2OXEA

Structure of the human pancreatic lipase-related protein 2
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
452
structure length
435
Chain Sequence
KEVCYGQLGCFSDEKPWAGTLQRPVKLLPWSPEDIDTRFLLYTNENPNNFQLITGTEPDTIEASNFQLDRKTRFIIHGFLDKAEDSWPSDMCKKMFEVEKVNCICVDWRHGSRAMYTQAVQNIRVVGAETAFLIQALSTQLGYSLEDVHVIGHSLGAHTAAEAGRRLGGRVGRITGLDPAGPCFQDEPEEVRLDPSDAVFVDVIHTDSSPIVPSLGFGMSQKVGHLDFFPNGGKEMPGCDGIWEGIGGFVSCNHLRSFEYYSSSVLNPDGFLGYPCASYDEFQESKCFPCPAEGCPKMGHYADQFKGKTSAVEQTFFLNTGESGNFTSWRYKVSVTLSGKEKVNGYIRIALYGSNENSKQYEIFKGSLKPDASHTCAIDVDFNVGKIQKVKFLWNKEPKLGASQITVQSGEDGTEYNFCSSDTVEENVLQSLYPC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of human pancreatic lipase-related protein 2 with the lid in an open conformation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Pancreatic lipase-related protein 2
total genus 127
structure length 435
sequence length 452
chains with identical sequence B
ec nomenclature ec 3.1.1.26: Galactolipase.
pdb deposition date 2007-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00151 Lipase Lipase
A PF01477 PLAT PLAT/LH2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.60.20 Mainly Beta Sandwich Lipoxygenase-1 PLAT/LH2 domain 2oxeA02
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2oxeA01
4QZVA 3R3ZA 3DYVA 4C87A 2I3ZA 4HVTA 4WFOA 4L3WA 4KE6A 5FUMA 5AKYA 2XUDA 2B9VA 1R3DA 2JGEA 2X76A 3WA7A 4G5XA 2IUKA 3ZLUA 4DNQA 1W52X 2AXEA 1JJBA 4Y2RA 3HABA 1JJIA 4LKOA 4INZA 4J0CA 3G9ZA 4RE6A 4YASA 1DTEA 3QM1A 3LIPA 5DNWA 3OM8A 3A2MA 3STUA 4IH9A 3O4JA 5HF5A 5HFAA 3AIMA 4AN0A 3EF3A 3BJMA 5ALEA 2HU8A 2WUFA 3R0VA 1ETHA 5LZ7A 1X2BA 4BYMA 1FFBA 5D3KA 2PSDA 5IKXA 4QDZA 1YCDA 4V2IA 1CRLA 1ODTC 4H7FA 1BE0A 2OLEA 2X5XA 1CUVA 3STTA 3ZV7A 1SCKA 1N1MA 3YASA 2WUGA 2CKMA 3PF9A 3SC2A 1I6WA 4I4CA 4J0DA 5HQ3B 5K3CA 2HFKA 3LP5A 4AQDA 2X8BA 3FSGD 2WQZA 3ZLTA 4EA6A 1YASA 1NO3A 1UKAA 1G66A 3SWWA 4ARBA 1MX5A 1J2EA 1EHYA 4FMPA 5JARA 5AH0A 4KR0A 3D2CA 4CCWA 4NS4A 1L7RA 2V98A 1A8QA 4BBZA 2WJ6A 3AJAA 3FNBA 1F0NA 3KD2A 2XE4A 2R8BA 1XZJA 3G0DA 2CMFA 5C8XA 5ALGA 2YH2A 3HRHA 4H7EA 2H7CA 2WG2A 4X85A 4NREA 4HXFB 3BNBA 1WOMA 1AC5A 1ZD5A 1E66A 4HXGA 5FDFA 1Y7IA 2JIDA 4AMYA 5CRIA 4K2AA 3IUNA 3DL7A 3HZOA 5AI9A 1XQWA 5ALVA 4CG2A 3M81A 4GW3A 2CBGA 2HADA 3G0BA 4UHEA 1XRMA 2K2QB 4OYYA 4G8CA 5HZGA 2GBIA 4OD0A 2OXEA 3BDIA 4HRYA 4BCBA 4RGYA 2B61A 5FPQA 4FBLA 1XLVA 4KAAA 1W1IA 1F0PA 4EB0A 1YS2X 3CCCA 5FKJA 4C4XA 3EQ8A 2WHRA 1IUOA 1WB5A 1E8NA 1HU9A 5HK8A 5CMLA 1XZKA 5DYYA 2BAGA 4IQ4A 1YS1X 1LBTA 5AIBA 4KAJA 1MNAA 4U2FA 5BWBA 1LNHA 1LPAB 4PSDA 2ACKA 2EDAA 2PL5A 3RK4A 2HIHA 1MTZA 3SK0A 2WHPA 1T2NA 1ORWA 1GYGA 4A5SA 3FCXA 2FJPA 4W1SA 2UZ0A 5CH5A 4QA9A 1N5RA 1YA4A 2QJRA 2WXUA 3QMWA 1TRHA 5K3DA 2OGTA 1BU8A 4PO3X 1FGOA 3WQHA 1ZICA 5AI8A 2JEZA 2XB6A 2AJCA 2GBGA 1G42A 2J3QA 4AZ0A 3HJUA 2FNQA 3HXKA 5AP9A 3BIXA 2WU4A 4DGQA 3FLAA 4K6HA 4X91A 1FFAA 4BCCA 3W2TA 1HDEA 1PJAA 2BGNA 5IVHA 3IUMA 1H2ZA 5AI6A 5EHZA 3GZJA 1XQVA 2QZPA 3QMMA 4OB8A 3H1AA 3T4UA 3TRDA 5AM2A 5DWDA 1XZFA 1FSSA 1DWOA 3L1HA 3G9TA 3JYHA 3DKKA 5E4YA 4M0MA 3IURA 3O8YA 1VOTA 1FFCA 3WK5A 1QFSA 3R3WA 4QLAA 5E4TA 1Q0ZA 5CH3A 3OC0A 5A2GA 1H2WA 1LPMA 2JF0A 3H2IA 1ZGBA 4MEAA 4C6HA 3ANTA 2XMDA 4BP9A 2HHAA 2WY6A 3H2KA 1HKHA 4OUKX 3VISA 2CJPA 2GYVA 2VAXA 3WL6A 1ZIXA 3VJLA 5BV7A 4KAFA 2AJLI 1RP1A 3BNEA 4EBBA 3QYJA 5K3FB 1ZI9A 1XRQA 2YASA 4FKBA 3F98A 5T4BA 2CUTA 3IVMA 5AM4A 5LZ9A 1XZEA 3FLBA 1BCSA 3WYDA 4JEIA 2XUFA 2Y2UA 1L7AA 4QNNA 1B41A 1G5FA 1QIKA 3DDUA 4Y2YA 2PU5A 2XMGA 1CEXA 1BN6A 1XQXA 4U2EA 4B82A 5I7UA 4UHCA 4BC0A 3I2HA 4C01A 2WHPB 5ALYA 2ZJ7A 4GI1A 4AN1A 4EZIA 1SOMA 2EEPA 2VATA 5K3BA 3DCNA 5AM3A 4CIAA 2QXTA 2PM8A 3BL8A 4WCVA 3DLTA 1SCIA 3D3NA 1Y37A 3WI7A 3H17A 4UUQA 2VTVA 3STVA 4CG3A 4XWGA 1QIMA 3PZWA 1MAAA 4DNPA 4DSZA 4QDOA 2WLSA 1CUAA 4DMFA 1ZJ4A 3FAKA 3D0KA 1P0MA 4X90A 2C58A 3C6BA 1XRRA 4LYDA 4GEGA 5AOBA 4AO8A 1CQZA 1FGRA 3ESDA 2HA7A 1R1DA 5A62A 2QMQA 3GELA 1QIDA 2XQIA 4J0IA 1QM6A 4J0KA 1AURA 4OYLA 3HI4A 1XZGA 5AI4A 5D3ZA 2RIPA 4B9EA 1CUXA 2VAVA 3PICA 4EY6A 4C4YA 2XMZA 4EY5A 3E0XA 1WCYA 1AGYA 3G0IA 4H7IA 3R41A 1W4LA 4QDXA 4QE3A 2YYSA 3AIKA 2XMQA 1O6GA 1JT2A 2OQIA 5ALTA 4ZV9A 4G1FA 1JFRA 4AO7A 2HA2A 1ROVA 1F8NA 4WY8A 4BVKA 3W9BA 4BE9A 1Y4KA 2QR5A 3FYUC 3D4LA 2C7BA 5JAUA 2O2IA 2BUBA 5C7YA 4ETWA 4FTWA 1MX1A 1LGYA 1CV2A 2DFPA 3S2ZA 3PFCA 2IIVA 3DQZA 4Q3OA 2C0PA 5CW2A 3JWEA 3D2BA 4I3FA 2QKYA 5CTAA 1R4ZA 5FP0A 1AZWA 2CEKA 4UHFA 5EIEA 1SFRA 3BWXA 5AKEA 3AZOA 5K3FA 1IK3A 2WG0A 4UBLA 3DJYA 1EXWA 1DT3A 2OCLA 3FSGA 1TIBA 2HA3A 3M82A 1QONA 3PF8A 2XUGA 5HCUA 2Y6VA 5ALRA 3WL5A 2QS9A 4FHZA 3X3HA 3WL7A 4Y2PA 2QJWA 5FPPA 4BRZA 1EDDA 2OQVA 1ACLA 3GBSA 3A6ZA 2ZSHA 5EHXA 5JADA 1XLUA 3V1LA 1E5TA 3C70A 1BCRA 4H7JA 4GHWA 4B9AA 1UZAA 5LKRA 3FYUA 1IZ8A 3C5WP 4H35A 2HA6A 3DS8A 3ILSA 1QMDA 1CUDA 1CUWA 1X2EA 2WJ4A 2XUAA 1UT6A 1Q84A 2ZJ6A 1IZ7A 3FOBA 3O0DA 5IVDA 1J07A 1PFQA 3C5VA 1XZDA 1R9NA 5FXMA 1QIFA 5FRDA 3RLIA 2WM2A 3AIOA 1P0QA 3G02A 3HEAA 1TCAA 4F60A 3F8SA 2DR0A 3FVRA 1AUOA 5AK3A 3FVTA 1DQZA 4Q3KA 1EB8A 1EVEA 3C6YA 4DNOA 2E3JA 5JZSA 4PNZA 5EEOA 1AX9A 1CIJA 3M83A 4F5ZA 3IA2A 2ECFA 1UFOA 5D6OA 4BB0A 1EB9A 4EHBA 4M0EA 1EX9A 3STWA 1CA1A 4K5QA 3QITA 3B3QA 3DOIA 1XZMA 3WKAA 5KREA 2JGKA 1UK8A 2GBFA 2JEYA 1LBSA 3G0GA 1QJ4A 2W6CX 1MX9A 1ZGCA 1MPXA 3R3VA 3FYUB 1MNQA 1GKKA 1VA4A 5AKGA 1UK6A 3F67A 2HA5A 3H19A 1AQLA 3PDCA 4PSUA 3BIWA 1ACJA 1FFDA 3D7RA 3I2IA 3CN7A 1QFMA 5J3JA 1U65A 3WMRA 4QDUA 2WIKA 3WL8A 1Q0RA 2JGMA 1K4YA 1E89A 4QDTA 5AKXA 4MWSA 3VVLA 3FYTA 1VXOA 5AM5A 5LZ4A 4BVLA 3JW8A 5EGNA 5ALLA 4X00A 1ZIYA 5IVIA 5ALXA 4DM7A 5AM1A 3IDAA 1CUUA 4JYMA 1R50A 1QZ3A 4X71A 3AFIA 2EDCA 2O7VA 3BNDA 2DSNA 3QPDA 3V9AA 4DSAA 1XZLA 4ZWNA 4BRSA 4NMWA 1CQWA 3WWCA 4X7BA 1CUEA 4A23A 2RI6A 4X92A 4Y2SA 4E14A 2HRRA 3Q8WA 3ESCA 1CUCA 3BJRA 1CUHA 4KEAA 4MXDA 1G4HA 3AZQA 1IMJA 3WJ2A 1RRLA 1XRPA 1CUGA 3WKEA 4H7KA 5DNUA 2XUIA 3H2GA 3H04A 1DT5A 1SCQA 2G4LA 1RRHA 5SYNA 5ALNA 3I1YA 1TCBA 5BWCA 1X70A 1EH5A 5SYMA 2VQ6A 1GPKA 1VLQA 3ZPXA 3WZLA 3R40A 5I8PA 3EQ7A 2XQKA 3BNCA 3O4IA 5AKJA 1UOOA 4P08A 4J0JA 2C5FA 5FOQA 1FGTA 2PSFA 2GYWA 3F97A 3V99A 1MU0A 1IUNA 4J0HA 3QH4A 3I2GA 1DX4A 3A2NA 4C4ZA 3EBLA 5A7HA 1JJFA 4X97A 4UBOA 4N5HX 2I3DA 4PF1A 4AX4A 1Q83A 1XRNA 1THGA 3STXA 4X3CA 1DWPA 5AK4A 3I6MA 1LNSA 2V9ZA 2V96A 4UBIA 4EY4A 4WJLA 2BUCA 4K6GA 4MJ3A 5D7BA 4UFNA 3DNMA 2YXPX 4U2CA 4G9EA 1ZI6A 4UBJA 3OG9A 4D9JA 5CT6A 5AOCA 3I6ZA 5AI5A 1VKHA 3RARA 4M0FA 5AK6A 1IVYA 1QIEA 2O2HA 3WWPA 1USWA 4Z49A 3PI6A 3A2LA 4Y2UA 1CUZA 5CT4A 4LYEA 5DYTA 5HKAA 1WPRA 4BDTA 1KU6A 7YASA 2QVBA 3K2IA 3FCYA 1QOZA 4ROTA 2J4CA 2GZRA 5AOAA 1ZOIA 2ZYSA 1QO9A 4QWTA 1H2XA 3VKFA 1EINA 5AKLA 4MYSA 1THTA 4AO6A 1YAHA 2ZYRA 4H7DA 4IH1A 4Q3LA 3C45A 5IH7A 5ALOA 3V1MA 1CLEA 4CG1A 3ED1A 5DJ5A 3WKBA 4CFSA 2IUJA 1KU0A 4AZ3A 3I28A 5C8VA 5A6VA 2PPLA 3C43A 2OGZA 3B12A 1EI9A 4KE8A 4HAIA 2H7XA 5JD6A 3ZLVA 3WKCA 1L7QA 3C6XA 1NX9A 3LCRA 3OURA 1RYYA 2DHDA 2QTBA 3ZWQA 2VJDA 4GDMA 4Y2XA 5JYCA 3HACA 2PUJA 2XUKA 4DTCA 4FWBA 4IO0A 4Y2JA 3RM3A 1W76A 4CCYA 3CCBA 4GLBA 3KSRA 4UHHA 5ALUA 4YK7A 4ARAA 3WYNA 4WFKA 3TEJA 3R3XA 5AI0A 1LPNA 1CUFA 1ZI8A 3I2KA 3DYIA 2B4KA 2C5GA 1TKRA 4B7ZA 2QRUA 2Z3ZA 2ES4A 2Z3WA 4KYVA 4PW0A 3C87A 4WFJA 3E3AA 3BXPA 3B5EA 3RKSA 3MVEA 5CT8A 1A8SA 1XKLA 1S8OA 2PSEA 3GA7A 4EUSA 5EIAA 2Z8ZA 2JGFA 2XLBA 1BN7A 4FNGA 2QM0A 3H0CA 1UKCA 1CFJA 4L72A 1OLPA 1J06A 1EA5A 2VSQA 2BFNA 5JASA 3DKRA 5EIHA 2XQFA 2FJ0A 5ISMA 1JKMA 2BGRA 3N0TA 4JH0A 2DHEA 5AM0A 2H1IA 3UUEA 1QO7A 1VJ5A 5JANA 1HBJA 4JUIA 4OU4A 4Y7DA 5T4FA 2XUHA 1F8UA 4FDMA 4TPKA 3SX4A 4CCYB 1VZ3A 4RE5A 1XZBA 4BC1A 2G5TA 5CXXA 2WUDA 4AMZA 3V1NA 3W06A 3DL4A 1AMNA 1A8UA 1MO2A 3Q0TA 4MQMA 1A88A 3I2JA 3G0CA 4Y2TA 4BTLA 2J4FA 1XKTA 1GZ7A 3WKDA 2JGIA 1FGQA 2H9YA 1K5PA 4E15A 3IULA 1Y7HA 3BF8A 5LP1A 4UHBA 5FV4A 5HFNA 4BAGA 1N8QA 3WWOA 3HYSA 3PFBA 1K6EA 3FLEA 3ANSA 2RAUA 4QWMA 1WHSA 1EVQA 1BS9A 4IH4A 5LYYA 4W1RA 1NU8A 1ZD2P 4GWLA 2JGJA 2WFMA 2HM7A 4ZV7A 1WM1A 2HDWA 1LPOA 3OOSA 2VF2A 3U1TA 4BVJA 3QVMA 2D0DA 5HF6A 2WIDA 3KOOA 2XI4A 2IX9A 2Y6UA 1EK1A 1GGVA 5HQ3A 4X93A 2CZQA 2PSHA 2D5LA 1RWQA 3E1GA 3WK8A 4KE9A 4E46A 4FLFA 3C6ZA 3NUZA 1W6RA 4ZREA 4F0JA 3IBTA 2ONCA 2WIJA 1KHOA 2AJ8A 1HPLA 2OCIA 5T4HA 1ODSA 1N5MA 2SBLA 5JALA 1DINA 2GBCA 5DNVA 3WWDA 6YASA 3I2FA 2WG1A 4B84A 1VZ2A 1XLWA 3PUIA 1FFEA 3BF7A 4ZRDA 3O4HA 3FWHA 2WUEA 1WPXA 3O4GA 2HRQA 5E2IA 5LIPA 2HU7A 3ICVA 4J3JA 4UFOA 2ZSIA 4L0CA 1YGEA 2ZJFA 5ALWA 2RONA 2XMBA 1YA8A 5ALFA 4B6GA 2PU7A 2LIPA 1ODCA 1C7JA 3WLAA 5ALDA 3WIOA 1J1IA 3QMVA 1DU4A 1K63A 4W63A 5ALMA 4E11A 2QT9A 4CI9A 4EY8A 4G9GA 4CIBA 2OPHA 4ZXFA 3DD5A 2DQYA 1MJ5A 3NOXA 2BJHA 3BE8A 4F21A 1UXOA 2GZSA 1YAJA 4LHEA 4ZI5A 5JAOA 2PSJA 5CH8A 5YASA 4U2GA 5AIAA 1XROA 1VE7A 5HK9A 1C7IA 4J0GA 4UBMA 3ESBA 1KEZA 4L9AA 4BDSA 2DQZA 5ALJA 4OSEA 1LLFA 1Z68A 4BP8A 3R3YA 1CVLA 2V97A 4PSCA 1UOPA 2VEOA 4BCDA 3EIOA 3H1BA 3P2MA 4GBGA 2XQJA 3KDAA 2ZVDA 4C89A 3D2AA 1DWQA 2BUAA 2WSLA 1EK2A 5BOVA 1LPBB 2JGLA 4B0PA 4HRXA 3W9UA 3WA6A 1PV1A 1FGMA 4W1QA 1F6WA 2XMCA 4P93A 4Y2VA 5ALSA 5F4ZA 4A16A 3ESAA 4YX9A 3WK7A 2QUAA 3QPCA 4X6XA 4KE7A 1QIGA 4UPDA 4JNCA 3WJ1A 4BZWA 2C4HA 3LIIA 3G9XA 3V98A 2GYUA 4Y9SA 2Y2VA 1BEEA 2WTNA 5FLKA 5H3HA 1QIJA 2G63A 3ICWA 1QLWA 3WK6A 1H22A 3S8YA 4UFPA 4KRXA 3LLCA 1TQHA 4Q1VA 1XZHA 4NVRA 1D07A 4XVCA 3R3UA 3D5EA 4QEKA 4LXHA 1DX6A 1NU6A 4BATA 2CB9A 5KWIA 2XUJA 1W75A 4G8DA 3C8HA 3WK9A 5AO9A 1CUJA 4BZZA 1WB6A 1QIHA 3MUNA 4DMHA 3E4DA 3VJMA 2H7YA 5CT5A 5ALKA 3WK4A 2WFLB 1GPNA 1UKBA 4X94A 5JD5A 3IB3A 4XIIA 1XRLA 2ACEA 4PQEA 4GXNA 4O08A 4FLEA 1CR6A 2PKYX 4EY7A 1XZAA 2J3DA 4LXGA 1MN6A 2PX6A 3V48A 5A7FA 2Z5GA 2ORYA 3F96A 4K6KA 1HQDA 1R88A 2XUPA 5E4JA 2XLCA 1OILA 5JZ9A 2OAEA 3AINA 4UHDA 3F9CA 1BEZA 2W22A 1MT3A 1E8MA 4IHAA 1A7UA 4JYPA 4HTAA 1YB7A 5A7GA 1H23A 4OB6A 1TK3A 2FX5A 4DIUA 2NW6A 5IVKA 3O9VA 1IUPA 1LZLA 2WIFA 2XMRA 4C88A 1GQSA 2OAGA 2OCKA 2HU5A 3MUOA 3L1IA 1DQYA 5JZBA 3M3DA 4XX1A 2C0QA 1QIIA 1XQYA 4QLOA 3UMJA 2VJCA 4P92A 5LZ5A 4Q34A 3W05A 3FG3A 4B83A 4X6YA 2Z8XA 4Q82A 2VJAA 3T52A 3FG4A 2JBWA 3V92A 1B6GA 1M33A 3KWJA 1H2YA 5C81A 5ALQA 5CXUA 4I19A 2WIGA 3GROA 1E3QA 5CT9A 3I6YA 5EI5A 3I1IA 4LIPD 2HL6A 2WHQA 4ITVA 1GKLA 2WU3A 5ALPA 3GFFA 2HA4A 4MYDA 4G4IA 2BKLA 1AKNA 3KXPA 5LLSA 1K8QA 3PE6A 4X6UA 3QPAA 4B80A 3CXUA 3HSSA 4W1PA 5ALHA 1EDEA 2FUKA 3OPMA 4ZGBA 4H18A 5ESRA 1LPPA 5LZ8A 3K6KA 4WY5A 2WJ3A 1VXRA 1HL7A 2PVSA 4GECA 4YPVA 2ZYHA 4W9RA 3KWFA 4WFIA 1ZD3A 1E8DA 2IITA 5JIBA 5A71A 3STYA 5DYWA 5LKAA 3G7NA 2WFZA 1UK7A 3K9BA 4UBKA 1GPLA 2PBLA 5HKBA 4B85A 2QUBA 1U8EA 3VJKA 3O9MA 3IUQA 3C8DA 1YR2A 3H2JA 5T4EA 5EFZA 3NWOA 2O7RA 1FJ2A 5AJHA 5JAPA 2WFLA 3DOHA 4KJXA 1MAHA 3DEAA 2Q0XA 4HS9A 4G4JA 1JU3A 1YSCA 1C4XA 4HZGA 1CPYA 1ISPA 2DCMA 1OXMA 3VDXA 1P0IA 2WKWA 4KRYA 3WZMA 4OU5A 5K3EA 2QOEA 1JU4A 3HC7A 1XFDA 5JD4A 3NGMA 1QTIA 4BE4A 3L1JA 4AB1A 5K5EA 3G8YA 2I03A 1HLGA 3UUFA 5AKKA 3D59A 5AKIA 1CUYA 2Y1KA 3G9UA 1LOXA 2ZYIA 4WDRA 4FFWA 4U2DA 3VXKA 5DTIA 3VVMA 4N5IX 5AHXA 2HFJA 1ZD4A 2XMSA 5EHNA 2VJBA 4MEBA 2OCGA 4G4GA 1VE6A 1JMKC 1QTRA 4P9NA 2RHWA 4S0XA 1WHTA 4H7HA 1GQRA 1EDBA 4FNMA 4OPMA 4DNFA 5CBKA 3VF1A 3W04A 3A70A 4H77A 4WDQA 2P0MA 3FG1A 1P0PA 1XZCA 5C8ZA 3QZUA 1U2EA 1LZKA 5AK5A 4FLMA 3OTQA 3ZI7A 1LPSA 1GXSA 4FBMA 2XUQA 1TAHA 1O6FA 1GT6A 4OCZA 2XUOA 4RNCA 5ALIA 5KBYA 4LXIA 4B81A 4MQLA 5JATA 1XZIA 1N8SA 2VA9A 2G5PA 4XJVA 4J03A 1JNQA 5KWJA 4Y2QA 3HLKA 5AKZA 3CN9A 4UBNA 2XT0A 3BDVA 4N8EA 3U0VA 3AUKA 2ROQA 2WTMA 3TGLA 1BROA 3GUUA 4U2BA 1ORVA 2WXTA 1WB4A 3CWZB 3N2ZB 1T4MA 4KACA 4BTVA 1R9MA 2OG1A 4DYHA 4QWWA 4B0OA 1CUIA 1YB6A 3IUJA 5AICA 3AZPA 2P8SA 1UWCA 3AILA 5DLPA 3H2HA 2RHTA 4TGLA 2AJBA 5AKHA 1ZJ5A 4HXEB 1UK9A 3TJMA 3FBWA 3MGAA 2AJDA 4J7AA 1UOQA 2DHCA 2RGUA 4NZZA 4AXBA 2I78A 3O95A 5EHQA 5JAHA 1CUBA 1U4NA 4N8DA 2WILA 3IIIA 2QXUA 4Q05A 3PUHA 5DTJA 1BRTA 1QGED 5ALZA 1CUSA 4FFVA 2HA0A 1JMYA 4BAUA 1SC9A 4WHAA 2PUHA 4DMKA 2O2GA 4PV7A 5HF8A 5LZ2A 2XQGA 5I9IA 5K3AA 3V1KA 1VA5A 3WWEA 4OB7A 4TVKA 2XDWA 1QE3A 1OCEA 1JI3A 4RPCA 3QBJA 1TCCA 2VT7A 4G8BA 4N8SA 3LS2A 4BAZA 2B20A 2OGSA 4MWTA 3EQ9A 4FOLA 3H18A 4H0CA 3WIBA 2R11A 4X95A 5CURA 2VT6A 2BCEA 4DMCA 4DLNA 5HF9A
chains in the Genus database with same CATH superfamily
1E2QA 3L6EA 4QZVA 3RVOA 5B1EA 1VMKA 4E5PA 2Y1WA 2HQBA 2JHPA 2HMVA 1M0SA 4NK5A 3DT9A 1O9GA 5CDYA 4FCCA 2X4IA 4KSYA 1W0JD 3FSEA 2DPYA 4L3WA 3GRFA 3GVHA 1PWEA 3B20A 2CXOA 3QELA 3E22B 3RWOA 4Z4IA 3SE7A 2F3SA 5AMXA 2EWMA 1R3DA 5EE0A 4R98A 1LK7A 3PYLA 1JHZA 2C88A 2I7VA 2VTEA 3IDOA 1XNHA 3E82A 3GR6A 3JVIA 5CNKA 3ZNNA 1L7MA 1CZHA 3RJ9A 1XN4A 4MKIA 4FX5A 4DNQA 3D6FA 4DOMA 2UYQA 1W52X 4WOJA 2AXEA 1JJBA 1KZ9A 3MWYW 4G1CA 4G5QA 5E3IA 1P9WA 4KXVA 1IZ9A 1YI8A 1DJQA 3SD7A 4Q3CA 2E37A 3WL3A 3KT6A 5B2FA 1E2HA 4YJFB 1NHWA 1QQBA 4KBYA 4LDPA 1OZAA 1USIA 1DTEA 3QM1A 3LIPA 5DNWA 2JATA 3OM8A 2BJWA 3KDSE 1YB5A 4ZJYA 2GA8A 3C3BA 3ZHBA 3STUA 1CY8A 4FYWA 4CLOB 1AKVA 4IX1A 3VVBA 4UUPA 3FUCA 5C8YB 3S28A 2F67A 4BMZA 5LU8A 1JS1X 1GDTA 1FA9A 3CLVA 3TZEA 5IUKC 3PEYA 2AFRA 1P62B 1PHRA 2AHOA 2PZGA 5L51A 1DRJA 1P4JA 3E7PA 1JEYA 5LZ7A 5JCJD 1Q7TA 1JJ7A 1R4AA 2O8EB 2DM6A 4HNAA 4DV6B 4O3MA 5KQGA 4NY1A 3HU2A 1I32A 5H68A 4J43A 4P7FA 4RS4A 2XKBA 1KEKA 2XHZA 1CRLA 1ODTC 2ECQA 4V2IA 5EPOA 3WNCA 4NPHA 3ZVNA 4H7FA 1BE0A 4KQEA 5BN3A 4MVCA 1PUIA 1SPXA 4EJSB 1HOTA 2OLEA 3LWDA 3LPLA 4NXNB 1LNZA 5FAXA 1PEYA 5LQSA 4C07A 1SCKA 1BXZA 1N1MA 1CJTC 2WUGA 2FNAA 3C5HA 3IC5A 3M6IA 3NUQA 5G0TA 3YASA 3GGGA 2JIZA 5DN6A 3FWKA 2YS6A 5JS2A 3R9KA 2A59A 3D4NA 5L8VA 3PQEA 1QGYA 2IKSA 3FBGA 3OJLA 2VYND 3LUPA 2NU8A 3ZWWA 2DUUA 4N9WA 4CT5A 4GE0A 5K3CA 1DB3A 3RWMB 1V1MB 2WYIA 4RX1A 3BGDA 1EFHA 3HCOA 4MSUA 1NO3A 3HPRA 3OQMA 3FCSB 4M1OA 4U9HS 5DXFA 2HSJA 2RGEA 3PC2A 5G2OA 3P20A 1RQLA 1ELOA 3REFA 1C1YA 3PX7A 4JI4B 3LDFA 4IDEA 3CC8A 4V3CA 3BWDD 4YJ3F 1ORTA 1E2UA 1P2TA 5EMLA 3BJEA 4PAWA 3WRYC 1KDPA 1H69A 1Y98A 4UE6A 4TKUB 5HS6A 3EVAA 3OMXA 1W8DA 3OQIB 4NS4A 4YMIA 1T5HX 1CC1S 4DDMA 3JD4A 4FEAA 1F0NA 3R23A 1WRBA 1YHNA 2FCRA 4YNBA 3G0DA 3VO1A 3LC2O 4FS3A 4BLQA 5KKNB 1LVUA 4OXQA 5ALGA 3KOXA 2Q29A 3V32A 3D8HA 3HRHA 1GQQA 3O8BA 4I1SA 1W88A 1M2FA 2B8NA 2H7CA 1VB5A 4P84A 5FL7A 5TT1A 1EPUA 3UATA 4A73A 1MC4A 1OBOA 4XI9A 1Z4QA 2VK8A 2UUPA 5EXEA 4E5MA 5J23A 2PDAA 2XB4A 1NI4B 1ZD5A 2VRBA 3AJEA 1E3SA 2CDRA 4HXGA 3RTDA 1Y7IA 4CQMD 4D0GA 2CZGA 3REGA 3MBIA 1CF9A 4I4TB 4WUTA 4YCCA 5JU6A 5B7GA 3QQ5A 3I04M 1HH4A 1Y8QB 3ZDBA 2AFHB 3TCXB 1UKZA 3C3MA 4JA0A 2JLQA 5DDIP 2EIXA 1QQ5A 3MS2A 3T5GA 4ER5A 5LQDA 4DJDC 5ALVA 3K9NA 4NCBA 4P54A 1SURA 2B1QA 4XR4A 5TEWA 4UOEA 5LUAA 4GWKA 4EAQA 1B8VA 4NBRA 4TTTS 2AOUB 2J48A 4W6QA 3L7KA 3MA0A 1KDRA 3IE1A 3CZ9A 4NHOA 3TFWA 3R3HA 4BNWA 4F97A 5KDOA 3IP3A 5JZOA 3AHIA 1V96A 1XRMA 3Q7TA 4G8CA 1LX6A 1MJGM 1N2HA 1PGPA 3ABRB 3L1KA 3PC7A 1K6XA 2CNOA 4ISBA 1F9AA 3HCCA 4BO2A 4D5GA 4D46A 4UPEA 3USCS 2A7QA 2ZR8A 3FCEA 1XEXA 2GESA 2XGMA 4GC9A 2I7TA 4HRYA 4BCBA 3Q7SA 4H7PA 2IUEA 3W8FA 3VR6D 5HMMA 3GJ7A 2B61A 4ESVA 2IZ5A 1EJ6A 1CEEA 1P31A 2H4JA 3LCJA 4ZYTA 4Y2GA 3A4LA 3K31A 4KAAA 2C2YA 3RUFA 3T4XA 4ZICA 1NJ8A 3DL0A 5DGCA 1QHXA 1W1IA 2PFSA 4EL0A 3WMWA 3IOBA 2GOYA 2PT6A 1YS2X 5F4BA 1D1PA 3AI3A 1D4AA 1A7JA 1AZSC 2AW3A 3D7KA 3IQEA 2D5BA 4WNAA 4A82A 3DT8A 1EUDB 4L3VA 3ROPA 2CF5A 2EWWA 1AO3A 1CD5A 1L4LA 3EQ8A 4XCQA 1XWIA 4ZP1A 2H92A 5IXSA 5JH7F 1GWNA 2WHRA 4KDEA 1IUOA 5I7SA 4ZCRA 1EFVA 2QRKA 1R8XA 3MT9A 5HK8A 2GXQA 3K0AB 2M2IA 3D3KA 3VI3B 5ARBA 2HJGA 1WSDA 1G16A 2NV0A 4KLRA 4M6WA 2FMKA 2OZKA 2R00C 3AW9A 3DXZA 1XTPA 2BHLA 2P27A 3FNEA 3RSCA 4DREA 4X7PA 3D8NA 2H54A 3DB2A 4LHZA 1UL1X 4DRXA 1VGQA 1A76A 2IYVA 2WYVA 4IQ4A 4M7WA 5AIBA 1UJBA 1LFDB 1VHJA 3PG5A 1FK8A 5ADVA 1MNAA 3DV0B 1JXQA 4L4ZA 3C8ZA 2GZ3A 3R7AA 1N3IA 1GOTA 1ZHHA 1UBUS 1IWBB 1DAEA 1IOVA 1V6AA 1JEOA 3MRXA 2DRIA 3NYIA 1NPTO 2QRNA 3QP9A 4LISA 1SIBE 3HPQA 4LDAA 4R83A 4KXQA 5IG2A 3NTLA 1D2HA 5HJEA 3K6RA 3E5RA 4KWIA 4D02A 1NZDA 2OV1A 3AESA 1GYGA 1N6OA 4MO2A 4PS0A 4UVDA 3TKLA 4AC9A 4YAFA 1IJFA 2RH9B 2VHJA 5CH5A 3MHTA 3JPYA 4QA9A 2CJYA 5DM1A 5EWJA 1M6HA 2AOUA 1A95A 5LFAA 1SKMA 1ABBA 3LOPA 4QAQA 2NQTA 1KEEB 4NHEA 4PO3X 4ETNA 4ZQHA 3UPTA 4CFYA 5DSXA 2PNFA 2IU6A 3D54D 1FGOA 3IP8A 3LQKA 4KTTE 4ILKA 3O8QA 3WQHA 3LCCA 3HJTA 2OHVA 5BN3B 1KK3A 4PCUA 2BLNA 3UWSA 3B6MA 5AI8A 4IHJF 2UVPA 4Q16A 2RGCA 3L07A 2N75A 2A9JA 4C5BA 1A97A 3RV4A 4QOFA 2L18A 4FONA 2Q7OE 2IYNA 5TARA 2PUAA 5AXDA 1FX0B 4P4SA 3KLPX 2NZUG 3HXKA 2P40A 3D64A 3W5DA 4LZAA 7AT1A 2BF7A 1AS0A 1G7SA 2YYAA 4JT9A 3CU5A 1P81A 1U9IC 4L5CA 4K6HA 4M1ZA 4ZQBA 1CG6A 1XWFA 3C1TA 4YVFA 4UM8B 3GEGA 4HDKB 3A1FA 3NFRA 4TSKA 3ZWCA 2BGNA 4RQBA 3B1XA 5IVHA 2H2IA 2BGUA 2PZFA 1PP4A 4M21A 4X7MA 3CX3A 3QPBA 4HQKA 4QG7A 1XQVA 2QZPA 4HQFA 4UMEA 2I7CA 3QMMA 3JARA 4MS3A 2EGHA 5TY0A 3TO5A 1P7PA 5DWDA 1HRDA 3ZIUA 2FPIB 4A2QA 4JXXA 2W2LD 4LC1A 5KTNA 3O4RA 4EUEA 5CGZA 5A5GA 1JHMA 5EJ9A 5BXQC 1GN8A 2EQ5A 4L02A 4NH4A 3G9TA 2O7NA 3DKKA 4F1JA 1QU2A 3UH1A 2TMDA 4A26A 4MPJA 2LTAA 4GM4A 3O8YA 3W2FA 3ETHA 5JROA 4EVQA 3I9MA 2VT3A 5HPYB 1FFCA 3WK5A 1GPJA 2VHCA 2IH4A 3FTEA 4HVAA 1D2GA 4N0DA 5EWLA 2OK8A 3UHOA 4N5LA 4BGEA 2HT1A 2WJVA 1T3HA 4QLAA 2RG7A 5E4TA 2XWQA 3Q8LA 3W6ZA 1Z33A 2GNPA 3PSHA 3SXJA 3AFNA 4LMAA 2MIIA 4Y67A 1GSIA 1U2QA 1E58A 2Z2XA 5F52A 1OQAA 5FJIA 3S5JA 4BP9A 2W2XA 2NTYC 1QWOA 3GH1A 3T95A 1K6MA 2E4ZA 3H2KA 4GQBA 1E20A 2ZLBA 5FOWA 4D4LA 3WYAA 1SB8A 4MR8B 1GY8A 1V8OA 4C0BA 2AUNA 4P58A 1V2HE 2MYNA 1REQB 3BCSA 4CQMB 3X1MA 4Q7JB 1KZYC 2GYVA 3LFUA 2EKDA 4IWXA 4JVMA 1ZIXA 1G5PA 4TYWA 1ANKA 2C4TA 4KZPA 4IS2A 2NQ8A 2DX7A 1XDSA 1M3SA 3P9YA 1F2DA 2AJLI 4XGRA 3A3PA 4KO3S 3V8NA 2MSKA 4FZRA 3L0PA 2A9PA 1UPBA 2DPLA 1G6KA 4G84A 5K3FB 3HCRA 5BSWA 1XRQA 4KNYA 1L4FA 3CRNA 4W9NA 3MSCA 4XWTA 2UVPB 1FDSA 3KKPA 3F98A 4C04A 2F3PA 4D98A 4NYMQ 2G3YA 5F2KA 3BH7A 2FWPA 2MYUA 2CCKA 2Q3EA 3PC8C 4HX5A 4KLZA 4XDZA 5BPHA 2QQGA 1S7CA 1Z15A 2HBQA 4K26A 4OA5A 4PG8A 2WLTA 4LVCA 4RHXA 3FLBA 1H93A 3WDLA 4KYTA 1P5ZB 5B6IA 1OWNA 5L3QA 1G59A 6GPBA 5D7NA 5A4IS 2WYOA 5G41A 1SHLA 2I0FA 3OQNA 1DZ3A 3RF6A 2PEYA 1L7AA 4HTFB 1J56A 2TYSB 4QNNA 3CSSA 4EOGA 3HK2A 1VLJA 1EUYA 5LBIA 2HH9A 4YN3A 2CC2A 1LLCA 4GI3A 4JB3A 3C5EA 5IMSA 1TECE 3CEJA 3GRRA 4YHBA 3JX9A 4DSNA 1LK0A 3EMKA 2BTQB 1H2EA 3RRBA 5B53A 3WC4A 4CM9D 3G2JA 1EIZA 3RYIB 4B82A 5I7UA 3JYOA 3IDZA 1AHIA 5BN5A 4LFBB 2BHTA 2L19A 3I2HA 3MJDA 1GTSA 1L1RA 4H9GA 4JDUA 3RKUA 1JTEA 4YIKA 3C3CA 2DKOA 4GI1A 1ZH4A 2UXBB 2Y76A 1QTNA 5PGMA 2V59A 1UCFA 3AVXA 2EEPA 3SICE 4BE7B 3RKRA 4RHEA 3ZVKA 3NONA 3ROXA 2Y0BA 4ANFA 4ZGWA 3M1AA 3NJ8A 4P7BA 5CVCA 1OLSB 5ESXA 5LLTA 1YO6A 3DMTA 1MEJA 5AM3A 1WMFA 1FU4A 1TXGA 2V45A 1JAIA 2GT1A 4Z9XA 2P65A 4DIKA 2V58A 1WULS 1JQ3A 2B78A 1SG9A 2CL0X 1YDEA 1X9GA 3LAWA 2IXEA 4MV7A 2JA2A 4N5DA 3A0RB 2HK7A 2XCOA 5KX5B 2ON6A 4HQ0A 4EX6A 1XXHA 4GPTA 4AQYB 3I4LA 1ZRHA 2JFGA 1O0SA 3KKKA 2H2DA 3CNEA 4ZALA 1QQ6A 4ZOAA 3IAS1 2VTVA 4G4SO 3DAHA 4RDCA 5T6MA 4CG3A 4X63A 4RD0A 4S1TA 3U3ZA 1BKYA 2W6ZA 5U4XA 2NIPA 3RUDA 4DNPA 4DSZA 4G0YA 1GR1A 4MA0A 1TAUA 4NJEA 2F00A 2ET6A 4OMUA 4QDOA 3Q9SA 4UNPA 2O3TA 4YQEA 4Z4HA 1U11A 5KNBD 2LDBA 4DMFA 1ZJ4A 2RC5A 3ABIA 2FSPA 3FAKA 5TV2A 3DF9A 3UUGA 2V3WA 3KUXA 5H8WA 1DPGA 3WP0A 3H2SA 4YCBA 4H0FA 2OMEA 2NZVG 5AOBA 1NURA 4MW6A 1DG3A 4WHMA 2QMQA 2FSUA 3GELA 4XIYA 4QQKA 3A14A 3DSRA 1NI3A 1V5EA 2RI1A 4CLRB 5CBPB 1AURA 4OYLA 5DV9A 5AUQA 1IK6A 1WP4A 5DNDA 3P8ZA 4HMPA 2XTZA 3IP1A 1N6NA 3UNXA 4KR7A 3DR3A 5CDUA 3K35A 3K2BA 3OKPA 4KQJA 5EXPA 2JGDA 3WLSA 3QVVA 3I32A 2VHWA 1JT9A 1YJ5A 3SSOA 1J25A 2AYXA 3PICA 1RAAA 2B69A 4O2AA 1DOZA 4FYKA 1M8GA 2NSYA 4G89A 1XDGA 4C4YA 1SXPA 1WCYA 5GJVC 2QLMA 3G0IA 2ZEJA 4MLZA 4EIWA 3S8EA 3I5XA 1KH2A 5BNWA 4KLNA 1G20A 3T41A 1TJ5A 1FUKA 2NQ2C 2QPOA 1QP8A 1Z0DA 2Y92A 5DBFA 3TI7A 1W4LA 2J9ZB 4QDXA 3KG2A 4ARUA 2ID8A 2GDZA 1GG5A 1M1YE 4QUJA 1UPFA 3AIKA 3NTOA 1H05A 3QVGA 1V4VA 4RJKA 3B3FA 2PRYA 3NQ41 1O6GA 1PT5A 4MDFA 2IYEA 1Z5NA 3IODA 4QOHA 5ECGC 4AKEA 4XGKA 1UKYA 1SXGA 3CPJB 1Q50A 2OSVA 2KSQA 2ODTX 2QW0X 4G1FA 3N74A 1ZLYA 2HA2A 1ROVA 2II6A 4ZVPA 4Q7QA 1YCGA 4CEJA 1U6KA 4U8GA 4A0SA 4QXQA 2IYZA 1U8FO 3E1SA 3M4YA 3QEBZ 3UV3A 3EMBA 1QZZA 3ER9A 4F7WA 2QR5A 4P5PA 3ZJVA 5C4MA 3FYUC 2Y77A 3DXXA 4ZI7B 2GPAA 2C7BA 4MUJA 2GM9A 4QPCA 1GL3A 3DEHA 4PBTA 4V1CB 3AYXB 1ZNYA 4JL6A 5BRNA 1M1ZA 4MGIR 1T9ZA 2O2IA 4ACAA 1WD5A 1LTHR 3FSJX 4KIWA 4LNUB 4ETWA 1UJCA 3TFQA 2A0YA 2F90A 1U2GC 4FTWA 2IPAB 3QW4B 1HF3A 2WHEA 5CB6A 3HXQA 2Q4RA 1CV2A 2OZEA 1EBUA 1P17A 4AMGA 4ZKEA 1IWOA 2BR3A 2FMXA 4BO0A 4RVGA 4D9EA 1CIVA 2E4WA 4Q3OA 1DEKA 3AB8A 4EG3A 2I4TA 2H3HA 2HDOA 3GJQA 4PFJA 4KQ9A 3EGXA 3JWEA 4J1QA 2R8XA 2QKYA 4TQAA 4AY4A 5BVHB 1R66A 1MKYA 4ZAWA 1F8XA 3ECCA 3W2IA 3GLIB 4AJHA 4UEKA 1X1CA 2P8JA 4UE2A 3OO0A 5EA2A 5C1IA 5BQOA 4OHBA 1VECA 1Z4JA 2R25B 5EIEA 4ZPJA 1PSWA 2MWMA 2ZREA 1C1XA 5DYNA 4ND4A 2VYVA 1UKVY 1PZNA 3IOEA 2R7AA 4C20A 1TMYA 3VX3A 1QOQB 1B8UA 2ERCA 1YUNA 1LWNA 4U63A 5K3FA 5J4VA 2WG0A 1LDEA 1HG0A 3DBVO 4Q4AA 1V8BA 1S2DA 2RHMA 3TE7A 3WJAA 4F72A 2W6IA 4IIDA 4XYLA 2OCLA 1O6CA 4F2PA 1TIBA 3TL6A 4ZOBA 3W9SA 1BE8A 1FVFA 3U2QA 1V7CA 3H4IA 3PF8A 1KQNA 3NEPX 3G6WA 1T35A 3PUKA 4R51A 3G2QA 3GHYA 3LLUA 2A9FA 2FGKA 2R85A 2Y6VA 3LFHA 4KMMA 1TA9A 3MTDA 4LK2A 4XLLA 4EL5A 3WAJA 1RDFA 1Y8RB 1C5KA 4LJAA 2JHFA 4MB2A 1NVBA 1HR0B 1X0XA 5LXTF 3E7DA 3OLQA 1A82A 1R9GA 4JBWA 2FK8A 2FHSA 2P0EA 4GX0A 1QXSA 3VH3A 2IUUA 3D4OA 2ZTVA 2GJKA 3DKIA 3X3HA 4BBPA 4U9IS 4UNQA 3WL7A 3PNOA 4J2HA 4QFBA 4Y2PA 4YRRA 1A5AB 1G98A 4HB0A 5BT9A 5JS8A 1K89A 4S2EA 1S8NA 1LW6E 4ZVNA 4YI5A 5EE1A 1JR3E 1LVGA 1Y6QA 1D4FA 2CXXA 4G0MA 3TLXA 2HBYA 3COPA 3P0JA 2JI9A 5EHXA 5JADA 1G9TA 5T3YA 3BMXA 5BN5B 5FL7D 1U1GA 3C70A 1BCRA 3BCUA 3C7KA 3LL7A 2DC1A 2B6HA 2VKQA 4PGHA 4RPJA 3VM6A 3ZKWB 1QVWA 4RIHA 1QF6A 1U0JA 4GHWA 3MWFA 1UZAA 2ZI4A 3E27A 4QQRA 4MVYA 1YFKA 1D4OA 1KARA 1XR3A 2G09A 1MJNA 3L6CA 1RQPA 4HDSA 5KIAA 4O63O 4DDVA 2D5CA 2YQ4A 3DS8A 5GINE 5K4AA 3RT9A 3OHSX 1CZLA 5K0JA 2HW8A 1A04A 1QMDA 1HQKA 2DY0A 4R8MA 3UJAA 3H11B 4JB0A 1WOYA 4KHZA 2WJ4A 2XUAA 3PVCA 5T67A 4DXDA 1HDZA 3E4CA 4DDHA 3NIDB 5KVSA 5H5JA 1JPVA 3CRW1 1YGPA 2FY8A 4F1WA 1M2VA 3HDGA 2VVTA 2ZJBA 3MJHA 2ZRIA 3C5VA 3CNLA 5ER6A 3U9SA 1C7EA 1SCUA 3RGWS 3W6UA 3R9XB 2QMYA 1R9NA 2XDYA 1KSGA 3HBMA 5DX1A 1QIFA 3TQFA 3V4PB 2XTNA 1USKA 2R8OA 2CY0A 1ND6A 2IODA 4HVCA 2PRKA 4H3VA 5LMNB 4GUDA 1N34B 2KQUA 2W6QA 2CZCA 2ZSBA 3WQRA 1P7ZA 1X7WB 3AHHA 4J1NA 3RSLA 4OREX 4UTOA 5GONF 4L4XA 4OBXA 1VCIA 4GMDA 5JDIA 1H2HA 1W4AA 1FMFA 2C9CA 2YINC 3FVTA 3HL4A 1FTSA 1EB8A 3VKVA 3OPYB 2ZSUA 4B75A 4ALNA 3PU6A 3ZE7A 3RYCB 2ZIXB 3ME5A 1CQPA 1YBMA 2JAUA 2ZRPA 2FW9A 1ONNA 3OTHA 4G41A 3M83A 3ELYA 4GUAA 4F5ZA 3VOTA 1QSGA 1SU7A 1MIOB 4WCFA 4GPIB 2ZSJA 5D6OA 1C4WA 3MFYA 1KHHA 5CVEA 4BLTA 5JYBA 1RYEA 3F4LA 4HWSA 5K1ZA 3KEOA 4EHBA 2G1JA 4YMUA 3HO1A 2BMWA 4M0EA 4EHFA 5KNDH 1B0UA 2W2NA 3UKJA 3U19A 5IJZA 5GIPE 3MBOA 4K5QA 3GEMA 2VRWA 4JBYA 3UKDA 2ASVA 1PWXA 3D5QA 1XZMA 2EP5A 1FMCA 4ECEA 3NOOA 5GZ1A 2YXNA 3HB7A 3ZWAA 5C46F 4TKZA 4XEHA 4KX3A 4N7BA 1ZZEA 4KNWA 3G0GA 2NZXA 2PYIA 2DFVA 1XAIA 1Z17A 4UD6A 1MX9A 4WKOA 5CXSA 1MPXA 1CY1A 4QFCA 1Z12A 1QK5A 5I9MA 1G5IA 1PRYA 2QP3A 1Y9ZA 4XD2A 1W4CA 1UK6A 4EI8A 2DECA 1MD9A 3F67A 2UZ4A 4D9MA 4TS1A 2BSXA 3L0CA 1SKYB 4U9UA 1NVFA 2HK9A 2RBEA 1WB9A 1Y3CE 8MHTA 1JKFA 3LW8A 4IDFA 5J4LA 3CE9A 1IHPA 1JA1A 3MUEA 5LNK1 1JUDA 1ABFA 1TUEA 5B1HA 3TKAA 3KB6A 4X3PA 4IYRA 2LKCA 3BIWA 3NBAA 3WIVA 3W4JA 2RB5A 4QUKA 1FFDA 4CM9A 4D99A 5CG1A 3S7TA 3WRWA 2OK7A 5DU2A 2OB2A 1AS3A 5AT1A 4DJJA 3KQQA 2A30A 4R4JA 3BWCA 3QV1A 1T91A 4OKIA 4RZHA 3JQ7A 1QYRA 4HGYA 5ICEA 5JNSA 1S3GA 2PGOA 2CGEA 4CKWA 3AGQA 3DZHA 2AZMA 4XM0A 1ILWA 2EQBA 4PZ9A 1YIOA 4L0MA 4GVLA 2ZUEA 2F3QA 4QDUA 3T7IA 4R7TA 1I8TA 5F5NA 3EK2A 3OLXA 2JGMA 5ILOA 4CEIA 1HYGA 1VL5A 1KPIA 1MB2A 5FTNA 1Z3CA 2I8AA 1QR6A 2IUSA 1JWBB 1GRNA 1YE8A 4Q7MB 2VTDA 1W94A 1XFAA 2TMYA 1KP3A 1DAMA 1JF8A 2HQ1A 2D62A 3F5DA 2WFAA 3FYTA 2FPSA 4JASB 3VR5A 1VXOA 5AM5A 2QN1A 2I1VB 4LY3A 2X22A 4C4PA 1EMDA 3WGVA 5LZ4A 1GSOA 4HNQA 2IF2A 1BSVA 3A25A 3RRMA 2YXDA 3TQIA 1VJTA 4AJPA 5ALLA 2NTVA 4DM7A 3AU9A 2BHNA 1P8AA 2E7ZA 2Q1SA 3NEYA 4Q4JB 1PS8A 2IS2A 3LKZA 1M1NB 3C85A 3JAKB 2VZ8A 5FNVB 1GAWA 1FFXA 1XRSB 2F1HA 3Q5EA 4MVJH 4Q1AA 2D00A 2HMSA 2CHUA 4WASA 4KQMA 5A5DA 2X23A 1IBLB 3K6JA 5DCLA 4DY4A 5JPIA 2V7UA 2VWPA 1YE5A 2OILA 3AEQA 4FILA 4R40A 1J97A 4M53A 1AB5A 3AIIA 5FBHA 3R7FA 1ZNQO 1PR0A 3U3KA 3BNDA 4BQFA 5EJMA 3V9AA 1DJOA 3GXBA 3KYBA 4PINA 5DHSA 4ZWNA 4A0FA 4BRSA 4RVNA 3MCZA 2VLBA 4YJDA 2Q0SA 1UZLA 2YVUA 1WAMA 3ABQB 4QYSA 4A23A 2ERXA 3DE4X 3U44A 1DBVO 3JD1A 2G9RA 2XECA 3DGFC 4CF4A 1DQSA 4DC9A 1ATIA 4NCKA 3OU7A 2O7QA 2WD7B 3BJRA 4WECA 3LX5A 4CF5A 2J6HA 2HPZA 2DWUA 3A1NA 1EG2A 1PT9A 1R0YA 1T2FA 4KEAA 3S0JA 2XCSB 5TPWA 3AF3A 4I66A 2X13A 1OV4A 4IUBS 4RK7A 4JYCA 2Z4RA 3ZV6A 3C4QA 3W79A 3JD0A 4MA5A 1RRLA 3HSYA 1CQJB 2ZCUA 2GM4A 2UYHA 1T0HB 3FVVA 3WKEA 1QP7A 3N8KA 1PR2A 1BO6A 3V8QA 2PRZA 4EM6A 4CGYA 3VGJA 2R7LA 4HQ6A 1DAKA 4FQ7A 2IELA 3H2GA 1C7RA 3L5OA 1NQXA 4NYJR 1XJ5A 2J32A 3GBPA 3QVWA 1FJGB 1QG0A 3A1WA 3PHIA 5I8ZA 1CLUA 1KEWA 3LYAA 3OZ7A 4H3KB 3HL0A 4UDXX 3A1UA 5IAKA 5TXGA 1OA1A 3OZIA 1XK7A 2KLHA 4LCBA 4HNHA 1UBTS 3JQAD 4QIHA 3E5HA 1TPZA 4WMLA 4YR7A 1TJ4A 3HVUA 1P9NA 1D7OA 1GPUA 1Q77A 4FI3F 4U0JA 5FBWB 1E4EB 5C51B 4IINA 1N33B 5AUOB 4OGGA 2F59A 2HCTA 2OD2A 2OM6A 1OJLA 4V0RA 1VJ1A 2WQ6A 5IYZB 4A15A 1NYTA 4FZVA 5EE5B 2BGIA 3HCEA 2HNAA 4IBOA 2Z58A 1USVA 5M2QA 4AS3A 4YAKA 5FFNA 2VTKA 3O31A 4L5BA 1NG1A 4F5DA 4S05A 1L9XA 4C0SA 2ZSEA 1Z2CA 4I1IA 4LRQA 5EHGA 2GN0A 2XQKA 621PA 4JR1A 4YQFA 2P2CA 1D1SA 4JMPA 1T4CA 1ISSA 3O4IA 4P08A 2VCEA 4JBHA 4B3IA 3KR9A 4RSRA 2EL7A 3DCYA 2JHGA 1JFTA 2XVMA 3LOUA 2VIIA 1FGTA 1OTHA 2WMDA 3UTDA 3KYCA 5CA1B 8AT1A 5JECA 2J0QA 2EVWX 2F9FA 3B6KA 3BD7A 3MFQA 4AP9A 4D74A 1RU3A 1O4VA 3AM4A 4IKOA 5IFKA 2A9VA 4NZYA 2AN1A 3F97A 2ACWA 1OB2A 2VWGA 4KXWA 1I9CA 5LYJB 5TQ2B 4J0HA 3BWBA 1Z6PA 1GA6A 2V9CA 1LY1A 4KN5A 1U7OA 3A2NA 4IRMA 4C4ZA 2O8DA 1KIMA 2JFXA 2YICA 2XE6A 1XP5A 3O2SB 4GBED 3NP9A 4LOAA 4MVXA 4D6YA 4I1PA 1QCCA 2A57A 2EWVA 3A1EA 2J6CA 2IYAA 4I50A 4RDXA 5A3SA 3V7WA 3N76A 2C31A 2RH8A 4HAOA 3D0QA 4LX0A 4F91B 1BYIA 3QYFA 1RBMA 2QD1A 1PFVA 2OCBA 4HL6A 5JCPA 2H65A 4MR8A 2P5SA 1WQ3A 2G1AA 2Y0CA 1H5UA 3GGSA 2C4WA 2HBRA 3IJEB 4C06A 5BRJA 3UM9A 2FEKA 1VLLA 1DWPA 4V0QA 1PEAA 5AK4A 5HE9A 1BD4A 1DTWB 4YGYA 3OA2A 3GCWA 1AK2A 1FB5A 2X0IA 3HCNA 5F9FA 1C8LA 1O95C 1X39A 3GCGA 4UBIA 1JJAA 2VWHA 4GXQA 4M87A 2ZIGA 3G17A 3TQSA 4AT1A 4MI1A 1VFPA 4I08A 4D8VA 1ZUNA 1A9ZA 1PWYE 2GD6A 4ZHQB 4N0MA 3RRXA 4F92B 1JEJA 1HV8A 1P1CA 3DLHA 4MJ3A 3NRBA 4UFNA 1CZNA 3ZD9A 4L51A 3ZZUA 4US0R 1O03A 3DNMA 2EC5A 3M6VA 1BFKA 5JSZB 2H2HA 1EEHA 2WJZB 2WPDA 4FDUA 2IE8A 3KSZO 1YC5A 1EHIA 3E5NA 4LV8B 1SXJA 2MINB 4WXRA 4D9JA 2FEAA 3JARB 3PGJA 1BS2A 4J49A 5U1PA 2P4EA 3IVAA 3VDMA 4BWVA 4DBLE 4JZKA 1UFQA 1SVKA 1VKHA 3G8BA 2IPNA 1AUXA 5L7YA 5L3QB 2AG8A 4CETA 3AU8A 4F3RA 2BMVA 1QHHA 3RIXA 1ZUD1 2B99A 1I3NA 3WGKA 2OHGA 1TEXA 4NCNA 3B5IA 1TFRA 1GNQA 1V25A 3ZHCA 2CLOB 1WBBA 3IAUA 2RH5A 4O2LA 4UPVA 3AI2A 1Z47A 1CUZA 4Y2UA 3H9CA 1J0XO 3TRHA 4G37A 1UFKA 5DYTA 1HT3A 4KGXA 3HA5A 4BDTA 1KU6A 1GAXA 3QE0A 4DA0A 3ZU3A 2XD9A 3GX1A 7ADHA 1Z2EA 3K96A 4BMXA 1RZUA 1Q7EA 1UBEA 1OA0A 2J4CA 5CEJA 1NDUA 3O82A 3VNUA 3G1WA 4YMTA 2G06A 4ZKDA 3CLSC 2PHZA 2RK3A 5DBEX 3ICQB 4HH4A 2FRVA 4D79A 1FC0A 3PD1A 2C0CA 5AOAA 1X74A 3KE8A 4CQMA 4KQGA 3LTNC 1JNYA 1M2HA 1P4HA 3CRZA 2HT6A 4UQPA 1QO9A 4QWTA 1C4KA 5TQ2A 1JQEA 4ZQCB 2RHDA 3CWZA 3OT1B 2ZIFA 3WHPA 4C4OA 1XAJA 4BN0A 4D81A 1INLA 1UC8A 3SQWA 1E9BA 3HJBA 1THTA 2IHTA 4AO6A 4CVNA 5CA1F 3MLBA 2B5VA 3VZSA 1Z5GA 4DZTA 4EF5A 1R4NA 1VHLA 2G82A 4K05A 3RBAA 1MFPA 4B09A 1KH1A 4GM0A 5IH7A 3CTMA 1SXJE 2ZRJA 1CS4C 1OOEA 4D92A 4OIFA 4KWTA 4P32A 3JSXA 3GLIE 2FR0A 1RMYA 4J75A 1L4NA 4K9MA 3V1MA 3W5IA 1M8JA 5I51A 1U0HC 3DP9A 3GFQA 3H1EA 3QWFA 3E9ZA 4QBFA 4QRIA 3ASVA 1JQKA 4AXXA 2ZZNA 3P4UA 1R0WA 2OENG 3DTVB 3MUFA 2J9FB 2OD9A 4TV8B 4RC9A 5E7QA 3SGLA 4YYEA 4CI0B 5JH7B 3C43A 2YUIA 4JENA 4L0DA 3MS7A 5B3AA 3U4GA 4DPLA 3ADOA 2FAXA 2A7XA 4KE8A 4HAIA 3PQ6A 1BHO1 5LC1A 5AW3A 2QNGA 1JSXA 1ZM4A 3H5AA 4XDHA 4D25A 4KVAA 4RKRA 2JBAB 2W2TA 4XPIA 1NX9A 1QVZA 3LCRA 3M6XA 3OURA 1N2BA 1PCXA 2Z95A 1RRPA 4DLSA 2VQFB 2QX4A 3RYFB 2V0GA 1NTRA 3JQRA 2PJZA 4RK4A 1KZHA 4KHPB 2JJ1A 4GDMA 1XQ6A 2FWRA 3MRTA 3IBFA 2XVYA 3DO8A 3X1YA 1OFVA 5FADA 1NRIA 5JYCA 1XNJA 1O8CA 1C8KA 2KHZA 3DLPX 2PUJA 4GBJA 4RELA 4C4RA 4CDRA 4LI3X 4N49A 2QMHA 2RK4A 2ZSDA 4OL0A 1J33A 2NYRA 4WWHA 5BWMA 1A2KC 1NVAA 1O1YA 1J24A 3CCBA 1BFUA 1A1SA 1FXSA 3LT1A 3UVEA 1IG3A 1F0KA 1L5VA 1Z0SA 3KSRA 1E1MA 2IEZA 4BUCA 3BMNB 2XKAA 1OFUX 2XYGA 1S02A 4ARAA 4QG3A 3OH8A 4WFKA 4XWKA 3H2ZA 3R7BA 2HLDA 3Q0EA 3FZNA 1U2PA 3ZCXA 1Q91A 3E3OA 4K46A 2YJTD 1CUFA 5GJWC 3IESA 3GUCA 2C5GA 3INRA 4J6FA 4GPAA 4NFLA 2FN9A 1CRQA 4E13A 3AQ4A 3TD2A 1NSTA 4B7ZA 2QRUA 1QCZA 3AGPA 1P2BA 4BNMA 3VNVA 5C9ZA 4GGOA 3DXFA 4KYVA 1EDOA 4WFJA 4RV4A 1Y3FE 2V65A 3HB0A 3TECE 4LTMA 2PXXA 3O1IC 5IT4A 2A1IA 5DO9A 1GZ3A 1AQIA 3GG2A 3VYWA 2CMHA 4YV7A 2ZDGA 1A8SA 2PSEA 3MWLA 3WBFA 2XCIA 1AZTA 3P9XA 5JVDA 2QTVB 4EUSA 3BFPA 1V45E 4K9SA 2IA5A 3ESRA 3PXXA 4A2PA 3R3SA 2JHAA 1X7YA 4O1IA 2R65A 4N01A 4H3SA 4OO3A 821PA 3F49S 5M5BA 4KLAA 3WGZA 2ZRNA 4UDOA 1U9IA 1G6OA 5BV2P 4UASA 1BN7A 1TF5A 1LA2A 1T8PA 2I6SA 2QN9A 4FNGA 4XTRA 2M6LA 4RY0A 3H0CA 2WWGA 4JY7A 1DLIA 2O6LA 1G1AA 4HDRA 1W0JA 2REBA 4X44A 4UM7A 3W5BA 2R6GA 2GF2A 2QP9X 4GX5A 4IUCS 4DBLC 3CNNA 2VSQA 1J06A 1T0IA 4KYIB 2ZWIA 3GPIA 3UA4A 3UJ9A 4BEBA 1WXDA 2RHOA 3ZHVA 2RHBA 1N7HA 2P75A 1L7OA 4XJSA 1XU9A 2QEQA 3LYUA 1N0UA 1EX1A 2GSDA 3C98A 4JH0A 4YWHA 2YYZA 3RRZA 4NPAA 4FUQA 1N6LA 4TWZA 1GRRA 3N5KA 3T5BA 1VJ5A 5JANA 2WF6A 1LFAA 4BMYA 1BKSB 1N0VC 4AS1A 2XUHA 4HY3A 2C84A 4LPKA 4FHGA 2H51A 1E3JA 4HR7A 3L0BA 4HPJB 4WESB 5I5GA 4CPDA 1UM9A 2ZE6A 4S3MA 1NP7A 1T6XA 5AVXA 3LC0A 1VZ3A 4B4UA 4ZJZA 4X8MA 1YJCA 3QLVA 4F2DA 5IVPA 1GPWB 2VUSA 2PY6A 1P73A 1PJBA 4BC1A 2C4VA 1M1YB 3FWPA 2G5TA 2P9GA 4KDCA 2EX1A 2PIDA 4AMZA 4B3FX 1K8YB 4RDHA 3V1NA 3W06A 2NVBA 1DUIA 1YR7A 5JMPA 3Q7QA 2C92A 3D6UA 4NU6A 1Y8ZA 1ID8A 2Y4OA 2OCYC 1AMNA 3HQ4O 4PZEA 4E22A 1KE2A 1E9FA 3ZJYA 1QH0A 2VJLA 4EKYA 2VJNA 2VUTA 3T0IA 4MQMA 1A88A 2O2CA 3UJBA 3I12A 1N9KA 2P78A 1GPBA 2QUIA 4FDVA 2O0LA 3WKDA 2JGIA 4DIOA 1KKLA 3CZQA 5FTJA 3L0ZA 1K5PA 2IP1A 1SCJA 3A9UA 3DZFA 2FEOA 1OVGA 4KWEA 5IASA 5K0GA 1L8XA 2X42A 3JTEA 4WADA 2VHYA 4UHBA 3RUAA 2ZBQA 4FHCA 1X8JA 4S2UA 2V6FA 4XPZA 2OZLB 3DE2X 4I2NA 1QGOA 1N8QA 2NZ2A 4XWAA 4OI0A 2IZOA 4B3HA 4BQQA 4CRWB 2CNLA 5KYWB 4M1QA 2X7XA 1RWKA 3PGLA 4DDKA 2Q9CA 4KXNA 5AHOA 3DDNA 1ODLA 3OWOA 4U7FA 1IQRA 1S9DA 2VPQA 2Q6TA 4IFTA 5A9SA 1NBMD 3QLJA 3U26A 4ZEOA 1EVQA 3K9LA 3BSSA 4IH4A 3KLNA 4C4TA 4TRMA 3M3HA 3T1NA 3BXFA 1V43A 1NU8A 1ZD2P 2D1TA 2QZSA 3BD9A 3I6QA 4EMTA 1LSOA 3OE7D 1BDMA 5K45A 3F7MA 4NV3A 1IFXA 2GWRA 5KTPA 5A3QA 5IAJA 3PHGA 3CA8A 2V7WA 4ZV7A 1OFGA 1WM1A 2HDWA 2C98A 2QY9A 2XNJA 3L41A 3OPNA 4WVLA 4ZAXA 5EJ4A 4RIIA 5BWNA 1SN7A 5BOSB 4GKJB 4UU8A 1E6KA 1BX3A 4H17A 3K53A 3N2IA 3FE2A 3U1TA 4CEIB 1ZMRA 3AR3A 2EG9A 2XBUA 4G67A 2ZATA 4B44A 3I76A 1VYTA 3UJHA 5KJ6A 5MFZA 3EXAA 4LRWA 3P27A 4OGFA 5HE8A 2AGVA 3IDFA 1GITA 3HVJA 1IPEA 3HKEA 1Z34A 2YS7A 2A5LA 2CZQA 2DY1A 2MR5A 3QYAA 2ZVJA 2JGAA 3B9PA 4IGEA 1CTQA 5FUBA 3GDGA 1Y8RA 1XXLA 4BNLA 1LBQA 5L3ZA 3L0OA 4E46A 1ULBA 2WUVA 3ZY5A 4KDFA 5KTYA 1Z35A 3Q8KA 3C6ZA 3NUZA 4PLVA 3NXKA 3NBUA 2WWVD 4GBMA 3FTCA 4QELA 3BIJA 3KPJA 4TS9A 2ZG6A 4PAOA 1L4KA 1LK5A 4OJYA 3MRVA 3WNVA 1FZQA 5AW5A 3TCNA 4IHJA 1IEVA 4EX7A 4ZCSA 5EJAA 1U5AA 1U3DA 1SZPA 3VPXA 1N2OA 3DUFA 1J2TA 1ULUA 4G0PA 4MULA 4EYOA 3D1VA 3EEQA 1E0SA 2JVJA 4OUDA 3FCUB 4WLOA 2E2WA 1BQ4A 4XW2A 3S3TA 3TOSA 3D6VA 3GQBB 1TEVA 2P11A 4JQYA 2IKQA 4D3YA 3B52X 4AZWA 3SQNA 4HYQA 4JSYA 2WE8A 3GA0A 2P79A 2QYSA 4ZOEA 1H8ED 1WIWA 1V16B 2VZEA 2Z0MA 4KUEA 5DCWA 5DNVA 5F1OA 4DA7A 1T9AA 1QH9A 1WXGA 3Q72A 2ZBEA 5JBQA 1O89A 3UC9A 2HU2A 6YASA 2Z43A 1HO3A 3I2FA 5M04A 2FETA 5HZHA 4AECA 1BWRA 3J7TA 1PZXA 4XYBA 4B84A 2O8EA 3ZWYA 4A8HA 1XLWA 3O3MB 4IOLA 3FW1A 1RHMA 4G5OA 5JFTA 3CLRD 4O2BA 1QS0A 3BF7A 4XIFA 2OYCA 2CXQA 3DGEC 3C48A 4ZRDA 4XGIA 2CJWA 4B1FA 4E88A 3FWHA 3MLAA 2FTKE 4I9GA 5H16A 4MJXA 2X0RA 2ZAOA 3ADCA 4HAXA 2QGNA 3P9SA 4QRDA 3U31A 2GO1A 3FGNA 4HGOA 4NOMA 3ZDAA 3F6CA 2O2JA 2W6NA 1U2TA 2A8YA 2HRQA 5JRDS 4WNCA 5E2IA 3PFHA 4UEOA 5KVQA 5EWLB 1BS1A 3BULA 2YV5A 3PIDA 3P9CA 4TS4A 3BQ9A 3L49A 1SOVA 5LIPA 3ICVA 3WLFA 1J42A 4UCQA 4L0CA 2QY6A 2YV1A 2I8CA 2YN4A 3DE7X 4Q3DA 3GLFE 3GLKA 1RKVA 3H6HA 2QF7A 1RWMA 3UK2A 4YJ2B 1D4ZA 2PR7A 1NBAA 1W5FA 2I3GA 1YA8A 2OBNA 2XMBA 3BJIC 4HJRA 4QDKA 1PNRA 2PU7A 4WXEA 2ZGVA 1KDVA 2YIVX 4I55A 4Q1BA 4V0NA 3CB4A 4PG6A 2I2FA 4CKWB 1AHHA 3ZGNA 1M0EA 3SOZA 2OYSA 4WSOA 1APBA 3JQ8B 4CMJA 1C7JA 1GUYA 2EGUA 2VDUE 3MM4A 1M67A 3KFVA 1NXOA 4I50B 2QRZA 4C1NA 2Q8NA 4EJSC 5ALDA 1CE8A 2ZU6A 3LXRA 2X9GA 2Q5JA 1F4VA 1F48A 1J1IA 4DARA 5BW8A 3M8KA 4HCJA 2ZP1A 3QMVA 1DU4A 4UUOA 1EFTA 1WPGA 3BERA 3ZWOA 4BMDA 4EMSA 4HFNA 4UVHA 3CR3C 2ZXEA 4PLGA 5BNFA 4I6GA 4W63A 3ZDZB 4BFVA 1FDWA 4L8FA 5KO2A 4CI9A 1TQ2A 3T61A 1G8AA 2BBWA 4IXTA 3SVLA 3AVPA 3OX1A 5JCOA 5JQGF 4G07A 5EMJA 3KL4A 4YS6A 1IPFA 1C0LA 3L05A 4WESA 3VKUA 3KZXA 1HT0A 1MJ5A 4KQCA 3ZHUA 4PGGA 2FWIA 4RFLA 1PNVA 2D2EA 4L4YA 5I7OA 2O8FA 2FN4A 3SQOA 1AKRA 3ZZ0A 3EVEA 2IWRA 4ZFNA 2WA1A 1VIVA 4JI1B 1L7DA 3SZRA 5G1PA 1NXXA 1EJ0A 5H1YA 3V5NA 2GRUA 2GN6A 3AHGA 1S4MA 4LJ8A 4JOQA 4BFWA 3L06A 4FFPA 2QSUA 1XROA 3VYSB 2K7ZA 2D4AA 1C7IA 2FB9A 2GBPA 4OKNA 3PNPA 3MD9A 2Q6IA 4UBMA 4HEHA 8ABPA 3ESBA 4G0NA 4L9AA 3WGOA 1MHTA 4P0PB 3COVA 2JAWA 3C14C 1W5BA 4HPWA 4Y0NA 4JLVA 1DJNA 1ORRA 2GCEA 4UNNA 4BP8A 2B0CA 4NDZA 2LGEA 4O2BB 2VEOA 4P38A 1DIGA 4J3FA 2OXIA 2R6JA 4FW9A 2JA1A 3KB2A 4HJXA 3U7FB 4GBGA 2OLKA 1S2MA 1RJ9A 2XQJA 3I5MA 3BZBA 1W9MA 3EGDA 2I4NA 1A98A 3NO4A 4BX0A 3WYEA 1ZDMA 4UHJA 2WWFA 5KTSA 4H1WA 2ZVDA 1OBFO 4D45A 4MW4A 2XOKD 3D2AA 5JO9A 2DWCA 3EUAA 4QYWA 2FFJA 1U8TA 1BX0A 2ZIXA 1T5DX 1COZA 1Z73A 1DWQA 1J5PA 1J8DA 1NQVA 4YPOA 3F78A 3ED5A 4C1BA 2YCLA 2CV1A 2PX0A 3B1ZA 1RNLA 2ALJA 3GGJA 4OMCA 4HYEA 2GJAA 3JCZA 4KTVE 3ZU4A 1G8PA 1N6PA 3EGOA 4HV4A 1Z4PX 4RF5A 2AI2A 4WZAA 3UUWA 3X2SA 4YIHA 3LVFO 1H94A 2XJ4A 1LPBB 2EBWA 4QFMA 1YT5A 4HRXA 1VC2A 1IIRA 1M1XB 4AY3A 5BNTA 4HHEA 1JWAB 2H1LA 3KXKA 1SK9A 1PV1A 1FGMA 2FR8C 2IIPA 4JELA 1ZRMA 3QSGA 3QXSA 5FUVA 3AKEA 3SLRA 1SBCA 3UXEA 3S2YA 3ZR4B 3PZRA 3NVAA 4W1QA 4ARIA 4Y2VA 2Z8YA 3WGQA 1IM8A 1TUBA 5F4ZA 3DWIA 2VBFA 3RYIA 3GO4A 5DHTA 3JYQA 5FBLB 4D7AA 3NH9A 5E0KB 4CEHA 1X13A 5JBNA 3KAPA 5SZKB 1JB1A 2BEUA 1RAHA 3L4BA 4TZ0A 4TL7A 3SC6A 2AJTA 2EJBA 3RCBA 3DOUA 3JALB 1TQDA 2WWTA 2R6R1 3PITA 4KE7A 1QIGA 3RS9A 3RHFA 5BUCA 3O84A 3PJFA 3PHJA 2PH7A 4JNCA 4JC5A 2W42A 2G28A 4WV3A 4DNXA 2V7GA 1M7HA 2WJIA 1GFZA 1GPAA 1ZOPA 3LIIA 3ZIAA 3G9XA 1C9DB 3V98A 5F2OA 3NIFB 1PZEA 2LZ0A 3AB3A 3EFOA 2PT7A 3E9RA 4Y9SA 3RC3A 4CMCA 2HQOA 3WGHA 1FDTA 4BQOA 4M7OA 3MNFA 4IM7A 1D0VA 3I04A 1RJEA 3A31A 2G63A 3ICWA 3L8HA 4D8TA 4ED9A 2REXB 3L79A 4F8JA 3S8YA 2ZPAA 1SVWA 3ZV5A 1NUTA 2JBAA 1ZW1A 1F12A 3A7EA 3ST7A 3BRQA 2GX6A 1V8DA 4BEJA 4Q1VA 3SMQA 5I6DA 4F6RA 1XZHA 2CUNA 5DWQA 1D07A 1UZUA 3RUIA 2J31A 3D5EA 1BHSA 1CY7A 4Q02A 4QEKA 5CFLA 4ZI7F 2GHTA 2V1XA 4ZCIA 3RU2A 4BATA 5CXQA 3DCJA 1NNLA 3QUAA 1VBKA 1E2IA 1NQTA 4ML3A 4QUEA 4UTZA 1DKMA 1W75A 1OLUA 2Q07A 5ED0A 5HOEA 2IHZA 1CUJA 4BZZA 1QM5A 1Q11A 1WY5A 1R0RE 2JCVA 3ELBA 4D43A 2OY0A 2J7KA 2FMHA 1IXZA 1JKJA 3GJSA 5HEKA 3WLQA 2JAHA 5CT5A 2LCFA 5FUWA 2BEWA 4JU8A 3TIGA 3LHIA 4ER0A 4PO8A 4MICA 4X94A 3CBGA 4XIIA 1XRLA 1EWVA 1SPBS 5IKOA 5IDYA 1OX4A 1U80A 1OLOA 1NKVA 1NLZA 3HR4A 4OI4A 2AKEA 2C5AA 3V4SA 1M2EA 5L45A 3MWDB 2Y1DA 4O08A 2ECPA 4XGQA 3THRA 4FLEA 4RZ2A 3S40A 3BN3A 1VRWA 5AR1A 5EUQB 4LI0A 3UXYA 3ZU2A 4EY7A 5BY2A 4NNJA 3OX4A 3KVOA 5EKSA 2J3DA 4ZZIA 1C0IA 2EF0A 3R8XA 1XQ1A 5KYXB 1EFRD 2Z5GA 3V1YA 3ZBUA 3ISTA 2JLRA 4MWCA 3T8YA 4OVKA 1JHAA 4EPYA 5A3VA 3ZC3A 3KNZA 1L5ZA 4LN1A 3GAFA 3AEYA 3HA3A 1X8XA 1H66A 1DAHA 3DJFA 4MVJE 3BXEA 3P71T 2R47A 1HE1C 3VBCA 1M83A 1GU1A 2BFDB 1BEZA 2LWIA 2W22A 3SLGA 1MT3A 1AUQA 1GQFA 1QORA 1ZL2A 3ERCA 4FJ0A 2ZI5A 4WRRA 2E6UX 1VE5A 5KX5A 1A7UA 3OTGA 2JI6A 2W9XA 3TW0A 1H23A 4R9VA 1CE8B 5LLDA 1TK3A 5E6SA 2PWAA 1U3TA 3CR8A 1QH1B 2VAWA 2NW6A 2QK4A 4V1CI 1Z37A 3RLFA 1B6TA 2ID9A 2O2YA 1WUJS 1A2BA 2ZWOA 1ULHA 3BIFA 4NKRA 2GSWA 1RRMA 3PDHA 1LZLA 2I6GA 2F8TA 1L0BA 1O3YA 1REQA 4ZK2A 4IJVA 4L1KA 4TX1A 5JISA 1M10A 3EDQA 4MQEA 2ZDQA 5FQOA 3AEQB 5LR6A 2OAGA 3UBMA 2V7XA 2P30A 1FU7A 4JROA 3MUOA 4E07A 4KNVA 4B7UA 4J7XA 4XCVA 2JLSA 1BDBA 5I01A 2C0QA 4PU0A 3K8QA 2ZWVA 2WJGA 3V8RA 1AK9A 1XQYA 5B3KA 2VUIB 4GQAA 4Q03A 4FFNA 5AJXA 1XC7A 2R00A 3I3OA 3BE4A 1AHNA 2H1VA 3M2PA 4UZSA 3ZCTA 5CW1A 1TNDA 4Q34A 2R1TB 2LPMA 1P2UA 3FG3A 3VR4D 1QHEA 4IZOA 4KK3A 4RPHA 1JN0A 2FFAA 5FWNA 2I9KA 1QG4A 2YYYA 4RW0A 1PVVA 1R4NB 3M70A 2XFEA 5DSTA 1CHNA 3R7SA 2G5GX 3SVZA 4RQTA 4NV1A 4NENB 5TQ0A 5G0UA 1G7RA 4I4IA 4ID9A 4U7TB 4EPVA 3BFJA 3VO8A 2OECA 4N6OA 4C0QC 3AVQA 3U5TA 3SR0A 1TO6A 3KPVA 3KZOA 1HMPA 4OH1A 3KPYA 3CF6R 2WIGA 2JJ2D 1PJ3A 2Q2NA 1NSYA 1SKUA 2LCIA 1H4TA 2W71A 3ADBA 5DNYB 4OXNA 1PV4A 5LP6A 2ZM6B 1TVEA 2RGXA 2HYIC 5JSQA 1OAAA 4LIPD 3MXTA 4UAJA 2GH1A 2YY5A 2GKOA 1RYNA 1GKLA 1A9PA 2WHQA 2EFJA 3RIEA 2Y99A 3ZWXA 5JO0A 5MFPA 2IEBA 4EHLA 3GFOA 3LT4A 4IHJB 4RF4A 3ETGA 3STXA 2IH5A 3PNLA 1GQYA 1R00A 3RAJA 2GR9A 4QU9A 5KMGB 1Y1RA 3V00A 2JS7A 2ZRBA 1AKNA 1Z2DA 4C2UA 5LLSA 3NHSA 4KPEC 1XMQB 2OUKA 3CEAA 3PQ7A 4X6UA 1U0OC 2QD4A 3U7QA 3QPAA 1W4BA 2DP4E 1Y5IA 2WZDA 5EQJB 3CXUA 1YZUA 3ZDDA 3A11A 1RI1A 5ALHA 3VH1A 1EDEA 1KJZA 2FUKA 2YFQA 3MT0A 3EWIA 3OPMA 4H18A 5CK4A 3TD9A 1N3BA 2QLFA 2DVMA 9GPBA 1T26A 3K20A 1D09A 4LX8A 2JLYA 4JJAA 5THKA 3CNBA 1WXQA 1PAUA 3THYB 2CNDA 3A3YA 5IMBA 1DQNA 4AKGA 2YN2A 1LPPA 3RS7A 2BJVA 4YDSA 6LDHA 3N8HA 4NLLA 4R0NA 3W0LB 1IC6A 3HCDA 1ZCAA 2WJ3A 2P0AA 1Q44A 1T34A 2VPYA 3L7AA 5IM5A 1Q1ZA 3DKVA 3PPVA 4DBVO 1SVOA 1DTWA 1D9XA 1HL7A 1KO8A 1O7JA 1PJCA 4WCVA 4X20A 4N7RA 3CEHA 3KKLA 4DIDA 2N42A 3HB1A 2O2SA 4GECA 2EU8A 1SWWA 1XDZA 2HO5A 2PQ2A 2ZYHA 2NZYA 3PC4A 4W9RA 4EPWA 4GOXA 2O0KA 1Y6GA 4PLTA 1IN6A 1TVMA 1PEDA 4EHDA 2W2VA 3OX3A 3Q3HA 2WABA 4IDCA 3UK6A 3TTYA 2PKEA 1E8DA 3A04A 3QLUA 5LDHA 1VG9B 3FPKA 2VJQA 1OWOA 3LPMA 4JJEA 1RBQA 4YJGB 2Z1MA 3I5AA 2WFZA 1E5VA 4XX0A 1UK7A 4D82A 3PUYA 4P35A 5GJCA 4B3MB 2NT4A 3IAEA 3UWDA 1RYBA 2ZAGA 5HKBA 5JW6A 4MZXA 2QUBA 1M8PA 3LT0A 2AN4A 4F2GA 3VR6A 1X7HA 3WSWA 3LZDA 3HVRA 5JYDA 1RQ2A 1O0BA 1G5HA 2BH2A 2DFNA 4CKBB 5KHLB 1FDVA 1FP4A 2M9MA 3OZAA 4NEQA 3VJKA 3UO8B 4CQLA 3AG6A 2QI9C 1J1ZA 4A9AA 3C4JA 2BEVA 3N2NA 4IIGA 2XXBA 3B78A 4BS9A 1XD8A 2RSLA 4ZOLF 3QKSA 3NWOA 2UDPA 1FJ2A 4Y9DA 1PW7A 1NR1A 3N2LA 3SF8A 4X8OA 3DOHA 3OPYA 1NP6A 4UCWA 1NM5C 3ND9A 5ED4A 3P32A 1JAHA 4LF8B 1P33A 1H6CA 2GTPA 2Q0XA 3DEAA 3EQZA 2AMVA 5LQMA 4F9EA 3OZCA 3T7EA 1JU3A 5KOYA 1TGVA 1YSCA 1RCTE 1U98A 3GPLA 1T9BA 2GCNA 5C18A 2NU7B 1ISPA 1PF7E 3UICA 4FQ8A 5F7JA 4Y9UA 4W8GA 3RS3A 3U7EB 1W29A 1WU7A 1EVJA 2LCQA 1NW3A 4MS1B 4L6AA 3PC6A 4WKCA 4RCZA 1U3VA 2ANBA 1RAFA 1P0IA 1YHYA 1NVDA 3C5CA 3PD0A 4FMBB 4GP6A 3MD0A 5ERGB 2HF9A 5K3EA 4UTNA 3I64A 4EA9A 4FD3A 1MRSA 1JU4A 1XZ8A 4Q1FA 2AC2A 4B4DA 4JX9A 5T4FA 4RH1A 5JS6A 2YBDA 4KQHA 1XKQA 5JD4A 4QTXA 4KQFA 4XB1A 1HZZC 4UKDA 1R6DA 4MW0A 3NFYA 5I4IA 3NDRA 4BE4A 4R0MA 3TVTA 3G8YA 1FRVA 4PLYA 1EGQA 1DJPA 5LA6F 4JQCA 3TNDA 1VBMA 2FFHA 1WWKA 2FK7A 3UUFA 1JYEA 1OLXB 4PNEA 2ADOA 1SCNE 3D59A 4FMDF 4DCPA 2Y1KA 2ADFA 2GPBA 4WDRA 4I8DA 4UMFA 3K0HA 4L8YA 2JGRA 3EEOA 3LD9A 3VVMA 1ZUHA 2WA2A 3OQVA 4N5IX 3TIIA 2HFJA 1ZD4A 3E9YA 5EHNA 3K0SA 3E61A 1QOPB 4RHCA 3AK4A 2K2WA 2NUTA 5BPFA 3R3JA 3ONDA 3JQ9A 1SU8A 3HXLA 3IUYA 4P4TA 1QPBA 3SKVA 4WA8A 3ZK9A 2AUMA 4PYIA 1J0EA 1QTRA 5COAA 4S0XA 1E79D 3TI9A 2XVZA 4CT0A 4FSHA 4DKJA 2PAAA 3ZXIA 1QGAA 2BMAA 1V1MA 3A6KA 4P7KA 4HNUA 2XXAA 2CE7A 5DMHA 4FEYA 3IP9A 5CBKA 5ADUS 3FXAA 3W04A 1U8ZA 5DHFA 2HMYB 1R64A 1UBKS 3KQWA 2P0MA 2ZQYA 5MHTA 2GF9A 4Q18A 4YAUA 1NXVA 4WVFA 1I2MA 1GARA 1N7JA 3ML1A 1U4SA 3QZUA 3D6AA 5ENVA 5FBKA 4OQXA 1DP4A 3RVDA 1NC1A 1LZKA 3JWGA 3DEFA 3WBJA 1MAWA 1TRKA 2CJXA 4O4IA 3W1WA 4ALJA 1WBJB 3IT2A 1OWLA 3H1GA 3ESXA 4R69A 4XD7A 2DAPA 3MF4A 4Q6BA 4ZPXA 1V5FA 3DPSA 4D9BA 4UTPA 1TAHA 1O6FA 2QMOA 4HBZA 3DWFA 2O7SA 1XVTA 1WZEA 2ZYUX 4JC0A 4MJ7A 4OCZA 3UF0A 1U5CA 3W5HA 4B81A 4HADA 2NM0A 3ANMA 4N1AA 1V1RA 5K0SA 2C7QA 4I5GA 2CHFA 1KTIA 5A4AA 4PC1A 1HXHA 4BLVA 1NLMA 1SD1A 1K4MA 4BO7A 4XJVA 3NBZC 1L8AA 3LNCA 4L2IB 1L5NA 1SOAA 1NMZA 5LQRA 2DERA 1GAJA 1S2OA 2QRQA 3F71A 4EW3A 2DFLA 4KL8S 1JNQA 1MIHA 1K7XB 3ZCQA 3EHEA 2R2AA 4NMMA 2RJ3A 3HLKA 2AFHA 3GU3A 4YMVA 2G88A 2JKVA 4PQRA 4Z7NB 5AW2A 1MQ9A 4MIOA 1TVKB 3IUBA 4KPFC 2FP4B 2XT0A 1Z4OA 2QV0A 1RLMA 3DFUA 4N8EA 2Q62A 3K1ZA 4BNHA 2ROQA 3SYMA 1XTIA 2E4AA 3CX4A 2H52A 3HS3A 2PBRA 5IP5A 1GTG1 4OI1A 1EAMA 1P61B 1PW5A 1V26A 3A9CA 2GXUA 3P52A 3HCWA 3N2KA 3AM5A 3DFFA 3ESYA 2PS9A 1C3OB 2ABWA 2NLOA 2V7TA 5CVVA 1YB1A 1BJTA 3E2IA 2JD1A 2YL2A 1F4PA 1VHTA 3H86A 4OHCA 4PBRA 4QWWA 1BVHA 1IK4A 3K2QA 3R09A 1JG7A 1DLJA 3EA0A 3L6BA 4G5HA 5JWHA 5B64A 1RWWA 3QWIA 4CN9A 2PV0A 1UPAA 3N0WA 5AICA 5EAIA 1UIMA 2B4AA 3K9CA 1T9GR 2DEUA 1YS9A 1BA2A 1UWCA 5TGZA 4O6VA 5DLPA 3R9XA 2RHTA 1K0FA 4XJXA 1Q20A 5EVCA 4GH5A 2NOAA 1BTOA 1WDMA 2IXBA 2X1VA 3T5MA 2QVXX 1HGXA 4MCHA 4O02B 4XQ0A 3EGVA 1UK9A 1X92A 1Z5PA 3FBWA 5GIOE 4M8LA 1UOQA 3W4KA 1WQ4A 2LIVA 3KM0A 3L82B 2XRYA 3LBYA 2EZ8A 3AL3A 3H5VA 4M7RA 1NXQA 2RGUA 1CVIA 5E6UB 4BU0A 2JIBA 4NZZA 4DLRA 3AWIA 1U31A 3HV2A 3O95A 1W46A 1ST3A 1VDZA 3OJOA 221PA 2ATVA 1XEWY 2YW9A 1PT6A 1U4NA 3HCAA 3QKUA 4ZO4A 3U7RA 2CWDA 4PSVA 2IDJA 4H6WA 1SH7A 4KV7A 3H2BA 4RK5A 4Q05A 3T9BA