2OXEA

Structure of the human pancreatic lipase-related protein 2
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
452
structure length
435
Chain Sequence
KEVCYGQLGCFSDEKPWAGTLQRPVKLLPWSPEDIDTRFLLYTNENPNNFQLITGTEPDTIEASNFQLDRKTRFIIHGFLDKAEDSWPSDMCKKMFEVEKVNCICVDWRHGSRAMYTQAVQNIRVVGAETAFLIQALSTQLGYSLEDVHVIGHSLGAHTAAEAGRRLGGRVGRITGLDPAGPCFQDEPEEVRLDPSDAVFVDVIHTDSSPIVPSLGFGMSQKVGHLDFFPNGGKEMPGCDGIWEGIGGFVSCNHLRSFEYYSSSVLNPDGFLGYPCASYDEFQESKCFPCPAEGCPKMGHYADQFKGKTSAVEQTFFLNTGESGNFTSWRYKVSVTLSGKEKVNGYIRIALYGSNENSKQYEIFKGSLKPDASHTCAIDVDFNVGKIQKVKFLWNKEPKLGASQITVQSGEDGTEYNFCSSDTVEENVLQSLYPC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Pancreatic lipase-related protein 2
publication title Structure of human pancreatic lipase-related protein 2 with the lid in an open conformation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 127
structure length 435
sequence length 452
chains with identical sequence B
ec nomenclature ec 3.1.1.26: Galactolipase.
pdb deposition date 2007-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00151 Lipase Lipase
A PF01477 PLAT PLAT/LH2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.60.20 Mainly Beta Sandwich Lipoxygenase-1 PLAT/LH2 domain 2oxeA02
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2oxeA01
3STYA 1DQZA 1KU6A 2WU4A 3QMMA 1P0QA 1MU0A 3BNBA 1HL7A 3STTA 1CPYA 1EDBA 2FX5A 2EDCA 3H18A 3FVTA 3NUZA 4QDXA 3WL6A 1ODSA 2PVSA 1U2EA 2C7BA 3KWFA 4UHEA 1J1IA 1MPXA 3GFFA 3HACA 4QA9A 3IB3A 1YAHA 3WWCA 5ESRA 4Q3KA 4INZA 4X94A 1TIBA 3KSRA 4Y2TA 3C8DA 3RKSA 2BUBA 1ZIXA 5AM5A 4QDZA 1SCIA 4IHAA 1S8OA 3KD2A 4RE6A 4ZXFA 3TEJA 4C87A 2B20A 5FV4A 4G9GA 5AP9A 3VKFA 5DYTA 2DR0A 1FFEA 4FNGA 1AMNA 5ALLA 1CIJA 2Y2UA 5ISMA 3OOSA 1CA1A 2QXUA 3E3AA 3KWJA 3O9VA 3Q0TA 3G0DA 2H7CA 4KRXA 4WY8A 3DKRA 2XQGA 3IBTA 3GELA 1VE7A 1KEZA 1VZ2A 1CUGA 3V92A 4LYDA 1ZI9A 5A7HA 2SBLA 3U1TA 5CT5A 5BWBA 1YAJA 4KJXA 3BJRA 4HXGA 1HBJA 3ED1A 3PZWA 1Y37A 3QITA 2RONA 2H7YA 4AX4A 3TGLA 1QLWA 1LZLA 1ZGCA 4LIPD 2BCEA 1HKHA 5JD5A 2YXPX 1UWCA 4M0MA 4LXIA 1Q84A 1L7QA 3I6MA 1MX5A 4KEAA 1BN7A 2C58A 3ZLVA 2C5GA 2OGZA 1EHYA 1Q0ZA 3V98A 3NWOA 1P0PA 3I28A 3QM1A 3E1GA 4J0HA 3SWWA 3ZPXA 2X8BA 1LPMA 1KU0A 1ZOIA 5D6OA 3BWXA 3CXUA 2JGKA 3WK4A 1JMYA 4G8BA 5BWCA 5HK8A 1UKCA 1ACJA 3DDUA 1LPBB 1WHSA 4FFVA 2XMGA 1HDEA 1TKRA 2BGNA 4L3WA 5CXXA 4RGYA 4QWWA 1XQVA 3QPDA 3I2FA 2YH2A 3IA2A 3BIWA 2R11A 2JGJA 2PBLA 1FFAA 4J0DA 1YGEA 4QWMA 2PUJA 1CUAA 1G4HA 5ALKA 4H0CA 3O9MA 2C0PA 4N8EA 4W63A 1MAHA 1WB6A 1M33A 4G4JA 1DT5A 1XLUA 1AGYA 4B84A 5AOAA 2VJBA 5YASA 1BN6A 4MEAA 3H1BA 5K3AA 1VZ3A 2WUGA 4OYLA 2AJDA 4KAAA 4ARBA 2OAEA 1NX9A 1QIIA 2JGEA 3KXPA 4MWTA 5EFZA 1UKAA 2ACKA 1SC9A 2ECFA 2WG2A 4IH1A 5FDFA 5LZ4A 3RLIA 2HU5A 3KDAA 4ZREA 1GQRA 5ALUA 2WTNA 1XZKA 2Z5GA 1W6RA 4AO8A 4H7DA 3AZOA 3FSGD 2YASA 1QJ4A 1XRQA 1EB8A 4X6YA 2PPLA 4FTWA 1CUXA 1GKKA 4CIAA 4Y2PA 5K3CA 2D5LA 3MGAA 4S0XA 1EVEA 4H7KA 1F8UA 4BP9A 4PF1A 2LIPA 4TGLA 4DYHA 2QOEA 1W4LA 1WM1A 4YASA 3WK6A 5AKHA 3DNMA 3T4UA 4IH9A 4Y7DA 4UBOA 5FPPA 1XKLA 5ALMA 3WK7A 5FXMA 3QPCA 2OAGA 4BZWA 3FCYA 1VE6A 1EA5A 1X2EA 3WK8A 1LPSA 2PL5A 5HF9A 3EQ8A 5EGNA 1U8EA 4J0IA 1EDEA 2ZJ7A 4AMYA 3VF1A 2DCMA 2GYUA 4QZVA 5ALHA 1GQSA 3G9ZA 2CMFA 3IDAA 1LNSA 2QUAA 4BE9A 2OXEA 4FWBA 4X00A 2Z3WA 4Y2JA 3RM3A 5K3FA 1E89A 7YASA 4ARAA 4X85A 1JU3A 1GXSA 2OG1A 3O4GA 4FFWA 4ZV9A 2K2QB 3WLAA 3LIPA 5AK6A 4RPCA 2CKMA 1XZLA 3MVEA 2ROQA 5AM2A 3BNCA 2OCKA 4YK7A 2XMSA 5EHNA 4HXFB 3N2ZB 4UBIA 2WFLA 5SYMA 1QM6A 4G8CA 3C8HA 1GYGA 3C6YA 4DIUA 5AKZA 4AO7A 4PV7A 4X6UA 1PJAA 1QIMA 3SC2A 1OILA 4C4ZA 1F0PA 4K6GA 3B5EA 5AKYA 2DQYA 3WWDA 5T4HA 3D3NA 2AJBA 2JIDA 5AI9A 4H35A 2QVBA 1IUPA 2ES4A 4HS9A 3WWOA 3I1IA 5CT9A 1XZGA 1CUUA 1DX4A 1G66A 4H77A 2D0DA 2OQIA 1J07A 1QFSA 5JIBA 5AKJA 3AIMA 3HRHA 5FKJA 5AOCA 2ZSHA 3A6ZA 5AI6A 4IO0A 3R3VA 3HSSA 1ODTC 2H1IA 3M82A 3F67A 3PI6A 2AJCA 3S8YA 2HM7A 4B0OA 2WG1A 4LHEA 4AN0A 4BCDA 1CQZA 4E14A 5DYWA 3LS2A 1UZAA 1ZJ5A 4OU5A 1VKHA 2GBIA 3WKDA 2XUJA 4XX1A 3BE8A 2HADA 2XUAA 3LCRA 1DX6A 5CURA 4P93A 4LXHA 3DJYA 4EY4A 3AINA 4UUQA 1E8MA 1IUOA 4BRSA 4X3CA 2VJAA 5ALFA 1MJ5A 4L0CA 6YASA 5FLKA 2JBWA 4PSCA 3NOXA 5A7FA 1UK7A 5D3KA 2ACEA 3QYJA 4MEBA 4BZZA 1X70A 3HXKA 5AICA 2XB6A 5EIEA 1W75A 1XRRA 2WIJA 4F60A 2ZYSA 1EVQA 1IMJA 4ZI5A 2DQZA 4FHZA 1F6WA 3O4JA 5K3FB 3D4LA 1DWQA 2IIVA 2OCIA 2WHRA 1QMDA 1TQHA 4OUKX 3WA7A 4U2EA 1UK8A 1IUNA 4J0JA 5AKLA 2JGFA 4M0EA 2G4LA 3TRDA 1WOMA 5FPQA 4H7HA 1WPXA 3V1NA 4LYEA 4MYSA 3QVMA 2QUBA 3PF9A 3G0CA 2WFLB 2Y6UA 5ALDA 5HCUA 2OPHA 2ZYHA 5LYYA 3DEAA 2CZQA 1NU8A 1XLVA 2O2HA 4PW0A 3AILA 1E5TA 3WWEA 1XRPA 1ORWA 2I3DA 4KE7A 4Y2YA 2VF2A 2XQKA 3IUQA 1XZEA 3OURA 3AIOA 5F4ZA 1H23A 2DHDA 1W52X 4DNPA 1QO9A 2FJ0A 2VTVA 2JEZA 1MNQA 1JFRA 2VT7A 4HRXA 3DOIA 4BBZA 3I6ZA 4K5QA 1BCRA 4Y2SA 4OB8A 1CUCA 1CFJA 3D2BA 1R4ZA 2XUOA 5C81A 1CUYA 2HA6A 2JGLA 4DSZA 4DMFA 2JGMA 2HDWA 2EEPA 3FLBA 1JKMA 2WY6A 1YB7A 1VXRA 1R9NA 3A2NA 4Q34A 2QXTA 1U4NA 1ACLA 4DM7A 3W06A 1YS1X 5T4EA 3FG4A 1P0IA 3AIKA 5CH5A 5LZ5A 4N8DA 2B9VA 4DNQA 1Q83A 4GXNA 4B7ZA 3C5WP 4UFPA 1DT3A 4H7EA 2PSJA 2WFMA 2XMQA 5C8ZA 1UOPA 5HKAA 4Q82A 4MWSA 4RNCA 2ZJ6A 2XUIA 4UHBA 5AIBA 1GPLA 3BNDA 2R8BA 3HC7A 4HTAA 3LP5A 2BGRA 1W1IA 2OCGA 4BVKA 3DL4A 4H7IA 1USWA 2QJWA 2FNQA 4JUIA 1AC5A 4UFOA 4WHAA 2WFZA 4Q05A 2WIGA 3OG9A 4U2GA 2WUDA 1EXWA 1AKNA 4C89A 1G5FA 3G0GA 5EHZA 1QIHA 3CCBA 3FYUC 5ALTA 4G4GA 4MXDA 3JYHA 5T4FA 3IURA 3W2TA 4F5ZA 1UFOA 4C01A 2H7XA 2V96A 1GT6A 4ZRDA 1ETHA 1ZI6A 5JALA 5LKRA 5AHXA 5JYCA 4H7FA 4ZV7A 3TJMA 1ZD5A 2WM2A 2WXUA 2WSLA 5ALQA 4GW3A 4PO3X 1QZ3A 2V9ZA 3STUA 3AFIA 2HA4A 3WKBA 4XVCA 1XKTA 2I78A 3PDCA 1EDDA 2AJ8A 1R1DA 4OCZA 5E4YA 3PUHA 1FJ2A 4DMHA 1VA4A 2WHPA 4X91A 5K3BA 3H2GA 3WIOA 3QZUA 4PSDA 2W22A 2RIPA 4EA6A 4Q3OA 5DNVA 2W6CX 1XZCA 4XIIA 1N5RA 1XZMA 2VJCA 2XI4A 2GYWA 3U0VA 4KYVA 5LIPA 3I2IA 1OCEA 4J0GA 2PSFA 5IKXA 2Q0XA 2XMZA 3WK5A 3GBSA 2P8SA 1A88A 4J7AA 1QGED 1QIFA 2G5PA 2GZRA 1XZAA 2P0MA 3ZI7A 4I19A 1R3DA 3GA7A 5CH3A 4I3FA 3PF8A 4IH4A 5JAHA 2IX9A 5CT6A 2IITA 1ZGBA 4EY8A 3AJAA 1CQWA 1MX1A 3GROA 5AI0A 1MNAA 1JU4A 3HLKA 4PNZA 2WLSA 4PSUA 3ZLTA 2HA3A 5EHQA 5JATA 3K2IA 2ZJFA 3H2IA 4X92A 5AM4A 1VLQA 1C4XA 5IVIA 5JASA 3M3DA 1AURA 4EBBA 1FGQA 1AX9A 1UXOA 4NVRA 5JAUA 3EIOA 4EY7A 4JNCA 3OC0A 1BROA 1DQYA 1G42A 1RRLA 3V9AA 1N5MA 4CFSA 1DU4A 2Y1KA 2VEOA 4FLMA 3MUOA 1BEEA 5FUMA 1K63A 1XZDA 3O4HA 5AOBA 1QIJA 4X71A 4P92A 2Y6VA 5EHXA 2O7RA 1CLEA 4ETWA 3DQZA 4W1QA 1WB5A 3WZLA 5ALYA 3L1JA 4RE5A 5ALXA 5AJHA 2WHQA 2WIKA 4AO6A 2ORYA 3W9UA 4XJVA 4CI9A 5HK9A 1NO3A 1CRLA 2VAXA 1TCAA 5LLSA 5ALRA 2Z8XA 2HA0A 3BL8A 1F0NA 1TK3A 5ALIA 1TRHA 2QJRA 2RI6A 3FG1A 1OXMA 3F97A 5ALOA 1HPLA 1UT6A 3G7NA 1JI3A 3H04A 3WA6A 3C6BA 3EQ9A 4OB7A 2OGTA 5AKEA 4HAIA 4BC1A 3IVMA 1XRLA 3F96A 4BE4A 5LKAA 4HRYA 3STVA 5C8VA 2RHTA 2QS9A 3P2MA 3YASA 1RRHA 4QLOA 2HFKA 4YPVA 1KHOA 3FLAA 1D07A 1ZD4A 2WUEA 1QO7A 3A2LA 1QONA 2WHPB 3WMRA 3AZQA 1R50A 1YCDA 1EINA 1XQYA 2J3DA 4FMPA 4GI1A 4P9NA 2B4KA 3QBJA 1O6GA 4K6HA 2CUTA 1CUEA 1YA8A 4DMKA 4N8SA 5I9IA 1CUDA 4B9EA 4M0FA 1ZJ4A 4GLBA 3A2MA 2FJPA 1H2ZA 4MQMA 5FP0A 5I7UA 4ZGBA 1E8NA 1RWQA 3N0TA 2VA9A 5AKGA 3M81A 5KWJA 4UFNA 4HZGA 3VISA 4BCCA 2CJPA 3DD5A 1CUBA 5EIHA 5K3EA 4GEGA 4EY6A 4GWLA 3G8YA 1EK1A 4CCYA 3GUUA 5EEOA 2J3QA 1MX9A 3WI7A 2HIHA 5JANA 3C70A 1UK9A 5IH7A 1GPKA 5JAOA 1JNQA 4GECA 4X95A 4BATA 1EI9A 3I2JA 5DWDA 5DNWA 3LLCA 4J03A 5EI5A 2B61A 1MAAA 1XRNA 5K3DA 3OTQA 4DNFA 2GBFA 3F8SA 5CT4A 3BF8A 4ZWNA 5E4JA 1CV2A 1X2BA 3D59A 4Y2QA 5BV7A 2PM8A 4FKBA 2G63A 1LBTA 3G9UA 3WYNA 3C5VA 1SCKA 4KE6A 3RARA 1YB6A 4K6KA 5LZ7A 5A71A 3HABA 4BYMA 3CN9A 3BJMA 5J3JA 4UHCA 2BFNA 3K6KA 3D7RA 4B82A 5EIAA 5ALEA 1JMKC 5I8PA 3K9BA 1A8QA 5A7GA 5ALNA 1BS9A 3HJUA 3WQHA 2HA2A 3F9CA 2IUJA 5LP1A 1FGOA 1ZD3A 2O2GA 3H2JA 5ALGA 4K2AA 3ILSA 1UK6A 1IVYA 4BCBA 2J4CA 1K6EA 4BAUA 1W76A 1QOZA 4NZZA 1EK2A 2XE4A 3CN7A 4W1PA 2Y2VA 5KWIA 3AUKA 4DMCA 4BTLA 3E0XA 2IUKA 2PSHA 3D5EA 3VDXA 1LPAB 3WJ1A 3JWEA 4X93A 5BOVA 2V98A 3WL7A 1WPRA 3CWZB 5C7YA 5HF5A 2HL6A 5T4BA 3W05A 3C6XA 2GYVA 4H7JA 4G4IA 5LZ8A 1YS2X 2EDAA 2J4FA 3V1LA 1BCSA 1HQDA 3X3HA 1ZI8A 3WKEA 1XRMA 5AIAA 4D9JA 5JZSA 1PV1A 2PUHA 4QNNA 4FLEA 2DFPA 5AI4A 4Q3LA 1TAHA 2YYSA 4LXGA 4B80A 4OD0A 4KE8A 1Y7HA 1QIDA 5AM3A 5AKIA 4B83A 1AZWA 3ESBA 2JF0A 2BUCA 3C45A 1H2XA 4CCYB 4CG3A 4WFJA 5HQ3B 3R3ZA 2OLEA 3G9TA 3FCXA 3GZJA 5AO9A 3H1AA 3V1MA 4WCVA 2XLBA 3FOBA 4E46A 3T52A 1QTRA 4JYMA 3ESCA 3FYTA 2WKWA 3UMJA 3I2KA 4FNMA 4OPMA 4Y2RA 2E3JA 2X5XA 3I1YA 1FFBA 2ONCA 3FYUA 2QRUA 1VXOA 1LGYA 2VJDA 3C43A 2RGUA 1ZICA 1GGVA 4E15A 1N1MA 3PFCA 4L72A 4UPDA 5AK3A 2GZSA 2G5TA 4OSEA 5CMLA 1GKLA 4WFKA 2C0QA 5K5EA 1QIEA 2H9YA 2XDWA 3QMVA 1MN6A 1CR6A 1R9MA 4QDOA 4QE3A 1RYYA 2BAGA 2GBCA 4KAJA 3F98A 4G5XA 4DGQA 5C8XA 5JD4A 4WFIA 2XQJA 4Z49A 2QKYA 5IVKA 5AKXA 1ORVA 3STWA 1DWOA 2WQZA 4BC0A 4EUSA 1OLPA 3UUEA 1XLWA 4DNOA 3O0DA 4AXBA 4UBLA 3C6ZA 1XZJA 1CUSA 2FUKA 2ZYIA 3DS8A 1IZ7A 4C88A 2Z3ZA 2WIFA 2HFJA 1VOTA 3I2HA 2VT6A 4QDUA 3ESAA 3AZPA 4KR0A 5JAPA 3H0CA 3DLTA 4TVKA 5LZ9A 3H19A 4B85A 5IVDA 3L1HA 3V48A 1THTA 3VVMA 4O08A 5DJ5A 4B81A 1ROVA 3H2KA 1E66A 5D3ZA 3R40A 4WFOA 3V1KA 5ALVA 4U2DA 1JJBA 1K5PA 4DSAA 5KREA 1A8SA 1EX9A 4BVLA 5CRIA 2PX6A 5CW2A 3IUMA 3OPMA 4Y2XA 3ZV7A 4X97A 1SCQA 4AZ0A 3HYSA 4DLNA 3W9BA 4EZIA 4XWGA 3NGMA 1Z68A 2WILA 3S2ZA 3ZWQA 1THGA 3R41A 4FOLA 3WL8A 5H3HA 2BKLA 4FDMA 1O6FA 2V97A 3MUNA 1YSCA 4V2IA 1B6GA 4AMZA 2UZ0A 3FSGA 1E3QA 4J3JA 3RK4A 3G02A 3VJLA 1XZFA 1LPPA 4MJ3A 3VXKA 1LBSA 2RAUA 4B9AA 1VJ5A 3O4IA 4BVJA 3EF3A 4G8DA 3A70A 2O7VA 2AXEA 4CG2A 2HHAA 2HU8A 2ZYRA 5KBYA 1LPNA 3Q8WA 4BDTA 4OU4A 4U2FA 4B0PA 4N5IX 4UBKA 3WYDA 1UOQA 1GZ7A 3IUJA 4X7BA 3FYUB 2BUAA 3DYVA 3I6YA 4UHDA 4X6XA 1A7UA 4EY5A 1XQWA 4WDQA 4KRYA 2CB9A 3FBWA 2QZPA 4Y9SA 3R3YA 2CEKA 2WTMA 4C6HA 1CUHA 4HVTA 4NS4A 4L9AA 1T2NA 1UKBA 4ROTA 4AQDA 4JYPA 3IULA 3BNEA 4UBJA 5A2GA 1IK3A 3FLEA 3HZOA 4OYYA 4ITVA 1YR2A 2VSQA 3STXA 5AI5A 4GHWA 2RHWA 1K8QA 4U2BA 2HRRA 4P08A 2I03A 3BF7A 3PE6A 1CVLA 1CUWA 4QLAA 1JJIA 5AKKA 2ZSIA 4BAZA 4UBNA 4CCWA 3JW8A 5HFAA 1QTIA 2WJ6A 1MTZA 2C5FA 1LNHA 1J06A 5A6VA 5CXUA 4EHBA 4Q1VA 4G9EA 4Y2VA 1LLFA 3WWPA 4YX9A 5AH0A 3CCCA 2DSNA 5JD6A 1P0MA 3DCNA 4MYDA 4FLFA 2HA7A 4AZ3A 4FBLA 3R3XA 4G1FA 2WG0A 3ZLUA 4BB0A 1QE3A 4A16A 2VATA 2ZVDA 3BDIA 3QH4A 3KOOA 3QPAA 3ICVA 3LIIA 4MQLA 5HKBA 2PSDA 5ALWA 4AN1A 1BEZA 1C7JA 2VAVA 4PQEA 3R3WA 4X90A 5FOQA 3O8YA 3H2HA 4CG1A 1TCBA 2XMRA 3WIBA 5LZ2A 4C4XA 2CBGA 4I4CA 4KAFA 1E8DA 1CUIA 4WY5A 2PU7A 1Y7IA 3M83A 3O95A 4HXEB 3FG3A 3B12A 1FGMA 1JT2A 1Y4KA 5JARA 5IVHA 1UOOA 4N5HX 3SX4A 3PICA 4H18A 1BRTA 2PKYX 4J0CA 3ANSA 3UUFA 5AI8A 5CT8A 1A8UA 1NU6A 4NREA 2JGIA 1ODCA 3G9XA 1J2EA 1IZ8A 4AB1A 2XUQA 1XFDA 3W04A 3FAKA 1YASA 2WJ3A 2OQVA 2XUDA 4KACA 4JH0A 5HFNA 4QWTA 2Z8ZA 2XUPA 3HI4A 3FNBA 3G0BA 2HU7A 1LPOA 1XZIA 2GBGA 5ALSA 1CUJA 3R0VA 1PFQA 4EB0A 1RP1A 4U2CA 5DYYA 5AK4A 4BTVA 3OM8A 4UBMA 2XT0A 1DWPA 1H2WA 2OGSA 1ZD2P 1CUFA 5HQ3A 4J0KA 4WDRA 1CUZA 4KE9A 3D2AA 4A23A 3HEAA 3VJKA 1N8QA 4DTCA 4NMWA 1FFCA 1MT3A 3DL7A 2XUHA 1R88A 2WU3A 2O2IA 3DOHA 1QFMA 1H22A 3ESDA 1EH5A 4JEIA 1CEXA 3H17A 2PU5A 4BRZA 1FGTA 4IQ4A 1QIKA 2DHEA 2BJHA 1AUOA 4A5SA 4F0JA 2XUFA 3PFBA 1L7RA 4LKOA 3D0KA 2XUKA 4FBMA 5AM0A 3G0IA 3FVRA 1HLGA 1L7AA 1LZKA 3BIXA 2XQIA 3WJ2A 3WKAA 2WIDA 3B3QA 5JZ9A 1AQLA 1DTEA 2DHCA 5CH8A 2AJLI 1EB9A 3ICWA 3QMWA 4UHFA 1Q0RA 2HRQA 4TPKA 4WJLA 1CUVA 2XMCA 2XQFA 5CTAA 3ANTA 5HF6A 3EBLA 3DKKA 5JZBA 5DLPA 4GBGA 4B6GA 5ALZA 1XZHA 3BXPA 2I3ZA 5CBKA 1LOXA 2QT9A 5DTJA 4OB6A 5JADA 4GDMA 4C4YA 4CIBA 5E4TA 4E11A 1HU9A 2QMQA 3D2CA 2WUFA 4UHHA 3V99A 1GPNA 3SK0A 3L1IA 1SFRA 2OCLA 3WKCA 2XMBA 1XZBA 1K4YA 5FRDA 2WJ4A 5AM1A 4Y2UA 3E4DA 1I6WA 4QEKA 1DINA 3VJMA 5A62A 3PUIA 3IUNA 1T4MA 5DNUA 1BU8A 5D7BA 2NW6A 1ZIYA 2XMDA 2C4HA 1F8NA 1ISPA 3WZMA 1XROA 1SOMA 2VQ6A 4QDTA 4W1RA 5HZGA 5HF8A 2WXTA 1N8SA 2JEYA 3IIIA 4BP8A 2QTBA 3R3UA 1MO2A 1YA4A 3C87A 1FSSA 4W9RA 3EQ7A 2X76A 1WB4A 5SYNA 4BDSA 5ALPA 3I2GA 2XUGA 1JJFA 2XLCA 1B41A 5ALJA 2QR5A 1TCCA 5AK5A 1WCYA 1WHTA 1XQXA 1C7IA 1H2YA 4BAGA 1FGRA 4F21A 1BE0A 3VVLA 5DTIA 2QM0A 1U65A 3BDVA 5E2IA 3DYIA 1FFDA 3FWHA 3WK9A 2PSEA 3WL5A 1QIGA 4W1SA 1VA5A 2HA5A
chains in the Genus database with same CATH superfamily
3N86A 2EX0A 4XVQA 4URYR 3V7NA 4A6DA 2JNWA 2J07A 3STYA 1KU6A 1M76A 4LN1A 1FA9A 2W8BA 1PZGA 4CV1A 2J9YB 2IYPA 4NBUA 1MU0A 3HKDB 1NLMA 1NQXA 1YC5A 1AHHA 1CPYA 1T2DA 1XTJA 3KR9A 2FX5A 2B8TA 1G63A 1GLVA 1P77A 5KQSA 1W9HA 4CN9A 1IOWA 1VBKA 1OC2A 2C61A 4QL3A 4ARSA 2O54A 5JWOA 4V3BA 3Q7QA 5GM1A 4H4CA 4IL5A 5BNIA 5I45A 4TYQA 1KY5A 2M6RA 1JG4A 2C7BA 3D4BA 3LPAA 1LEHA 5FJIA 3RUFA 1GPWB 3X1JA 4AKHA 3NDPA 3WTCA 4UHEA 4U1RA 2NTNA 4ZGGA 1OFUA 2O8FA 4BECA 3GFFA 5AUOB 1YQDA 4QA9A 4IIFA 3MAAC 2BGLA 3FUCA 1H9CA 2Q29A 4RZUA 3IB3A 4YALA 4COOA 1TEHA 3UBTA 1BWSA 4Z8YA 3K0HA 1VMEA 1P4GA 5ESRA 4Q3KA 5P21A 5NULA 1PT7A 1QKJA 1V4NA 3FBTA 1AG9A 1BVRA 4GZ3A 4EG8A 1W0CA 3QI7A 4X94A 1WMBA 1FYFA 1LBEA 3L8FA 3ROKA 1MW9X 3C8DA 3EGIA 1PGNA 3LDGA 1JSCA 4AP9A 2OHOA 5HXAA 5JSHA 4FFDA 3A1EA 1PVDA 1P81A 4BIIA 3NRJA 5C7OO 3HCWA 4ND8A 4F3YA 1S8OA 3I62A 4ZXFA 4R2HA 3I0NA 3RC3A 4E5KA 1P9WA 5ICMA 2PLWA 3F4KA 2VPPA 2WIBA 3TJRA 5T8KC 2QL6A 2OKGA 1IQ0A 3F5DA 4PC2A 3IT1A 3GGCA 3HZZA 2C2OA 3CPEA 5FUXA 1WOYA 5DGIA 2RBKA 5AP9A 1Q3KA 5E6SB 2DR0A 1S0UA 3LKVA 1QE5A 2Z2IA 5EKTA 2X6TA 1AMNA 4DQXA 3QQ5A 4LCJA 5FV7A 3AG6A 2AOXA 3L7MA 3MCUA 5B5SA 1ADBA 3IJPA 2DQKA 3OOSA 1AD2A 2QXUA 3PQFA 1M1ZA 3AWIA 5GV8A 5KVCA 1WX1A 3BICA 2QTHA 2GZHA 3E3AA 3KWJA 5BW5A 5C9ZA 1N0HA 1PJCA 1ZRSA 3ZDXB 5AHOA 4L85A 5UKDA 4M60A 3PNBA 4EEXA 3DOUA 2BMVA 3E27A 3IBTA 5KYTA 1M6HA 1XLTA 2HZ7A 4CPDA 3EF1A 4F4DA 2LCQA 2DLCX 2P75A 3I73A 1GNSA 2BGKA 3V92A 3E2MA 5A7HA 4MW4A 4GLLA 3Q0IA 1Q2XA 1KAMA 3R6DA 5CIWA 3SLKA 3RASA 1JFFB 2P68A 1KMNA 4J7XA 4LZZA 1OKKD 4YRFA 4DAEA 1XMJA 3ZBPA 1JXMA 2I4IA 3I9KA 3G0OA 1A2KC 3N8DA 4MV1A 4TT3D 5JTUA 1BXRA 4BJ1A 1SK9A 1UIMA 3ED1A 1ZR2A 1Y37A 5FPYA 5JU6A 4J16C 1G21E 3TGLA 3KX2A 4DDUA 5BQ3A 5LC1A 4KR3A 4FQ8A 1JN0A 1PDOA 3MWLA 4BX0A 1ZGCA 4LIPD 4EARA 2BCEA 3LHFA 2ANBA 3BREA 1NURA 2J5RA 1XTTA 3GJ3A 2I1WA 1CY4A 1I4DD 1UBEA 4M0MA 3RS9A 3I5MA 4C1NA 7AT1A 3NP9A 4RELA 3A10A 5JXWA 1P2GA 2XXJA 4ID9A 3KKMA 1L7QA 3WQSB 1MX5A 1TUBB 2BM1A 1RPJA 1ZW6A 3TW6A 4CMJA 1FOEB 3ZLVA 4URZR 1MRZA 1EHYA 1PYGA 2Z9DA 4YXWD 3PPVA 4D3XA 3NWOA 3L4SO 5CTJA 5BPFA 3I72A 3EZYA 1MB3A 4D02A 3L93A 4RTSA 3I28A 3E2PA 2LIVA 3O2NA 3RHZA 1DIAA 3BCUA 3E1GA 3RG8A 3PRYA 4O4HA 4L8VA 5JEDA 3SWWA 2X8BA 4E5MA 1D5WA 1LPMA 3ZTYA 3LWDA 1YZYA 1JEQB 1ZMXA 3BWXA 3CINA 3FMFA 3SJUA 4BEWA 4G0WA 1JMYA 5BWCA 2Y68A 3WQQA 5HK8A 2CFCA 2CMGA 1UKCA 4JOSA 5BP7A 1XTUA 1LPBB 3JYNA 1W5TA 5EJAA 3KD3A 2BDUA 3M1LA 4B3BA 3R9XA 2NV0A 1R4AA 1WHSA 2J41A 3T1VA 2PUGA 2JAHA 2ZAGA 2GF9A 2YVLA 4MW7A 3VSCA 2ZJ4A 1Z63A 3T1HB 3QKUA 5CK4A 5ECYA 2PZMA 4AG5A 3QPDA 3I2FA 4IP0A 3RBAA 1EZZA 3K0AB 1T6NA 3BGIA 5EJ4A 2X0RA 4JOCA 1W36C 4MINA 1TEVA 3KB8A 2GEJA 4B3HA 1G3UA 3CNOA 2HNBA 4A2WA 3A4LA 5A4IS 1KTIA 1WZUA 2ZXEA 2CK3A 4YMTA 2CVHA 2QVZX 4KXYA 5K0NA 3OT1A 3R6GA 1N6RA 5K6TA 2FWMX 4WA8A 5CVVA 2VK4A 4D79A 4JN6B 3OEYA 2TECE 3EC1A 2GDZA 4I55A 3V8BA 2LRGA 5HIKA 3H11A 2HJWA 1CUAA 1G4HA 1NYRA 1UDWA 2PUJA 3IHKA 5ALKA 3UGKA 2H8KA 3VUEA 1GNQA 3ZXXA 2JJQA 2NX2A 4KQMA 2RGRA 2VDJA 2ZRCA 2D3TA 2GN9A 3VDQA 4H0CA 3CNQS 3O9MA 3WRYA 4W63A 4RGVA 2EW8A 4EAAA 3WNQA 2EC5A 3S29A 1GAQA 3CR7A 2PX0A 3DXZA 1DT5A 1XLUA 1E7QA 4ZC8A 4B84A 3B7PA 4KQWA 4JUCA 3FKQA 4M8NE 3OOHA 4OQDA 4H31A 2JRLA 2FPXA 4WAUA 2E55A 1KH3A 2QMYA 3HJNA 2VJBA 2EGHA 3L1KA 1WCXA 5YASA 3VHXA 2ZUEA 4QJ3A 3T7CA 4TXJA 4Q9JA 3W5SA 4EELA 3GP8A 3BWDD 4UQPA 2ZZKA 4B74A 1K1EA 1K2WA 2OZLB 4P5DA 5F52A 3NYWA 1ZK0A 5G0SA 1AK9A 2Z57A 1DKOA 3TCKA 1S3SA 2GM5A 2YJTD 3CB2A 3GX1A 3PBKA 4LOJA 3LYHA 2Y1EA 2J3JA 3TZ6A 5FI3A 1FC0A 3BAZA 5EXPA 3ZHCA 4BVGA 1DADA 1RLUA 4UUOA 1RPNA 5IYZF 3VSDA 3PUYA 2ZIAA 3BK7A 3DUWA 3L0DA 3N2IA 4PRYA 4Z5XA 1NKSA 4J1TC 4PXYA 4EI2A 2CJWB 2W2PA 4JQYA 4KWCA 4MDYA 5EIXA 1KI9A 1XJ0A 2EBHX 4O4IF 4UU7A 2J0EA 4GYYA 3FWKA 4XYMA 1KRHA 4IXDA 3SR3A 3F71A 3CUVA 1HG0A 3DAGA 3E23A 1T9DA 2FEAA 4KOAA 1JR3D 2DP4E 2ECFA 1TPYA 2FZCA 2X1VA 3MOIA 1U3UA 4RV9A 5FDFA 1U1CA 2HU5A 3KDAA 1NQVA 1PJTA 2GERA 2QUHA 5EESA 2WTNA 1JX6A 2C0CA 3WOHA 2DBZA 3RRBA 2GBLC 1XZKA 3JQBA 5E1DA 4EYEA 3KQNA 1JEYB 3RFUA 5EY5B 5CAEB 3JVDA 2Z5GA 4PZUA 4RWZA 3T0GA 3Q7IA 2H2HA 3RVJA 4H7DA 3ZU3A 3WAGA 1EM8B 4GSYA 5D84A 2IKSA 2VDLB 3OBBA 1H66A 3THWA 3L8GA 1Z88A 3N3BC 4UUPA 1DQPA 3TVDA 2C04A 2K7ZA 3EXFA 4DT1A 4X6YA 1V4BA 4TV8F 2HX1A 1FDRA 1E3TA 1B15A 3JQ8A 4Q1DA 4EUEA 5A4FS 2HF2A 4NNOA 3AP1A 4PEVA 5A3RA 3T3HA 1AQNA 4S0XA 2OESA 3EDQA 1LUAA 1ICIA 4UHJA 2P65A 2LWIA 3N2NA 1JKIA 1DE0A 2V4MA 5EL0A 4BP9A 4DYHA 1PS9A 2O8CB 4AJLA 1ZNYA 2BR3A 1XVUA 3LF1A 4HC4A 1MG0A 4HF7A 4K9LA 1Z5PA 3BB1A 4MPDA 1YZFA 5FOXA 1P44A 3JQDA 5TSDA 1QH9A 1N7HA 4M0KA 1NDHA 3OMWA 4YASA 3TSAA 2VTBB 4WFQA 3ZE2B 2HY7A 4EMBA 4XB1A 5FOTA 3GAFA 4LF6B 2ZJ1A 3T7DA 3IAS1 3EEBA 5FB3A 3ESYA 3Q3HA 3T4UA 3K35A 5E9WA 1XCOA 1ZUWA 4FEEA 3IPXA 3QVGA 1QXSA 3L0PA 3AQ4A 4FFNA 2BI8A 3WO1A 5HIMA 1IWBB 2ECQA 1OFVA 3O7MA 4HH1A 1CT9A 2CFOA 1GLNA 3QPCA 5KHAA 4BX8A 5JCOC 2IODA 1ZS9A 1VE6A 3U37A 1UIRA 3KV1A 3H0KA 3SEFA 4I50F 2VT2A 2E6KA 2IA5A 1J9ZA 2ODQA 3ENVA 3DKPA 4QX6A 3SZUA 3IR6A 3IHLA 4BO6A 1NQAO 4BNUA 4F3CA 1FBNA 4LDPA 3TIFA 2F59A 3TPCA 5B1SA 4NJMB 2I99A 2W83A 4A3SA 2DCMA 2FTKE 4L73A 1Z08A 1PKEA 1QANA 2VSXA 3ZE7A 3V2UA 2Q21A 1DWUA 2J7PD 2NXEA 1N6OA 3LVRE 4MYCA 1EP2B 5DLEA 1OLXB 3T7KA 1UFVA 3UHOA 1GQSA 2YDXA 5I7SA 3FUVA 2CHFA 4A7PA 3ZZUA 2XX3A 3DB1A 3KJHA 1LNSA 3L8YA 2V7GA 4HGYA 2Q7DA 2X9VA 4I14A 3S68A 3GFBA 3N3AC 3K8ZA 3A9SA 3IO3A 2VQEB 2W6OA 1F1JA 2MYPA 4X00A 5K8LA 3VAAA 1E3SA 1E89A 1EFPA 3FY4A 4JUDX 4AKGA 1JU3A 2Q1WA 4FC6A 3ITKA 2OB2A 2VDWA 1W5SA 1CSEE 1GXSA 4DEXA 5K9ZA 1G55A 2OG1A 1O4VA 4Q7LA 4XXHA 2XEDA 3DT6A 4JLKA 2CUKA 3MZ0A 5MGNA 5CK5A 2P9QA 3ZR4B 5CDYA 4D0SA 5EIWA 1W1UA 1OE0A 5B4VA 4JGBA 1KDTA 2K2QB 3LIPA 5AK6A 2FGJA 1H8EA 4OUDB 3FUTA 5LFAA 1WJGA 4M1KA 5I8WA 2W58A 3QG5A 4RPCA 4HEA1 3S2EA 1MIOB 1U2SA 1YS6A 4MCAA 2R1TA 4R8RA 1EUZA 1HFWA 1DUIA 3QLJA 2I33A 1EWYA 3I4LA 1JQJC 4OH1A 3HFJA 3U2QA 1RAIA 3TSCA 4LHYA 3TTWA 1OASA 1ISSA 4XQ0A 1BGVA 3NX4A 3ZD8A 1JQ3A 1RWMA 1SBYA 1SZJG 1BX1A 1T36B 1ECJA 2Y93A 1PZXA 5EVCA 4IIEA 2XMSA 3WX0A 4IJ6A 4P4SA 1FQOA 2B9EA 4UBIA 5ERYA 3HRKA 2ZCUA 3BXEA 1IZYA 4KQHA 4EOGA 2FQ1A 2IZ6A 3CG4A 1JWLA 3HWX1 1JAXA 3IOCA 5KOJB 5TQ2B 4IIJB 1HTWA 4D4LA 1X13A 5K6AC 3ER6A 3FDXA 3JVVA 4YGYA 1FTYA 4IPTA 4NARA 2NN3C 2QTAA 4HFMA 1QPGA 2FR0A 4F97A 2RK4A 5GONF 1Z2PX 1U9IC 4PZAA 1WZIA 1YV9A 2A2ZA 3GFGA 2P3OA 5KUTA 5F35A 4LW8A 4W9MC 1WSWA 3A9RA 2J0SA 1V48A 5EKXA 1CE8B 2QQFA 2NXCA 2FZGA 1WLYA 2OK8A 1OYWA 1Z0FA 2JIDA 1Y7TA 1E1YA 5AI9A 5CFPA 1TOAA 2OO7A 1ZIDA 3ZEIA 5BWMA 5HR5A 1OXUA 4KGZA 4NCBA 4JMPA 4HFNA 2JATA 1KK3A 3BH0A 2HI0A 3IAEA 4WN9B 5B1DA 1N0IA 1UEIA 2OCBA 2Z1MA 3QOYA 5FWYB 5G2OA 3WJAA 3ZY2A 4EVQA 1DXHA 2I5PO 1YJQA 3BHMA 3W06A 3QVKA 5LYJB 2ZYVX 3QFHA 2B36A 3ABIA 3OZVA 4LJLA 4PO1A 2GEFA 2VZEA 4EAQA 5TRTA 5JDIA 1XU9A 1E59A 2W00A 2OQIA 4BWGA 3KUXA 2DPHA 1IDOA 1OI3A 1QFSA 4OH7A 4MKHA 3ORQA 1MJNA 3A7EA 4GRIA 4X8MA 1QKIA 2BT4A 2A7XA 2QX8A 1TAUA 2WWGA 2RGNA 5FKJA 3OKAA 1I8TA 2PD4A 3LY8A 4MLCA 4DQDA 1C0EA 2EX1A 5F98A 4GKKB 4XCQA 1WQ3A 1NVGA 3K30A 3N87A 2I2XB 4AJ9A 5A02A 1VIMA 1RXSA 3GZNA 1UM9A 3ASUA 3IKJA 4R5HA 1P2BA 2PSSA 1VL1A 3R0XA 5FO0A 4JWTA 4C43A 2R1UA 3GGPA 3RU3A 2IUUA 2AJCA 2R1VB 4HYYA 4G81A 1FU4A 3UFXA 2HM7A 1MQAA 1NI4A 1JG6A 1M2KA 4LHEA 4ISBA 1M8GA 5JCOA 3NEJA 4ZK6A 5EINA 3R7BA 2Z3VA 1BTOA 1ORRA 3ACCA 3ORHA 4HQKA 1OXBB 1O95D 3LS2A 4PPGA 3NBUA 5CX1A 5DTMA 5DYWA 2JFZA 1RAAA 4OU5A 1LFDB 1MA0A 1Y9AA 2GBIA 2HIAA 4PX9A 4LVCA 2J32A 5IXYA 2XUJA 1LWNA 3I58A 4WUTA 3WTBA 4XX1A 2QQ5A 3TOXA 3I8OA 1EFAA 4HY3A 3URMA 3O21A 3OIGA 2FSHA 1PR9A 1FDSA 3GF4A 2H7VA 2MINA 2ZQZA 1R5BA 3GRZA 3OZEA 1G16A 1MTOA 4P93A 2LE0A 3DBRA 1HQYE 3TZKA 2GVNA 3I52A 3A1TA 3K96A 4BRSA 3TOVA 2AX3A 3D8UA 4C07A 3T5TA 4LOLA 2BM9A 5J40A 1KFKB 4CZ2A 4DHWA 1G6OA 1U3DA 4K03A 1ZOPA 3I64A 1VL5A 1ABFA 2VYNA 3EG9A 3HO6A 3OJCA 1C3OB 3MNFA 5BSVA 3KLPX 3DT9A 2ZRLA 1Z6QA 1E5DA 5AJYA 1YRYE 3ZCSA 3VU3A 3ESQA 3HKBA 3P9KA 4IFBA 4MTLA 5FLKA 1U8CB 4K9KA 4PSCA 5HPYB 3I4FA 4RCZA 4FGZA 4GPD1 4DC1A 4UZEA 1YDWA 3MB8A 3QIVA 4ER5A 1B8PA 1DHRA 1YZTA 2ENWA 2ACEA 1O96B 4KWHA 5C5IA 4ZOBA 8ATCA 5EWMB 3HXKA 2Q1TA 2ZI3A 3C1TA 3SYTA 1H65A 2XB6A 4PZLA 1PW7A 2E21A 3CRMA 4X7MA 5J2TF 3R5JA 5ELLA 1W75A 3VSEA 3RE1A 4E5DA 1BQ4A 1KP9A 2IYQA 4JR1A 5FLYA 1GTMA 3RPEA 4I6JA 3CUYA 1N2BA 1EVQA 5JO9A 3H5AA 1MJHA 3ZDEA 1IL0A 3S3TA 1G8KA 3ELYA 3TFQA 4PLVA 1HDOA 2IJGX 3GR6A 1AY0A 3O4JA 2C9DA 2X0IA 3D4LA 3Q2IA 4W4TA 1FPMA 2WMDA 3OCXA 1CG6A 4IVRA 2WHRA 2YX1A 1TQHA 3MQ4A 3THXA 1IHPA 3MW8A 3A25A 2YRWA 2QLNA 4PHGA 4CM6A 1VYTA 3MJSA 4JENA 3TXAA 3BE6A 3F7TA 4R7ZA 2BKAA 2FFRA 1VPWA 4J2HA 4M0EA 1FJHA 4DCSA 2BRUC 3AEQA 3VI4B 3BD8A 2IIQA 1KTVA 3QWAA 4FYJA 3SBDA 1G18A 1CETA 2BFCB 2OG2A 3KYDA 5B7QA 1SUBA 2DVMA 1KJQA 2Z08A 2PWBA 3IPRA 3JZMA 3U7QB 4EYOA 1Z0JA 4BQEA 3ANMA 1WPXA 2R6AA 4YUVA 5LP6F 4R2MA 3H99A 1G5QA 3LAWA 3V1NA 4MYSA 1KOGA 4F8YA 1JIXA 1RSZA 2QD5A 4C05A 2WMYA 3BHNA 3QJGA 5AW8A 2QUBA 1Y6ZA 3EUWA 2WSIA 3EVZA 2OXIA 3D5TA 4CEJA 3AUSA 1WABA 3SI7A 2FEOA 2PJZA 3G0CA 1MB2A 5IAEA 2FMKA 2XBLA 3EUAA 1OLSA 3ZJUA 1CXZA 1W85B 3P96A 4GD3Q 1QH8A 4IW3B 5ALDA 1ID1A 3GEEA 1F3LA 3MGCA 3O90A 4F9EA 1QFZA 2WKRA 4IDQA 2OV6A 4HN4B 1M34A 2CZQA 3SC2B 2C07A 2GARA 1XLVA 3ANLA 3FPCA 2O2HA 4PW0A 5H9VA 3AETB 1Z47A 3W2HA 2PGAA 4MOWA 3FB1A 5I7OA 1T5TA 1XPUA 1C1XA 2YS6A 2FK7A 1NQTA 2QA5A 1XRPA 5C34B 5T8KA 4YJGA 3ZU6A 2I3DA 4NZPA 4OK3A 5JQGB 4L4SA 4JELA 5AWFC 4ZQGA 4EB3A 4IOKA 1RZVA 2ZWVA 4G01B 4DMUB 1RDFA 4P80A 1M67A 2E1PA 2VF2A 2Q3CA 4JJEA 2XQKA 1U7DA 3UJHA 2SICE 1H6BA 1LJ8A 3ZXUB 4I9NA 4YRGA 3S1AB 4WACA 3AIOA 4JP5A 1H23A 3IBCA 2I6GA 1QB8A 2G83A 2OHHA 5LB4A 2JLAA 3A04A 4KSCA 2GJ9A 2FJ0A 4R2WA 5FWDA 4WCDA 2NTYC 1RQPA 2QLTA 2II6A 5ENDA 5AVQA 1SCUA 2VT7A 3BTOA 3RYCB 5ERGB 1I1HA 4J0FA 2IX3A 3I6ZA 4ZP1A 1FVFA 3TNYA 5BW4A 4K5QA 4X6LA 3RS5A 1HFEL 1ISFA 2XFDA 3KS9A 4YJ3A 3ELBA 4NBVA 1WXFA 1YS4A 2AWOA 2G17A 2C7GA 2QRHA 3GJQA 4M83A 3EZLA 2AQKA 4RF2A 4KPUA 2YR0A 1W88B 2I7TA 3S7TA 4YRSA 4F3RA 2PUBA 3ML1A 3EXEB 3W1WA 2OUKA 4HX9A 3WLKX 4BMCA 1Y6GA 1L8OA 4PRKA 4WZAE 3WSVA 4W5TA 4LJRA 1CR4A 2A57A 2R6HA 3MB5A 1QYXA 1WNFA 3KT3A 4MV7A 5AJUA 4LZNA 2DTEA 1N2CA 2IUSA 2PO7A 3DNPA 4KTVE 4BLRA 4J16A 4XM2A 2WY6A 3EOBI 4GX2A 3V8QA 4GMFA 1FDTA 3WXMA 4EW3A 3EGWA 2YJZA 2VF7A 4GO1A 1FPQA 4Q34A 1EP3B 4YUWA 3I37X 4RH1A 3UB3A 3WLHA 1GCIA 1NW3A 5E8RA 3L7JA 5TQVA 1PL7A 4DM7A 3GL9A 1XTBA 2Y1XA 1KJ8A 3K5HA 1HNXB 3FG4A 1CYDA 4Q37A 1QZZA 4RDXA 4JVMA 1H85A 2KHZA 3TKYA 2NPIA 4DNQA 3UB2A 2IYWA 3B53X 4RIGA 4D5GA 4PAWA 2VZLA 4BFLA 4CLHA 1IZZA 2CVPA 2C4KA 1QMGA 3F6PA 2E4YA 2RAPA 4U0KA 3MT8A 1YRLA 1UBNA 1PW5A 1XRJA 2A1UB 2B6HA 3IP7A 3IRUA 4N0DA 1TL7C 2PMDA 5J5AA 5HZHA 4NZOA 2PEYA 5DLQC 5DW0A 2XKBA 2ZJ6A 4ZVVA 3ZTWA 2WB2A 2B92A 2W6MA 2IV3A 4IZIA 3AM1A 1R4MB 1U8XX 2VTEA 3OJWA 1D09A 1GPLA 4L57A 3BNDA 4NYJR 4LYFA 4PYKA 3WMWA 3K0KA 4BQIA 2HDOA 4RVUA 1XELA 1F3OA 5B6PA 5KNDD 2I9KA 3LP5A 4Z9FA 1Z0KA 1TGVA 3O94A 3ZDCA 2AMYA 4L3VA 2BGRA 4ALLA 4LMRA 4QARA 1Y1QA 2LXNA 5IJZA 3I1FA 5CM8B 5IKEA 1Z4QA 1LLCA 1N4AA 1QDUA 4BNDA 1TLFA 1RWOA 4GX0A 4HT3B 2BMWA 1USWA 2PH5A 3D1VA 1FMCA 2YJGA 3PQ6A 3R4CA 2RCYA 3HBMA 3U60B 1JJ7A 2A3NA 2HSZA 2RH5A 4KXNA 4Q05A 3NDIA 3D81A 3M4ZA 2QENA 1T4DA 5KX5A 4LTDA 1CEEA 3DBLA 1NHWA 3HCBA 3SG0A 2WD8A 4C89A 1TD9A 3OC6A 5BN4A 3JCZA 5KHLB 2ZIEA 3G0GA 4BQRA 5KVQA 5EHZA 3ETLA 1ZQ1A 3GAZA 2A4KA 4YNBA 4MQ6A 3QLTA 4ZO9A 1NRJB 3GVHA 2QX9A 2P1ZA 3MWFA 1VE3A 3PE4A 1WZEA 1XTRA 5ABPA 5HRAA 5J47A 1ZQ9A 1OI4A 2G88A 3EZGA 4MXDA 3RTAA 1XMSA 3JYHA 3ZWMA 3PQEA 1LV7A 1SU6A 4ZMSA 1NXTA 4TYNA 4QGGA 2JBAB 4QSMA 3NATA 2H2AA 4C01A 4HLNA 1LSSA 1DOAA 4MUIA 1DV1A 5EEGA 4M55A 3PD0A 4JLOA 1ETHA 2NYVA 2WYIA 1XTKA 4JQSA 4Q4AA 4DOMA 3F3MA 5JALA 4G67A 4WXYB 1G5TA 1ST2A 1F2VA 2C92A 5FWXA 1EFVB 2FZ5A 3PIRA 5LKRA 4YP7A 1CY6A 4CLOA 1CF2O 7REQB 4H7FA 3OCWA 3WDLA 4K0KB 3FTDA 5FFNA 1C4WA 1QH0A 1RM0A 2WM2A 5DM0A 1SQ5A 5JRZA 2J3LA 3A1UA 4B73A 6ADHA 2VDKB 3DM9B 3V1YA 3LY5A 1G8SA 1ZUNA 4Y1RB 1ZRNA 3CF2A 3HPQA 4QPJC 5EJEA 4PG6A 4EHLA 1DPGA 1UDCA 1VL6A 4LV5B 5A1JA 2MT9A 1TQ4A 4F9FA 3GLTA 1ADCA 1Z38A 2HA4A 4MKGA 3WKBA 3N2GA 1IBSA 5EMNA 5K0FA 3K8YA 3UM9A 4DVGA 5BN5B 2I78A 1VI2A 2ERCA 2JFUA 3KOZA 3CZ9A 3L02A 3TDMA 4D25A 3T06B 4ZVSA 2FNAA 1SOAA 3NXKA 3OA2A 3SQNA 2ADFA 3S2IA 5C4IA 1VA4A 1KAGA 2B7CA 2GBLA 4MS4A 4X91A 2FPUA 3GLIA 5FYDA 2HEGA 4PLZA 2RIPA 4DTIA 4QJ4A 4ER7A 4NEGA 2JEOA 1U0LA 1Y89A 4NEHB 4Q3OA 5HTKA 1DKMA 1OFHA 1IQPA 4Q16A 5DNVA 2GA9A 2Y0DA 1X1EA 3KQSA 1J70A 3X44A 5BRJA 3KLMX 4YV2A 4WKCA 2XI4A 3DB2A 3TQQA 3GNLA 4F4UA 5AVXA 3LGAA 2KJQA 2H1LA 5NLLA 2OCXA 2Y66A 4D45A 5I9NA 1APBA 3UQYS 4O33A 2W2KB 3I83A 5LIPA 4DCVA 3NOOA 3L5KA 1DAHA 3GBVA 3I2IA 4J0GA 1PYOA 1JE1A 3E35A 1XN1A 5J1SB 2WSMA 1ZVKA 2XMZA 3KVNA 1S1CA 4MX8A 3VR6A 4DBLC 3QNMA 2WHXA 1QHHA 1R6AA 3ZCQA 1BGWA 1VHQA 4DQ0A 3U9LA 1FDWA 1A88A 2QRKA 4J7AA 1K7CA 5F1KA 5J59A 5FBRB 1XKXA 1RRMA 2HR1A 4HRAA 4DV4B 5EA2A 3QPUA 4CL2A 3KYCB 2PMWB 3GDFA 4CYMA 4KQGA 3L07A 2DTDA 2P0MA 4RM2A 4A6XA 4ADSG 1EBUA 1UT5A 3IP6A 2VPTA 5BUCA 3GA7A 1CDZA 4Z9YA 1GRNA 3FFAA 5JAHA 2QW0X 1VJTA 1FX0B 1KDRA 1JP7A 4BWFB 1HZJA 3T54A 2JGNA 1E7MA 5IYZB 1ZGBA 2VNHA 2OR3A 3WZ2A 2QGFA 2YMQA 2BGTA 1NVDA 4II2A 3B36A 4MA0A 1CQWA 3QVUA 3SGLA 2I1QA 3FF1A 3TLJA 1I94B 3GROA 2R66A 2HPHA 1IYZA 1Z7WA 4O4IB 1HNZB 1OIWA 1WUTA 1E9VA 1JDPA 3IBFA 2JASA 621PA 3AJRA 1TU3A 1ADGA 4EQ6B 3F4BA 2WLSA 1D2HA 2MMCA 4DKXA 4B3FX 4QM7A 2JANA 2UUCB 4ZCSA 4X92A 3DZCA 3G5MA 4BQNA 3ZNQA 2ZEJA 4LE0A 3ILYA 5J2UA 2CLLB 4ZQCB 2AC7A 1KI6B 4AT1A 1C4XA 3T5DA 1O97D 4TQ9A 5JASA 2VFAA 2F1RA 3BN3A 1AURA 3M3DA 1L7OA 4EBBA 3CYFA 4GGMX 2CB0A 2GETA 2VN8A 2XGOA 4CETA 1UXJA 3FIUA 3X1XA 3HJTA 4G0YA 1EE2A 4TV8B 3UOAB 4UM9D 4FDAA 1EESA 4NVRA 1TPZA 4W99A 4PNPA 3KHUA 4YLEA 4ZARA 3HB9A 3W8FA 1UH5A 1EFRD 4V1CB 2H48A 4H2DA 3UH1A 5KSWB 4MDEA 3NT2A 4BMXA 1RT9A 2Q7XA 3NIWA 4HADA 5T41A 1FMJA 1XO1A 1OI2A 1L7XA 2XXAB 1LF5A 3EGDA 3MYYA 1GZVA 3SF8B 4EYGA 3D7SA 1LCIA 1XXLA 1ZW1A 3MBKA 1C1DA 4AJPA 3GJ5A 1QIJA 1U6IA 3D3QA 1CTQA 4HGNA 1QUEA 3FNIA 1ZH4A 4P92A 4A6PA 2Y6VA 1E2BA 2ZIWB 2FMFA 3BK2A 5ERXA 2HRDA 1KHTA 3GLQA 2H57A 3AY7A 4Y3UA 3EBPA 2FW9A 1IJEA 1RBZA 1CLEA 1TF2A 1XTQA 2FUG1 2YIDA 2ZT5A 3OWHA 3R0ZA 1EXNA 3FCCA 4IGFA 2LBPA 1JG7A 2X0KA 4PYQA 3DQZA 2UYGA 1ZLYA 1M2EA 1TMGE 1XTZA 1GPJA 3I9JA 3IVXA 3PC3A 4I50B 1PNOA 1OWOA 2OV1A 1RQ7A 2YW2A 3JAMA 4RE5A 1QGUB 5ALXA 2C77A 4A4DA 2H4WA 1Q1AA 1N2HA 2WHQA 3FRHA 1JNYA 1RABA 2J9ZB 3HB1A 2QPOA 3OX3A 4MCIA 4XJVA 3W9UA 4AO6A 1TQ6A 2XYRA 4CTJA 4EENA 5K6AA 2GRJA 1GT91 1GQOA 5KTMA 1H2RS 3IOBA 3FHLA 3NTLA 3UNXA 1RAHA 2H1WA 5LSAA 1LLQA 2WJJA 1FXWF 2AVNA 1CX9B 2VAXA 1JSZA 3B38A 4JVNA 1EUYA 1S7CA 1MX3A 1XV5A 3EA5A 1U9IA 3QE0A 2JFYA 4UAUA 4BQPA 4PG8A 4W5QA 1FU8A 4BQSA 2Z8XA 1ULAA 2XADA 4D0GA 3C8ZA 4XSVA 1TK3A 1TVKA 1HY3A 5ALIA 3AVQA 1SUSA 2R6DA 2QJRA 1MRNA 1Z7GA 2DR3A 1XDDA 1OXMA 2VHEA 2BEWA 3GK3A 3VHQA 2NSLA 4S12A 1X7ZA 1UT6A 3LX6A 4NATA 2A33A 3EJWA 4HWTA 4XEUA 1SN7A 2ZCVA 4RH0A 3B60A 2FZLA 1DTWB 3LPDA 1JIJA 4UTPA 2HH9A 4CM8B 3DO6A 2C3MA 3T94A 4LWPA 5A04A 1OTXA 1O9GA 2OGTA 4PTZA 4TMVA 2ZIUB 1PE0A 1XRLA 3N0VA 2XB9A 3SJCA 2H5IA 5C8VA 4TVBA 1E3JA 3VAYA 1DXQA 1I36A 2WAYA 3DCIA 2RHTA 1PZMA 1PV4A 1JH9A 2O1WA 1Y4ZA 1T91A 3ZZMA 3P2MA 4ITUA 4A2CA 2GK6A 4I1PA 3ZWAA 1QB7A 2R6GA 1Z2CA 3VNRA 2QN9A 3HR8A 4MW1A 3WDSA 4CIVA 2Q0SA 5BSMA 3UXEA 3PXUA 2VCHA 4E1BA 1L2TA 1ZD4A 4UM5A 5FOUA 3CZPA 3DDZX 1NWHA 3HN7A 4RZ2A 4DMRA 3AMVA 2O50A 3AZQA 3L0YA 4DPMA 5CBPA 2VI5A 1XMXA 4JT2A 1NF8A 3BBLA 4JHXA 2CXTA 3A4YA 4MITA 4V2UA 1X8JA 3UJBA 4C20A 2RGWA 3BDAA 2QE6A 2YWEA 5CFLA 3Q2KA 4UMDA 4FMPA 4H1VA 2ZRKA 2TS1A 2B4KA 4JXJA 3F3KA 3QBJA 3KQYA 4J0QA 3CXRA 3PS9A 2V59A 4FFOA 4HAZA 5B1IA 4R1TA 1G5IA 2POCA 2CVOA 2GPWA 3IXLA 1Z22A 5GONB 3MUEA 4EPYA 4YP1A 4MGHA 1XWFA 4AMVA 4BU1A 1CUEA 1YA8A 3GUHA 4ZOEA 2FSSA 4N8SA 4PLHA 1T9AA 3V9PA 3DBVO 4IZOA 4M0FA 1ZJ4A 5REQB 1H2ZA 4TQUS 3DHWC 4J1QA 5FP0A 1XGKA 3LM8A 5DYNA 2WUVA 2NO4A 2CY0A 2B7BA 1JLSA 4QTXA 1RWQA 4TMXA 2DPXA 4XM0A 3I5YA 4KQ2A 1IN8A 4G65A 4QOIA 1XQ6A 3M81A 3P9XA 5AKGA 4Q7KA 5FLEX 1QYIA 5DMHA 4BCCA 2JCBA 3NHLA 4RD2A 5DN6A 1KDVA 2VPWA 4I3HA 3A27A 3BXXA 3AUFA 3DWEX 1CUBA 1QKKA 1O7JA 2PXHA 1TGYA 1QVVA 3RVOA 3IOEA 3WLRA 3RAPR 4ENSA 3HP7A 3FZQA 3QXSA 4FYXA 1BX0A 2Q3DA 3AV3A 3GMTA 4EY6A 4FMCF 5L9AA 1K7EB 3TNLA 5ILGA 1VI6A 4Q21A 4H16A 1Q5PA 1ZZEA 3UENA 2E4AA 2XRMA 4W8HA 3SYKA 3T3MB 3WNDA 3ZX5A 5EEOA 4QG3A 4B3MB 1P74A 3RS0A 5E1OA 4PGAA 3SXJA 2Z2YA 3UA4A 1MX9A 5CB4A 4DA4A 3KZVA 8ABPA 4IDPA 4X1KB 4BMSA 3ZZ1A 5B64A 2DUWA 3GHHA 1GP2A 1LX7A 4R81A 4C0HA 4E2FA 4WL0A 1GPKA 4X1OA 4LV6A 3TMYA 3GLGA 3DLCA 4ZOAA 5ECWA 3KEMA 3WGYA 3FPSA 1YFKA 5C80A 1JNQA 1P6XA 1U9JA 1Z82A 3P9CA 5FR1A 1EWVA 5LUAA 2J3MA 3E18A 3B1ZA 4IR7A 4M9XA 1TMYA 2O0MA 1YDMA 4MQEB 4MW9A 5EYPA 1UT8A 3PDUA 4GKJB 2E87A 1EI9A 2QTVA 3HA7A 2CV2A 4QO7A 1DB3A 5FBWB 1YQ9A 3JALA 4V0LA 4XQGA 2BEVB 2BE9A 3OTGA 5JUWA 1GG9A 3LLCA 4B45A 1UDBA 2QQGA 1RQRA 1NRWA 2WEKA 3Q1KA 4G0MA 2KM1A 4L51A 5TT0A 4Q9AA 2B61A 3DFZA 4KQJA 5JXJA 2FPPB 1XRNA 2J7KA 3BMNB 1DL5A 3FKSD 3PGMA 3D8HA 1OX5A 5K3DA 4DNFA 4TVSA 4TTTS 4MZXA 3E05A 2H4FA 1J5EB 5JS8A 2DBQA 1O8BA 2G9RA 2XHJA 3R6TA 5CT4A 3F7OA 3UYKA 4MRNA 4ZWNA 1UBHS 3D59A 1X1CA 4ZVTA 4Y2QA 4Q9DA 1H8ED 3B82A 1SHJA 1L7MA 1W1WA 4NOKA 4TSFA 2IYUA 2OBXA 1VSTA 3QBDA 2BRUA 1NN3A 1TJ5A 2P5YA 2F67A 2G63A 1L5NA 2W7TA 1BYIA 4D4GA 4PYJA 2O8EA 2DCUA 3S55A 1SCAA 2P5TB 3IV6A 4WLVA 4Y1GA 3C5VA 4RS4A 3FWNA 4TWJA 4RSHA 3QX3A 4JKYA 3GEBA 1ZK1A 3MS2A 4KE6A 1ZJWA 1RXEA 1YB6A 1CJKC 4QRDA 4K6KA 1PFWA 4BMNA 4EEKA 1W4RA 4R2LA 3K2EA 1V9LA 1F2UA 4EPXA 3U3MA 3V6MA 3F7NA 3CN9A 1TYCA 3EDOA 3BJMA 3KKNA 2X6QA 4XUEA 3IP8A 3O8RA 2X9QA 2BFNA 3AHDA 3HB5X 4JJGA 3D7RA 2RKBA 4LDNA 4WKBA 1C29B 5CCEA 1SIUA 5ALEA 2GD2A 1YZKA 5CDGA 2UYOA 1SKBA 1SB9A 3K9BA 3LH5A 4I9GA 2Z6VA 2GCOA 1X8LA 1XTVA 4PSAA 3LTEA 1QHYA 4TYWA 2GK7A 1RVV1 1Z29A 1R8YA 1I32A 1KI1A 2BBSA 2IF2A 3C3DA 1RWVA 1SIBE 4JL6A 3QOWA 2HBRA 3N5CA 4JAVC 3IEIA 3S8MA 5J2TB 2G36A 3PEUA 1TT7A 4PYIA 3D8NA 1BS9A 1BHO1 3QIAA 1YZUA 3CRZA 5GAJA 4A8JB 4KWEA 3WLLA 5DHRA 4DM3A 1CZRA 3NJ8A 4NCNA 1Q91A 2HA2A 3FOCA 1YZHA 3N6VA 3ADCA 3LD9A 3CU5A 3OZTA 3WBKA 4Q3EA 1GYPA 1A5BB 1T9GR 1ZISA 2B8WA 1OWLA 5LA6F 3RKUA 4ZVUA 4O2RA 2PQ2A 1DJLA 3KKOA 3IS3A 1UK6A 4I99A 4BCBA 1K6EA 4D7AA 2XIJA 1RI1A 1Z2AA 2PD6A 1QOZA 2QRJA 3PL5A 4G25A 3MJRA 1Y7PA 2GOYA 1EK2A 4W1PA 1O89A 2DUNA 5DK4A 2Y2VA 4ACAA 5KWIA 1RYDA 5ECGC 1F8YA 3UJCA 3T1NA 1D6JA 1QR2A 3MTQA 3DTTA 3BS4A 5B3LA 4DMCA 2I65A 3QNWA 1PT8A 2W6IA 2PSHA 3WICA 1S2DA 3D5EA 3QWFA 3K70D 2G72A 3PHGA 1FTNA 4C4SA 3L6CA 4GSKA 4WK2B 3SVTA 1L1RA 3N59A 4YRQA 3W9YA 5LP6B 2OA0A 4NG4A 1E2MA 2BF4A 3OY7A 5JCJA 4MI9A 4X93A 2KW5A 2V98A 3V80A 2ZRIA 2F6RA 3BQ9A 4YT4A 5AUNB 1SHUX 1XR3A 1T2EA 4JFRA 2XYPA 5HF5A 4H7PA 3KKKA 3SSAA 1WW2A 2PKQO 4K81B 4NF2A 3OX4A 2IP1A 3WGZA 1D2CA 2HNAA 3S28A 3TBFA 2GYVA 2NU8A 3W05A 4U6SA 5G3ZA 2W2LA 1ZD8A 4N39A 5B3AA 4MIKA 3SHOA 5KYGA 1RJDA 1JFLA 5B53A 1YQUA 1B16A 1CULC 2E37A 1BWQA 1IFXA 4G4IA 4I6EA 5D5HA 4XWOA 2IC5A 4EFLA 2GUWA 5C1DA 3CVXA 4KDEA 2H0RA 2C2GA 2J4FA 4X45A 3WHKA 4YPOA 2BFBB 1P8AA 4C5AA 2AE1A 3D1LA 1LJUA 1OZ0A 2IPOA 1K08A 2ZSBA 1Y5RA 5KYYB 5KJ6A 1XB2A 3U26A 5G4KB 5AIAA 4G2TA 4L4ZA 1DS6A 1GD1O 4G1UC 4P5PA 1L5RA 4C2BA 1PV1A 4BS9A 5L4SA 1I3MA 1JTFA 3LWBA 4B71A 4HTFA 3A58B 2LG7A 2ORWA 4DLPA 3EZ9A 3GN1A 5AESA 4CKYA 4LDQA 5I7RA 1V47A 1ORTA 1N0UA 2DULA 1AGNA 1Y1TA 4AZSA 4X3OA 3QTLA 1Y7HA 2QYTA 2R5FA 1PNQA 5D2CA 4Z9XA 2QRPA 1E6WA 4CT4B 1ANKA 3U3JA 4TRRA 1E2FA 3HWSA 2JF0A 1BX3A 3C45A 1M5UA 1WV1A 4YRJA 1R0YA 2I0FA 2HREA 3TQCA 2D2VA 2OEPA 1RMTA 2AQIA 1TJ4A 1T3ZA 3I53A 3O4RA 1ZITA 2XGMA 4MB6A 3H4TA 3VM6A 4KIWA 2WMOB 3LUFA 4Z99A 5HQ3B 1XDBA 2POQX 3G9TA 5C1BA 2EATA 2OFXA 4OK6A 5AO9A 3H1AA 3KR2A 4PYMA 3RSCA 4PCUA 4TRNA 1Z2DA 3FOBA 2VJMA 3MSCA 4LZJA 4W5WA 4HUQB 4OLAA 2WABA 2B8EA 4P81A 1F2TA 4TL8A 1XVLA 3F6RA 3BHIA 4WZBB 4BEJA 4BX9A 3T9CA 1ARZA 1GU0A 4L4RA 3HCDA 3LK6A 4E88A 5GIOE 1TA0A 1Z15A 1OHHA 2CBZA 3PDIA 5K8CA 1JZQA 1SPXA 3MQ2A 1C1HA 2BBTA 2FMHA 4CKZA 4Y2RA 2FOXA 2E3JA 2X5XA 1FFBA 4KV7A 5D85A 5IJXA 5I7HA 1FP4A 2LZ0A 3T34A 3KQMA 2Z2KA 3C43A 4GGOA 4LYAA 5M5BA 2D0IA 1H2HA 1K7FB 1TO1E 3ZBQA 2DGDA 1BZYA 1G8GA 1RKXA 4QREA 1GGVA 4CXMA 4RQAA 4XLTA 1NMXA 3S27A 2IS4A 3PFCA 4L72A 5AK3A 5GV7A 4TROA 2ZPTX 1ZAYA 4J8PA 2GZSA 1JKFA 5DI9A 2DJIA 2ZBEA 2NVUB 1V96A 3ND5A 4BNFA 3L2OB 4I1SA 5CMLA 4CM3A 1MJFA 5F4BA 5K5EA 1QIEA 3HCAA 3O8CA 2QVGA 4XR9A 3CRNA 1FY2A 3QMVA 2VHJA 5IDYA 1MZPA 1N0WA 4MMYB 2X4LA 1ISJA 1R9MA 1ZK2A 4UNQA 4XI9A 5KYVA 5SV2A 3RTCA 1I5OA 1Z4OA 3OF5A 2VRNA 1U3VA 2V4ZA 3L6BA 5JG7A 2NU7B 2IS2A 1OIXA 4KAJA 3ZJ5A 4BNZA 4O2LA 1BVUA 5C8XA 2R8XA 5CGQB 5A5GA 1L5KA 4D9NA 1ABBA 1XFAA 3FDZB 1I7LA 2GN0A 4D9EA 2XQJA 1TZBA 4ZPXA 4MR9A 2IS1A 1FL9A 1EFCA 1U8AA 3CWQA 3AM4A 4RHUA 2YKGA 2PPVA 4Z49A 4RKWA 4ZAXA 3HDTA 5DFAA 3AM5A 4ARZB 1V43A 1Y5NA 2R79A 3IVRA 4P3KA 5D00A 3U4MA 3OOEA 4UEQA 2X7XA 2NUBA 1UQUA 2X5KO 1FFXB 1UEJA 3GRKA 1C7QA 1ZKMA 3H16A 3M9LA 3MERA 3STWA 1F5NA 3QU4A 2FN3A 4PAQA 4EUSA 3WLSA 4AUNA 1VLLA 2WT4A 2IGTA 2NACA 2EKLA 2GZ1A 1J8DA 5ENZA 3UUEA 4Q6WA 4DNOA 3O0DA 4FT4A 4R68A 3LA8A 3WIDA 1DAPA 4AXBA 3OFNA 4AD8A 3NHFA 2HQBA 2PV7A 2I8CA 1XVVA 3DEHA 1JUDA 5BW6B 1B93A 2QUIA 3KXIA 3MCZA 3SZGA 4EI8A 1CY7A 4JLJA 2ZSEA 3RJ9A 1OWPA 1WMSA 2CLDX 2WIFA 3OQ6A 1M2FA 2Z1NA 3R8XA 3V7YA 1VOTA 1IQRA 3U4HA 3M6AA 4HAOA 4ESHA 4JZYA 1Y8ZA 5IBCA 3TLBA 3ZD6A 1GDHA 5FORA 4F3TA 3A37A 4YI3A 2XBUA 1QHEA 5MFPA 1I2MA 1K8YB 4IUDS 4M6WA 4GL4A 1QYDA 2BFFA 3U9SA 5KVVA 4L0MA 4YHHB 5JNTA 3UG7A 3H0CA 4MWBA 4TVKA 1LWOA 3BRSA 3QVOA 2O0HA 1EWKA 4HB3A 4OP3A 1N6PA 3V48A 1KMQA 4FYMA 2L0XA 3U7FB 3THOA 1X94A 5DJ5A 3ZXYA 3T0FA 4F3NA 2DQSA 3Q15C 3W7BA 1CZLA 4HG2A 3ZWDA 4I7EA 4WY2A 1H9BA 4WFOA 2Y0BA 1E9RA 3DMGA 3WLEA 5CLJA 3CBGA 4J07A 5DCUA 4BPBA 2PT5A 4A2QA 4QGSA 5ALVA 3K16A 2WJIA 1HE1C 1HDZA 1P9RA 5DGTA 3VR4H 5JH7F 4U2DA 1U8YA 2EBFX 3HDQA 3LV8A 2XD4A 4QHTA 5TGDA 3GLHA 2AF4C 3GVCA 3GHYA 1KAHA 3UPTA 1MH1A 1GTSA 4G2NA 1PUIA 2HBQA 2R6CA 2ZUVA 1RLIA 3H5VA 4ML3A 3RS3A 1IVNA 1P4JA 2BTQA 4ICIA 4X97A 3U40A 3DAFA 3R7SA 3N5KA 4DDWA 4LHZA 1UXGA 4N7JA 4RQTA 1J25A 1SCNE 4A27A 3UWKA 3S2ZA 4FYWA 4DR5B 2IE0A 3BMQA 4MVJG 5ELXA 3FTQA 3X2FA 4YQFA 3E4CA 1JSLA 1TAGA 1NG1A 3LYAA 4FDMA 4HDMB 4HO1X 4QYTA 2V97A 2ZJBA 3MUNA 4NJEB 4O63O 4W82A 4WXEA 4EPTA 7ADHA 5AFSA 2X1MA 2A0KA 1C5KA 2YRFA 4OVKA 1B6GA 2AXPA 4JB8A 3RFTA 5BPHA 4AMZA 2IKQA 4R8VA 2ATIA 4R5MA 1HV8A 3IPLA 4HGOA 3TK1A 2X0NA 3VJLA 2JL1A 2AOVA 5B6JA 1LPPA 4KPFC 5ITWA 1ADYA 3NKLA 1LBSA 2PNFA 3T9EA 2JCYA 1V1MA 3O4IA 3SKVA 1R8QA 2ATCA 2O3RA 4JVLA 4KXMA 4ZDJA 1JDNA 1GTG1 5J4VA 1M75A 1OBOA 2P6MA 2YIVX 4H1TA 4BRUA 2ILVA 3GDWA 3IMKA 2PWYA 1X1BA 4XCXA 4UDXX 1DCMA 2QY6A 4RMGA 4G8DA 5DZSA 1GL3A 3F49S 4LOAA 4ZQFA 1QH1B 2DFLA 2OORC 4BUCA 3SM3A 2QUZA 3UATA 4IIXA 4XIGS 5SY6A 5B6IA 5AHRA 2HHAA 4MUMA 5G1NA 4HMPA 3IJ5A 1K9SA 1OC4A 5JW6A 1R0KA 1V11A 2AEJA 2J6BA 2XHEA 3KJGA 3SJ7A 1ZUHA 3AVWA 3KQWA 3DR5A 1O5OA 4WJKB 3DMRA 5CFZA 3FFWA 1NW4A 2OL4A 2NSYA 3D2LA 4Y67A 4JJIA 4EJ2A 3C3CA 3QFFA 2FA9A 4RPKA 4L5BA 3MEQA 3V4LA 3OAAA 3NBXX 3PI7A 2GEBA 4GWGA 1P1JA 4J76A 3WV5A 4JU9A 1XJCA 3AVOA 3GFRA 2B1RA 4JSRA 4XOUA 2OAP1 3K15A 1GZ7A 3U5ZB 1E5QA 1OGYA 5L3QA 3FYUB 4J6FA 4OAOA 1NSTA 1N3YA 3H86A 1NXPA 2BMFA 3R76A 4JODA 4X6XA 2W70A 5CU7A 2XDAA 2JI4A 3OCYA 1UC8A 4MP6A 4WCFC 1TKBA 2P6NA 4HKTA 2M6SA 3JPYA 4YGXB 4ZO6A 3RK0A 1LQ2A 3DV2A 3JS5A 5BNZA 1D4ZA 2KB0A 3FCUB 2M1ZA 4GXTA 1XMPA 3JD0A 2V7XA 5FD8A 1F8FA 1VE9A 1JS1X 4ZVRA 2PEZA 4AQDA 1UKBA 2QTZA 3M9WA 1OFTA 2VNKA 3P7MA 3L8HA 4Q1FA 4R2IA 4WLNA 5AXCA 3RVKA 4NLLA 4E2XA 1SBIA 1W0KA 4BFUA 3V6LA 1CW2B 1L8QA 3RIXA 1VFNA 3HZOA 1VB3A 5K4HA 4DUZB 3QXJA 3NM6B 5BT8A 1EYZA 4Y2HA 4E6PA 2RHHA 3STXA 3R9WA 4M1QA 2QX4A 2Y1GA 3ZHXA 4F04A 3EG5A 4NXMB 2ZSUA 3KJZA 4FHCA 1A04A 3G0HA 3HL4A 4TTRA 3ZYZA 2AG0A 1YACA 1KZ6A 2CYBA 2QLFA 3HJRA 4HAWA 3U09A 1XD9A 5IJWA 3NV7A 1SOUA 1S2LA 4Y8VA 1K3UB 2IPMA 1KVTA 2XDQB 3ONEA 1DO8A 2ZJ8A 5AKKA 3TTUA 4KX3A 4ENTA 3FR8A 2ZSIA 5DTEA 4JLBA 1CR0A 1IIBA 3BD6A 3D4IA 4IHJA 1A77A 2D5AA 1Y6FA 3GPDG 4II7A 1VLZA 2GD0A 3TSWA 2RGCA 3HP1A 3BH7A 3EC7A 5A6VA 3D4PA 3D6MA 4UEKA 4Z9AA 1TIKA 5CXUA 2QDKA 4YJFB 5BSRA 4EHBA 5LOVF 4GKAA 2PLRA 4C76A 4C0KA 4ZJPA 4Q1VA 1WG8A 2Q0HA 3QXGA 3AR5A 3OZBA 4OQYA 4CR6A 4HFRA 1CC1S 1NN1A 3ZHZA 5CJPA 1TC1A 2OVFA 2XA1A 4M1WA 4OXQA 4BXOA 3M8KA 1XEFA 2VHTA 2C4UA 2R62A 2PWZA 5LBTA 4CRWB 5L8VA 2QRNA 2UYYA 4KUGA 1GPMA 1A4XA 3GT0A 1GCAA 2PZBA 2QD1A 4MP3A 4ZO4A 2QLBA 3ORYA 3GRAA 4WBNB 5KNBH 4QBGB 1YWGO 3X1WA 1OXXK 3HHPA 4FLFA 3ULKA 2HA7A 1K5HA 4MQUA 3RUCA 3PHJA 4AJHA 5JBNA 1XDSA 2AN1A 2GPTA 1EU1A 1KBZA 5F5LA 3ZLUA 1Y1RA 4WXHA 2XKJE 1E79A 1U0EA 2D1QA 4RJIA 5B3KA 4I9UA 3LUHA 3GLUA 2R7NA 4A16A 2VXCA 3VVBA 2OTCA 2VATA 3BDIA 5IJ9B 5K0LA 2O2ZA 3ICVA 1HT3A 3GOQA 3H1FA 4I5FA 3RVBA 1BEZA 4KDCA 4PBSA 2NUTB 1H69A 5EJFA 4PQEA 4PG4A 5E9JA 1YR8A 3I04M 5BORA 3O8YA 5FOQA 4ETMA 4CG1A 2ZR0A 4B33A 2CLHB 2Q7OE 5DYGA 4OLHA 3R1IA 1TCBA 1B6RA 3K7EA 1SZPA 5A3VA 1GR1A 3ACDA 4EH1A 5LZ2A 3MLBA 2XCTB 4YAOA 2NTJA 4R51A 1AO3A 1II0A 4UCWA 1RHMA 2HLPA 1R74A 4URWR 1YUMA 1U7XA 2AI2A 3C1UA 1B42A 3IODA 4I4CA 5PNTA 2AR0A 4UCFA 3S2FA 3T7TA 3FDFA 4DQKA 1SKYB 5CB0A 2R0QC 1GG8A 4AUKA 2PU7A 1OJ7A 3HYCA 4DLUA 5FTLA 1Y7IA 1U4SA 2C83A 5ADWA 4BZPA 5HWSA 2JI6A 2Q3LA 3C6QA 3GJZA 1K0UA 3M83A 4BKRA 1V7CA 3EXHC 4KOEC 1TUGA 1CCWA 1U0JA 1WXHA 4D74A 4AUEA 5JSUA 1FGMA 3N7AA 4L27A 4UJ5A 1NJ8A 3PC6A 2O3SA 1JPVA 2B2XA 5JARA 1I80A 3N8HA 1IDN1 3BB4A 3QLVC 2GF2A 1E2EA 2BSAA 3QVXA 4KI0A 1V0JA 2OHXA 5K6RA 1YDEA 2EW2A 3P9NA 3GMSA 1BRTA 5KJ1A 2PKYX 4N3AA 3TUZC 3ANSA 5KNCH 3KVVA 1NR5A 1HE2A 5AUQA 2Z2XA 4A6EA 2QI9F 2QF7A 2GZDA 3DTVD 3L40A 3NEAA 4NREA 4M98A 2DBVO 2F1IA 3T8YA 4DSNA 2J87A 3EN0A 1MDFA 2C7VA 3G9XA 4LMBA 1J2EA 3DZHA 3INYA 4H08A 3UQZA 1EKXA 1U7PA 4G5HA 3IP9A 4GQAA 4MLPA 2XUQA 5CNKA 1JALA 1XFDA 1VG9B 2Z2ZA 5KQRA 4Q19A 3H42B 4O5AA 3FAKA 1QQ7A 2EYUA 4G36A 3UJDA 4D6XA 2J6HA 3RBZA 3DXYA 2B4YA 1KI2A 3G49A 3RREA 1EX6A 2QT1A 4QU9A 4EL0A 1L5HA 2ZUBA 3E84A 2OQVA 3C98A 3JR7A 2AFVA 4D8UA 1D1QA 1MOSA 4A36A 5HFNA 1X80B 3F3YA 4RYLA 1MVNA 1MHTA 2AB0A 2INGX 3INNA 1K0FA 8ADHA 5JQWA 3LYUA 4FI3F 5A0VA 4OAPA 421PA 4KLZA 5GGYA 3W5CA 3I23A 5G53C 4RVHA 3H8VA 5C2JB 3ADPA 1LPOA 2A67A 1X7WB 4YONB 3UAWA 4DR6B 2C2HA 3A6EA 3ORSA 2PY6A 1CUJA 4O2BA 1D2EA 4LJYA 2CV0A 3R0VA 5K20A 1C0KA 3CVYA 1PQUA 1PFQA 1NF9A 1NSFA 3WIEA 4EB0A 1UPBA 1Q3TA 3K1TA 1OOEA 4US2R 3ZDDA 4Q9IA 3CLRD 3RJTA 1RP1A 3PTAA 1NVBA 4OOEA 1MO6A 3HA3A 4BTVA 3EVEA 4C7BA 1WPGA 5A9TA 4KMRA 1N3IA 4UBMA 3VZRA 5I5GA 2XT0A 5C7IO 4CLRB 3PJGA 3VU1A 2CHVA 2BVNA 3C3WA 1H2WA 1F8XA 1ZD2P 4HDSA 3BTVA 1CUFA 5EE9A 4J0KA 2UXDB 3GVPA 1V5FA 3W3AH 2H4YA 3USCS 3D31A 1MMFB 1Z07A 2H17A 1GADO 2C9MA 3DHVA 3HEAA 2HMYB 3FNHA 4A23A 2JLYA 1UBRS 4MPTA 2R2AA 2BKVA 2FUNB 1YNSA 1H1LA 3B9QA 3PR1A 3H5IA 4LRXA 3RJZA 4DTCA 1B0PA 3BAFA 1FFCA 1MT3A 4ZCMA 3DL7A 2XUHA 4QOGA 1ISMA 4EVIA 1YL7A 4B5LA 1OVGA 3VR3A 4RTRA 1USGA 1V8DA 2DWUA 1GFZA 4ZAFA 1LF0A 1P5FA 3A9CA 4O3FA 2Q6IA 1MDBA 1VMDA 3ZW8A 4HLQB 1QFMA 3J81k 4HNRA 1H22A 2O0JA 3ESDA 5C3UA 1EVJA 1DARA 2VCEA 3FDJA 4JEIA 3UWPA 5DBGA 1CEXA 3PNYA 2DUUA 1K88A 2QN2A 3RC1A 5HZKA 3OHPA 5TC4A 2DYKA 1E94E 1G98A 3LJKA 2DJ5A 4RF5A 1G20B 1YL6A 2X0EA 3L0SA 4OA5A 1EXVA 2DHEA 2NPFA 1KSGA 5E0KB 3ER8A 1NNLA 1NMEA 3OCCA 1WUKS 4F0JA 4QDKA 3CTPA 4LSZA 2VUTA 2A3RA 1YJXA 1POWA 2CCJA 4KLRA 4OJTA 5EZQA 5JYDA 4AI6A 2NT4A 2XUKA 3NWEA 4ZI7A 1QG2A 2AJTA 3HUTA 4FBMA 3G0IA 2I29A 4AWAA 3DZGA 1J33A 1HFKA 3FVRA 1TK9A 2B99A 3GWGA 1E2QA 1XYYA 3BIXA 3WJ2A 1W44A 2NQTA 4G86A 3WKAA 5DH9A 3K20A 5PGMA 4BKUA 1UP7A 2MHCA 5I8ZA 1WMFA 3CUEF 2J30A 2QM3A 1LU9A 3HWRA 4G1BA 3LBHA 1E5XA 1ZGJA 3S44A 3B3QA 1HH4A 3OTWA 3KCQA 1TCVA 5JI3E 3A3NA 2DHCA 2Q5CA 5JAMA 2BMEA 4G1MB 1QQ6A 1SC4A 3QMWA 5EP2A 4X8HA 2HF8A 4AY3A 3B1WA 1Q0RA 4GUAA 3WGUA 2HRQA 1HOTA 1CY8A 3DC7A 2Y8EA 1OW3B 1RHRA 4CT5A 1P45A 1UWVA 1P72A 3MRTA 5IT4A 3SIXA 1KYWA 1M1XB 3GQBA 2PX8A 2VXBA 3ANTA 5E7MA 5HF6A 4ZIRA 4CR7A 2CHQA 2AMVA 4HMOA 3NHZA 3E1SA 3PGXA 2NUPB 5JZBA 2JIZA 4X41A 1A5AB 3DV0A 2GCPA 5HZMA 4J0EA 4GBGA 1KHHA 3GRPA 2PJRA 5LA6B 1Q2UA 3F78A 3UUGA 5I51A 4C6TB 5KOHB 5JS1A 3BL6A 2VYVD 3QE4A 1LOXA 4ZJZA 2HC9A 3EDYA 3RABA 1QNLA 1LH0A 2A1TR 5KQLA 4OB6A 5HMMA 3I04A 1A8IA 4KFUA 2XECA 4MW0A 4NMXB 1XNJA 4G4SO 1PFGA 2FHPA 3ZCVA 4QJBA 4C4YA 4CKXA 1Y48E 1RZUA 4F5EA 5E3JA 1SXJD 3CKYA 4RFLA 3BMOA 4L75A 3PNSA 4KNWA 2Z5LA 1Y81A 4LF5B 3RSGA 4E11A 4WWHA 3K5PA 5KQMA 4BLTA 3M4XA 4DEVA 5KYXB 1XAGA 1G0NA 4XLLA 2XZLA 1UINA 3IMGA 4UHHA 3WRVA 3QW2A 4DDKA 1YHNA 2RFLA 3V99A 4IFIA 1MV5A 3U16A 1WEHA 1SFRA 1KORA 2XAAA 3IVAA 1XN4A 1LLDA 2GO7A 4QOFA 3Q3GE 2H54A 4R9VA 2XFEA 5L40A 4Y98A 1D5CA 1GN8A 4IICA 5LQCA 5KS2A 2GK4A 4LBWA 1KEPA 2WU8A 3L6EA 2DXIA 5EIBD 4MAMA 4NP6A 2JIMA 3G2NA 3MBIA 3LT2A 1K4YA 2WJ4A 3PYXA 1U0FA 1IY8A 2AC2A 4Y2UA 1NC1A 3P4UA 4XTRA 1KYZA 3E4DA 1RJEA 1IJFA 2X3FA 3IHWA 3LUGA 2OLJA 3A1CA 4FT2A 1JAZA 5A62A 1BD3A 2GLXA 1Y42X 5DU2A 3LLMA 1IWPB 2JLZA 4K05A 4K6MA 2FV8A 3NM4A 2PUDA 1RWKA 4CF3A 4NZMA 3F9IA 3AKDA 1WF3A 4Q93A 5D51S 3Q87B 2W90A 1XD2A 1IBKB 2YYYA 3E8XA 4GIBA 1J56A 1XROA 5CVUA 2ZYWX 1KYYA 3GLRA 3W1VA 4C06A 5KTOA 3D6VA 2VQ6A 2R751 3P2EA 3FKJA 5EHIA 5G41A 3SM9A 4Z53A 3E6AA 1ZGGA 3CKMA 3C3XA 1F0YA 4WGFA 4BFWA 1GGEA 5L45A 3IXMA 1YO6A 1C7RA 4Q02A 1GDTA 2JEYA 3OQBA 3IIIA 3KBOA 4JA0A 4BP8A 4BJ6A 4O02B 1MAUA 2E1RA 5FNZA