELBA 4C0KA 1UT6A 1UJ2A 4N3NA 2GLXA 3X3HA 1EK5A 4MCAA 4JYAB 4M0EA 2G5TA 3DXFA 2Q07A 1MXHA 1SJ9A 2N42A 1KI6A 1U0NA 2OO3A 4FSHA 3A1CA 1SXJC 3DP7A 4Z4FA 3DR3A 3L0ZA 1E1NA 3ESAA 4UXIA 4X97A 1QYDA 2O2XA 3T5MA 3DE0X 3SXUA 1FUYB 2IYPA 4PQFA 3W4KA 4F86A 1ENPA 4LQCA 5JH7B 4XGRA 4PZZA 3FM9A 1CVRA 1Q15A 4I4CA 2OQIA 4OD0A 4GKJB 2QZ7A 3MSCA 3A4LA 3FUCA 2IUTA 4Q66C 1BYIA 5B1EA 1PJZA 3R9IA 5LXTB 1PKEA 2GDJA 4JI5B 4TQAA 3KEMA 5FA8A 4H7EA 3IYLW 4NXNB 5ALRA 3O4HA 4DCUA 3BEDA 1P1IA 4RACA 4AZTA 2IPAB 3FZNA 3KR1A 3FMIA 1U0LA 4IYRA 1Y7LA 3D4PA 3D8HA 1IK3A 2YXLA 3PQCA 1G9SA 2PRIA 2RH9B 4WN3A 3BWXA 1AKEA 4FFBA 4B3SB 3N2LA 1L1EA 4NDZA 3GY0A 3I64A 2RCYA 4NMWA 4EABA 1MABA 2GN8A 2PWYA 2WJYA 4ZYZA 3OJEA 3PIIA 2O8CA 1S8AA 3KHTA 1QGOA 3H9UA 2H0AA 2CFCA 1AIPA 1VBFA 2BGNA 2DM6A 3QKSB 3QU5A 2DERA 3LNCA 3HUFA 3WLKX 2AXPA 5A71A 4TXJA 3DZFA 4QO7A 5J4YA 2ZJ6A 3EYWA 4BNWA 1LLFA 4NNPA 1ODLA 4R71A 4YJ3F 4IO1A 1BRMA 1Z88A 1YK0A 4KNWA 3ODGA 3RCBA 2IYQA 1BKDR 2AJLI 4LHEA 1K2VN 3F7NA 5KQMA 1O6GA 3EXIA 2R7NA 1NV9A 2V55B 4TKMA 2VDJA 5D8DA 3EEFA 4KWTA 3ZPXA 4UMFA 2P9FA 3LPAA 3T3NA 4KO3S 1QYVA 3O0DA 5C3UA 1EGVB 4FZ3A 4C6TB 4TX1A 1I4DD 4FD2A 1YR8A 2RGYA 3M4YA 4OJNA 4PYLA 3ZHSA 4YCSA 1DARA 5ALSA 1Z0JA 1EFUA 1ZO8A 1SB9A 3QH4A 2WOOA 3AIMA 3NALA 1EVZA 4XVQA 1KFJB 3X43A 4O8ZA 4BWYA 1GILA 1RQRA 3Q2OA 1KXJA 1VG1A 3KU4A 4PBRA 3LSTA 1Q1BA 4G89A 5DKFA 3ZHZA 2FY8A 4EZIA 1J2JA 1PO7A 1G3QA 2VNHA 4EKNB 2JL1A 2I2WA 3F1KA 4WSOA 3UUFA 2VPTA 3CKMA 4QGAA 4YJ3B 1II0A 4E14A 2CLIB 2O3JA 4E1AA 1TEHA 2ODNA 4L75A 1NJSA 2NO7A 3QVUA 5FWXA 1V4BA 4N7RA 1DKOA 5K4GA 3DBHB 4J0CA 4YCDA 1Y5RA 3ELUA 1XRQA 3AVTA 5AJVB 3E4CA 5F9FA 3ZCRA 4GQAA 3H2SA 4QYWA 1YJAA 1FVXA 4YA6A 4DSAA 3A1EA 3MNFA 1GYGA 4FYPA 4KQWA 1E8DA 4OFWA 2BFBA 5FWNA 5GP1A 8OHMA 1NYLA 3E9NA 2WM8A 2X41A 4JSTA 4MKHA 2AZMA 4PNPA 3JALB 2I8AA 1WVMA 3M6VA 2AOTB 2X8JB 1Z5OA 4MKGA 4ZPXA 5M5BA 1J0XO 2JBHA 2C92A 5KUTA 3LQRA 3MLBA 5GGYA 2IFTA 3PGA1 4BKRA 1QJCA 2YN0A 1F8NA 4ZDKA 4L9WA 3WNVA 3IDZA 1YO6A 1DQRA 4DWOA 1PNTA 3V55A 1P33A 2YZ7A 3PSAA 1XRLA 4KQ2A 4B3GA 3WSWA 4QJ3A 1O97D 4ZZ0A 2HMSA 2XKBA 3EHEA 5LQJA 5LL6P 1H85A 2HK6A 2QSYA 4HLDA 1REQA 4ZMSA 2A5YB 3UMCA 3FFXA 3RTBA 2OUKA 5CVDA 1ZH2A 4QBIA 5KS2A 3H7AA 3B6IA 4GPEA 4H4EA 4XYGA 3OOHA 3U5TA 5HQJA 2IS2A 1RXUA 2W8BA 3KQVA 3HZHA 5TR9A 2NP7A 4YT5A 1DJPA 1DFGA 1SBHA 4WUTA 3L1UA 4RK7A 3EFOA 2VQDA 2FPSA 4L5IA 4RMNA 3KKKA 4BP9A 4ZYWA 3RADC 1GUDA 5C4MA 5JYCA 2NVOA 4YJDA 4GYKA 1A5SB 2QNRA 3P9CA 1JPVA 1N5OX 3AUFA 1K98A 1XAIA 2XTAA 2VXCA 3AKEA 3T3IA 2NGRA 5TPWB 3UCEA 1IOLA 1T6BY 3MB8A 4JC0A 4WRRA 2HPZA 1JNQA 4QA9A 1PGPA 1Y8QB 2FEWB 2W70A 1OBHA 2CVHA 2P0AA 3LUFA 3NWOA 3ZLBA 5EE3A 3C5EA 4KYTA 3GJRA 2QUBA 3LQ2A 1YD7A 1XC7A 3O93A 4HX2A 3UXHA 1TK3A 2VHCA 4BMZA 2XBLA 3PNBA 3RUAA 5L6LB 4V24A 5A5FA 2X2PA 4N0PA 3SZLA 1FFBA 2VA8A 3CUUA 4QREA 2Q50A 1KMHA 3E84A 2AR0A 2D2IA 3JQGB 3TRJA 3STWA 3QVWA 1MZPA 8LDHA 1RLUA 2OAGA 2XVXA 2Z2JA 3QNUA 1SEVA 5KNDA 2ZP1A 1EEHA 3CH4B 3TJZA 3THXA 2FEAA 2EQ5A 1KU0A 1XDDA 1GRRA 4EY8A 4QFCA 2JFQA 2FK7A 1BTOA 2HF7A 3RIEA 4JODA 3KJIA 3LFHA 3RGWS 3IEIA 3W0LB 1VCNA 2RE8A 2Q1UA 5EP3A 1CUFA 1G8KA 1KZYC 2JD2A 1UBRS 3ESQA 2OB1A 3D8RA 1QTIA 3X1MA 1YZNA 1GPYA 1QV6A 1E2DA 2HIMA 2D5LA 1RLTA 3OMXA 2AS0A 3A0RB 2Z3WA 4KWIA 2PKEA 4LISA 3TXXA 3O1JC 1DX9A 1XZPA 1ZD5A 3SQNA 2SICE 3F67A 3SJBA 4DTCA 4EQZA 5JNTA 3C74A 5FCDA 1SC9A 3RYHB 1IU9A 1F8UA 1NUUA 1QXSA 3HO8A 4O2AA 5IAJA 4EG4A 3R1IA 2PX4A 4UUNA 2DBRA 3LYUA 3WIVA 3DGFC 3VR5H 3N2NA 1GZ7A 4EM6A 6ADHA 1Z07A 1TEVA 5TARA 7AT1A 3R9XA 4PCLA 1H6BA 3Q6MA 4B71A 4KN5A 1BXKA 2JBAA 4MV0A 3GPLA 2ZR8A 3STUA 2CFRA 1DG3A 1Z5GA 2XNJA 5IW8A 1GLGA 3MGKA 1POWA 1TA9A 4XLZA 4JI3B 3AL0C 4XGNA 2F8LA 2G4VA 1RM0A 2EATA 4Q9DA 1KYTA 1NVXQ 3N76A 3ON5A 1FX0A 4GAEA 5EQTA 4CQMA 1KO5A 2C0PA 4TL8A 3DCIA 5ED0A 1RWWA 5A3SA 2WTBA 5A5GA 3KXKA 3AKZA 3VPAA 3IMCA 4HDNB 5HDBB 4QDOA 2EFEB 2XMCA 3DW3X 1EDOA 1IBCA 1QIEA 1RXEA 4A6XA 4DLZA 3F74A 3T6KA 3FRHA 1CUIA 2FQQA 3SJUA 3ZK8A 4D6XA 1FNSA 3R24A 4LZWA 4LYJA 2F9MA 3VNVA 1DHRA 2A0FA 3PGLA 4LW8A 1QIFA 4D97A 1MNQA 1CY0A 3W1WA 4R8MA 4M99A 1OXTA 1ZJJA 2NTVA 4ZV9A 3EXEA 1WZCA 3U40A 1G291 1IBKB 4JX9A 5KPDA 3H86A 1O0SA 2P6UA 3H3XA 2PV7A 3RBXA 4RTOA 3IP5A 3TR0A 2R6ZA 2LGEA 1AC5A 2WHYA 4NVRA 3W6UA 4CMIB 4CT5A 4QDTA 2IW1A 4FCVA 1G5RA 1EK1A 2VSOA 3L7LA 4N82A 1JSCA 2OQRA 3JYLA 1MF7A 4Y9SA 4YV1A 5CB8A 2HT6A 2Y4NA 3QEMA 1M6YA 2CHFA 3HFRA 4RENA 2H7YA 4IQ8A 3FYUB 4XIFA 3PTAA 5A2GA 2RBKA 1NXQA 5JMOA 2PRYA 5IHPA 5EIEA 4JGIA 1T4CB 5ADHA 2I9PA 3ZCTA 1YDHA 2JKZA 1SVKA 1V7ZA 3EMKA 1YGYA 2BEVB 2PGIA 4NNJA 3BXEA 5DOVA 2E4XA 3LXMA 1RC0A 4NU5A 1A2KC 4Q16A 3BCRA 4BAUA 4FGLA 4E13A 2IU6A 4ZDWA 5K0NA 2F9FA 3QOWA 1RI5A 3V2GA 2IYOA 3HN2A 2E21A 3UMSA 4BEJA 4IJKA 3USZA 3OIVA 2I9KA 4JIGA 2C99A 5EPUA 4LJLA 2WB2A 3S68A 3TLCA 3WL8A 4I9FA 3UQZA 5AUOB 2PJDA 3EF1A 3QF4A 4HMPA 5C35A 5BQXA 4IDOA 5JVDF 3NONA 1VSQA 1KSHA 4HDKB 3G0GA 4GEGA 3U09A 1NOKA 3UATA 3V99A 1M5TA 2H5IA 3IDAA 4Y9UA 1ENYA 1NIPA 2BONA 4EITA 3K94A 2CY0A 3P8ZA 3ED5A 1T8WA 4M9UA 5EJMA 1KJQA 3R6GA 2XTZA 3B51X 4M0UA 1K3UB 3O3CA 2CLOB 4NHOA 5CYOA 1SC6A 3AB3A 3AEUA 1IBLB 4LI3X 1I4LD 3KEQA 4FGKA 5DRTA 2ZIXA 2IH5A 2FFJA 2FOLA 2BFEA 4WZZA 4HVLA 1QV7A 4XX0B 4FFWA 3KE9A 4HUTA 4I1VA 2HZ7A 2ENUA 1PTJA 4AX8A 4AN1A 1WE2A 3W5UA 4TWRA 1PZMA 3OBBA 2XUGA 4J6EA 4LDAA 5BSRA 1KK1A 3A9CA 4D4IA 5JVDB 3LAWA 3UK1A 1UJ6A 2VRWA 3ZBPA 3KSDO 1FUKA 3NHKA 3Q0IA 4D9IA 1U8EA 4DMGA 3WQHA 4Q4HB 2WA1A 4P7JA 1BAPA 2LPMA 1A98A 3FMVA 3FTNA 3EWIA 2LBPA 2Y0DA 1PTJC 3DAGA 1FMCA 5KQLA 1PYGA 1XZDA 3GLQA 3GARA 1CIJA 3GBPA 1FU7A 3MPUA 3TTSA 4A8JA 2O54A 1E5DA 4RCVA 4UW9A 4QBGB 4AJIA