2OXEA

Structure of the human pancreatic lipase-related protein 2
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
452
structure length
435
Chain Sequence
KEVCYGQLGCFSDEKPWAGTLQRPVKLLPWSPEDIDTRFLLYTNENPNNFQLITGTEPDTIEASNFQLDRKTRFIIHGFLDKAEDSWPSDMCKKMFEVEKVNCICVDWRHGSRAMYTQAVQNIRVVGAETAFLIQALSTQLGYSLEDVHVIGHSLGAHTAAEAGRRLGGRVGRITGLDPAGPCFQDEPEEVRLDPSDAVFVDVIHTDSSPIVPSLGFGMSQKVGHLDFFPNGGKEMPGCDGIWEGIGGFVSCNHLRSFEYYSSSVLNPDGFLGYPCASYDEFQESKCFPCPAEGCPKMGHYADQFKGKTSAVEQTFFLNTGESGNFTSWRYKVSVTLSGKEKVNGYIRIALYGSNENSKQYEIFKGSLKPDASHTCAIDVDFNVGKIQKVKFLWNKEPKLGASQITVQSGEDGTEYNFCSSDTVEENVLQSLYPC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Pancreatic lipase-related protein 2
publication title Structure of human pancreatic lipase-related protein 2 with the lid in an open conformation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 127
structure length 435
sequence length 452
chains with identical sequence B
ec nomenclature ec 3.1.1.26: Galactolipase.
pdb deposition date 2007-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00151 Lipase Lipase
A PF01477 PLAT PLAT/LH2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.60.20 Mainly Beta Sandwich Lipoxygenase-1 PLAT/LH2 domain 2oxeA02
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2oxeA01
5K3DA 4E11A 4ZREA 1QFSA 3VKFA 4QDTA 4N8EA 3QPCA 5HQ3A 2BGRA 3WIBA 4B84A 4PQEA 1JJIA 3DDUA 4ITVA 3GFFA 4WY8A 3M81A 4UBKA 3R3XA 1YR2A 5CT5A 3I2IA 5IVIA 4JYPA 1H2YA 3HJUA 1ACLA 4E14A 4WFOA 1CEXA 4C87A 2GZRA 2WHPB 2QOEA 4FWBA 3ANSA 3MGAA 4Y2PA 5E4YA 3VF1A 5K3EA 2XUFA 3AILA 4BAZA 2X76A 5AI0A 5HFNA 1FFEA 1F0PA 3STWA 5YASA 5ALYA 3WLAA 2PVSA 5C81A 1Y7IA 1DQZA 2PSJA 1F0NA 2OLEA 4WY5A 3WKBA 2BGNA 1JFRA 5HZGA 5E4JA 4AN1A 4FLFA 1UKCA 1DWPA 5HFAA 4J0DA 3N2ZB 3OC0A 4BE9A 1VE7A 4P92A 5FV4A 1XZEA 4G5XA 1WCYA 4DNFA 5C8XA 5ALPA 2HADA 5HF6A 4G8DA 2WUGA 1RRLA 3FWHA 1XQXA 4W1PA 4AB1A 3V9AA 5HCUA 1QTIA 1XROA 3PZWA 2B61A 3QVMA 4ZRDA 2WU3A 4L72A 3ED1A 4I4CA 2AJCA 4TPKA 5K3FB 2ACEA 4J0KA 2UZ0A 3H2HA 1ZIXA 5J3JA 1WB5A 5ALQA 1U4NA 3VJKA 4BAUA 1CUXA 2DQYA 1TIBA 2J3QA 1K63A 5DTIA 4Y2SA 3ICWA 4FTWA 1DX4A 4DYHA 2Q0XA 2QT9A 2QXTA 5AKXA 2BUCA 4OU5A 1EI9A 1Y37A 4MQMA 4CFSA 5AOAA 2HRRA 4Q1VA 2HHAA 5K3AA 1VLQA 1TCCA 5CT9A 4GXNA 4HTAA 4BC1A 1TQHA 3Q8WA 5SYNA 4MQLA 3CXUA 3G0BA 4UFOA 5AKJA 4WFKA 2WIGA 5D6OA 3KWJA 3OG9A 1VE6A 1S8OA 5DYYA 3H2GA 2WJ3A 3MUNA 3TEJA 2XI4A 3AZPA 2GBIA 4QE3A 3E3AA 2GYWA 4XX1A 1MNQA 1BEZA 2WG0A 5LKRA 5ALJA 5ALXA 4KAAA 3GZJA 3IUJA 4I3FA 3WL5A 3G8YA 1LPMA 4F0JA 3H17A 2VATA 2CUTA 2B9VA 1X2EA 2J4FA 3D4LA 1UFOA 4BB0A 1OLPA 4C01A 4DM7A 1XZHA 4Z49A 3WJ2A 2AJLI 2SBLA 3PDCA 4NREA 2QR5A 4WJLA 5FRDA 2RAUA 1IUPA 4ZWNA 3NOXA 3L1IA 3JW8A 1MX5A 5ALVA 3A2NA 4B9AA 1MAHA 1Q0RA 1E89A 2XUGA 1LBTA 4HAIA 2OXEA 2JBWA 3C6ZA 1XFDA 3IVMA 2PUHA 5FPPA 3ESDA 2XQIA 3N0TA 2WXUA 5ALZA 1QIDA 2ES4A 4LXGA 3A2LA 4EY8A 1YGEA 1TK3A 4BBZA 1XZKA 1CRLA 3H0CA 5IKXA 4ZV7A 1FGOA 5ALUA 3HLKA 4UBMA 4BE4A 1WHTA 2XUOA 4ZV9A 3K9BA 3DOHA 1IZ7A 2I3ZA 4IH1A 2IUJA 1IVYA 2CMFA 4Q05A 4AN0A 4INZA 2GBFA 4BVJA 4FFVA 5JAPA 4UUQA 2I3DA 1HLGA 3IA2A 3ZPXA 3IULA 3CWZB 5DLPA 3R40A 4OYYA 1R1DA 1QJ4A 3QYJA 1PJAA 2AJDA 1H2XA 5AKZA 3WWPA 5CH3A 5EI5A 1XLVA 2XQKA 4JUIA 4HS9A 4TVKA 3V48A 2ZVDA 5C7YA 1QIFA 2ZYSA 1BCRA 3H18A 4O08A 4CCYB 2HA6A 4FBMA 1KU0A 4GLBA 1KHOA 2HU7A 5A6VA 5CTAA 4BVKA 4XIIA 2O7VA 3K2IA 4DIUA 1FGTA 3IURA 4Y2YA 4F60A 5DYWA 3VVMA 3FOBA 3PUHA 1HU9A 4OD0A 4I19A 4PF1A 4B6GA 1YA8A 4Q82A 3SK0A 4PSUA 1T4MA 3H1AA 3RARA 5ALWA 1NX9A 1QGED 2C0QA 1J06A 5ISMA 4DSAA 2DHEA 1TCBA 5DNVA 1ZJ5A 5SYMA 4MEBA 4AZ3A 4WFIA 4G1FA 4QWMA 4M0EA 1XRQA 1QIMA 2WIKA 5FPQA 3VISA 3V1KA 4C88A 1X70A 4KAFA 1XZJA 3C87A 3EF3A 1XKTA 2C4HA 4N8DA 4IH4A 1BN6A 3G9ZA 3WMRA 4K6HA 4K5QA 2PSDA 4HRYA 3MVEA 1QIJA 1BROA 3ESCA 4QZVA 1W6RA 1AUOA 1N8QA 2DCMA 5JAUA 3PFBA 4BZWA 2IUKA 5IVHA 3A2MA 3O9MA 4DNQA 2EDCA 5CURA 3B3QA 4J7AA 4G8BA 4DMCA 2JGFA 1LPBB 2RONA 4N8SA 4F21A 4AQDA 5JD5A 1FFAA 1KEZA 5EHXA 5I7UA 3STTA 2OGSA 2ONCA 1ZGBA 4RE6A 5ALTA 1G5FA 1XZLA 1CUSA 4FOLA 1N5MA 3WA7A 1C7JA 5HK8A 3ESAA 1A88A 2WFLB 5C8VA 1R3DA 2C5GA 4BZZA 2QMQA 5KWIA 2OCKA 1R4ZA 2OGZA 3BIWA 4PV7A 2HA7A 4UBJA 2DR0A 1BRTA 1A8QA 1F6WA 1XLWA 4BRZA 3C6YA 3BNCA 2WU4A 4C4XA 5KWJA 2WQZA 2VJDA 3QITA 4PW0A 3C8HA 1ZI6A 3FLAA 4LHEA 2XMSA 2YH2A 1CUBA 1N1MA 1TRHA 3E1GA 4K6GA 2JGLA 3E4DA 5LZ9A 1FGMA 3WK9A 3V98A 3H2IA 5JIBA 4JYMA 5AIAA 5ALDA 2GBGA 1VA4A 4KRYA 1ZD5A 4J0HA 3RM3A 4P93A 4HZGA 2O7RA 1JJBA 4IQ4A 3IUQA 5AJHA 1LLFA 1Y4KA 1CQZA 3F98A 1AZWA 3AUKA 3ILSA 4DMFA 4MYSA 1CUAA 5JD4A 2JIDA 4ROTA 2DHDA 3DKRA 1XLUA 4XWGA 2HFKA 4EZIA 1ODCA 4QA9A 1Y7HA 5AH0A 2FX5A 2WUDA 1MX9A 1J07A 4EHBA 1J1IA 2PX6A 5A62A 5EHNA 3WKDA 1L7AA 1YASA 4ZGBA 4C4YA 3F9CA 1VKHA 5K5EA 1EH5A 3G0GA 3LIIA 5JYCA 1A8UA 3DD5A 1R9MA 4X90A 4LIPD 1UZAA 1XZFA 3W2TA 2G5PA 4X85A 4X94A 5AI9A 1NU6A 5AM2A 3L1HA 4E15A 3V92A 1W76A 1G4HA 3T52A 2Z3ZA 4FKBA 4G9GA 5AM1A 3EBLA 3H2KA 3HABA 4EA6A 2B4KA 5AKLA 3PFCA 3DKKA 4QWWA 4AZ0A 2QRUA 1MTZA 1CUFA 1LPAB 4UBNA 2I78A 4Y2TA 2OCIA 2HA2A 4LXHA 2VT6A 1XZIA 2E3JA 1EVQA 1ORVA 4ARAA 3QMVA 3O4GA 4Y2UA 2G4LA 2J4CA 3BNDA 4FNGA 1W1IA 3HI4A 2I03A 4YX9A 2XUHA 3M3DA 2XUQA 3QZUA 5AKGA 1SOMA 1CUDA 4BDTA 2WXTA 1EVEA 2W22A 1H2WA 1IK3A 2ORYA 4QNNA 4FNMA 3EQ7A 3AZOA 5AIBA 2VA9A 3FYUA 5LP1A 4KE7A 4Y2QA 3D5EA 1ZD2P 3W06A 3VDXA 1LPNA 3GA7A 5K3CA 5A7GA 4HRXA 2WG1A 4BYMA 5JD6A 2XQGA 4OCZA 5ALKA 1HDEA 1CUUA 2R8BA 2YYSA 3STXA 1JNQA 2RI6A 1H22A 2Z5GA 2DHCA 4FBLA 2D5LA 1VA5A 4MWTA 2HFJA 4KAJA 4L3WA 1VOTA 1P0QA 4X97A 1FGRA 4NZZA 2WTMA 1ZIYA 2GBCA 1GPKA 4HXEB 4PSCA 3BNBA 3WWDA 1R88A 3CN7A 1O6GA 1QTRA 1DWOA 1HKHA 3I28A 3LP5A 1UT6A 3DNMA 1GPNA 1QZ3A 4UBIA 1UK9A 4GEGA 4KR0A 3ANTA 2WUEA 1QIHA 2OQVA 4ARBA 2OGTA 1GT6A 4HVTA 4CCYA 5CH5A 5D3ZA 5E4TA 2XLCA 5ALIA 4DMHA 3M83A 3IUMA 1Q0ZA 3HXKA 2QXUA 1CV2A 1VXRA 3KOOA 2YASA 4LKOA 3IUNA 3HEAA 3AJAA 4U2FA 2HA3A 1MPXA 1HBJA 4GBGA 1MNAA 3JWEA 2Y6VA 3DL4A 1B41A 3I2GA 3HRHA 3UUEA 2RHWA 1UOOA 3ZV7A 3C8DA 2VAVA 1QIEA 1EB8A 4V2IA 3V1NA 3G0CA 4IH9A 3WKCA 1CUVA 3OURA 5AOCA 3C6BA 5EFZA 5AP9A 2LIPA 4L9AA 5ALOA 1AGYA 3WA6A 2ZJ6A 1CUGA 1MT3A 5JZBA 4JEIA 1DTEA 2XMZA 2WIDA 5BOVA 1ZD3A 2ZYHA 2W6CX 1FFCA 1QIKA 4GDMA 1AKNA 5AKHA 3ZWQA 4CIBA 2R11A 3C45A 1UOPA 5CXUA 2WJ6A 4G4IA 1XRPA 4QDOA 1G42A 4UPDA 1K5PA 2QVBA 3I1YA 4NS4A 4E46A 2X5XA 5ALRA 1QO9A 4DGQA 4WDQA 3FVRA 1CVLA 2C5FA 2HA0A 1K8QA 3LS2A 4FLMA 5ALGA 1XRLA 1DX6A 3WK4A 1EDEA 3X3HA 2XMGA 3DQZA 5IVKA 5ALHA 1EA5A 3B12A 1YSCA 4H77A 2XUKA 1ZJ4A 3SWWA 4X6YA 1U65A 3G0DA 1AX9A 5T4HA 3I6YA 1DU4A 4QDXA 1USWA 5H3HA 1THGA 1J2EA 4ZXFA 4GWLA 3L1JA 1MAAA 4AXBA 1XRMA 4UFNA 2XE4A 4CIAA 3BIXA 4BATA 4U2CA 3PF9A 5ALNA 2XMDA 5A7HA 3D2AA 1BN7A 1M33A 2HRQA 2JGKA 4KACA 4CI9A 1E3QA 5I8PA 4H0CA 2H9YA 2XMQA 4AO7A 3OOSA 1JJFA 1MJ5A 1WPRA 3PUIA 1UK6A 1ODTC 4X95A 2H1IA 1UXOA 5DYTA 1CUJA 4B85A 4JH0A 1SC9A 1OXMA 3QPAA 4EY6A 1FFDA 4P08A 2H7CA 1BE0A 4UHFA 4B9EA 2Z8XA 2PM8A 5LZ2A 1BS9A 1JMYA 2DSNA 5FKJA 4N5HX 5ALFA 1YAHA 1SFRA 2PKYX 2WHRA 3H1BA 3RLIA 1QE3A 2JEZA 4EY5A 1IMJA 3W05A 2XUAA 3V1LA 2CZQA 4C89A 1YS2X 5AO9A 1WB4A 4GHWA 3WZMA 5FUMA 1E5TA 1Q83A 3DL7A 3FYTA 3RKSA 5FP0A 1CPYA 3BE8A 2HDWA 1ACJA 5AK4A 3STYA 2VQ6A 3HACA 1QIGA 4PNZA 1ZD4A 3WK8A 2WSLA 4NMWA 4P9NA 1CIJA 1LPOA 3C5VA 3H19A 2JGIA 5EEOA 2ZYRA 5BWBA 3KWFA 1XRRA 3BNEA 2CKMA 6YASA 1CUWA 3EIOA 2JF0A 3WKEA 2CBGA 3P2MA 1W52X 4K2AA 2O2IA 2WHPA 7YASA 1R50A 4MEAA 3WQHA 1ZGCA 1LZLA 5AKKA 3FYUC 3BF7A 4OB8A 3ZLVA 1B6GA 3M82A 5FLKA 5ALSA 4ZI5A 1LOXA 1YB6A 3I6ZA 3CCCA 5LYYA 3DYVA 4RE5A 1JT2A 1ORWA 1JU3A 3U0VA 5HF9A 5LZ8A 3OTQA 3STUA 3FG3A 3R41A 5ALEA 5JAHA 4X92A 1EK1A 3NWOA 1CA1A 4W1QA 4CG2A 4X71A 4TGLA 3HSSA 3IIIA 2XMCA 4U2GA 3ESBA 3F97A 5AI5A 3AFIA 1A7UA 3KSRA 4KYVA 3A70A 1YA4A 2XQFA 1WB6A 3B5EA 4EB0A 1QFMA 5A7FA 3BL8A 1JI3A 5A2GA 5LIPA 4L0CA 2WG2A 2CB9A 3SX4A 4KRXA 4WCVA 5AK3A 4DNPA 1FSSA 4WDRA 5JADA 2WIJA 3G0IA 4G8CA 4XVCA 1XZGA 3V1MA 2EDAA 5EIHA 1ISPA 4QEKA 1YCDA 2NW6A 5AKEA 2VT7A 3GELA 5K3FA 1EDDA 1UWCA 1YS1X 2G5TA 1CLEA 2XLBA 3C43A 4Y2JA 1R9NA 4G9EA 3R3VA 5JALA 2V97A 3WKAA 1N5RA 3PE6A 2OG1A 1A8SA 3HZOA 5AK6A 4C6HA 2Z8ZA 1SCIA 2ECFA 1GQSA 4G4JA 4RPCA 1VZ2A 5CRIA 5K3BA 2QUBA 3R3WA 3G9UA 3AIMA 3AIOA 5A71A 4OPMA 3WZLA 3ZLTA 2PPLA 2PSFA 3WL6A 1ZI9A 5LZ5A 3I6MA 1ZICA 3H2JA 4GI1A 4Y9SA 1GGVA 5ALLA 4A16A 2AXEA 4LYEA 2C7BA 2YXPX 1G66A 1CUCA 1CR6A 1UK7A 4Q3KA 3LIPA 4OUKX 2WILA 1VXOA 3BJMA 3MUOA 5JZ9A 5E2IA 3H04A 4MYDA 1MN6A 3FLEA 1ROVA 4A5SA 1C7IA 3LCRA 5CBKA 3CN9A 1EDBA 1HQDA 2PSHA 2H7XA 3KDAA 2RIPA 2ZJFA 3T4UA 1TAHA 3VJMA 1FJ2A 4OSEA 5F4ZA 2JGEA 2ZYIA 4H35A 1ZI8A 4KE9A 1MO2A 2OAEA 2CJPA 2IITA 3D7RA 1XQVA 3DYIA 1MU0A 2HU8A 3D3NA 4JNCA 4FLEA 1ETHA 2ROQA 1GPLA 1YB7A 5LZ7A 1OCEA 1BU8A 1XZMA 5C8ZA 4KJXA 2WY6A 4W63A 5AK5A 3D2BA 4B7ZA 1FGQA 2RHTA 3WI7A 3UMJA 5T4FA 4H7JA 3GUUA 3FAKA 3O4IA 4H7FA 5IVDA 4HXGA 2PSEA 3F96A 3WK5A 3PI6A 3WK7A 1XZAA 5D7BA 4B81A 1BCSA 1XZCA 2G63A 4W9RA 2J3DA 2AJ8A 2JEYA 1AQLA 4H18A 1F8NA 4IHAA 1PV1A 1HPLA 2WFMA 3FG1A 4B0OA 3S2ZA 3HYSA 3WYNA 1GZ7A 4Y2XA 1EB9A 1XQYA 3G9XA 4EY7A 3C70A 3FCYA 1QONA 1LZKA 5CT4A 1AURA 2BJHA 5EIEA 2IIVA 4ETWA 3QBJA 4Q34A 4F5ZA 4BTLA 4PO3X 4QLAA 2C0PA 2CEKA 3R3YA 2ZSIA 2WLSA 3I2JA 1QMDA 3IB3A 1WHSA 3FBWA 3AZQA 3I2FA 3R0VA 5AM5A 1WOMA 1EHYA 2H7YA 2QM0A 1UOQA 2OAGA 1OILA 4OYLA 1DWQA 1TKRA 3FLBA 3BWXA 5AHXA 2HM7A 4KE6A 5AKYA 1ZOIA 3W9BA 3G7NA 1WM1A 3TGLA 4D9JA 2XDWA 1Q84A 2OQIA 1CUIA 2WJ4A 5DTJA 5JZSA 3VXKA 4QDUA 1GYGA 1E8DA 3FNBA 4Q3LA 1QOZA 3DS8A 1BEEA 4DSZA 1NO3A 1EK2A 2K2QB 3IBTA 4W1SA 5CMLA 3R3UA 5ESRA 5JARA 3D0KA 2B20A 2XMRA 5CT8A 5AI8A 2AJBA 3I2KA 2VF2A 4X6XA 5AI6A 1W4LA 2WIFA 4DMKA 4BDSA 1UKBA 4BP9A 3OPMA 1JMKC 5IH7A 2PU7A 2QKYA 5BV7A 1L7RA 3C5WP 3KXPA 5KBYA 1MX1A 2BFNA 3BDVA 4BRSA 3FSGA 1XZDA 2VJBA 4QDZA 5AM4A 3VVLA 1I6WA 4B83A 3BF8A 3NUZA 1P0IA 4LXIA 5HQ3B 1QO7A 5DJ5A 2JGJA 3DCNA 2XUPA 4J0JA 3ICVA 1UK8A 3UUFA 4LYDA 1XRNA 4J0GA 5HK9A 3KD2A 2WUFA 4GECA 2WFLA 1F8UA 4RNCA 2XT0A 2PU5A 2PL5A 5AM0A 1GXSA 4BCCA 1C4XA 4CG3A 2VJCA 2O2GA 4X91A 5LZ4A 4IO0A 4EY4A 4UBOA 3FYUB 2FJPA 2VTVA 5EHZA 4MJ3A 1CUHA 1TCAA 5D3KA 3W9UA 5CXXA 3EQ9A 4BC0A 3HC7A 3U1TA 1VJ5A 1JU4A 2QUAA 2QJWA 1RWQA 1WPXA 3F8SA 4RGYA 1EX9A 2WFZA 3F67A 4DLNA 4OU4A 5FXMA 1GQRA 5JAOA 1XZBA 2VEOA 3WJ1A 2HA5A 3WL8A 2C58A 2XMBA 3SC2A 3QM1A 1QM6A 4H7DA 3D2CA 1QIIA 1HL7A 1THTA 2WM2A 5FOQA 2XB6A 2X8BA 3S8YA 2WKWA 1XQWA 1GKLA 4BVLA 3WWCA 5I9IA 4H7EA 3GBSA 2PUJA 2WTNA 5JASA 1Z68A 3ZI7A 4KE8A 1P0MA 1LGYA 4B82A 1H2ZA 4FDMA 1CFJA 2QTBA 1UKAA 2BCEA 4MWSA 3STVA 4AMZA 1CQWA 3LLCA 2D0DA 3G9TA 1K6EA 5KREA 4NVRA 2DFPA 3O95A 4X3CA 2ACKA 5DWDA 1JKMA 5EIAA 3E0XA 4KEAA 5FDFA 3O0DA 3Q0TA 1CUZA 3IDAA 2XUJA 3AIKA 2OPHA 1IUOA 1CUEA 2FJ0A 3WK6A 4FHZA 5JATA 1IZ8A 2ZSHA 4YASA 5HF5A 2OCGA 4UHEA 2QZPA 4J0CA 2OCLA 3AINA 4DTCA 4EBBA 3RK4A 4QWTA 4BCDA 3WYDA 3QMMA 3EQ8A 4GW3A 4PSDA 4Y7DA 2Y6UA 3NGMA 2FNQA 2XUIA 3WWEA 1DT5A 1D07A 1LNSA 4BCBA 4G4GA 4B80A 3ZLUA 1DQYA 3OM8A 5CH8A 3VJLA 1RP1A 1XKLA 2O2HA 4M0MA 1CUYA 3WL7A 4FFWA 2IX9A 1L7QA 2BUBA 2VAXA 1E66A 2HL6A 1SCQA 3FVTA 3WIOA 2Y1KA 2EEPA 2JGMA 2GYUA 1LBSA 2XQJA 4N5IX 5CT6A 1FFBA 4W1RA 1GKKA 4UHCA 4C4ZA 5BWCA 3O8YA 3PICA 4U2EA 3YASA 4UHDA 3DEAA 3JYHA 2P8SA 2VSQA 4DNOA 2HU5A 1PFQA 1VZ3A 1W75A 4QLOA 2Z3WA 3DJYA 4H7KA 5T4EA 5DNWA 2BKLA 2GZSA 2V96A 4AO8A 5LLSA 1RYYA 2GYVA 4AO6A 2Y2VA 1H23A 1E8MA 3C6XA 1X2BA 4Y2VA 3O4JA 5EHQA 1O6FA 3TRDA 1AC5A 4H7IA 4UHHA 4K6KA 2HIHA 4J3JA 4YPVA 3O9VA 5AKIA 4HXFB 2VJAA 3R3ZA 5AI4A 4XJVA 4B0PA 3DOIA 4MXDA 2HA4A 4S0XA 5T4BA 2BAGA 4BP8A 4J03A 4EUSA 4AMYA 2FUKA 1IUNA 4X7BA 3G02A 3I2HA 3FG4A 5HKBA 1DT3A 1NU8A 4AX4A 3FSGD 2ZJ7A 4J0IA 4OB6A 3DLTA 3A6ZA 3TJMA 4X6UA 1T2NA 1P0PA 2PBLA 1LNHA 2WHQA 2XUDA 4CG1A 3CCBA 3K6KA 4Y2RA 4WHAA 3BJRA 4A23A 4CCWA 5JANA 1N8SA 4Q3OA 1U2EA 5HKAA 5EGNA 4OB7A 4YK7A 5HF8A 2RGUA 2Y2UA 4U2DA 4U2BA 2QS9A 4UHBA 3QH4A 3FCXA 4X93A 3BDIA 1U8EA 4BAGA 3W04A 2QJRA 4H7HA 5AOBA 3WWOA 2DQZA 1EXWA 3GROA 1YAJA 2P0MA 4WFJA 5CW2A 4BTVA 1LPSA 3D59A 5ALMA 5AICA 3QPDA 5AM3A 3BXPA 4FMPA 1LPPA 1RRHA 4UBLA 1KU6A 1DINA 3I1IA 3PF8A 1E8NA 5LKAA 2V9ZA 4UFPA 4M0FA 3V99A 2V98A 1K4YA 4X00A 2BUAA 3O4HA 1EINA 1AMNA 1SCKA 3QMWA 1QLWA 5DNUA 1ODSA
chains in the Genus database with same CATH superfamily
1DUVG 4BWYA 5K3DA 2DPGA 4M49A 3IELA 4MWCA 4R3NA 2FN9A 1G6HA 3K6RA 3KTFA 1C29B 4WKNA 2C7RA 3A6JA 4K40A 4N8EA 2Y0EA 4RETA 2PZ8A 4Z0NA 1JQJC 2BGRA 3L7BA 3LT4A 1MC8A 4LY9A 1SA0B 2W2MA 4PQEA 3IMFA 3THWA 1JJIA 4ITVA 1Q44A 1ODLA 4RK7A 3GFFA 3RJMA 5IMSA 1P6UA 1LX6A 2PL9A 2PRSA 1H66A 1GT91 2VKTA 1JVSA 4G3XA 2D1YA 3U80A 2G04A 1TUEA 4M9ZA 4ZU6X 4I99A 3V8BA 5BWLA 1ILEA 4A0FA 3FMFA 1RYBA 2XHHA 1YUBA 2BC9A 1NR7A 1QO0A 2E1PA 4D7AA 5B5SA 2QN3A 3I2IA 4UZFA 4MVXA 4H4CA 3UB4A 4KK3A 3E81A 4UC0A 2HSDA 1Q7EA 3NP7A 1JEQA 3RVDA 4AJOA 2H4WA 1H2YA 5FPSA 4J29A 2KB0A 1AN9A 4I1IA 4WFOA 1M3SA 1AKMA 4JY7A 4PNPA 4X9XA 3HMQA 1E2NA 4FDUA 4C87A 4CLOA 2GZRA 1U63A 2W8BB 2W6MA 2X3FA 1YRLA 2QSUA 4C2BA 4YV7A 2BGIA 3ANSA 4Y2PA 9ATCA 4OQMA 3HJAA 2BZSA 2C2WA 1X94A 4Q4AB 1H9CA 2IA5A 5JJLA 2WW8A 3E35A 1XV5A 4ZOLA 1QYIA 3OZDA 5L6MB 4HJXA 1HYEA 1NDUA 1RBMA 3QBTA 2P35A 3A9RA 4Q9LA 1SVMA 2R66A 5REQA 1NVDA 1XSEA 2WPDA 5JV5A 3BULA 3TSCA 2WYOA 4MB2A 4TWRA 2BV3A 1U9ZA 2F8MA 3LLUA 3P9IA 5A9RA 2XEDA 5EZYA 2DBRA 1U3UA 1YB5A 2JHFA 3CT4A 2RI1A 2CHVA 4ZT3A 1W6UA 2R6DA 3K8YA 3OFSA 1GDHA 2EJCA 3X2EA 3R24A 3R9WA 1RWMA 3INTA 2EKPA 1Y7IA 2HJWA 5A06A 4HLUA 4NL4H 1DAFA 2ZM6B 4LJRA 4N7RA 1BFDA 1Y3HA 3KSBC 1ZITA 4WZBA 3U7RA 1T1SA 2F9MA 3RSGA 2ZROA 4WY5A 3ZJ5A 1KOJA 1IOZA 1JFRA 2BGNA 2BEVB 5CA0F 2XB2A 2AOVA 1YO6A 2GEKA 4J7CA 4RMJA 4F2DA 1U80A 2NQ2C 4OP2A 4HAWA 3BMNB 5LLDA 1XKXA 1AD2A 4RL4A 5HFAA 1DWPA 4JEMA 5HJ2A 2IDKA 1W85B 2Q4DA 2UYQA 3KYCB 1VE7A 4P92A 2V0GA 1YQUA 1U98A 3GUHA 4CM9A 2C2GA 4BE7B 3IOYA 2BMEA 3LVFO 1XN4A 3PHIA 4TS9A 2JFXA 2YJTD 1D0VA 4HN2A 4JIGA 2G1AA 4AJNA 3C39A 2VI5A 4HLQB 3OIYA 2C4MA 5K4GA 3DO5A 4G63A 1XAHA 1QLJA 1V9SA 3BXGA 1CRZA 1X1QA 1P4GA 4R51A 2HBZA 1PUXA 1TO2E 3U3KA 4DCCA 3LCVB 2PXAA 4KVAA 2GO1A 4BFWA 1UXHA 4LDQA 1KDYA 1TEHA 3QVMA 5JZVA 5KHAA 2VNJA 2LGJA 2DWUA 4WUVA 4MS1A 1RQXA 4IG9A 2CFTA 4B3TB 5H8WA 5FR2A 5K0NA 2AJCA 2AYZA 5J4VA 4YCMA 4LYAA 3DF9A 3H9EO 3M6VA 4QYXA 3R5JA 3DVLA 4MQ4A 3UPDA 2J45A 3B2NA 1HG0A 4Y6GB 1ZH8A 2NZ8A 4WINA 1W9MA 3H2HA 3BAFA 3VU9A 1KYQA 2PBZA 4IMRA 4X8HA 3TIXB 5MN5A 2Q07A 5ALQA 2E48A 4RU1A 4O3MA 1MRZA 4BAUA 1CUXA 1N5KA 2PZFA 4BN5A 5L3VA 4N47A 4RDXA 3PBKA 4GR4A 1X42A 4FTWA 3S5JA 1DX4A 4NP6A 2QXTA 3HO1A 4CMIA 2BUCA 2ZS8A 3EHEA 4FDAA 4ZQFA 2C7PA 5EVJA 5FBHA 4OU5A 1JEDA 5JJIA 4POOA 2R79A 3R5KA 1D4OA 2OWEA 4D81A 2EW8A 2NV0A 1Y37A 2PKWA 1HRDA 2JGDA 1BD4A 4B6QA 5C1OA 3LZDA 3HXQA 1E3MA 3L01A 4NSNA 1L2TA 5LXTB 1Z75A 2QVGA 1W8IA 4ND1A 1JZQA 2E89A 3E82A 1JZSA 3SG0A 1LTHR 1S7GA 2NU6A 4UM9B 1N6KA 3ZE1B 3QIAA 2I34A 4N6NA 1Q74A 3T7KA 1GG5A 2G83A 1LDYA 1FY2A 1V8FA 2Z3VA 3CLVA 4M7WA 5LNK6 1OTYA 2ZIXA 3WHIA 3Q6NA 4F46A 2QRVB 5CEEA 2V6BA 4C3VA 1L4LA 2Z9CA 3KWJA 5CIQA 1SKBA 2O0LA 2Q46A 3JPYA 3TZCA 2XBLA 3L6BA 1H4TA 1KAOA 1KP3A 5HMLA 4REQA 2OORA 3EXFB 1BOOA 3ORFA 3AZPA 2P1RA 2ZITA 3KZMA 2GBIA 5TV2A 4AZ0B 3ZHQA 4CYMA 4LYHA 1K8ZB 4QE3A 1N6IA 3OMWA 4CKEB 1DIOB 2ZVPX 4M0CA 1KDOA 2BHRA 3D6FA 5DNAA 5ALJA 3HCBA 1UBKS 1E69A 3ZKWA 3FMGA 5LOVB 1HFWA 1UMKA 5LDDC 4L22A 4MQEB 4RQUA 4Y18A 4DCPA 5K0JA 1M10A 3SOPA 3TNJA 3S8EA 1NBEA 4HF7A 3FHCB 3SIPA 4DL9A 4G8JA 4MRSA 3H17A 2VATA 3Q87B 4EVIA 2XXAB 3ZE0B 4C7MA 3DNPA 4CEIB 2G28A 3AWDA 2XQVA 1UFOA 2PLRA 3EVTA 4GICA 4C01A 4P0PB 1RT9A 3WJ2A 1U8CB 4PAQA 4O2AB 3U7QB 3CINA 3KB1A 2R48A 2C2HA 3WGGA 2QR5A 2P2YA 2RAUA 3NAZA 4PC7A 4H6VA 3PIRA 3QVGB 1RPTA 1AVTA 1GN9A 3IILA 3RTBA 4HZUB 3PI7A 1KF0A 2IHVA 1B73A 2ZR8A 4PO1A 2X9GA 2J5KA 2NTJA 3KOMA 3L1IA 3NOXA 4ZCPA 1G21B 3ZQ6A 3FZEA 2PT9A 3OWHA 3KOZA 3RASA 5ALVA 3TECE 2BFCB 3A37A 4RDCA 3G2QA 3CFYA 3ZG6A 4HFJA 5IF9A 5KQGA 3L7CA 3QJ5A 1Q0RA 1GGEA 1HMPA 5SV2A 3HUEA 4Y1RB 4EO7A 4MIYA 3WAJA 3WHPA 1FK8A 2QRNA 1RQ7A 3T7RA 2F3QA 3QEMB 5CA1F 4HAIA 2EFCB 1K9SA 2OXEA 3W6UA 4ZZ3A 3KBBA 4I2NA 5EIBD 7MHTA 1ZMBA 5KTMA 3FJ1A 3WDKA 1TLFA 4MITA 5FPPA 4NICA 3VR4D 1RJGA 3C48A 4Z4HA 2NV2B 2XQIA 5BT9A 4X20B 2HYIC 3WQBA 3M4NA 4BNDA 2WXUA 4XM0A 4ESHA 4I46A 2BEWA 1XEXA 4U0KA 1YGEA 4D96A 3TYXA 4BBZA 2LGEA 1EQUA 2O1WA 4JR2A 3IAXA 3QFFA 1XZKA 1XR3A 2PZLA 1SBIA 3CX7A 3E7PA 3H0CA 4D9KA 5FF9A 3P32A 4P4UA 3HLKA 1BCSB 5IT9A 4BHTA 1RZ3A 2IYSA 2UVQA 3DDHA 3L02A 3OHMA 3Q12A 4NJOA 4QFDA 3ZV6A 5KNCA 4UBMA 4H60A 1G21E 4HH3C 1SC1A 1WHTA 2FSVC 3UTCA 2H85A 2LKDA 4YV0A 2VDWA 4RZ2A 1OR8A 2QJFA 4W7IA 4BKOA 2HCRA 2K4MA 1IZ7A 1T3LA 1W0KD 2I3ZA 2ZBUA 2ZYUX 3D0RA 4LEIA 4MHOA 3TFWA 3UATA 3CF6R 1Z73A 4JP5A 2AK3A 5GGYA 3U9TA 3HVUA 5GAJA 2UXCB 2O19A 3QFCA 4RIGA 5KYVA 4UTOA 2C2ZA 4UUQA 1SUWA 1ZCJA 1P1IA 2I3DA 4GKKB 4XGKA 1PX2A 3Q9UA 1VJCA 4RACA 3BZUA 4ID9A 3VTZA 3I8XA 1OFVA 1WO8A 4QHSA 3UXHA 3TW6A 3R40A 4E1BA 1EFLA 4U6QA 1PG0A 1R1DA 2DJ5A 3HV0A 3OIVA 3TD9A 3VX4A 4BNVA 1SHTX 4ND6A 1X13A 2JIZD 4IUBS 3W3ZB 2FR0A 3UGTA 3TXAA 4E31A 5TGZA 4NHEA 5CH3A 2CXQA 1QHYA 1W44A 4DLYA 3PEYA 2ZDHA 3D6VA 3W8FA 2DPXA 3I23A 1HY3A 1ORTA 3LY8A 3AUTA 3QFTA 2XQKA 4HYEA 4JUIA 4OJMX 3R7AA 3RC3A 3RRFA 5L4LA 3EEBA 1ZUNB 2D7JA 4EL5A 2RCNA 1EDOA 3S81A 4LV6A 1GTG1 2KBEA 1SHZA 3ZHTA 3DBRA 3N70A 3WB2A 3OBBA 1P7CA 1VRCA 1YZTA 4PLFA 2CCGA 4TYQA 3NYIA 2FUG6 2NZUG 2XA2A 1RQNA 1FIUA 1BCRA 2R60A 4ZOQI 2IEGA 3ON5A 2FPPB 4JP8A 4ZVQA 2B1JA 2R4QA 3UYLA 1JE1A 1E0DA 4Y2HA 4ZGGA 5IULC 5EXEA 5IASA 3LUGA 4AYTA 2DKFA 2HA6A 4G0XA 1U2GC 2CVHA 4S1TA 4MVJP 2WYVA 1FNBA 3T5GA 3ELYA 3DAGA 4BO6A 2EC5A 1LLQA 2XMPA 1KHOA 3L41A 3LY5A 1P62B 2KXVA 3SBEA 4LDAA 5A6VA 4MKFA 1ZD1A 1R6VA 1VECA 1DI0A 1E3TA 2IEDA 4RLHA 3LWNA 1KYYA 4IVNA 5TPWA 1M34E 2EP8A 1UWLA 2WTEA 1MXHA 2M1XA 2W2LD 5KJCA 2FR8A 2O8DB 3WHKA 2XWSA 2BBTA 4RMGA 1F4PA 4F60A 3OQ6A 1Y4ZA 3VVMA 1U5BA 3FOBA 2XGSA 4PZZA 1HU9A 1Z2AA 5CLHA 4I19A 3VNQA 1JPJA 1X1DA 1TM1E 2OV3A 2Q5HA 2Y1WA 2ZPTX 3FHLA 3AETB 3QXJA 3TPZA 4BV2A 1IATA 2C2OA 3VNSA 2GEFA 2P3SA 2AFHB 2RI0A 2FPXA 3OLQA 4R1OA 1B7GO 1HQYE 2F64A 3LE8A 2GESA 1YR8A 4BU0A 3RARA 3HS3A 1GADO 2LZ0A 3AF6A 1G4UR 1MG0A 4IMPA 4YMUA 2PWAA 5ISMA 3HL4A 1QZXA 4DSAA 3Q88A 4ZKDA 3KEMA 4WCDA 1C1DA 2YTZA 3VPDA 4D26A 1E2KA 1ZJ5A 3GXOA 4NENB 5B7NA 2WP0A 1EVZA 3HEMA 2B4YA 3OD1A 3RANA 4LHWA 2O2JA 1D9XA 1J0BA 3FZGA 1YZLA 2ONJA 2ZRLA 4CETA 4NBTA 3SJZA 2QN6A 3DUWA 3R5FA 3RS4A 3X2FA 4WFIA 3DPUA 4P7KA 2W2QA 2WP8J 4M0EA 3LO5A 2FRXA 4QVIA 4DHWA 1ZNYA 3PUVA 3C5HA 5CPFA 5FPQA 3V1KA 4C4AA 1Z0AA 2OHFA 3AR2A 3KJNA 4KTVE 4KBFA 4CZ2A 2JLRA 2QDKA 3C87A 4RV4A 1PF7E 4KWHA 1QYCA 2FPGA 2L82A 3NQ41 4P81A 5IFKA 1ZR4A 4IDDA 4FGZA 2C4HA 1E0AA 4ZI7B 3KJFA 1BN6A 3COWA 3BN3A 4AS3A 1H2BA 2GB4A 2XR1A 1GPYA 2HMUA 5AVJA 4X0EA 3WMXA 1UUFA 2GTHA 2YWCA 4O4JB 2DJIA 2AFHE 4HRYA 3MVEA 3GZNB 2DMRA 5G0UA 3PC7A 1QIJA 1BROA 3ESCA 3P9ZA 3RF7A 3VDQA 4CMJA 5CITA 4QZVA 2VRBA 3IQIX 1I7QB 4CCAA 1OX4B 4KUEA 5C5EA 1N8QA 2IHTA 3RBAA 3BH6A 1BHO1 4Q93A 2JFZA 4NWIA 2HJRA 4X64B 1I5EA 4B2YA 3ZJUA 2VZEA 2GN0A 4M8LA 4LRTB 4D43A 2WHXA 2BFEB 3ZLBA 3PQ3A 1COWD 2IUKA 2QZ4A 4L51A 1XDWA 4Q01A 4IJWA 3A2MA 4NC9A 3IBFA 3L9WA 5JO9A 3C3BA 1IAVA 5THXA 4YMLA 3EOZA 1CZUA 2NXCA 5CURA 1QG0A 4GOND 4H17A 3BRWD 4MV8A 4PGMA 3Q9NA 5C1IA 5AOVA 1JQLB 5GQSA 4DMCA 2O6LA 2ZSBA 3DW1X 4PFKA 3ER9A 3KR2A 4RWEA 5LQRA 3DEIA 4N8SA 3PJGA 5FI3A 2OYRA 3SNHA 1DKPA 1QUEA 1Z0FA 2LE0A 1SZDA 2I2FA 3C24A 3C8MA 4FR2A 4IUYA 3TMYA 1FFAA 3WTCA 1D8AA 1K7FB 2OOKA 3FPGA 3WZ2A 5L53A 1KEZA 1YRAA 2GPTA 2YY6A 4DYDA 3U5TA 4G4SP 3NH6A 3RT1A 3DZHA 3AP1A 4P0TA 2PH7A 1VPWA 2J0EA 2Y71A 3AVQA 4RE6A 5ALTA 5BYJA 4FYXA 4X24A 5JBNA 3VQTA 2QYSA 1H85A 2XXBA 2H7VA 1Q11A 3HA7A 4HEHA 4HCJA 4OF4A 5GOZA 3K71B 2EBHX 1JIUA 1A88A 3DAOA 1MQSA 2JLCA 2R1VA 2Q5OA 5E3HA 2BE9A 3DDWA 1F4VA 1L7XA 1HO3A 1JQBA 1JL3A 2UUCB 4EKNB 1UMCA 4CN8A 2OB1A 4I50B 3L0SA 3O75A 2I76A 2O1XA 4AJJA 1R3UA 2R86A 2UZ3A 2VJQA 2YN2A 4PZLA 4PV7A 3BIWA 1WZCA 3EW9A 4MGKR 5DBGA 1BMFD 2V6MA 2W83A 1PS8A 2HXYA 3SC6A 4DUGD 1DBSA 2MJLA 3KDSE 5FYQA 1KIFA 2Q5QA 3HJTA 4YC7A 2AYXA 4M4SA 3HU3A 4UBJA 1ZMTA 1IJFA 1F6WA 4XQEA 1XAJA 3Q8MA 1XLWA 1AN0A 5EJ7A 2KBFA 3OJWA 2CLCX 3NHYA 3KZXA 1KY2A 5EZYF 4C4XA 3EXAA 3AKDA 2M98A 4RFLA 4OHKA 5KWJA 4KR7A 1C9JA 5AVZA 4UATA 1XNQB 4M0LA 1DAIA 4HAVA 1UPFA 5C53B 4QUBA 2OFWA 4YRMA 1P4JA 1JIIA 2GAIA 4G23A 2O8FA 4L4UA 1Z5OA 4JJZA 4BQIA 3RI3A 2REQB 5IEBA 2WY2D 2XE7A 3WL3A 2M6SA 4I9NA 1E94E 1HXHA 3IR7A 4GS5A 2IW3A 5EQFA 2YKGA 4JV5B 5JJKA 3PGJA 3L8FA 1EX6A 1JIQA 3AR6A 2BMFA 3H2IA 2FDXA 2ZAGA 2AG8A 2J41A 2NPOA 3Q8XB 2HO4A 1M0WA 3TOVA 3U1BA 4LK2A 1V8PA 1VA4A 4KRYA 2HUPA 2Q3FA 4K0RA 3LM8A 4NJEA 5TE9A 4LZLA 1MJNA 4P93A 1ANKA 3DR5A 3ZJVA 3AVVA 4AS1A 2VXBA 2OESA 4Z9BA 3TLAA 4BQFA 2GEDA 4EFLA 1FVFA 3EGDB 1Y4UA 2C3OA 3WGOA 3KR0A 3TNDA 4CQJA 4WXHA 3AFNA 1XMQB 3PJRA 2B3DA 2P2LA 3FY4A 3RABA 2QIOA 2DHDA 2OHVA 3JU3A 1U1FA 2CE7A 1V16A 2YWFA 4IDBA 4JI8B 3CNBA 4GWGA 1BD3A 3VNRA 4NKRA 1ODCA 4QA9A 1RI1A 1W5SA 2OKCA 2RHJA 3JRWA 3N0XA 5HRCA 1J8YF 3ZCXA 1SKUA 2H2DA 2DP4E 2ZW9A 1MX9A 1EVIA 4FXPA 1BX1A 1J1IA 1DJLA 9LDBA 4DR6B 1SIBE 4NZOA 1JR2A 1BS1A 3DWIA 3PHGA 3GYGA 4OHZA 1PBTA 4UEOA 3WB1A 4P36A 5HR5A 4ZGBA 4PAOA 5FWAA 3EJ6A 2R1UA 2DGDA 3EFOB 1JVBA 4JGBA 4F91B 1SVUA 2Q1TA 4IFTA 1VKHA 2QVXX 3OTHA 2GEJA 2O0MA 3N8KA 4FFBB 3NG1A 4B48A 5IARA 1RHUA 3LKVA 1PR1A 3B36A 1RI3A 1ULZA 3JCZA 3DMNA 3GI1A 3UPUA 1A8PA 4MDYA 4IDEA 2KXTA 3IKVA 2RGBA 3K09C 3CUVA 3LO8A 4WV3A 4A6PA 4IQ0A 1WXQA 2VOJA 1R0SA 2J9YB 1UZAA 3AV3A 4JMPA 3KWMA 4X85A 1P7VA 2C8LA 1F12A 4JT4A 5ITSA 4C2UA 1XP5A 4NV3A 5AM2A 3FLMA 1J0CA 2YOGA 5IKEA 3L1HA 1PEAA 4E15A 3ZHCA 2QSYA 3A4MA 3JX9A 3KJHA 3CSDA 5DLEA 1U3TA 1D04A 3FB4A 4XUGB 3ZU4A 1FFYA 1ACMA 1YGYA 2FRDA 3HBJA 1LS1A 4EPRA 1DCFA 3T52A 4AFNA 3L8GA 1EEXB 3PUWA 3QWHA 5LVAA 3QX3A 1E1QD 3E2IA 1V3TA 3TLBA 1VKRA 2Z0MA 2JCYA 3P2OA 4IF4A 4G9GA 5KNLA 1M1NB 1BYIA 4RPLA 1IEXA 2VIIA 1H8EA 1O77A 2UVPB 3PD1A 5IJ9B 3TW8A 1NN3A 1BS2A 1WA5A 1ZU4A 3H2KA 1OLXA 5HMMA 4ER6A 3D6NB 4UM8B 1SHJA 4EA6A 2IQIA 4HBGA 1VL6A 3Q7PA 1DJPA 1OY1A 2YNMC 2B7CA 1W5BA 4LBYA 3WGLA 4BNUA 2XVMA 4C0WA 2FW1A 2DG2A 3ADPA 4KR9A 1NUSA 3ZY2A 4NF2A 3TTSA 1NG9A 4W5TA 1GYQA 1W0JA 1ZBQA 4H4EA 1PNVA 1EJBA 1RQPA 4CGZA 3QG1A 5FA5A 1E7QA 2I78A 3DAHA 3MINB 1FUEA 1G5TA 1UFVA 1ODFA 3RFXA 4J2HA 3Q9LA 1LQUA 3HB4X 4E4RA 1NW9B 1QHHA 1Z2DA 1DBQA 3GFGA 4J2TA 4EG3A 2POCA 1DB3A 4XJXA 4MW2A 4R8SA 2X0IA 3OEYA 4FFNA 4IGEA 4KR6A 1JA0A 4MZDA 2W00A 4CT0A 2V58A 1NTRA 5FL7A 1C30A 3LUFA 2Q2QA 1ISRA 3C3DA 1Q2UA 1H6CA 1R4NB 1QCZA 3N7TA 3QMVA 4HDSA 3O4GA 4LRWA 4YRLA 2G4LA 5IC5A 2FFBA 5CIYA 3CNHA 1U1EA 2J4CA 3I3OA 1GU1A 2MSEB 5EG5A 3D6JA 4Z3DA 3HI4A 4AZSA 2I03A 5EQJB 3TLXA 3GLFB 3HCEA 2ZJBA 4OL9A 4EDHA 1UBMS 1UPAA 4HAZA 1FFXA 1QRRA 3LFTA 4PZCA 4G0YA 5J2UA 5JNUA 3RT9A 3GJRA 4IKPA 4QL3A 4CMBA 8ABPA 1H0RA 4OYHA 2OCPA 2ZWOA 1Y9ZA 1JA9A 4ND7A 2PDAA 1QBGA 1FLDA 4MTLA 1P1HA 1P1RA 4OGGA 1GFZA 3A6PC 3H42B 2QL7A 3UQYS 4BDTA 2GWRA 3OLCX 5I9LA 3P94A 4IMJB 3DXZA 1EVEA 3ENZA 3FPLA 5C18A 2O5CA 3H1EA 3M9WA 4CU2A 2W22A 4EPVA 3N07A 3THRA 4DRXB 1SVKA 3THXB 3VSDA 3R7LA 2ORYA 4QNNA 4B76A 1Q0TA 1P5HA 4FZ5A 4V3BA 1FSGA 3TSAA 3AZOA 3WOHA 3EGXB 3RNOA 4HR7A 1CKEA 2X1LA 4KSYA 5ICSA 2ZI5A 4KO1S 3GMSA 2NPIA 2E4ZA 4KE7A 2ODPA 4Y2QA 5LP1A 2J7KA 2R6ZA 2HSEA 3JQQA 4R1QA 2W70A 3SSNA 3Q2KA 4WL0A 1AXEA 1Q1BA 3OTGA 3RB8A 1I6LA 1CS0B 2PUGA 5J59A 1EFHA 1D6NA 3E4CA 4K9NA 3BD7A 2XODA 3CH7A 3LUBA 4WCFB 3VR3A 1T13A 4DMLA 2HJVA 4Z4GA 1BVHA 3QVUA 1UMDB 5H83A 1EZZA 4QUGA 3MTGA 3S68A 5JVDF 3PVSA 2NGRA 5GZ1A 3A3YA 1KMHB 1X1RA 4M98A 4PIVA 3NTUA 1B0UA 4RNDB 4Y6QA 5BQPA 1EFVB 2AQKA 1HDEA 3ESZA 1EG2A 3G2MA 4NYMQ 3W1VA 2CDBA 1CUUA 3HKBA 3MT9A 4DANA 7REQB 3BM5A 3PUKA 3RVQA 2ENUA 1VQ1A 3STXA 3ZU2A 5J43A 1N2ZA 3D1JA 4Y7CA 5CNIA 3W4JA 5LU9A 2OBNA 4NOLA 5JCOA 1H22A 3T7DA 2BDTA 1P9NA 1Y8QB 4RKWA 2DHCA 3H1TA 3ADDA 4YHBA 5I9BA 3OCZA 4IF6A 2Z6QA 4OQNA 221PA 5IJ0A 3DGEC 3DAYA 1V9CA 4M46A 1G0NA 2JAWA 1AKUA 2IF0A 3EX7C 2ACWA 1NMEA 3L0BA 3L9XA 2I3BA 2P9GA 4OEHA 2CJWB 5IJWA 1QH1A 3Q7QA 4C0QC 4CCSA 2QZ9A 4KZPA 5FPHA 2MCFA 3AUSA 4G56A 3PNOA 3JVDA 4D4IA 4PSCA 3WWDA 2P1ZA 3GJ4A 4K3VA 3TAXA 3K0AA 2XE8A 2H4XA 2Z2YA 1N5LA 1O6GA 3FKSA 3OT5A 2DX7A 3PPXA 1R7RA 4K6FA 3Q7EA 3X1DA 1DWOA 2OVFA 5HKKD 1SU7A 2PV0A 4P5DA 4G6ZA 1M72A 3BUSA 1PFGA 3G2NA 3BDAA 1MXFA 3U9SA 2Z9DA 3BJZA 4YACA 5TQ0A 3RNLA 1E2MA 2WB2A 1QB7A 2IXFA 2OZLB 1G8MA 4TMZA 3U7IA 3M1IA 3WLEA 4BZXA 4GX0A 3TB4A 5DLYA 3GDGA 1KI4A 5KOIA 2B0CA 2C9OA 1QZ3A 4S1NA 5TVKA 4GEGA 4ZT4A 1MZPA 2VQEB 1T5IA 1LV7A 1WZEA 2BMVA 3ZU5A 1RJDA 4DLRA 1GUZA 2EERA 3PNQA 5DLQC 1GG9A 2XAUA 3OEWA 5P8WA 4RY9A 4UJ5A 1H2EA 3QVKA 4A73A 1AQYA 1O5TA 5CH5A 4YRNA 2I22A 1NLMA 5D3ZA 2G1KA 1IWPB 3SDZA 4FQ7A 4BNKA 3LFHA 3RCBA 3EHDA 1C9MA 3WP0A 3VAYA 4LUCA 2C29D 2YBDA 3M83A 3VAZA 4B81A 4G0OA 1JIKA 2DLDA 4FCTA 1FYXA 3B5JA 4GUDA 4RD3A 1GR0A 3AR8A 3ZBQA 5GV8A 5BOSA 1D6JA 3KUUA 1CV2A 3V4PB 1I10A 3ADKA 1NA5A 5KQRA 5AWFC 1OLUA 4LKOA 2CXTA 3NVDA 1GA6A 3HKEB 4G1VA 3IUNA 4O2BB 1Z5UA 2ODWA 3NEYA 2GKOA 4AXXA 1FLVA 4Y3UA 4E2YA 3VJRA 3ZD7A 3FOAA 2P67A 4U2FA 3JVIA 4TM8A 5CVTA 3LT2A 4QUKA 3BSWA 1W4RA 1X7WA 1WSAA 5KYYA 2I3GA 4GBGA 1BW9A 3EGEA 4MMYB 4NABA 4DDKA 1CEYA 4IR7A 3SFVA 1C4KA 1Q92A 2Y6VA 3GGOA 3U7FB 1ZOLA 5HRUA 2HSGA 2YXNA 4DSOA 1UOOA 1SCJA 2W9XA 1OAOA 4PLTA 3WBFA 2BTOA 4M0KA 4UXIA 5FD8A 5KVQA 4L75A 4TL8A 4EG0A 4YCJA 4B3XA 2XNSA 2H5IA 1ZN2A 1QIEA 1EB8A 3GC6A 1XL1A 1KR5A 3JAWB 2VRCA 3QU5A 5KKCA 1EXMA 3QK7A 4FKMA 5A5FA 4RORA 5KAPA 1RM3A 4IVPA 3CR3C 1Z12A 3K05A 4JP1A 5FUVA 3RYFB 3U7EB 1E3IA 4PIMA 4HJRA 3TIFA 2ARKA 4E5SA 5KTRA 4BYGA 5DIFA 1OFHA 3ZD8A 2G06A 3A9SA 2A0UA 4Q3CA 2ZM5A 1TA4A 1QV9A 2DBYA 3JARB 3EC1A 1PX0A 3AY3A 4MZXA 4DN6A 1IQ0A 4L76A 3DOOA 2HU2A 1XYGA 1INLA 1U0HC 2JJMA 2ZE7A 3EFHA 1AY0A 4ZMSA 2NYAA 1MT3A 2EWVA 4KQ1A 1H9BA 4OGLA 4OY3A 4ZO6A 2JIPA 4E5VA 1QYVA 2P6PA 4IIFA 4CG0A 2ENWA 2QTHA 1Y3IA 4OKIA 3GLIA 4RZHA 1Y5LA 2FWNA 5EZ6B 1IUKA 4G97A 5TVGA 4HADA 4CRWB 1ZD3A 3CURA 3VPHA 3B51X 1N34B 2W6CX 3P8ZA 3U81A 4HPXB 2B4RO 2ID9A 3BGIA 3C4VA 1G18A 3IE0A 1GZUA 3IA7A 1FXWF 2H51A 4WZ6A 2FI1A 1NF2A 5FPTA 3ZWQA 4CM5A 1KERA 3K96A 4NFHA 3V8PA 2XF2A 3C45A 1HZJA 2J4DA 3KSZO 4UQPA 5M04A 1FTNA 2ZTMA 1UQTA 3FSEA 3LBNA 5CXUA 1BH6A 1XHLA 4RKEA 4U3JA 3RUIA 5CCXA 3G5AA 4UPDA 1DX9A 1QHSA 1HM5A 4NARA 1FU8A 5SZIA 4MVJH 3TLKA 2A84A 4KWCA 3IV9A 2OK8A 1QTNA 1QS0A 1ZN8A 3QI2A 4MGIR 4XFJA 4CTMA 1L7PA 3V3KA 2X5XA 2B99A 3U4QB 1U81A 4AJ2A 3BC1A 4MICA 2OV4A 3DBLB 3M33A 2HO5A 3LH5A 3WMEA 2G88A 2UZ1A 4GC5A 2NZYA 4YJ3F 3ZCSA 3TQSA 3THWB 5EJGA 4MW9A 3DHEA 3B1ZA 1U3VA 5ALGA 1W5AA 3N3AC 1G63A 1WPGA 2XZOA 4XXHA 5D1HA 1EDEA 3QGMA 4YRGA 1F1JA 3X3HA 1HYGA 2H1RA 3IR6A 3FPSA 2C20A 4QRIA 1C0PA 4XQ0A 4YJFB 3OECA 4NU6A 5SZHB 3UY4A 5GZ3A 3GR6A 1EJ2A 2V7WA 2DFVA 2E9SA 3DQZA 2B2XA 3HWX1 4MR9A 5G40A 3PEVA 1HT1E 2D3WA 2HJSA 3O92A 5K20A 1NI5A 1JHZA 2D0PB 2Y8EA 3BIOA 1J56A 3EQZA 5B3AA 4H77A 1X86B 1LS6A 3VU3A 3G0HA 5FO1A 3N75A 5DM70 3MCWA 3JQEA 2PWBA 2XUKA 1AK1A 1YT5A 3ORQA 4GMDA 2C54A 5FWXB 4GMXA 1QRAA 1JEQB 1PGNA 1U2DA 1YQWA 1MQ9A 3LUPA 1KZGB 3IP7A 3PNVA 3ROTA 1EWTA 5F98A 3G13A 3BZWA 1MD9A 1O57A 2G9VA 4TXMA 3WIDA 4CLOB 2O54A 2Z6AA 2PEYA 3NWEA 3FHTA 1E2QA 2PCLA 1PZMA 4EW2A 3U2QA 5DCWA 2R47A 5T4HA 3RFFA 2ZSKA 1EQAA 4ZOLB 2EP7A 1PZNA 3I6YA 3HKCA 2PQ2A 3MNFA 4LE1A 4NH0A 3SS9X 3G88A 3ITKA 3P45A 1QK4A 1NQVA 4NMMA 2CT8A 1THGA 1S8AA 4ERXA 1N5DA 3R5SA 3TRHA 3ADCA 4DV6B 5REQB 1JQKA 1XU4A 4CIVA 3L1JA 2W6ID 4Y1GA 4HDKA 4GBJA 3W9SA 3MB5A 1ZC3A 1ML4A 4GD3Q 4IMIB 5EZYB 3CMCO 4CF7A 4CIAA 3Q9SA 4CUKA 4U2CA 2ECPA 3RSZA 3B89A 2C4TA 4GZ3A 4N49A 4RZQA 2GERA 4WKGA 1TO1E 2PJUA 2ZDQA 5C1BA 2XWQA 3KWLA 4GLJA 4H59A 2YXDA 3GH1A 1WWKA 4QPPA 3D2AA 4LZNA 4QUIA 2AEJA 5A7HA 5FULA 2IWRA 3DVQX 1AGPA 1LDMA 1TF2A 1YK1A 3FTPA 4LN1A 2SECE 2VSXA 4WRRA 1KZHA 2C5EA 3HYTA 3UEOA 1KZ7B 2VK1A 4WZBB 2RKBA 5MFPA 2H9YA 3EA5A 3HV2A 3CLKA 2YQ5A 5M7EA 1NI3A 2FEOA 3ZWOA 2LPMA 4HSEA 4XX0B 3FM9A 3T34A 2PK3A 2X2FA 3CRNA 4ZMRA 4AX8A 2EFEB 4CKCA 2R8PA 3QYPA 2G9NA 3TQTA 2DVMA 3I01M 3WLQA 4Y6RA 1PV4A 3CEJA 2Y05A 1UXOA 5EEHA 4GOLD 3USZA 4BFZA 1X3LA 3ICEA 5BSUA 4LF7B 3TPFA 3DHVA 2PO7A 1TIPA 1EIWA 2Q1WA 4QQNA 1L4YA 1KTVA 1SCDA 3ZE9A 2AKEA 3O6VA 3GJ7A 4KHZA 4CLRA 1SC9A 3M2PA 1OXMA 1U7OA 4J7UA 3UAVA 1FFDA 1T91A 2OY0A 5TJ9A 3T3IA 3UMRA 1ZWLA 4I2VA 3NH9A 3V7WA 1AF7A 1ZW6A 3H87A 4UHFA 1XTBA 2D3TA 3GRVA 4FMCF 4DCJA 1MVNA 2JLZA 1WAMA 1YMUA 3CR7A 1K0UA 2O1SA 2XWPA 4GI2A 1OW3B 4QPDA 4XWAA 4BQPA 2KW5A 4MO9A 1QP0A 1RU3A 4Q7LA 4D8UA 4MS1B 5LZ2A 4RIIA 1QYWA 1UT8A 2YVAA 4OK6A 3ERCA 1MMFB 1Z74A 2JIBA 4PTZA 4RANA 4N5HX 1E9FA 2HGZA 4OLHA 4BRUA 3UAZA 2P2NA 5CFRA 3VU1A 4V0RA 3U1VA 2NSHA 2P0EA 4MI9A 2PKYX 1BA3A 2WHRA 2HY7A 3RLIA 1QE3A 3VU9B 3I5YA 1E1MA 4RSMA 4RD1A 1XTTA 2YRXA 3KUKA 1SCNE 4IGAA 2BZGA 4CMKA 3CZRA 4YRBA 5AW9A 1X1TA 2XUAA 4Z2YA 4EATA 1Y6FA 4PX3A 3V1LA 4BECA 3EAFA 2CZQA 1RYMA 1B6TA 4CMIB 4EQZA 4OTZA 3HXMA 3ZGOA 1SUBA 1NLZA 2BF7A 1RHRA 1KNXA 5AO9A 1D7OA 4B6SA 4QT4A 16PKA 1DTWA 4D80A 1VPDA 3BWCA 3PLRA 2JGDB 3E1SA 2IVZA 3S40A 4B5KA 3U60B 1AHIA 1HI9A 2IZ1A 2HK8A 1TK2A 3RKSA 2KPOA 3C4QA 4DLUA 4TKVB 3JQ6A 3VC3A 2AZDA 3OJOA 3IB6A 2NU6B 2C7GA 4BO8A 2ZIFA 2HHCA 1SZPA 1CPYA 3BE8A 1J21A 3UICA 2HDWA 2WI8A 4YAEA 2QX4A 2RGCA 1DKOA 3ELUA 4O33A 3GAFA 2VH1A 2J7PA 2VQ6A 5JQWA 1P4SA 2W6ZA 3HACA 3TMKA 1QIGA 3ZY4A 1CRPA 4YCDA 5JFOA 3RYIB 3MN1A 2VYVA 4PNZA 2HSJA 2FFJA 3O47A 1WTAA 1KI6B 3SKYA 2FEMA 4RABA 2CXNA 2O6HA 3ZGXA 1LPOA 1M2HA 2X9LA 4ND5A 2YY7A 4DW8A 3ZXXA 3B82A 1TF5A 4OQFA 5DK6A 1EM8A 1T5HX 4PLGA 5SZKB 4EBFA 1Q2XA 4Z9YA 1XRRA 2I91A 1SG6A 2CKMA 1KJ8A 2GDJA 4YCBA 4MYTA 4QATA 3ZKWB 6YASA 2QMYA 1K7XB 1J0XO 2WKQA 3RV3A 3VZQA 5HHTA 1V71A 3PNPA 1HZZA 4A0RA 4C0XA 5A0FA 4CI0B 1NBIA 2IZ5A 4INPA 5HEKA 4RADA 2QN9A 5IAKA 1B1CA 4QPJC 5AXCA 2VO1A 1TQDA 3RR2A 5BSFA 3CLUD 3R0XA 2IV2X 5CFMA 4LJYA 1E9VA 1YZUA 2O5VA 1H8HD 1W36D 4R9RA 1JFSA 1ONOA 2YVLA 3ACBA 1K3TA 5F3DA 4KW7A 3HJRA 3CVVA 3D8RA 4JXZA 1DO8A 3R7WB 3USES 4V0SA 4RVSA 4Q7QA 4JI7B 3ZHZA 4EKGA 1T5SA 4OBBA 4DV2B 1LWNA 4I6GA 2W7TA 1LI4A 3CVXA 2NOAA 2R96A 3D8UA 1CU1A 4I36A 3RAJA 4A91A 4DDVA 3FYUC 3CG4A 4KBGA 1PT8A 3BF7A 4N0QA 4NU8X 3ZGZA 1ZQ1A 1XU9A 1DPFA 4H6WA 1YDEA 3O03A 1NW4A 5FLKA 4ZI5A 4ZPJA 3TLGA 1GXSB 1I1HA 2IZZA 1BXZA 4L28A 2XTNA 1LOXA 3I9LA 5LYYA 2WIAA 1E1NA 3MJVA 2GFQA 2XD9A 1WUKS 2JI7A 4CIXA 5J2TA 4RPIA 3UJBA 4E5PA 3TVYA 5DV9A 1RPZA 1W2HA 3EVEA 5HF9A 3OSUA 1U8XX 5ED4A 1XVLA 1OPRA 3P97A 4OBEA 3A3OA 1AV6A 3M6AA 4FONA 2FTKE 4HQOA 4Z0PA 4ZDIA 2DERA 3NWOA 1EFDN 1I2DA 1OWNA 2DUNA 5DP1A 4W1QA 4CG2A 1DHRA 5A3JA 3ACCA 3BB4A 2BEWB 1XEXB 4TGLA 4TLDA 5TR9A 1Z22A 2UXBB 3AHEA 3QP9A 1ESDA 4GL2A 3KQYA 2O59A 3ESBA 3HVJA 5JPDA 2E6KA 1NX6A 2PYIA 3AFIA 3I5MA 3PENA 3EH2A 2IKQA 4OIMA 5IC6A 3GRAA 3LX5A 5IH3A 1S96A 4B43A 4P33A 1JEJA 1O8CA 4KVZA 4TTVA 2YMMA 3JRXA 4F56A 1QFMA 4HLUC 1N3IA 4LF6B 2XFDA 2HNAA 4PHFA 1WHTB 2EEZA 2XVYA 3T99A 1VE1A 3DLBA 5I9NA 2VDWB 5KJ1A 2ZGVA 3HGQA 3SX4A 1V4NA 2AN3A 3ZIUA 5DHSA 1P8AA 1E0SA 1SUFA 1TFUA 4P6VF 4IJQA 5F2KA 1MORA 2DTXA 4HMQA 3WBJA 4BO2A 2VQDA 5CLQA 4JJ6A 3IOCA 2WIJA 4TXLA 4AP9A 1EG7A 1OBHA 1E2GA 2ZYGA 1DBRA 1WETA 2VQSA 4G81A 2I99A 3IJPA 4QEKA 5LP6A 4R71A 5LSAA 2QVYX 3CB2A 3M89A 4OGFA 4W5OA 1GRVA 2VT7A 6PFKA 3QYAA 2ZJOA 3DE3X 2X5NA 1LV8A 4JU9A 3SXPA 4CNBA 5HJEA 5LDHA 1YFJA 2G5TA 2EKLA 2XLBA 3C43A 2AOTB 3LHSA 3PFIA 4CWAA 1RACA 1CR0A 4HYQA 5JALA 4WNYA 1UBTS 1BH2A 5LYJA 3AMVA 3ZK8A 5E9WA 1K4MA 2COEA 2OG1A 2GD0A 4URWR 3HZOA 3C6QA 4MB0A 1DQSA 1MA3A 2V7QD 1HX7A 3DBRB 1B00A 1SCIA 3UXEA 1I4WA 2CF5A 2J31A 1FLNA 2VHCA 2P2ZA 1M5TA 4JI3B 1GITA 3WIUA 4LPKA 1BCRB 3IBYA 1A9ZA 1B0ZA 4XSVA 3M4YA 4U6SA 5F9MA 2F3PA 2WMOB 3BORA 3N86A 2M1ZA 3LJKA 5J4KA 5L7TA 5TT1A 2VDVE 4RCVA 3ZLTA 1EIZA 4I9UA 3WZLA 1TT5A 2R44A 4PRZA 4HO1X 2ZJZA 1DEAA 2FPKA 4KR3A 2PPLA 4BO4A 4ARVA 5B1HA 3P4UA 1AIPA 3I53A 5AMXA 4PC1A 4ZRNA 3LSYA 3U3XA 3L8ZA 3ZWYA 5TPWB 3SM9A 4F2HA 3HFSA 2VK8A 1ZI9A 2ZVJA 4KQ9A 5LZ5A 1Q6ZA 5EJ9A 3R2JA 4IIYA 5BN1A 3T7IA 1O6CA 4Q19A 1TOAA 3KHKA 4J75A 1DAMA 3GLHE 4GP6A 4KMMA 1TUGA 1QP4A 4N5MA 3OP1A 4Y9SA 1GGVA 2H2HA 2HXSA 1TUIA 3RUAA 3T7JA 4ZVUA 2W43A 2FEAA 2GA9A 2OPBA 1QHGA 5EFOA 1H69A 3FOZA 4O4HB 2PRYA 3ZWCA 3T9EA 4EKYA 3GD7A 3MD9A 1Z5ZA 2VFAA 1CUCA 4JL5A 5CLFA 4A3SA 1JR6A 3MQ2A 1Z6AA 3PFWO 4Q3KA 3K6JA 3LIPA 2VEDA 3BTOA 3ABIA 4KB5A 4MKXA 5CVUA 5EQTA 3V32A 2IOYA 2ZUVA 2PGIA 4RDHA 3EA4A 1LA2A 5JZ9A 2FCRA 1EGVB 3H04A 3RFUA 1PLLA 1C1DB 1V3UA 1ATZA 4OXIA 3HXLA 4MGHA 4ZVNA 1MN6A 1P18A 1XTVA 3FLEA 4N39A 1P6XA 2BI4A 3LV8A 3SZOA 3VO8A 3DB2A 1VLLA 1JFLA 1YZNA 2OORC 1GLNA 1Y80A 2GUWA 3AONB 3CJQA 1VBMA 3LCRA 3O2SB 4C5BA 4L5AA 2PSHA 2GZMA 3EEIA 1JIXA 4OA8A 2X4GA 1XNJA 3C2QA 1Y3DE 3K70B 1A5AB 3M5PA 1JPUA 1NMSA 1FJ2A 4LVUA 1NASA 5DM2A 2CNBA 4HI0E 2EHDA 1NQUA 2A33A 2WKPA 4HGRA 4LX0A 2H2WA 2ZB2A 4H35A 4PPNA 3SNKA 2E0IA 3NONA 2W48A 2B1QA 1I1QB 2JLUA 3D3WB 4KE9A 5GJCA 1H05A 2YWEA 4WA7A 3LNCA 1MO2A 3VC2A 1LFAA 5JFTA 3I9V1 1YE5A 3FIUA 1MU0A 2PTGA 4JNCA 4MAFA 1S9HA 3OJEA 3GK3A 1MIHA 4C2AA 4Q9DA 1P4AA 2NU9A 1FSFA 2NLOA 2WV7A 3LOPA 4I1YA 2R8EA 2ROQA 5FEMA 5T3YA 3REOA 4DZTA 5KAMA 9MHTA 2D1TA 1G3UA 3IVAA 3R7NA 1IWOA 4OA5A 2F3RA 1TL7C 3PL5A 4EYOA 4LK3A 1WP4A 4R2IA 4INAA 4V0NA 1BU8A 3KE9A 4FGSA 3W5AA 1S4MA 1W34A 2NUBA 2SICE 1Y6RA 3OJXA 1T8PA 3ZVRA 4COOA 5C8ZA 1KHHA 3IXQA 5AK5A 4FGUA 2P9ZA 1VGRA 4YP6A 2W93A 1XWIA 3VKWA 2QTVA 4LJKA 4BJ6A 1AGRA 1FRNA 3OIWA 4L9SA 3W5BA 2AN5A 4DREA 5C8YA 1P1KA 3C8UA 2LCFA 3EZ6A 4IHJA 4WJZA 5DX8A 4KXWA 1ZJWA 5KSYA 2JI4A 3ET5A 2VP0A 3GBVA 2PX4A 3FAKA 3H5TA 4LYGA 2FQWA 4H7FA 5IVDA 1GM5A 3WIEA 2PSEA 1HDZA 3RVJA 3U4AA 1NBMA 2ZWMA 2YHBA 5DGHA 1SQGA 2CNOA 3IEIA 3WK7A 2WWIA 4WK2B 1G7RA 1GZ6A 2XT6A 2XITA 3HNPA 3KB8A 4O3FA 4KYIB 3ODPA 1UZLA 4YT2A 2AV6A 4DLZA 1DV2A 1JILA 2YIMA 4I6EA 1Q5PA 4G67A 4IXDA 2LBPA 2HREA 3LW8A 3HO8A 3ZK7A 4E2FA 2WKSA 4PN3A 3VA7A 1Y82A 2X4IA 4IHAA 3LQ2A 1YFKA 1HG1A 2D2FA 1SHKA 3RTEA 5K51A 5D01A 3LOUA 4F4DA 4G24A 2CF6A 1KVQA 3IO5A 3ZGYA 1C0EA 5EMMA 1IN4A 4DZZA 5FR1A 3NX4A 2AZTA 1BX0A 1GTZA 1TB4A 2PGJA 3I1FA 4LSGA 4BU1A 1HPLA 5BNIA 1BTOA 4KWTA 2XNCA 4HGOA 2FZLA 2GHTA 1ESMA 3JTMA 1GZ3A 1P9LA 3L46A 4TQUS 3V2IA 4GWKA 1GFWA 1P2FA 4PG8A 1PKXA 2O4CA 3FF1A 5K2MA 3W5CA 3QBDA 1OXSC 3HYSA 2E4WA 5LL6P 4PSKA 5FFMA 1NPTO 2HSZA 3E23A 4QTYA 3K0HA 1NVTA 3L7NA 5ICEA 2VH5R 4QXRA 3AQ4A 1DG3A 3PYMA 3C70A 4MJLA 4PLVA 3DHYA 4FFRA 2J9ZB 3VKHA 4R40A 4RF2A 1QONA 4K26A 1Z5PA 1JKFA 3KUCA 1DEKA 4I5DA 4R81A 1K66A 3KO8A 1AURA 1UP7A 2CSXA 5TMPA 1JDBB 2J3EA 4C76A 5FTLA 1AS0A 5B37A 4A6DA 1T36A 3SN6A 3NHFA 3O8BA 3QBJA 5EEGA 4F5ZA 3GLGE 4E2XA 3AR3A 1P2SA 4HZIA 2C0PA 1B74A 4NECA 1V3VA 3R3YA 3AXTA 2V3CC 2ZSIA 1G41A 1Y1SA 3I2JA 2LV8A 4NOMA 3EGIA 3C5EA 1YOBA 3MMPA 1I0LA 2VYNA 3ETNA 3M5CA 2BTEA 2B69A 1WHSA 3SHQA 4BKPA 2OZKA 1I4OA 4QECA 3ZBTA 1VE9A 1YZYA 2ZB4A 4FGJA 4NJEB 1C8LA 2QX6A 1YOVB 1D1TA 2VCYA 3PE4A 2V59A 1PFWA 3PT5A 1JA1A 1WOMA 4GKBA 1KMIY 3I04A 5KOYA 4GEKA 1Y33E 3HXTA 1H6AA 1OBCA 1OILA 2B7BA 2JCBA 2CFOA 1YQTA 2VR1A 4GI3A 4TMTA 1IN7A 3UFXA 2FQXA 3FLBA 4CQMB 2HV8A 1U7HA 1AS2A 2HM7A 1Q21A 3NYWA 5ERXA 5CHEA 5AKYA 2UKDA 1KDVA 1O87A 2VDNB 3SIXA 1X7DA 1ZVVA 2ZUWA 3B6JA 1V16B 2FLKA 4FEEA 5DGIA 1N25A 3VSCA 4UHJA 2RHCA 4BLOA 4JKYA 1RW4A 1KI2A 5H16A 4L7VA 2P7IA 5ABPA 2C5SA 2FR8C 2Z8YM 3QFSA 4PZEA 4HDNA 4UMEA 1SD5A 4HOYA 3VXKA 1G8KA 4DB2A 1UPXA 1WS6A 3ABRB 3IMKA 5CHYA 4UUOA 4MUEA 4YRZA 5EJ6A 2CDRA 5CYFA 3R8CA 4C78A 4HMOA 5JY1A 4BZPA 3NMUF 3S70A 3UHOA 1RXEA 2H0RA 4M21A 2OD9A 1J8QA 5ED0A 4D9FA 2RKWA 4G9BA 1E1LA 5AD1A 4W1SA 2ZRDA 1DUIA 3F3MA 3MWLA 3P0RA 4M89A 1LU9A 3V55A 3SEAA 1N6HA 1LBIA 4B2LA 3O9ZA 2V7VA 4JU8A 1GKUB 1Z7EA 4ETNA 5JARA 5JSZB 4O1MA 1LEHA 4G65A 4UXJA 4FHGA 1NSFA 2QTWB 3UH0A 3O7MA 2AJBA 3T06B 1K86A 3QWIA 3MM4A 4LJSA 2ZZMA 2V7EA 3DDCA 3J81k 3FPCA 4KQFA 2RG1A 4X6XA 7AT1A 4LI0A 1Q57A 5GVSA 1JU9A 5JMOA 4F3TA 4TZTA 1W4LA 2VP9A 3JS5A 4JB8A 4PYOA 1TQ4A 3P5BA 3SF0A 1VSQA 1USKA 3K70C 2D6FA 2RHBA 3U3JA 1UKBA 1VLJA 1GU0A 3NWBA 4BP9A 2RAVA 2CY0A 2V7TA 2QPLA 3OPMA 3TW8B 1NKVA 5HZKA 4KFCA 1KO4A 1OLXB 2O3RA 2FEPA 5DFAA 1O3YA 1X8XA 4JENA 4RHTA 6GPBA 4EHJA 1NQOA 5F76A 5DBFA 4IIEA 5FI5A 2G72A 5HRAA 2JGAA 3DV9A 2YIDA 1G1MA 4ETMA 1V7QA 1XNGA 1X9GA 4O5OA 3TZLA 3NDIA 3DLPX 4I6JA 4AJIA 2VBFA 2JA2A 2IEIA 1AE1A 1J00A 1DXHA 8OHMA 1NPDA 4MR7B 4X3PA 2WF6A 3H05A 3P2KA 5KOJA 1ECFA 3DBHB 4BRSA 4F8JA 5B64A 3EDQA 2C7QA 3SGLA 1ODIA 4TTQA 5BPFA 1XZDA 2VAMA 1MRNA 1SIWA 5IAOA 4KLCA 2IW1A 2ZRIA 3NYRA 4C7KA 1C30B 1E58A 1TJPB 1RI4A 3K15A 5AM4A 2IXEA 3VVLA 4HDSB 4FSDA 2F4NA 2QU8A 4LXIA 4ER7A 4J0JA 4TLLB 4AW9A 3MJHA 1ULBA 1UK8A 3PNMA 2D7DA 4D0RA 3OCJA 1JDSA 1FFXB 2DULA 3B1KA 1VSBA 2WZQA 5J2UB 4BGDA 5LLTA 4Z1MA 2H57A 1P29A 1TA0A 2JH9A 2WUFA 3OCUA 2PUBA 1R5OA 1RWKA 1R27A 3W5UA 1DC4A 2DHRA 1F8UA 1K6MA 4BQQA 1G3IA 2QGZA 4RNCA 1J0DA 2ZQ5A 3KVVA 5E9AA 5H3LA 3FWNA 3TIIA 2G8LA 2PL5A 4D98A 3M8KA 4XDHA 2Z4RA 5G4KA 2WQ7A 1WJGA 3LQ4A 4BCCA 4F3KA 1BDMA 1XWFA 2FG6C 2HK9A 3WLIA 1BFUA 3AHFA 4YRAA 1HRKA 3HKDA 1WUTA 4IO0A 4DSNA 3CB4A 5JS2A 3M3PA 4UBOA 3VPFA 4QPNA 2DB3A 3DM5A 1XJQA 3CBGA 4OAOA 5AJVB 5L7YA 3X1YA 2GZAA 2CV2A 1UPBA 1ZH6A 4YAJA 1JYSA 1G1AA 1U4SA 2ETXA 1TA9A 2YCLA 2ATXA 3I05A 4MJ3A 4N0PA 1N33B 4UM9D 2YYYA 2HI0A 1CHDA 3N2LA 2BFFB 4C0LA 3EVFA 5ILOA 1AG9A 1CERA 1MW9X 3LPMA 4L8LA 3E3MA 1NV8A 1VJ5A 2GRUA 2NXNA 3CTMA 2VA8A 4LGMA 1I2AA 2WSSD 1TKAA 3IMGA 3IYLW 1VLMA 2FPMA 5IANA 3W2FA 1VMAA 1D2HA 2PLFA 1RWQA 1YVPA 4YDHB 3F7TA 1TW3A 3OE7D 2IBTA 4KDFA 1N9GA 1UKVY 2QGNA 2IJGX 4BIMA 2DFKB 4RGYA 3MHTA 2CNWA 3HKBB 2YZ7A 1E9DA 3F67A 4MV3A 3O2QB 4XIFA 4LFBB 4QAJA 2H2AA 1UMBA 3EXEA 4L08A 4ZDKA 3RFTA 1NHWA 4O8CA 1I94B 4BMPB 2CEAA 2PZAA 1FMFA 2PUDA 1VJRA 2XDQA 3RAGA 3AEKA 3TGWA 3WJ1A 1W2GA 3KSDO 1JDBC 1U94A 2HH9A 2XMBA 3BERA 3O7WA 2AR0A 4G0MA 1FQWA 3QM1A 3SC2A 2FG7C 4TWJA 3RGWS 1A1SA 1EFUA 1QYDA 1TRKA 2QW1A 4HDMA 2H4FA 4Q6BA 3OZFA 4KQIA 4RK6A 5ULLA 3WNBA 4D3YA 4PS1A 1KORA 2FWBA 3DOJA 5K4HA 5EHIA 1JG6A 1QH1B 2H6EA 1CNEA 4M8KA 3L7OA 2CNKA 5AW6A 2EATA 1TEXA 3OZSA 4GG1A 3C0KA 3D8NA 2FEWB 3K0AB 4R3WA 3FRHA 2IIPA 1T2VA 2X8BA 4US0R 1CLUA 4I55A 3A3PA 1O95A 4TM7A 3SS8A 1F0YA 1THMA 2BFBA 2BI7A 1GTVA 1B1AA 1GYRA 1EYZA 1LBQA 2Y1EA 1EP1B 1GKLA 2X58A 1XQ9A 3BQMB 2AHRA 2LR0A 3FRJA 2VDPB 3AM1A 3QOYA 7ABPA 2NVWA 3V4LA 5I9IA 3PU6A 2UZAA 1PZEA 2WTNA 2X41A 2AG0A 1Z68A 3ZI7A 3GOQA 4JVLA 3L8DA 3H4IA 4KE8A 2YS7A 3CM0A 4JZKA 5TLSA 2I29A 4IOJA 3U7JA 1ZEJA 2GLXA 4UNIA 3A9VA 2ZBGA 3M6WA 4KHPB 3FFBA 1IY1A 2CB0A 3GFPA 3BOSA 3U37A 1FS6A 2GCOA 4IAOA 4MKHA 4B82A 1G8SA 1Z7GA 2COUA 4KQXA 4UAJA 1M2OA 4AG3A 4FDMA 3AP2A 4YAFA 4DCGA 5E3IA 2V5AA 3G68A 3FMOB 4KN9S 3ET4A 4QUDA 3ZWPA 3W3AH 3LLCA 4HG2A 1FU4A 5BOSB 2BJWA 2Z5FA 2R6GA 1ECLA 3PC2A 4N40A 1A7JA 3IQEA 5KREA 2DFPA 2YFHA 1JG7A 2Y1CA 3D02A 1H2HA 1EZ4A 1XZPA 2PRZA 4JJGA 4MRAA 5EUQB 2LRGA 5DWDA 1OLUB 1CP2A 3IP3A 1S4QA 3GUVA 3UANA 4D4JA 1Z5VA 2A9VA 5AJZA 5ES4B 5K0ZA 3HFGA 3E0XA 2PUFA 1P9OA 2RB4A 5FDFA 4Q9IA 2C8JA 3C3JA 3I4LA 1PLKA 3REQA 4MR8A 4NCAA 4Q1FA 4TWZA 3VFDA 3T3EA 4PRKA 1MB3A 5ICMA 2H3EA 4LV5B 5KYYB 3QKRA 4UDYX 2A0FA 1B6RA 2PKQP 3N0RA 4PICA 4JOQA 4DADA 5JATA 1JB1A 1KVRA 5ESWA 2OBMA 3WLHA 2FRDC 1KJJA 1KWGA 1EVKA 4OXKA 2QZPA 1YMVA 3UJ3X 2GCEA 3AINA 2QZ7A 4IW3B 4DTCA 5AVQA 2FDRA 1FVOA 1I3NA 3KBOA 4U7TB 4QWTA 4JBWA 4EBBA 5BUSA 1RBZA 3WYDA 4P34A 2QMUA 5HIKA 2QENA 2A0KA 1Q91A 5GZ6A 3RRXA 5FOXA 4L5YA 5I48A 4OBXA 4OQDA 4YLEA 3WG9A 1F8XA 2QMHA 3R5HA 4QXPA 4PSDA 2OHOA 2Y6UA 3JALA 3P9CA 1RQGA 2FNQA 2GJAA 1HDCA 4UM7A 1T2UA 3QELA 3V2UA 4BLSA 1IIBA 4JOSA 3ZI4A 5AFSA 4HHEA 2ZPUA 3H2ZA 2XOXA 1OXXK 1ESZA 2FGKA 3MYYA 3ONWA 4QO7A 5CH8A 4PHGA 3U3DA 1IN6A 4TS4A 1AJEA 1CF4A 3VJLA 3G6KA 1A5TA 5CXQA 4N48A 1IJKA 3W5IA 1AQ6A 3ONVA 2X8JA 1WOYA 3S1LA 4FFWA 5BO5A 3RRNA 3VHXA 5EYPA 4RVDA 3GCWA 2C31A 5DMXA 4D6PA 3IT3A 4DDUA 1KPHA 1L9KA 3GLIB 3COVA 3BSFA 4LRUA 2CVZA 4LTDA 1NBOA 5JYDA 2ZB3A 4BIIA 4OSOA 1MPTA 1AK2A 3ZNNA 3U09A 2X23A 4D8XA 2ZRNA 4DJEC 4JQSA 3PFGA 5CT6A 1FFBA 2GO7A 1T0JB 4YI3A 4HY3A 4DHEA 3UJNA 2C3UA 3GFOA 5DNDA 5BWCA 1CZOA 2Q9BA 2W0MA 1MABB 3C7CB 4WKBA 2GPNA 3T9BA 1TNDA 4AY3A 3AR5A 2Q1XA 5FNVA 1TM2A 1KAQA 1Z07A 3ND9A 1R0RE 2J9RA 1KK1A 2HPZA 3ROMA 4B44A 4G1UC 2LNDA 2J46A 2P8SA 3KOUA 1P45A 4QFMA 4BMCA 5F5XA 1J7JA 2PX3A 3JQPA 2A2ZA 2HU5A 1YI8A 3AX6A 3NKLA 3LUKA 1QS0B 1FVXA 2I4RA 4UE6A 3ZKAA 3RIGA 3RV4A 1XD9A 2DLNA 1QHNA 1QRUA 1OYVA 3TL6A 5C8YF 4IHJF 1SY7A 3E9YA 2UZ1B 2QJTA 1LY1A 2GZSA 4PQRA 4BJ5A 3A7EA 4HUTA 5KWVA 3GLIE 3DV2A 3OZXA 4KDRA 3NB0A 3DULA 2H63A 3K72B 4OFZA 4OL0A 3UWOA 1X15A 1Z35A 2GVDC 2Q3JA 3M6MD 3VI4B 4PG6A 5BV0A 1CDOA 1GUBA 2IEZA 2NM0A 5LMZA 3NBUA 2G08A 4JITA 4MR9B 1FXUA 1V4VA 2BL4A 2VNIA 3MBOA 1GA4A 4MW4A 5E6SA 5IT4A 3NTLA 3SAJA 1W94A 4UUPA 1PZGA 5JEDA 1AC5A 1DKUA 3NS7A 3QFHA 3ER8A 1GG2A 1T1JA 4K6KA 4UZEA 3WBBA 4BGVA 4JUFA 3SZLA 1V47A 2ZPAA 3CW2A 3EXG1 3L0PA 4KBYA 5JCOC 4Y0VA 1T4DA 1ZP6A 2B35A 4PCAA 3TLEA 1WRBA 3NEAA 1TMOA 3VYSB 3S55A 4D3DA 4A0GA 2WOJA 2GTIA 4LTMA 2P11A 3GV0A 4OHMA 1AMOA 3UG6A 1IXRC 3KR9A 4J7XA 1HOXA 4RYDA 1NXPA 2ABWA 3SZMA 3O9VA 3P5SA 4OQEA 3IUBA 3H1GA 1P72A 2WSIA 4XYGA 4NBSA 3HSYA 3LL4A 5AI4A 1T0PA 1YNOA 4ENTA 2ZBPA 4MUKA 3BK7A 2BMWA 3MG9A 2QUKA 4Y6SA 4G0QA 2Q0QA 4XVRA 4WXYB 2CDCA 2ODQA 1Q3TA 3HKCB 1GGMA 4L0DA 4P2GA 4BP8A 4KWIA 3AFMA 3JD1A 1S7CA 5DGCA 4EHHA 4J0FA 4HH1A 4LY6A 4FC7A 4ZFNA 4MVJE 4XWKA 1IUNA 3CZ4A 4FI3F 1G20A 3JZAA 4IILA 2GCIA 3A05A 4X7BA 4ARUA 3QE0A 4X7MA 2E5LB 4HDKB 1II0A 1PR9A 1FYDA 1QC5B 4GLOA 4AICA 5KQLA 1UADA 3RRYA 3VPXA 2XHZA 2ZJ8A 1PS9A 4DE5A 4ZJPA 5HKBA 2GZ2A 2ZSFA 3HY4A 2XGJA 3UJ6A 3WDSA 1APBA 3B6EA 3F6BX 4YJHA 1Q12A 3TUJC 1QG2A 1RDFA 2YDYA 3SM3A 4IDCA 5AXDA 2DYKA 3N1UA 4FT4A 1ADBA 1WLYA 1YWGO 4QFCA 3FSGD 4EW6A 4B3SB 2PAAA 1XP8A