2OXFA

X-ray structure of the unliganded uridine phosphorylase from salmonella typhimurium in homodimeric form at 1.76a resolution
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
250
structure length
250
Chain Sequence
b'SDVFHLGLTKNDLQGAQLAIVPGDPERVEKIAALMDKPVKLASHREFTSWRAELDGKAVIVCSTGIGGPSTSIAVEELAQLGIRTFLRIGTTGAIQPHINVGDVLVTTASVRLDGASLHFAPMEFPAVADFACTTALVEAAKSIGATTHVGVTASSDTFYPGQERYDTYSGRVVRRFKGSMEEWQAMGVMNYEMESATLLTMCASQGLRAGMVAGVIVNRTQQEIPNAETMKQTESHAVKIVVEAARRLL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Uridine phosphorylase
molecule tags Transferase
source organism Salmonella typhimurium
publication title X-ray structure of the unliganded uridine phosphorylase from Salmonella typhimurium in homodimeric form at 1.76A resolution
rcsb
total genus 82
structure length 250
sequence length 250
chains with identical sequence F
ec nomenclature ec 2.4.2.3: Uridine phosphorylase.
pdb deposition date 2007-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2oxfA00
4G41A 2GUWA 4M7WA 2RJ3A 3KVYA 4YO8A 1Z35A 2HWUA 3DJFA 1JPVA 2I8AA 5B7QA 4NY1A 1VHWA 3K8QA 1Y6RA 1JE0A 3E9ZA 1JYSA 2ON6A 5CCEA 1ZL2A 1A9RA 3OZDA 2A0YA 3NM6B 4WKCA 4M1EA 5B7GA 1Z5NA 1T8SA 1PR4A 4DA8A 1SQ6A 5FAKA 1U1FA 2A0WA 5EFOA 1RYZA 1TCVA 5F77A 1OUMA 4LKRA 5IFKA 4BN0A 4TTJA 3EMVA 3OF3A 4QAQA 4DABA 5F7ZA 4TXMA 3BL6A 5C80A 1QE5A 3D1VA 2QSUA 4BMYA 2OC9A 2AI1A 3FUCA 1TGVA 1U1GA 1PW7A 1ODKA 3P0EA 4YNBA 4TS9A 4TYMA 1Q1GA 4BMXA 2QTGA 3OZEA 2HSWA 4DANA 4R2WA 2AI2A 2XRFA 3PNPA 1RT9A 1Y1SA 4OEHA 4DA7A 4OGKA 1NW4A 4F3KA 4WKOA 1NC3A 3MB8A 3FB1A 2OECA 4GLFA 4MARA 1A9TA 1Y1TA 2H8GA 3GGSA 1PBNA 4JWTA 3O4VA 1RFGE 1PK9A 3OZBA 4KN5A 1RR6A 3OOEA 1JDVA 3FNQA 2ISCA 1PR5A 5I3CA 3OOHA 4TTIA 1YR3A 4L6IA 1Y6QA 1PR6A 1VHJA 4TXHA 1RXSA 4K6OA 4GMHA 1M73E 2QDKA 5KB3A 3FOWA 2OXFA 1B8OA 4NSNA 3P0FA 1OVGA 1Y1RA 4D98A 3PHBE 1V4NA 4UC0A 3FAZA 4M3NA 4FFSA 1FXUA 1A9QA 1Z39A 4L0MA 5F7XA 3UAYA 2HRDA 1PKEA 3KU4A 4L5AA 5CYGA 4MCIA 1PR0A 1U1DA 3EEIA 4P54A 5EUBA 2P4SA 3UAZA 1ZOSA 5B7PA 5CXQA 4H1TA 4YJKA 5JPCA 4F2PA 3OPVA 1K27A 4JOSA 4D8VA 3E9RA 1TD1A 1OTYA 1A9OA 1T8RA 1T0UA 1U1CA 4R2XA 4TS3A 4G8JA 2BSXA 1SJ9A 1Z38A 1ECPA 4G89A 4U2KA 1ODLA 1VMKA 4E1VA 5IU6A 2QTTA 2I4TA 5F7JA 2OC4A 4WKBA 4QFBA 3E0QA 3F8WA 1G2OA 4JP5A 3UAXA 3ONVA 1WTAA 3UAWA 1PK7A 4EARA 1K3FA 1JE1A 1RSZA 1Z34A 1OTXA 4PR3A 1YBFA 3EUFA 4QASA 1LVUA 3NBQA 3MMSA 3NM4A 1I80A 1Y1QA 3T94A 3UT6A 1ULAA 1N3IA 1VFNA 4GKAA 1A9SA 3U40A 1Z36A 2A8YA 1TCUA 3KVVA 4IP0A 3ENZA 5CCDA 1ODJA 5CXSA 3C74A 1V48A 3DDOA 4D9HA 2HN9A 4I2VA 1Z5OA 4EB8A 5B7NA 1T8YA 4RJ2A 3PNSA 3LBAA 3KVRA 4QARA 3IEXA 3DPSA 3DF9A 3BGSA 1CB0A 1LV8A 1ULBA 1U1EA 1Z33A 1JDSA 3BSFA 4OY3A 3LGSA 1YQUA 2IQ5A 4QATA 3UAVA 1PR2A 2QPLA 4WKPA 1CG6A 1B8NA 3ODGA 1K9SA 4D8YA 4R31A 2AI3A 1PF7E 4OJTA 1LX7A 4D8XA 1YRYE 1V45E 4F2WA 3IOMA 4L5YA 1JDUA 4NS1A 1PR1A 1Z37A 5F78A 1RCTE 1SD2A 4DAEA 1XE3A 1V41E 4DA0A 1RXCA 3TL6A 3OCCA 3GB9A 5EPUA 1A9PA 5F76A 3KUKA 4WKNA 1ODIA 4X24A 4LZWA 5DK6A 3FWPA 4F1WA 4BMZA 4TXNA 4QEZA 1A69A 5F73A 1V3QE 4ECEA 1V2HE 5K1ZA 4DA6A 1RXUA 3LA8A 3PHCA 3KHSA 1SD1A 1JDZA 4MCHA 5CYFA 2AC7A 1NC1A 4TXLA 1JDTA 3K8OE 1PWYE 1TGYA 1JP7A 4DAOA 5F7OA 1Z5PA 1OU4A 4DARA 3SCZA 2Q7OE 4TXJA 4YMLA 3NM5A 3INYA 1T8WA 4LDNA 3DP9A 4OGLA 3OZCA 1YQQA 3EUEA 4GLJA 1OV6A 4LNHA 1RXYA 4PNPA 5ETJA 1C3XA 4L5CA 4OF4A 2A0XA 4LNAA 3QPBA 4F3CA 3O6VA 4TTAA 2PGAA 2B94A 3BJEA
chains in the Genus database with same CATH superfamily
2IXDA 5J5VA 3HBJA 3AP2A 3GUUA 1QLJA 4G41A 2FHSA 3UTDA 1GUBA 2RGCA 2P69A 1MEJA 2QBYB 3PX3A 3CVJA 1RLMA 3NIWA 4FIDA 3ZQUA 4BQFA 5DCYA 2X3YA 3TB6A 4ZMRA 4ZCMA 2QJRA 1P6QA 3WFIA 1IY1A 3ZNQA 1C9EA 1Q0RA 4YMSA 3B5IA 1RQGA 4AF8A 4ZAZA 1SPBS 1J0EA 4F71A 2GCEA 1Y98A 3LS2A 2Z4SA 4X7PA 4XB1A 3D2BA 4ARZA 4ZXFA 4FDUA 3HXKA 5F21A 2GN8A 4OUDB 3T3HA 1VHWA 4MS1B 1DLJA 4E1BA 3DV0A 4LYHA 1MHPA 1PGOA 3FNEA 4UASA 4Y2JA 5DM4A 3UEOA 5GGXA 3FY4A 3HB9A 3NASA 1TT5A 3A6JA 1KFKB 2N46A 2OQIA 3LAWA 2ZBQA 4DMKA 4QNNA 3HZOA 2XQFA 1XVAA 2DF8A 4U0JA 1ZL2A 1Q1QA 2NQ8A 1ESMA 3C3KA 1MO6A 1DAFA 5J23A 4KQHA 4DEYA 2WABA 2C2MA 4AJJA 1F3OA 4ZZIA 2N47A 5FWYA 4AI6A 4AJEA 2OD9A 3OSUA 5BURA 4YPOA 3HKEA 2RG7A 4DA8A 5JQGA 3VYWA 2Z43A 4BNDA 2A0WA 4BO2A 1E2BA 3AEQB 2EWMA 2QRHA 3G6WA 3UHOA 3VPGA 3K5PA 4C29A 3JRNA 3TQOA 1JHPA 1SC1A 2P67A 3LLVA 4UXJA 2IZ1A 1Z2EA 1DRVA 2R5FA 5J5CA 3CX3A 4GKKB 1HL3A 3MUEA 4HBZA 4NENB 2JI6A 4REMA 1NGSA 3ZE9A 5CU7A 4JEHA 5CFOA 3TXYA 3UJNA 3RIHA 4G86A 2FMTA 1VL1A 1B0ZA 3CVXA 1V7PC 2XTAA 2ZIGA 3QI7A 1EP2B 5E0OA 3R76A 4EKDA 1VG0B 2OL4A 4AC9A 1Y8ZA 2H5EA 3G0BA 3HU1A 4YDQA 1DIBA 5FPTA 4IS3A 1J56A 3EZ6A 4QU9A 1QGUA 4RIHA 4DN6A 1QDUA 4HQKA 2AEMA 2HIAA 3AXSA 3HVKA 3I1IA 3IO3A 2RDMA 3KQPA 4ML3A 4UMFA 2OC9A 2AI1A 3F5SA 3U4HA 2F90A 2I87A 3KJEA 1R5BA 3IB3A 1QGUB 2YNMC 5KWSA 1E1LA 1EXNA 4JBLA 9LDBA 1X8LA 3AEQA 3GUCA 1OAOC 4G81A 1J23A 3W5CA 2BFBB 2PUTA 3AHCA 1ML3A 3GLVA 4IRUB 2PH1A 1M8KA 2Y3IA 3WLTA 3DCNA 4QNRA 3O92A 3THWB 1TYBE 2VEOA 4FSXA 5L51A 3LTNC 3F4KA 2ORYA 3DP7A 3PDJA 4GRIA 4OJYA 2FEOA 4KXLA 3DV9A 1J09A 4R2WA 3VKWA 4BNDB 4NCHA 2HLHA 2HD4A 2XNKA 1OF1A 5JU6A 1WABA 5ERXA 4INJA 1D2NA 3CWZA 2PAAA 3IBFA 4GM0A 5HUJA 4AIRA 2ZIXA 5FO1A 5HFAA 2BRUC 4DVJA 3TJMA 2ECFA 2VWQA 3RBVA 3KR1A 1LI7A 5HBRA 4F3KA 1KORA 3OG9A 2OZLA 4DV5B 2FFHA 3C4QA 2AZ4A 1S1MA 3T3OA 4B3FX 2LTAA 1QCYA 3LD9A 1H05A 1V8DA 4UMVA 2Q4BA 3CF0A 5KNLA 4NXNB 1RJDA 2QPOA 5SZJA 4XX1A 3MTGA 3VYSB 5A5DA 3MILA 1W0KD 4FGSA 2MMGA 1WW3A 1NBIA 4TMYA 1S2LA 3KL2A 4RV5A 3BGDA 4OHPA 4HSEA 5G2OA 4KN5A 1D09A 3WE7A 1T0IA 5A4DA 1IHUA 1VE3A 2JFUA 3B1ZA 4OQFA 3ZDFA 1YS6A 4NZZA 3TH5A 4BVJA 3CSDA 4RD4A 4PQYA 4YMTA 1H42A 1QORA 5JDCA 2YWDA 5SYNA 1K2WA 3PHGA 3GEMA 1R9JA 4ZOLF 4C4PA 2WKSA 4S1OA 4X1OA 2CHQA 3DMPA 3F4LA 2K7FA 4A10A 4C89A 5ITZB 3F6CA 2WSSD 3L0BA 1BS2A 3LWDA 3PDUA 1V5EA 3CEAA 2OV3A 2RHOA 4KXQA 2PMKA 4P1ZA 1RZRA 2B2NA 2IE8A 4Z4IA 1SCUA 1OH8A 2OESA 1V3VA 4LQLA 1KMMA 5FTKA 4F7WA 1HYGA 1HL7A 5EIAA 1KJ8A 4M1OA 2AKYA 3BGWA 5JFTA 4Q4LA 1E20A 2E1PA 1SNYA 1L7OA 3REQB 1XVTA 2WUWE 1TLFA 1EUZA 4UBKA 2OYCA 3KKKA 2ADMA 4EYEA 4C6HA 2NSJA 1B14A 3VVLA 1MR3F 2REBA 1DWQA 1SBNE 3HJRA 3IIMA 3INNA 3WKCA 4PC7A 1OC2A 3OPYA 1C7IA 3D5QA 4C2BA 5IJ9B 5C32A 4ZQIA 4LY9A 1R8YA 1D04A 2OBLA 3UGKA 1EZZA 2YQ5A 1KI1A 2ZBPA 2PUHA 4OKSA 3ZVRA 4M7PA 1D07A 3CBQA 3DBIA 4DJJA 1KI6A 1U8ZA 2Q4RA 2XW6A 2JGRA 1R88A 2Q3LA 4MA5A 2YR0A 1B6SA 4DQDA 1ZNZA 2FSUA 3GJ6A 5FBRB 1M2HA 1JXOA 2O2IA 3HLTA 5JATA 2F3TA 4LZPA 4FWTA 1NRWA 5HM6A 2HQBA 1T5BA 2J3JA 4QTUB 1PWHA 1XMVA 5T41A 4BE7B 4O3MA 5JPCA 4CIXA 1K27A 4KR2A 1UPUA 1FY2A 3NEYA 3A2KA 2J7PA 1N77A 3ADPA 1RAFA 1AKUA 1CFZA 2IUEA 1IN6A 1UXIA 1JQLB 3KZOA 1VIAA 3PDIA 3PC3A 2FWAA 2X1LA 3P2EA 3RSQA 3SX4A 5AVZA 2JFOA 2I22A 1T1RA 4KAXA 4PQEA 1T5IA 3HBFA 4RGQA 1DXQA 3AOEA 1JAHA 1E2QA 2BMEA 1X86B 2X8WA 3TM5A 1TQ4A 4ON9A 1E8DA 2O57A 2I33A 2FOIA 3HXLA 1U63A 1F2DA 2RBEA 3MS4A 4M1QA 4PZLA 2WWVD 3RBZA 3UANA 4G0WA 3AOEC 1JLHA 1LDYA 4NHOA 2PGIA 1JECA 1WHSA 2R86A 1SG0A 3U4CA 2AD5A 4U7WA 5T4HA 3GLGB 1H2WA 2AN3A 4KFRA 1FXWF 1DEHA 3D43A 3O5AA 1RWWA 2D2IA 1U28A 4M54A 4U2KA 1FMTA 1HYHA 2GPNA 5KS2A 4LFAB 1U11A 3I83A 4Q02A 2B92A 2FSVC 2UDPA 5TXGA 4AYTA 3ONWA 4PHFA 4DTIA 3NWEA 2HJ9A 4BVBA 2JLZA 3CVWA 2JS7A 2R00C 2VT2A 1OI7A 2J3QA 2D6FA 1QUFA 2FFJA 4BECA 2Z56A 3SJZA 5E4FA 4JSYA 3EJWA 3H9EO 1G8MA 5K3BA 4WIAA 2O8CB 3LL7A 1OWOA 3HY4A 4C7BA 2JFQA 3DBLA 1WSAA 2E82A 2GZ3A 1U8AA 3W04A 3SF8B 3DZDA 4XFKA 2PGDA 2Z5LA 2BKLA 5GONB 4BCCA 2QUBA 3NXKA 1EK6A 3G0CA 3MUOA 2Y2VA 1NI4A 1RLJA 3M3DA 3DMTA 3VHQA 3MOSA 2FEXA 3QNMA 3AM1A 3F4BA 2HOQA 4Z99A 4DREA 4FFDA 5KQPA 4GECA 2W58A 4FFLA 3UT6A 2G9NA 4MQ5A 1CBUA 4M0KA 7MHTA 3ES9A 4JUDX 2AFHA 2OP0A 2OMKA 3I8SA 1RSZA 3MC1A 3MHPA 4YVFA 5K3CA 2LBPA 3S0JA 3EC2A 3E8XA 1XLUA 2L82A 4HDOB 2CFCA 2II6A 4HWOA 4NYMQ 1OJ7A 3OE7A 1JH8A 2FWNA 4N5HX 4DUGA 4WY2A 1UC9A 1FVOA 1YR9A 5HQ3A 1H2HA 5E6SA 4CI9A 1JEAA 3KQQA 2O7RA 2ONKA 4FBGA 2ZB8A 2ZTLA 1Q7CA 3VUEA 1QMPA 4UHBA 3FMOB 4RM3A 3U4QA 2JLAA 1OWPA 2CY0A 4H4EA 5A05A 3THYB 2FF5A 3A4IA 4PAGA 5G1NA 4I36A 5K0JA 3GGDA 3U1VA 1C2YA 2HLDA 1QFJA 1K89A 3EZ7A 4B2YA 3TO5A 1VMEA 4FNOA 2RGEA 3KUXA 3KZCA 4I4TA 4XQCA 2QW1A 4QLAA 3WB2A 3SC2A 4XYMA 5GOTA 4W5RA 4I55A 4WBXC 4XAQA 4YV2A 1E4VA 3E9QA 3BHNA 4EGCB 2YOHA 5J43A 3ECSA 4R1LA 4DIFA 2OT3B 5K8IA 2HHAA 1FQKA 4FIZA 3OIVA 3ZHRA 1RJ9A 1SUSA 1T9GS 3B7GA 1K5PA 4CM8B 2GN0A 3EMKA 1AV7A 3KSZO 4I8IA 3EISA 2ERYA 4X6UA 2IYFA 2GEJA 2ZSKA 4KWTA 4Q00A 4EA6A 3WNZA 2GHQA 2LDBA 1RPZA 2B83A 4FTWA 4LHXA 3N59A 2Q45A 3H4TA 1YCGA 2WIDA 3AVXA 4FFOA 1R66A 1XEAA 1FJXA 4HSGA 2PKCA 4A4DA 1A9XA 3BT7A 1IB0A 2FSPA 2PCJA 5EYPB 2VLBA 3K0BA 1HEYA 1ZEJA 2QSYA 4AJ4A 1O94D 2VT7A 4EG3A 4TT8A 5JT1A 1RM3A 2HA6A 3CX4A 3FROA 5EGNA 3TBFA 2V1XA 1CNEA 1UOPA 4Q1DA 3TB4A 1J0BA 4BKRA 1KO1A 4YCCA 3Q7EA 4M6WA 2QRKA 1ONOA 2PRKA 1IZ9A 1PT7A 2GCPA 4U3JA 1TKBA 3GC6A 1RACA 3VNBA 1UDCA 5EXXA 3U31A 4LRTB 1JLRA 2Y6VA 4QG7A 3HUUA 1VKJA 5MFPA 2Q3FA 2AFIA 4Y3UA 1XDSA 3WFJA 4E08A 2XUFA 1LRLA 1QYDA 4D0RA 1XQWA 1P4AA 2EFHB 5BY2A 1IZ7A 621PA 1FSSA 2WMYA 2JLUA 2OGUA 1GV0A 3K1JA 5I7WA 2PVCA 4MITA 5KVQA 3NHYA 4EG5A 5BW4A 4HB3A 2Y0PA 3WWEA 1D1PA 3GRCA 4ZU1X 2QMEA 1ZO8A 3PIRA 3MG9A 2BKEA 3ASYA 1IUPA 1EUCB 3NP9A 1CUZA 3HBAA 4FPXA 4MRRA 2XXBA 1DRKA 1JAYA 4BBZA 3STUA 4O4JF 4LUCA 3KOWA 5FP0A 4TROA 3UZUA 3EOZA 1RS0A 4DMUB 1YHYA 1SB9A 5FAXA 5BNZA 3TR5A 2CUTA 4PCVA 2CF5A 3EEFA 3EBOA 4R8MA 4M0DA 1VCMA 1YL6A 3WL4A 3UJAA 2PX3A 1EEXB 3KB8A 1ADCA 3UIEA 2GBLA 3RFUA 1GNVA 5EPUA 2ENUA 5C5DA 4MVXA 1Q15A 1KP2A 4PYMA 5EE3A 1MDFA 3WGKA 4IDNA 4ND3A 3BMXA 4FEEA 2JBWA 2NV6A 1CXZA 3N5KA 4BMSA 4QM6A 3MWJA 3M4JA 1R27A 3DOEA 4RKYA 4TXNA 3TINA 2VNKA 2XX3A 3I64A 4DLVA 4BP3A 1UFRA 3I09A 3NC1C 1IMJA 2AXPA 5AW1A 1ZICA 4LA4A 4NULA 5F73A 3TPZA 1P8AA 5ESRA 5D5PA 2R8OA 4DLBA 3FAKA 5FI5A 4BQIA 4EO7A 4TRJA 3FTFA 1V2HE 5K1ZA 2TRSB 4EKNB 2WT8A 2JK0A 5J4VA 1NUAA 1Q77A 4G5GA 2D5LA 4UU1A 2HYIC 1TPZA 1GRQA 4KN9S 3ORQA 3PQDA 4V0KA 2JF0A 3LP6A 3SHVA 3D64A 1Y3FE 1C3EA 2AMJA 4M8SA 5LP6F 2ZZMA 5FLYA 2ZUBA 2H00A 3A0UA 2HREA 1CUBA 3PXUA 1HQDA 4WLEA 1Z8DA 4G0QA 1LTKA 1TA0A 3VTFA 3FBGA 3K8OE 3DEHA 4URZR 2OVFA 3T61A 4CNQA 1MX5A 4K9LA 1XJ5A 3B7PA 3GGPA 5DK4A 1THZA 3KC2A 3O2SB 4U8HA 3VBCA 4PSCA 1JG4A 2VJQA 5KSWB 3ONEA 1X39A 3W77A 4X85A 4LXGA 1QHEA 1QIMA 2C7BA 3M70A 3ZUGA 1UBRS 5F2NA 2JFPA 1QFYA 1Z4MA 5C7IO 5ENDA 3NM5A 4MTLA 1JIXA 1B6RA 2GN9A 4V3CA 1I9GA 2QMQA 1WF3A 3TSZA 3AINA 3EXEB 4G4IA 4B48A 3BSSA 3BWEA 1JEDA 3ILYA 4LWQA 3GA0A 3O03A 2G07A 1UFQA 4CR7A 3BB4A 3OZCA 2DLCX 1NR1A 3KQUA 2XRYA 2AA3A 3EGDB 2P2ZA 2WR8A 4C5CA 2ZSUA 3AHEA 2G1PA 3AETA 3V8VA 1F6DA 1MZPA 4LI0A 3C6BA 4BDTA 3TNLA 6NULA 1C3XA 1JW9B 3OFNA 4V3BA 2VP0A 4KEAA 3H9UA 4OXXA 3IDOA 2BWJA 4ZV9A 3EIFA 4OFZA 1T8PA 3ONNA 8OHMA 3V2HA 1PBTA 2BZ1A 3L41A 3PEUA 2F1JA 1GPH1 3ECAA 4DTCA 1GGNA 2HGZA 1XMOB 1IG0A 3HWRA 3AIOA 2B34A 1ND6A 3L40A 1WEKA 3OLWA 1Q1AA 2J5QA 3EVAA 1I0ZA 3T7TA 2JH9A 2ZT8A 4UVDA 3F0TA 1K6EA 2VT6A 3LBNA 1OBFO 2QTCA 3LT4A 1U90A 5L3RA 3F6RA 3RU2A 1UJMA 3PTZA 3ROQA 4DCNA 2X0RA 3O8NA 4JJFA 1QOPB 3B60A 4HMQA 4PAOA 2A30A 5FADA 1OIWA 1E60A 4WLNA 3NS7A 2RI0A 1KHTA 3G8CA 1Y6RA 4AZVA 1ZZGA 5B37A 3VRHA 1XXHE 2JCYA 3RUCA 4C4ZA 2VXOA 5K0CA 2WIFA 4JDUA 5BMVA 2B8JA 2J0QA 4LOKA 4EPYA 4II2A 3QEKA 5JAPA 4JI0B 5ITZA 2FR1A 1VJ1A 5TQ0B 1ICEA 3O9VA 5TGDA 1TVKB 3AR3A 2Z6VA 4C7OB 1JG2A 1M0WA 1NVUQ 4Q05A 4UJ5A 4YCDA 4ACAA 2UUOA 3K2IA 4TLBA 5HQ3B 2O2HA 4QEDA 4XM0A 3ROTA 1F8GA 1F8FA 1MB4A 3W8DA 3KPWA 5L45A 4TS1A 1LVHA 3LQ1A 4I99A 3WI7A 1I14A 1C2TA 3QXXA 1LDEA 1M6VB 4P0PB 1TMOA 3ESYA 3GRFA 3K0HA 3D3QA 3UW1A 5TJ9A 2G0TA 4NU8X 4I1OA 4CMIA 1OBOA 5HPYB 1FYVA 2Q1UA 4GPBA 5EINA 4EIWA 2QAGB 4D26A 1EX6A 2RHBA 4C0JA 2Y1GA 4I1SA 1F7UA 3TX2A 1DC8A 4QQKA 1JB9A 1CS4C 3L01A 4ZVTA 4OOFA 4DMMA 1P0FA 3D7LA 4RANA 5HNKA 1CRLA 2A3RA 4IS2A 1EVJA 5BN5A 4HXGA 4G56A 1F5SA 3SVTA 1A27A 1JEYB 1ZSNA 1HQCA 4WOCA 3OQVA 2VAMA 3P9YA 3QVGB 4FN5A 4RD6A 3SDBA 1R0SA 4W5OA 1KI4A 1MO2A 1AG9A 2R6HA 2XVMA 1R4AA 2HHLA 3OD1A 2IOHA 3ZC3A 1ZQ1A 2F3QA 1C9NA 1UK8A 1YR1A 4ZT2A 2ADFA 3KOZA 5K0GA 1QPZA 4TYMA 4NZPA 1JR4A 1FW8A 5AKKA 1QF7A 1UWLA 3QMWA 3JQDA 5IN4A 1NBHA 3ESRA 1VSUA 2OMEA 1R0YA 1Z7BA 2JDIA 4H7JA 2YMMA 5EC8A 3VU0A 4FR5A 5IG2A 4I7EA 3L4BC 5CA1A 4ZAFA 1GXSB 4PU0A 1J5PA 3VYUB 4CLRB 4DANA 3EXG1 3AP1A 1SC6A 3AR6A 3ABZA 4L8YA 2QN6A 1UBUS 2QX8A 5KHAA 5F33A 2XBUA 4BAUA 4Q6WA 4RTRA 3H2ZA 3E5HA 4JC8A 4BNUA 3HBLA 2UYGA 4YALA 3QMPA 5SV2A 1QCCA 3P9PA 3BAFA 3UXEA 1XWFA 4KGXA 1YB7A 2P78A 4INPA 2YFQA 1T6YA 4OHYA 1ONNA 3KK0A 3PEFA 3IKLA 3N9IA 5KNBD 2VYFA 2H31A 4MARA 1A9TA 5CRIA 4YRRA 1CB7A 4OD0A 1UDRA 1QHSA 2WVGA 4RVGA 2E1RA 7AT1A 2CLKB 3SJCA 4GPEA 2YYAA 4CQJA 1FNDA 4ZOCA 5U4QA 1N6KA 1QGOA 2QU7A 3LUHA 4JWTA 1VL6A 1NUHA 1QE0A 2IRWA 1U0GA 4IDOA 4BQSA 5A4MS 1HDYA 1RFGE 2QR3A 3LK6A 4IFEA 2PMEA 4QPZA 4R2KA 2D8AA 5KNCH 3UOGA 3RWBA 1JBQA 1PI3A 4J76A 4IWXA 1P0PA 4JJZA 4ZARA 3LY8A 3NVKI 1HKHA 2XH8A 1NASA 2F1OA 2Z1DA 8GPBA 2Q9CA 3CLUD 4LOHA 3RAPR 3JWGA 3GUYA 1NJGA 1JSXA 1XQXA 2G63A 1RP7A 2I1QA 2YXEA 4PFQA 2Y27A 4LZAA 4CJXA 2H52A 4BNWA 2WG0A 3AH8A 3L4SO 4TTTS 3ZY6A 4GMHA 2H9YA 1L4YA 1WPQA 4NMWA 4Z1OA 1FFXA 2G5GX 1Q50A 2GETA 3GEBA 1W1WA 5AXCA 4MW6A 5AI0A 4C01A 5C53B 1KVQA 1YKSA 2IXEA 3ASZA 3EMBA 3I92A 5DKFA 5JWRA 4DF3A 3A11A 4D41A 3D0QA 1SUPA 2XBLA 3LQYA 2QL5A 4KGDA 4X63A 1E2PA 5A3VA 1Q20A 4B7ZA 4EY8A 1N8TA 3B1JA 4JQSA 5CJ2A 4B6GA 4RETA 4FLEA 1KKLA 1O7JA 2VDRB 1RAIA 2V7UA 2BH9A 3U4MA 1X7GA 2LP4Y 2C0PA 5FI0B 2V96A 1F5NA 4YTEA 4U2FA 4IGIA 5ALKA 5DW3A 3FWNA 2I4MA 1YIOA 3W05A 2I54A 2VYCA 4UE6A 5JADA 2HA5A 1NE2A 2FZCA 3KU4A 3H8WA 3LG2A 1FSPA 2WC1A 3FETA 3KE8A 4Y6RA 3I05A 4JB8A 2QMYA 1YR8A 3WL5A 2WSIA 3MWGA 3EEQA 4DBVO 3VR5D 1XDZA 1TIPA 1XZ8A 4KMSA 1SU8A 3ZY4A 5KCZA 2R6DA 1JLMA 4EVSA 1S4QA 1BROA 1QFXA 1USKA 2E4ZA 2QX7A 2AXNA 2Y76A 4YJKA 3N0VA 3RF7A 4EI9A 3T7CA 4HZUB 1LPSA 3E4DA 4NMMA 4O4IB 1AB6A 1AD2A 4PC2A 4W9RA 4JL5A 4B3TB 1B2RA 1QDEA 2WWGA 5KNBH 2G9QA 4YXWD 2BSQA 3N74A 1N0VC 1DC4A 2W8BB 4IVPA 1Z5UA 2XTZA 1SU7A 3D8SA 2DFDA 4FFBB 2CNLA 3RVQA 4BKUA 2AR7A 4EDFA 4R8RA 1I1OA 1PJ4A 2CLLB 2OHXA 4P2BA 3WIOA 3ZU6A 3D2CA 3FSRA 4KTVE 2XIJA 1U0FA 3IP7A 4CM7A 8AT1A 1O87A 3ZJ5A 2K4MA 4ZWNA 5HGJA 3ZWCA 5AW4A 2NSDA 1UBHS 3KUDA 3WLKX 1JBEA 4DGSA 4HLUA 3CW9A 2GBIA 1GQOA 1CY7A 1SUEA 4OHWA 3QKTA 1KOFA 3VX3A 3W9UA 1VRWA 2I67A 1MA3A 2DKFA 3R6TA 4MAAA 1ZD8A 4GM4A 4NCXA 3HUTA 3V4ZA 4RHFA 5CVCA 2I2BA 5EP1A 3TDKA 4W6QA 3CF4G 3VR2A 5JCOC 3U49A 4CVNA 4D3SA 3DE7X 3KEMA 1IUKA 2J0SA 3I3OA 2XMPA 4IIEA 3FCEA 3M4ZA 1H5NA 1JQKA 1FJGB 4ZCIA 4WKGA 5T67A 1OAKA 1HT1E 5HFNA 5BSRA 5L7WA 2HDNB 1BCRA 3GLGA 1WQ4A 4JT8A 3W6PA 5TSDA 4D42A 2SKDA 3QYPA 1YL7A 3NCHA 1BE8A 1JTEA 3AFNA 3VZPA 3I04M 3SJAA 2XUAA 3VH4A 2IS2A 4YR7A 1V2GA 1X0XA 1JKXA 3KNZA 5JS7A 1OXTA 1ZN8A 3UBMA 5KTNA 3H99A 3FYSA 2RHRA 4NDNE 2Q6LA 3NG1A 2OHVA 3GMTA 1GZSA 2EFCB 1YC5A 3SVLA 2VLIA 1ETHA 2WJ4A 1OZ0A 3I1FA 4PRYA 2ZVJA 3V2UA 4CF7A 1TYDE 1XAIA 3ANXA 2X19A 2YWJA 3DEKA 4N7MA 2Z95A 1H8EA 3I30X 1EBBA 1GHTA 1LVUA 3O1IC 4L3WA 4MWOA 1QRUA 4RHCA 2PTGA 4F9FA 3IFSA 3COZA 3N28A 3UKOA 4BRZA 2PWAA 3K0SA 3HVRA 4YRTA 1Z6GA 2XYVA 3PPVA 2YICA 4KK3A 1EFRA 1U2QA 1CRWG 4OIFA 1OH7A 2QP4A 4OQNA 3DE3X 1DBPA 3LPMA 5D87A 1CQJB 4ZQEA 2IPXA 1ATZA 3KPVA 2QENA 2FWRA 1TQ8A 3ZHVA 1P7VA 1JT9A 2P9HA 3F3MA 4PONA 4DCCA 1HLDA 2ZI5A 4R7TA 1JKFA 5CA0B 1SVMA 4E70A 1I7PA 1ZRHA 3L2OB 4ZIRA 2JLQA 4EGJA 1TEZA 4O25A 2FR8C 3JQCA 3KEOA 4HDKB 3AGQA 3JQ8A 2JGAA 4MW2A 4F06A 1M2OA 4X6YA 2YJ5A 2VYND 3HFRA 2DPYA 2GYUA 4GSKA 3PT9A 3K0EA 2BGKA 1GAQA 2JIZA 4QXPA 1JHRA 3R3JA 4Q3DA 1ZOLA 2XGOA 4GPZA 2Q6OA 2DPGA 1C4XA 2FQ1A 1LX6A 3DDOA 2HK9A 3CF4A 4JJKA 1L5HA 3X1JA 5AM3A 1XNQB 4O02B 1WSWA 3KLNA 1ZK3A 2RKBA 3C41J 4O63O 5BR8B 4BX2A 3STYA 3HY3A 4N6GA 4NESA 5ESWA 5KJCA 3P26A 1NLMA 3DDWA 2PQ2A 5K8JB 4E1AA 1NN0A 1SA0A 3QU9A 2QVXX 2ZR8A 3T0IA 3LKZA 4EHFA 1E5LA 3P4XA 1IWPB 4K26A 4J2TA 3R7FA 1GR0A 4IIHA 3H11B 2E18A 1P8JA 4EFKA 3KEQA 2XMRA 4OQYA 3W5IA 2UUPA 4QARA 2YFKA 2B98A 3MJVA 4YUXA 5JJBA 3E5NA 3K9FC 4J1NA 1OY1A 1D2GA 4FMCF 2ATCA 3MXTA 1K6MA 1N1EA 1UZNA 1TW3A 4RADA 2ODBA 2A5LA 4RD0A 3NHUA 2YJGA 5HCNA 2QOEA 1CB0A 3SBDA 3BXPA 4BV2A 4KBGA 1Q3HA 1J90A 1RLUA 2P9EA 5JEDA 5E38A 3DPIA 1Y37A 4P9NA 4BZWA 1E6WA 1OBVA 3FOAA 4DIDA 1SOVA 1DE0A 4KR3A 2DP4E 4IJVA 5DHUA 2OGZA 3OM9A 3VQTA 3WZ2A 1ENOA 4LJRA 1KZ1A 5ECDA 2ZTHA 2L42A 1P9WA 4JLWA 2PNFA 4HUQA 2PS1A 3WYFA 4WKPA 5I9BA 2GD1O 3KG2A 1V5GA 2WTBA 2O5RA 1UMDA 3IPYA 4FFRA 1CG6A 4PGFA 1EAMA 3FDJA 3Q0TA 2FRVA 4WA7A 1GGHA 4CKXA 2XMBA 2WIGA 4LF4B 2F17A 1E4EB 1BMFD 1DRWA 3WYCA 1PVVA 1V9CA 3H0KA 3LYUA 3O7MA 5K5EA 3K6KA 4YV0A 1W85A 1G66A 2AYZA 4LVNA 4J03A 1R50A 4NECA 1YRYE 1V96A 1MAHA 2EOAA 4LBVA 4U5XA 4FW9A 3OLZA 4RA6B 3DSRA 2H11A 5ITVA 2LIPA 2X8JB 3GD7A 3L8GA 3OO0A 4KZKA 1FX0A 4KB5A 2I7TA 4WGGA 3SKXA 5AVVA 3F73A 1M2FA 2VEDA 4L4XA 1TJPB 2XHZA 1NW7A 2I7DA 2JFHA 5FBZA 2V97A 1BOFA 2A0KA 2W6MA 3HY6A 4EFMA 3R77A 4B6EA 1V1MB 2IHJA 3VR3D 4RWEA 1V41E 2BEJA 5JBQA 3ZCSA 1DQNA 1PUJA 3FHOA 3IDAA 1VC2A 1Z4NA 4QPJC 2Z6AA 1A72A 2B2XA 3T3GA 2H85A 2ZBDA 2EKLA 5F1KA 4ZAVA 2CJXA 2ZZNA 4ZEVA 4DIBA 4DR4B 1T25A 3W4KA 3VZDA 4AZTA 3OQPA 1N3BA 4L95C 4W63A 2HA2A 3QQ5A 4W6ZA 2HA7A 4CGYA 3K15A 3QRWA 1NW8A 3N2LA 4BVAA 5A1TA 5AUPB 1ODIA 3EZYA 3TPFA 5HKKD 4HFMA 5EPEA 5JANA 3AR4A 4RHTA 4DS3A 1F2UB 1L8QA 3IMEA 1SCAA 4BV9A 1A8QA 2ABWA 2MYPA 4L51A 3PI7A 2XEXA 3WLQA 1MJNA 1YMUA 4JOBA 1JU3A 3P0IA 2A33A 3RSFA 1SKYE 2QX4A 2ZJ0A 4BVEA 2V74B 5THXA 4Y0VA 2O7SA 1BQEA 3WZLA 3MLEA 2DBVO 2J3HA 4J0IA 4DQVA 3QW4B 2H7YA 4Z8YA 4YRKA 2DEUA 3C8UA 1ODSA 2SBTA 3HDYA 3LA8A 4NTZA 4GU5A 1G5FA 2NUPA 1ZOPA 1JDZA 3PP8A 4BRSA 4TRMA 3WIUA 1M9NA 2PWZA 4V1CI 2JFNA 3JD2A 2A1UA 4G0XA 5AJWA 1XTQA 2X9LA 4RAOA 2DQYA 3AB3A 3DZHA 5JY6A 1W5AA 2HBQA 5DYGA 4O8ZA 4RPIA 2BFFB 2VH1A 3HP4A 1XA0A 1GGFA 1MO5A 3D3NA 3UT5B 5B6PA 2NP6A 1G41A 4LOAA 1QIEA 2GN4A 2QUAA 3T5BA 3ZIAD 5H68A 5LFAA 2BT4A 4S24A 1JN0A 3TGLA 3IAFA 1ZYUA 5EWMB 3ICOA 4YRMA 3GGOA 2QLTA 3SIXA 1JDJA 3HABA 4ATNA 2P9JA 2D5AA 1QRAA 2WNSA 3SU8A 4DL9A 2BGJA 3B9QA 1ZIYA 5J1SB 3WLRA 3QOFA 1E2EA 5AHOA 2QLNA 3MMZA 1N6OA 3CX6A 2Q7OE 1XQ9A 3KJGA 3F49S 2QXTA 2C54A 4CMIB 1YJQA 2Y0EA 4RMJA 1MC1A 1G42A 5K09A 3A4VA 1TPYA 5CW2A 4LJKA 4QAJA 1I51A 3H75A 2G17A 3ZXIA 2PUCA 5K3SA 1VBMA 3FLAA 3B5JA 3RNOA 4XPZA 4CKBB 3MPOA 4LJ6A 2I76A 4ESHA 2YV5A 1IH8A 3MF4A 4LNHA 3L0SA 3QPAA 5HMMA 1CEXA 1XCLA 4YCJA 5LD2B 4MDFA 2PEYA 1DS6A 2YWFA 3QLVC 3MWFA 4IV0A 5CYPA 4Z0PA 2QVGA 1KI7A 5IH7A 1UBOS 4LNAA 4ARSA 2ZBGA 4DBLC 4DSTA 2WTUA 2FV8A 4LC9A 1QTNA 3LP8A 5GZ6A 4LHZA 3U39A 4E33A 4PTLA 3FBWA 1CZLA 2IYRA 2HBRA 1PGQA 3GLTA 3RSZA 4DDMA 2W2MA 5C1DA 4AYWA 1XA4A 1A2KC 2RHGB 4FYYA 3G13A 5SZHB 5C81A 4TKVB 4NX2A 1DT5A 3BJZA 3KPYA 2Y99A 3L1HA 3T1VA 4ASUA 1COWD 5AR1A 4M7WA 5EA2A 1ADFA 1R5JA 4RVUA 4D44A 3ZHOA 4KKXB 1WXEA 3HCAA 3M6FA 1LK5A 1E32A 1ATIA 5J2TF 5TT1A 3RWMB 5ESDA 3TECE 1IK6A 1TM3E 1KPHA 1JVBA 1YZFA 5E9QA 4Z3OA 3M6AA 2D7JA 4EFNA 5LZ7A 1Q3KA 3THOA 4AFNA 4L15A 1DV2A 4LJYA 3D6MA 3VSDA 3DJFA 3CE9A 3R0XA 5IJWA 3BD8A 3KUUA 5AKHA 3IPAA 1JJ7A 3H9JA 5TVKA 4B3JA 5D3MB 3V5NA 4JLSA 3J81k 1W88A 3HA5A 4ESEA 2HDWA 1Z6YA 3E27A 1W0CA 5BV8A 2ZYSA 5JISA 3FBTA 1JYSA 2ON6A 3USZA 2VP3A 4CLDA 2IKSA 3IUNA 4GWKA 1UFOA 2J9YB 5CM9C 2AE1A 2GVZC 3UPTA 1HXHA 4AJKA 1GPAA 3TNFA 1O97C 5ALLA 1A2BA 2GYWA 3N0TA 4B8ZA 3A1WA 1WKCA 2XDYA 2BR5A 4EQ6A 2CYCA 1KJNA 4YRBA 1L7EA 2VUUA 2VDWA 3REQA 5BQ3A 4QVIA 4L8VA 5BYAA 4PG6A 1QAOA 2WF7A 4JQZA 2PSHA 1RKUA 4OUDA 5F98A 5I7RA 5TMPA 4EG8A 1X1BA 4BE9A 2REXB 3VO9A 4Q82A 4OIMA 4Y2HA 1MC4A 1N2EA 2GMWA 2O0LA 2ZI7A 1I13A 2WICA 3GFTA 4B4VA 2EBFX 4B6SA 5K3OA 2PL5A 5IK2A 1ZUWA 3GGGA 1NI3A 1X2EA 2VHYA 4CU5A 3LKDA 4BGEA 3MJDA 3WL3A 3I5XA 2YCLA 3EEYA 1GG9A 1JDBC 4J0CA 3K09A 2ATVA 2ZYGA 4UHDA 5ALUA 4BLTA 3LT1A 2CD7A 3BK7A 3ISJA 4H9GA 5JPDA 3CPSA 4EVQA 1QVWA 3C70A 4KRGA 1DCKA 1ZK4A 3AZPA 1FQOA 4A36A 2HMYB 2OXIA 2AW3A 1X15A 1SQGA 1Y3IA 2CHFA 4BO6A 4Y2GA 4EKEA 1VM6A 5DMHA 2BGLA 1WUKS 5ILGA 1P9NA 4V0QA 3DBRA 1LV7A 1NBOA 2BC9A 3FGPA 3WWOA 4A6PA 4FB5A 3ZWPA 3IAAA 3PA6A 2XXJA 2VFAA 1CDEA 3PK0A 3K31A 1E6MA 4O2AB 4R68A 4E3ZA 3OTOB 1ZINA 3DQPA 4GXNA 2E37A 1HDGO 2G83A 3SHWA 2GNAA 3FVQA 4KH1A 4XGIA 2CZCA 2PMDA 4H0FA 4LS3A 3IMGA 4NPHA 4F86A 3RNLA 5GIOE 2PFKA 1FJHA 1EA7A 1M34B 4V0OA 5E7JA 4RHYA 3ZGYA 4CEJA 2CL7X 1J8MF 3HNPA 4LCEA 3BSYA 3AYZB 4M1SA 3L07A 1XIVA 2YV1A 2IXTA 4HH3C 4KJXA 2A86A 1QMGA 3IPLA 4F56A 2QT9A 5KYWA 3JAMA 1L5MA 3PS9A 1H3NA 1COZA 4J3FA 2LR0A 3V7YA 2NZVG 3BF7A 4NJEB 3NGLA 1KSGA 2CMGA 2QG9A 2J5KA 4EYQA 3FSEA 1C7FA 2VF7A 2ZRLA 1S89A 3THRA 4HLNA 1E9SA 1ARZA 5DO9A 4ABTA 1G5IA 3PTLA 4M9QA 4R05A 1KU6A 3VPXA 2WFLA 3M9WA 1JG1A 1JWAB 1UKEA 2XOXA 1R0ZA 2BEUA 3S99A 4BFXA 1OXBB 2MSNA 3KXIA 821PA 1VHLA 3FSGA 1R1DA 2A59A 5FT9A 4INOA 1KE1A 2COEA 1ZVQA 1GVNB 2V55B 4ANFA 2VJCA 4BNHA 4DCOA 3KLBA 5J40A 1SBQA 2GWHA 4P93A 3DCIA 3GCZA 3P0RA 4HVCA 3O4RA 3R0QA 4ZYUA 2C7OA 1VLLA 3V6LA 3RIGA 1XA3A 1THTA 1Z0IA 3HQ4O 3I42A 1TYZA 1XL0A 2FA9A 1JLLB 2Y1OA 5DNEA 4BNZA 3FMVA 4G1EB 1CZUA 4PY2A 2O14A 4UATA 2CK3D 4NF2A 5CX1A 2R84A 2HMWA 2JEZA 4O2RA 1X2BA 4Z4HA 1YACA 1OKKD 5BV0A 2IUFA 4E6PA 4JFAA 1EFPB 2C8LA 4U6QA 2G0NA 3UN1A 4BFTA 3NGMA 4EAAA 3T9CA 4I9GA 3C5HA 2P2YA 4BASA 3CT6A 1PLLA 3CH5A 1KSHA 3CZPA 3DE5X 5AW8A 3RUHA 3ANNA 1SXIA 5DM2A 5AW0A 1MRSA 1USVA 4G0ZA 4WK6A 1IONA 1YUNA 4LY6A 1K8QA 1ZONA 3HP1A 4PRLA 4QDUA 3PQ7A 1F4VA 5D84A 3RSSA 1I36A 3NBMA 1U8UA 3O8DA 2GKOA 4K5QA 5KWVA 2JGEA 521PA 1YCDA 1XKXA 4RYLA 5IAJA 5JSHA 2COKA 4KPUA 1C7JA 2J4FA 1KP3A 4F2HA 4M2LA 4FYMA 2YXLA 1X77A 3UMGA 2QYTA 2Q4EA 3M8KA 2YYYA 2H5IA 3KTAB 2W98A 3IXLA 1ONPA 1XPJA 1YDHA 2Q62A 1KRWA 1OXUA 1QPBA 2Q9BA 2HRRA 3NHWA 1O4WA 5DTMA 2EX1A 4ZOQI 5AESA 3ER6A 1V9SA 2DJ5A 4WEOA 3HCRA 4IHAA 3TI9A 1SK9A 1E1CA 4DRXA 4ZHQF 4RK7A 4P54A 2VP5A 3OT1A 1N32B 1MD9A 1GPBA 2PVPA 4RKWA 3OM1A 4RZ3A 4AJNA 1Z4JA 1WXHA 2AK2A 4Q4DA 3SC2B 1UM8A 3X2SA 4EABA 4F4FA 5CG1A 3VO8A 3Q7SA 1EHCA 4RD1A 1UK9A 1YBAA 3PC2A 1TM2A 2CUNA 1MNQA 3T5TA 4XDZA 4X84A 1J49A 5BUQA 1FYWA 1O0CA 4DQLA 1D7AA 2Q3DA 2W6QA 2POCA 3AW9A 1YR6A 4H7KA 1QFZA 5CT8A 3VISA 1MOPA 1HF3A 1XMJA 3EVDA 1SUFA 2I8CA 3MWEB 421PA 2Q2WA 4K2AA 1L4BA 3CRVA 1B74A 5IKXA 4H17A 4L27A 1J2EA 5T8KC 1A97A 3RU7A 1WEHA 1QJCA 2PUJA 4C0AC 4C05A 3B1XA 4N5IX 2Z9BA 4C87A 4KPGA 1X13A 1XZMA 2QTTA 4RZUA 2AEJA 3B89A 1R74A 3UJ6A 3SAJA 1JR2A 1P74A 3G9XA 4RACA 2GF0A 1WW8A 1P77A 2O8NA 1U0EA 3GNLA 3I04A 2XD4A 3LYAA 4MP3A 1QOZA 2VS1A 2ZIAA 3KFLA 1KMCA 1O77A 4CV2A 5AFSA 1YTUA 2NLOA 2I4IA 3M1LA 4Z49A 3D8RA 1KK3A 2WBLC 1VKHA 5CDFE 1YQDA 1LS1A 1PVDA 2QD1A 3KR0A 3QV1A 1SEVA 3MS2A 4W5HA 3F9IA 4B7XA 3BCUA 1W76A 1UIMA 1NM5C 1ZZEA 3LI2A 4UKDA 3GLGE 6REQA 3WQQA 4YFYA 1X19A 3IDQA 3TOVA 4M53A 2A6PA 3M34A 4UFNA 4LRUA 2ZUFA 4UUMA 2IYZA 3BXZA 3EAFA 4M98A 4YPFA 2P5YA 1QK3A 1W36C 2YZNA 4M0FA 4IIUA 2G08A 1XB2A 1NN1A 2UVPA 3KKLA 1FYDA 4HWKA 4KXUA 3GRAA 1KEZA 4MZDA 4A8HA 1YJ5A 1SELA 4L4UA 1PS0A 1Q22A 4JI7B 1NX6A 4GI7A 4IFTA 3CTMA 2PD4A 3VC2A 4BN4A 3ZDCA 4OJQA 4TTSA 1H93A 3R0VA 5F2KA 2IYQA 4RXMA 2Z5FA 3W5UA 2I2FA 4ZFNA 1S8NA 3WXBA 1V6CA 1E1NA 4K88A 2ZUTA 4CMCA 3DB1A 5EQDA 3PGVA 5EJGA 2OKGA 1ZVVA 1RI2A 3KZMA 3K0CA 1YJCA 3GFOA 5IARA 4WZBE 2UXBB 4OQMA 2Y1KA 3RI3A 2I8LA 3M9XA 1M6EX 5JNSA 3BB3A 3L6EA 2XB2A 1NYTA 1HRDA 4JUCA 2XDAA 2I6GA 4ZDWA 3NBZC 1KL7A 3BG5A 4HAZA 4GPAA 5IASA 4MV9A 3T0GA 1L6IA 1V6SA 2GAFA 2ZROA 5ITSA 1GXSA 2BR4A 5JTTA 2KJQA 2HM7A 2NZXA 4ZO4A 1V7CA 2Z30A 4PSKA 2QTMA 4ZT6A 4CI0B 3U56A 1UAAA 1IQUA 2A3NA 2OUKA 2XAAA 1KC1A 2CXQA 3OKFA 2CJYA 3DMDA 3FLEA 4MQLA 4J0QA 1M8PA 1UQTA 3I12A 1CZRA 5I51A 1OAOA 3R23A 4AS2A 4CKCB 4DQXA 1NNSA 3CUVA 2EJUA 5J2UA 2IL1A 2PUEA 2EF1A 3ZG6A 3OQJA 4LZJA 4X90A 4LXUA 1W0JA 2J30A 3FD8A 2VNHA 3TMYA 4HDNA 1G98A 5IXYA 4ENTA 4KBYA 1MW9X 4W1RA 3E22B 4B3SB 3NALA 4JB0A 4PSDA 4ZQBA 3OX2A 4EX6A 1CYEA 1IEXA 3PJEA 3C3XA 1N5MA 3IXQA 2X7XA 1NFFA 3OZTA 5L4NA 3MJCA 2Z1NA 2D4AA 3AGPA 3GH1A 2J8ZA 2W6PA 1M2JA 1KMHA 3FPKA 2ZRFA 1RRGA 1DAKA 4GSLA 5AOVA 4C7KA 1LNQA 2X3UA 1Z33A 3GN2A 1JDSA 1PJZA 5G4KB 5TEWA 3HK2A 4OY3A 3VVBA 4EY7A 4TL6A 4RH3A 1GRNA 4BP9A 1SVIA 2ZR7A 1XJQA 3N3AC 1MF7A 1PTKA 1BKYA 3RTBA 3VNQA 2F67A 3DHWC 5FOVA 4WFQA 4F5EA 1QM5A 1NHGA 4N47A 2YN2A 2XB4A 3S8MA 2ZATA 4WZBA 4M9RA 3M1AA 1SUWA 4ER0A 1R9MA 4MDEA 5HYVA 2Q7XA 1FDWA 1ZGCA 1CNMA 2AE2A 3ODGA 1KJQA 2IZ5A 2Z04A 4H1HA 3WMRA 1YRQA 3UV3A 5DGCA 2HR1A 1M5RA 3BEOA 1VJ0A 4Z4GA 3VV2A 1G8FA 3ETGA 1F9AA 2AN4A 1IWOA 1HEUA 4E30A 2CV0A 2NADA 1UPFA 2JKVA 4IHJB 1JEQB 2J33A 4OGGA 2WZCA 5JD3A 4X7BA 1J5XA 1XZLA 5JYEA 2OGWA 3EVCA 1Z37A 4NKRA 1RCTE 1RRFA 3QPUA 5EMHA 3SD7A 5KREA 2OQRA 1VCNA 1J1UA 2AFIB 2QZZA 3BJMA 3L7DA 3T6KA 4LG1A 2Z5GA 2BKUA 5J2UF 4PXSA 2VJNA 4JLMA 3AERB 2PPVA 2H3HA 5MN5A 1JV2B 3BULA 3WHKA 3NH6A 2GPYA 7ABPA 4OG2A 3EVZA 1VXRA 2CXOA 3QW2A 3QX8A 2AZXA 3EUWA 4QOJA 1STOA 3N8GA 3RQIA 4Q5IA 5FCDA 4Z7OB 1UADA 1UPBA 5CVUA 1V4BA 3G2KA 2FG6C 4DDWA 3U48A 3IVMA 3KUKA 4P34A 4ZCLA 1I9CA 2ZULA 3IBYA 2VNIA 2ZJ2A 4EGAA 3SSOA 1EFUA 1GRVA 1EWKA 2G80A 4R01A 4Z9YA 1QHXA 2FQQA 2LUOA 2IYUA 3NIGB 3K30A 4AX8A 5A4JA 3WNQA 5KVVA 1TIBA 1XI2A 4PNZA 3G7NA 4C2TA 4FR0A 2E6UX 3CKYA 5K0FA 3AETB 1UT5A 1XNGA 2PA0A 4M1MA 1QZTA 3B7WA 3L4BA 1DC6A 2NN3C 3T1QA 3TYXA 2W00A 3R40A 2CKMA 3PPXA 4J90A 4O3FA 4HDCA 3PHCA 1RHUA 3QHPA 4DM4A 2EF0A 5C8YA 2J3IA 4CV3A 3VBEA 4NQZA 2JHCA 2OHOA 4D57A 4JR0A 1FU7A 4WBNB 2PVSA 3RVDA 4EOGA 5JW6A 1AKEA 3COJA 4JGGA 5MN6A 5BNFA 1OLSB 1ZIDA 2AWOA 2X8LA 4XLLA 4U7DA 1II8A 5T4FA 1T43A 4MKFA 1A7JA 4P38A 3UCXA 4N41A 2ZYAA 4X3CA 1Q5PA 1KQNA 1ZKDA 1XQYA 1XKLA 4OOEA 1O6BA 4A5SA 3AF1A 2TMGA 1AKMA 1AUQA 1X80B 3BIWA 3E53A 3G5LA 3JWPA 3M6LA 5AM1A 4BUZA 4I1VA 3TGPA 5IUKC 2NO4A 3WK8A 2DHQA 1L5NA 2QLMA 2OFFA 4YMLA 3CUSA 4QJ3A 1Z0SA 2QTVA 4IMPA 1XCMA 1RAAA 4YQFA 1P5HA 2C4WA 3SXUA 2Y66A 2DPLA 3IMKA 4AP6A 4KO4S 1D0VA 1ULTA 4IZOA 4XSGA 3JQ9A 1VJGA 4AJ2A 2JZCA 1L7RA 1VPEA 4D8TA 1A5AB 3IJRA 1C9DB 1KDOA 1P73A 1V8BA 1D9ZA 2J48A 2MDTA 4PX5A 4Z9XA 5FR2A 2G0AA 3WK4A 4EJ2A 2F00A 3GZTB 4JV5B 2IXFA 5HZMA 4EKIA 1CSEE 2O8BB 2VPQA 1CHNA 2CNBA 1FNBA 9GPBA 3T38A 3OQIB 4RJIA 3PE3A 3ZKWA 3OQOA 1PNRA 1R0BA 5HKBA 1EWVA 4PLFA 5I5EA 3LX8A 1NZJA 3CF2A 3KKQA 4Z8XA 3SE0A 4OX9Y 3NHLA 3NBKA 1IHOA 2IWRA 3DV0B 2AKAB 1M6HA 1FBTA 4KQGA 4LOJA 3RE1A 3VPCA 2VSXA 1KDPA 1P0QA 2P7HA 4JS0A 4XD7D 5C1IA 4TSFA 4F60A 1GGEA 1SIUA 3U81A 5EJ8A 4I5DA 3RHSA 4BGDA 3RQSA 4UM7A 4MRMA 4YRFA 2O2JA 3JZIA 4UZEA 1Z45A 5DH9A 5C35A 3P9NA 3ESQA 4YO8A 4KE7A 1ZRMA 3OO1A 1POXA 1MT0A 3GT4A 3QYFA 4RZXA 4ZU3A 4F4IA 2RHWA 1DHRA 5AVYA 1PFWA 4BO1A 1YZKA 2AR0A 2LZ0A 1ZK2A 4JJEA 1ZGBA 4NFYA 3VSAA 1NP3A 4K86A 4OREX 4U5QA 2QNIA 1HPLA 4UCFA 3KPUA 5DXJA 5AQEA 5KYYA 2QZ9A 4PYQA 4Q3AA 2WIBA 4I08A 1CVLA 4PLZA 3SHTA 5AW2A 4OK3A 1R6VA 2Z2IA 4YJFA 2DPXA 4RTMA 2IY8A 3F6SA 3T7JA 1UPTA 2AOUA 2GJSA 3JARB 2Q5QA 3NRCA 1GD1O 3MXOA 1IVSA 4L8LA 5CB0A 1MXHA 1T6ZA 1AXEA 2H2HA 4WKCA 5L3ZA 2DETA 3IPRA 2HFKA 5CA1F 3EWIA 4X62B 3PUHA 2JKZA 4G8DA 3RYIA 1Q0TA 3D31A 2IOFA 1NKVA 4I5EA 4R2JA 4R81A 4CIBA 1UDBA 4BYMA 4OU4A 1CQWA 1MVLA 3ASVA 5AKGA 4QOGA 1BO6A 4XX0B 3ZWYA 4CFYA 3Q5EA 4CM9D 1MGOA 3E2IA 1Y7PA 4V03A 5BP7A 4NBSA 4P4GA 5MGNA 1PFGA 1L4UA 3JRXA 3QMMA 2WLTA 2YJTD 1C80A 2NXNA 1G4UR 1W30A 3PITA 4FB4A 2R11A 3LC1O 4XIIA 4BN0A 3HTXA 2RC5A 3FR8A 2B9EA 3Q3IA 4IHQA 4JI2B 1L8OA 4LWPA 3LPAA 5AP9A 3EW9A 4DA9A 1XNJA 5ILOA 2DQ4A 2D74A 1GLVA 3NONA 5HMLA 3BFKA 3VM6A 1NUUA 1KAQA 1NW6A 2OFXA 2YXNA 3QK7A 3OLQA 4P4SA 1IN5A 1F0PA 3WV5A 1ABFA 3RFCA 4KQEA 3ULKA 3GZNB 3V8EA 4DZRA 2CW5A 5ALVA 3M4XA 3CEMA 3LZ6A 2W5UA 4NBVA 3P2IA 2IV2X 1EMDA 1NMEA 1NBAA 2CMKA 5IAAA 2BL4A 3VTZA 5LUAA 2FXVA 4RIGA 3EXFB 2Y0BA 1A5SB 3ZWDA 1CUAA 5HRAA 1J2RA 4N6NA 1HBJA 4E5MA 5IKMA 2O2EA 3GEGA 3OH8A 2FUCA 3IOCA 5H59A 1PQPA 4J43A 4BEJA 2IODA 1QH9A 3BXHA 3KJQA 2AXQA 2G8LA 4TSRA 4HAOA 1K0UA 1QX3A 2YS6A 5ARDA 4Z53A 2NNLD 4NMXB 2GHRA 2EERA 3GT0A 1OGIA 4BJ1A 1TK3A 2FPXA 3IE2A 4XCVA 3FUVA 4JI8B 2QRNA 3INGA 4DSNA 4GMDA 3WYGA 1VLQA 4ED9A 1J4AA 1RM5A 3R5XA 4J0HA 1EM8B 1BNCA 4C7OA 3DULA 4YRGA 1TUBA 1CR1A 2FP4A 2UZIR 4C5AA 3GT3A 1MOZA 1W6RA 2BISA 3CUKA 4JX8A 2LRHA 4F3NA 4WK2B 1U3UA 2DTEA 1AHHA 2PWPA 4GOLD 4GR4A 5HE8A 4JKIA 5DMXA 1Y1TA 3IKVA 3GHYA 4KIJA 1Y3HA 2PEZA 4WVLA 4RHUA 3VZCA 1GIAA 5AK5A 2C3MA 1U3GA 3LT2A 3P4UA 1QGDA 2FN8A 1IFXA 2QUHA 3GP5A 1OYYA 1E79A 1C9KA 1VIDA 5DI3A 3HJNA 4MUJA 3OM8A 4URXR 1OLXB 1YASA 4WNCA 1UPCA 1YQ9A 2HLPA 2ZB2A 3DZGA 2WJJA 4HQ6A 3T35A 5AQ1A 1N36B 1M1YA 4AULA 1USUA 4K03A 2PUBA 1M74A 2LVBA 2Q5IA 2VQDA 2HXYA 3Q2IA 4D9MA 1BGWA 2PR2A 3C3CA 3VR5H 1XDGA 1PHPA 3H18A 2GTPA 2D4HA 4JT9A 2NTVA 3H0EA 1W93A 1I1NA 1Y6ZA 2I71A 4Q1FA 4C3VA 4AQ7A 1NU8A 2XUPA 3PPIA 1KZHA 1GPJA 3GARA 3IBSA 3Q7RA 3V4FA 1Q1EA 3ROMA 3T9AA 2R7KA 2ASVA 4HPJB 4J4HA 4TXHA 2QMZA 2FEMA 4ZV4A 1DJOA 4ZJUA 3KQTA 1JFTA 1XLTC 2X0IA 2WYIA 3EZXA 3OTHA 3RVJA 3KCQA 3UICA 1AUOA 1XZGA 2V3WA 2D1YA 3SXUB 2Y77A 4KQXA 4C1BA 1P44A 2PO7A 3RS3A 4I3FA 2V3CC 2IS4A 1QANA 3PQEA 4FCWA 4L08A 4QGGA 1N8KA 1BVYF 1YB6A 1JUDA 1I3MA 2I65A 3DBHA 1CY6A 4Y6GB 3IQGX 3PHBE 1V4NA 2UXDB 4TOIA 2I3AA 3FPLA 3GF4A 3QE0A 1ZEMA 2Q6KA 4ZI7A 3ACBA 1HNXB 2JEOA 2D1FA 3DZFA 5F12A 3IUYA 3VKFA 4JVMA 3FOFC 2ZS7A 4Y9RA 3RF6A 2OAP1 4PBRA 2W71A 1H85A 3ZHXA 2OCAA 1AS0A 1R4MB 5IDXA 1RXVA 1Z2CA 2CJPA 3MD0A 1NJ2A 3OU6A 1B2LA 3RARA 3OZGA 2ZYWX 3Q9NA 3OQMA 3F1KA 4JLDA 1EFPA 2I4NA 3KBBA 2IYTA 1WZUA 4HH1A 3SZOA 3TKYA 3UC5A 3PF8A 5DN6D 1H4QA 1OXVA 2VC2B 1B8VA 1T1GA 1U7DA 3A70A 3UWMA 2IWHA 3D0RA 1YQEA 1XZNA 4BNLA 5A6SA 1BCRB 2D62A 2OCYC 2OE2A 2ZB4A 4Q03A 1BJTA 2J0VA 5B7PA 4RTLA 4JI6B 2V5VA 3BEDA 2JAHA 5JCOA 1L5KA 1ESDA 3VR6A 1BWSA 1QG0A 2Q3MA 3IYLW 3AUSA 3OTQA 4MXDA 1FFCA 5KWIA 2P30A 3DNPA 1Z2AA 1N57A 2FFBA 2K2QB 4OBWA 4E21A 3AKZA 3FG9A 3VH1A 1XEWY 1D7OA 1I3OA 1NDUA 3BHMA 4KO1S 4KMRA 4XA8A 2IBSA 2HK8A 1UKYA 3F98A 1TEXA 2NU6A 3WYAA 1NRXA 2HEIA 2VH5R 1T8RA 1QOQB 3P5SA 3T41A 3PQFA 3FFAA 4MV5A 4PVCA 2C3PA 1CZKA 3GIWA 3HGQA 2EJVA 4M0CA 4ER3A 1CY1A 1KTIA 4XDHA 1W2HA 5CURA 3W5BA 3JV7A 3HKBB 3M2PA 5REQB 1I24A 4Q01A 1RQ2A 2QVLA 3MT9A 1GFWA 1WIWA 2G6TA 5EMLA 3UK0A 4CKWA 2PM8A 4RWZA 1Q7EA 3KKMA 4HDSA 1OHHD 2AQIA 4L22A 1RXEA 4RL4A 4UZFA 4WKBA 5F7JA 3W5AA 1W5SA 3HLKA 5CA0A 1HE8B 3BREA 1FRFS 1D4ZA 4AZ3A 3VTKA 5HJ7A 1ORHA 4K81B 3PEVA 2ZAYA 1XMPA 1FS4A 1R9NA 3CONA 3KWJA 5IVIA 1JDBB 2XE7A 3GDWA 4Z4QA 5HF9A 1NJ8A 4E09A 1TA4A 3AY6A 2ID7A 1IVYA 4HDRB 4X8MA 3WK5A 4ERXA 1KXZA 3HJFA 1RQRA 4PIPA 2EW8A 2ZDGA 3EIHA 3GJ7A 2I91A 2JL1A 4OGWA 5BR7A 3AVPA 4JSTA 2BZSA 4L1KA 4EWLA 2YINC 1TEVA 5DM1A 1RMYA 2WUVA 5IP5A 1WXWA 4HNAA 1NNEA 3VOAA 2NG1A 4DA4A 1O54A 4BIIA 1CR2A 1K3FA 4N03A 4IVQA 3BICA 3IP6A 3WNVA 2WG2A 4CCAA 4FEAA 3EXG2 1GU1A 4UQOA 7REQA 3FJYA 1KYYA 2I03A 1ZD9A 2RH4A 4FUTA 4EHIA 3CEPB 4Q9KA 1E61A 4KFCA 3BTVA 4KVZA 4X1KB 5ED0A 1OTXA 4GOND 4BQNA 5LBUA 1HSZA 3U44B 4BEVA 4ZVUA 5ER9A 1KBZA 3WLAA 1VTKA 3SFVA 1RQ7A 5LQJA 4JU9A 4UVHA 1L4LA 4AXBA 3BUSA 1B93A 3BOSA 5DDIP 2LDXA 1TM4E 2YRWA 2H2WA 2Y9PB 3TFWA 4BV8A 5AVTA 4WRRA 4DYVA 4ZJZA 5I01A 3S8EA 1QHIA 5IJXA 1IWBB 1XDDA 2IEDA 1E2UA 1PDVA 3C6XA 3TIIA 1N5LA 3RSGA 3Q3HA 3H5WA 2H63A 3RR2A 1DTWB 3V7NA 2WD7B 3I6IA 5JLAA 3ICQB 1SN7A 4G3XA 3MINA 4U2BA 4G1BA 1GNQA 3ZBPA 3GMDA 1JTVA 2BDTA 5MGBA 3I2JA 5DTQA 4CEIA 5C5CA 1T26A 2VPZA 2Z3VA 2A9RA 1AXGA 2PYIA 1X3LA 2YX1A 3A9TA 3CRQA 1P39A 3R3VA 2A8YA 1ZY2A 1YI8A 3AQ4A 3FCYA 3H2KA 3QXJA 4J29A 2C83A 2V59A 1P6UA 4TMTA 3TOXA 3MEQA 1NJ1A 1K7EB 3H05A 3WWCA 2BY4A 4F6CA 1FEZA 4HTFA 1U2GC 1PX2A 1Q92A 2BMJA 2Z9DA 3BMQB 2A5GA 3BD7A 3R24A 3OLXA 1IULA 4U2DA 3WDKA 2QDXA 3ZWKA 4B1FA 5ED4A 1QS0A 3EPHA 4IMRA 4HNSA 4HNVA 1KNQA 4NOKA 4LRYA 2ZS9A 1Z6XA 1O95D 1PJ2A 2ES4A 3ABSB 1DAIA 2M6LA 1LBEA 1JEEA 3UY4A 2YJ4A 1Q14A 1N34B 5AJYA 1ECGA 4LRWA 3PSHA 1AUPA 4IQ0A 2YHUA 2EWWA 3NIBA 4PPYA 5IYZA 1A8HA 1L5ZA 5J9FA 4CDGA 3U19A 4W7HA 4YMHA 1NL3A 1CF2O 5EJ5A 3EVGA 3KHKA 4G9EA 3SZUA 3DPSA 3M3PA 2QJTA 5FOWA 3DHYA 4ND1A 3LT0A 1K92A 1NZFA 4P7BA 2AG1A 5AK0A 4PQRA 5IW8A 4M83A 2KLBA 1M1ZA 3C5VA 2GXUA 4U00A 4C21A 7ADHA 5LOVA 4JJ7A 1PRYA 1K86A 3JD4A 3VHXA 1RBZA 1I5EA 2VQ3A 2Y93A 3LQFA 2XCRB 3LGSA 5KMGB 6ADHA 2VPTA 2ANCA 2UVPB 3B6EA 3BDIA 3JASB 3DHEA 2O3TA 3QU7A 5A5GA 1YZHA 3DMGA 2WJZB 3U09A 1E94E 4L6AA 2QPLA 1WLSA 3TTSA 1FXWA 1VGVA 2HF7A 4EF5A 3PGMA 3IL2A 1E3WA 3U3OA 4JYCA 2CFTA 1K9SA 1BXRB 5ELLA 3R20A 4YROA 2GVDC 3W7VA 4LGCA 4FJ1A 4RFLA 1WHTA 5DLEA 2HV9A 3DTVA 5CDYA 2JH8A 4FMBB 2WUDA 5TF0A 3P4YA 1WNTA 3IOMA 4HNHA 3ILHA 1GL3A 2C5FA 1NI4B 2E9SA 5FA5A 5T6MA 3ZX4A 2ISQA 2OD2A 4G85A 5HA5A 5KEIA 2JD1A 4UZSA 3ZVMA 3S44A 2MSKA 2P79A 2CXUA 2X1MA 3STHA 4QYXA 3GH3A 1BJKA 4O2BF 5BWOA 1KY4A 4DFDA 5L40A 2IVFA 1SVSA 1XE3A 3G9ZA 4Q9JA 1W9MA 3AEZA 4FT2A 1PT6A 2Q6TA 1SPXA 1EVIA 2HA3A 4G4SP 4N6OA 2GARA 4J0DA 2PZKA 1DG9A 3WQSB 1PZMA 2OO5C 3WV4A 4BNKA 2AX3A 3PUWA 4YJHA 5DGIA 3JQQA 4EY5A 3MUNA 1B41A 4R8VA 2ATEA 1MVOA 1VL5A 1JEQA 2GZRA 2L17A 4RF3A 4PG8A 2HMAA 1Q91A 3LCMA 4FX5A 3HKCB 1Y7IA 1K3TA 4U7FA 1YULA 5DYNA 4D9BA 4FSHA 1DOAA 3L8CA 3I9JA 5DPMA 1CHDA 4O4HB 3AKDA 4D8UA 5BMVF 1EFVB 2Z6UA 2HF8A 3T7DA 1HMPA 3FDZA 1LPMA 5ALQA 4B3RB 3V9PA 2D5CA 1YFKA 1UBMS 2LCFA 3AJAA 3OIWA 4IMIB 1Z3CA 4Y1FA 4YCAA 3F2VA 4B2IA 4DBZA 2QNRA 3DZCA 1A1VA 5LLTA 1O5IA 1XTSA 4KBFA 3VR4A 2C4NA 2X4DA 2IYVA 2YWGA 1OZFA 4CTJA 1EG2A 3HUFA 2ZI9A 1ZD1A 4AYXA 5EE1A 2BFWA 3L7IA 4WLOA 1KI2A 1QK5A 4X41A 1K8RA 4UTRA 5ALTA 5KOIA 3OIUA 4G4GA 1UQUA 4KDFA 1SCIA 3EF3A 2GGSA 1ZK0A 3H87A 2FX5A 4H1VA 1NFRA 4QDZA 1YFJA 1XK6A 3PKJA 1ZH0A 3PWKA 1SWVA 4UAVA 3TQHA 4TV9F 3H86A 4BPRA 3RHFA 3OEHD 4OL0A 1F1JA 2PPLA 3BDAA 4E4TA 1F0NA 2VHEA 2A58A 3ETDA 1BA2A 5D1HA 3REGA 4LWZA 5ADWA 5KTRA 5A0VA 1YKFA 2WUEA 4L3OA 5BO5A 1C1DB 5JDIC 5LQMA 3KB6A 2HCFA 3L0DA 4FGWA 3TLXA 2QMUA 5EJ2A 2W6CX 2Q9UA 1LDGA 1YIAA 4XR9A 3IV6A 3R0ZA 2O59A 1ZM4A 2J6HA 1E0DA 3B9PA 1ZSYA 4OQZA 5K9ZA 4JBXA 4MUEA 3ZI7A 2QLFA 3E3MA 4YJ3A 3RYCA 1VCHA 1O5OA 1B0PA 1U80A 5KOHA 3B2NA 4RPGA 5JH7F 4MW1A 4Q4HB 4PG4A 3IE0A 2AG8A 1SHKA 5FWDA 1Y1KE 3TNJA 4BZPA 1Q12A 1JKJA 2W2KA 2P2NA 4PNEA 3SMQA 3G2OA 2JI8A 3IGFA 4AG5A 3AHJA 3PCTA 3U3KA 3DKRA 3PRJA 3PGA1 4OYRA 1W4CA 2QQ0A 4C22A 3FCOA 1CPYA 3O6VA 1XCBA 3EDRA 3WB9A 5EKDA 2NYUA 4QUDA 3DT9A 2BEWA 2QN1A 2YY7A 5KDLA 1YS2X 3DG9A 1O6FA 1Q6YA 4R8SA 4WW0A 5J4KA 1Z5VA 4NJMB 2GUWA 2RJ3A 4HQNA 4JBGA 5IJ0A 3I1JA 4E32A 5GINE 2CUZA 4U4AA 3A6EA 4JSRA 2QVBA 4N0PA 1C3LA 2IUTA 3IT0A 2B1QA 2FGJA 2QGFA 4Y1RB 4TT3A 4BGUA 4D4MA 3BXXA 5BSHA 1ZD3A 3A9SA 2BI7A 2Y1LA 5KPDA 1U9IA 2VNSA 2C82A 1OX4B 2G09A 2WU3A 1LH0A 3TE6A 4DLAA 4EEKA 5KYUB 5JFOA 2EKBA 3LY5A 3PFGA 2REQA 5JE8A 3BGIA 4DC9A 2WZDA 3NO4A 1KI9A 2IX3A 1LW6E 4XUGB 4BLVA 1PL7A 3T1TA 1CRQA 2P9GA 1G20E 2V9PA 2H2IA 3B6MA 4OHFA 3MCTA 3OESA 4ZAYA 5EJ4A 2PTHA 4NDZA 1ID1A 1O58A 4G23A 2R60A 1ZXBA 2MINA 3GPIA 3O8BA 4ZIRB 2G5TA 3HDQA 3JAWA 3N87A 1FYEA 3I45A 1WBBA 5BUSA 1G9XA 1T1IA 2W9XA 3NWJA 5COQA 4Y9TA 2BI8A 1U2EA 2B0CA 4BVGA 1SXQA 4YIKA 1ZUNB 2TMKA 4KFTA 4XQEA 5CB4B 3HCFA 4WXPA 1AX9A 1CQJA 1T8SA 3O94A 1U9IC 5ADUS 5MHTA 1BOOA 1H94A 2V4UA 3PC7A 5HDQA 1NY5A 1L4EA 5EFOA 3P9RA 2C5HA 4J91A 1T36B 3NZEA 1KP9A 4TWIA 4W1PA 1ADGA 1GDHA 5L7YA 1V8PA 3UUFA 1M34A 2RIPA 4D45A 9ABPA 1VYUA 1REQB 2DB3A 1RJEA 3N7AA 3PL1A 4X0EA 4I6GA 1E1DA 5M34A 4O4LB 3LUDA 2HY7A 2FUG6 3S7ZA 1MAAA 1R4ZA 4D9KA 5JZBA 2IS6A 5HF8A 2PSSA 3B20A 5IXSA 1QE5A 5K0TA 2H16A 5AW9A 2I7XA 2RB5A 3QFCA 1QTRA 2BKXA 3VDQA 4BL5A 1KC3A 2QU8A 3W1WA 2YWRA 3E7PA 1TO2E 3L4EA 3UHFA 4ENRA 1U0NA 2JHGA 2OHHA 5FO0A 3RRYA 3R3UA 4ETIA 3M81A 4WXMA 1GCIA 2CT8A 4Y7CA 4UJ3A 2H07A 4ZZ1A 4AY2A 1E9CA 2HB6A 2A57A 1J8YF 1CJUC 2IGBA 4OPMA 5JIBA 3DAFA 1Q1GA 2NXEA 4B80A 2H1RA 4BLSA 4OXRA 2E55A 3LWBA 1GEEA 3NTXA 4UM8B 4G0OA 3TEMA 1II0A 3ZUPA 2C8JA 3EFEA 4HUTA 2WYHA 3FNBA 1U94A 1SAYA 3ZDXB 2PQMA 4JXXA 2W2LA 3B5EA 2W2OA 4GEGA 4HR7A 3V2IA 3ND5A 1FP1D 3U0BA 1QV6A 3X2FA 2BFAA 1Y1SA 3K70B 5FUQA 2W22A 2RGUA 4MKHA 3VHRA 4PG7A 4HI0E 1DAOA 5JAOA 2I3ZA 4CZ2A 4YWHA 2GDJA 1V35A 3A04A 3H2SA 4OGKA 5FWYB 3WYBA 2ZP1A 1VCIA 1NW4A 3GG2A 4NH4A 2F4VB 4QBKA 5BSFA 5AXBA 1TAHA 3BE4A 3FTPA 4MVWA 2AG6A 3AVYA 3O73A 1RE1A 2HAEA 4MCAA 1A9XB 1E8MA 1V5IA 2AQHA 3P9QA 4DHWA 3RFXA 1XPUA 1XPRA 2Q3EA 3R7WB 2H8GA 4PFKA 3GGSA 1IN7A 2EU8A 2DU8A 3NYIA 1ZA2A 4RPCA 1XRSB 1W4BA 1NN3A 2EHJA 5D3MA 4CIWA 2XXAB 2XUHA 5JSZA 1H0HA 4URUR 4WL0A 1JHXA 2XGMA 3CQ9A 3ZZNA 4F5ZA 3CVYA 1Y8AA 1GAJA 2IIVA 1NSTA 2ZSBA 1QIFA 3ZBTA 4XIYA 4P33A 3RK4A 4MW4A 2HSDA 4D2IA 4YO7A 3ADOA 3A1CA 5JNRA 5JS2A 1IOZA 5TV2A 2D2VA 5I3CA 4UPDA 2OHFA 2WINI 3AUXA 4MR9A 1HKUA 4US0R 3RAGA 3LY7A 2CBGA 1RI4A 3BYZA 3IBGA 4ZVQA 2CVOA 1GCOA 4J0KA 2Q8PA 3C4VA 4OHRA 1NVVR 5DBIA 3UMFA 3WGNA 3OCJA 1DKOA 1L4FA 1P91A 3E2MA 2IPNA 1M73E 1RHKA 4MRNA 1DOHA 1QP0A 1IY9A 4O2LA 2V4ZA 4X61A 5A5EA 2IYSA 3RJ9A 5D7NA 2J32A 2X5XA 2XYRA 3SBOA 1RAHA 1U9ZA 4RKEA 1B8OA 4NG4A 5U9CA 2F59A 4NSNA 5K8TA 1Z25A 4RK6A 3IAM1 5JLJA 2QLJA 1AN9A 5EWLB 4OK5A 2XMSA 3RSHA 3COPA 3M4NA 2P5UA 2QN9A 3OEED 4WY5A 1IBKB 2I7VA 4N65A 2IITA 1NFQA 5KNCA 2VQSA 1RHRA 2WUFA 1A5BB 2JNWA 4I19A 2IK8A 3RUPA 1FTNA 2QJWA 5FWXB 3OX3A 3C45A 1U4OA 4RK5A 2H08A 3N2GA 4RMHA 1Z39A 2OHIA 2P9YA 4BB5A 3WS7A 4ZHQA 3TLBA 5KYXB 3DZKA 3HI6A 5CIWA 4AUMA 5EWJA 3NT4A 2JI4A 3FXAA 1EHYA 4Q0MA 5JCXA 3II6X 1I3LA 2IIPA 3P9XA 5JBNA 1I0IA 3H5OA 4KW7A 3P1JA 5AIBA 1U2PA 5CYGA 5D3ZA 4I9FA 4UM9B 1NXTA 4ARZB 2FPUA 4TN5A 1YS7A 3ETJA 4R54A 3PLNA 5DI3B 4LF5B 2Y4NA 3C15C 2QRQA 3OTIA 5EOVA 5EUBA 1AV6A 4HDNB 1CR4A 1LDMA 1NBMD 1T2NA 3HZHA 5CXQA 3MTIA 4QRIA 4X20B 5GQSA 4DV3B 4GPTA 2B21A 3BK1A 1DNPA 1GUZA 1I33A 3OPVA 3D7SA 1LUAA 3QQPA 3KOYA 4J4BA 3LZCA 3PVSA 4TV8B 3SQNA 3I58A 3T54A 3THXA 1TD1A 2EGHA 1GUFA 1B42A 4R8KA 4DLKA 1A9OA 2DT8A 3BFJA 5AMXA 3B3FA 3E05A 4YR9A 2NWQA 2XYQA 1KI8A 4GYJA 1YU9A 4ZKEA 2QXYA 4XD2A 3W6UA 2ACKA 1HZJA 3BGVA 5CH5A 2ORVA 1P0IA 1UP4A 3CFYA 5JZMA 1SQ5A 2GH1A 1LBHA 3HU5A 4E2ZA 4EZIA 4G09A 2PLFA 4PLHA 1NXVA 3BZBA 3E7DA 1ZIOA 3H9CA 1WVMA 3CZQA 3HA2A 1A7UA 1FLAA 4QX6A 4ENQA 1XWIA 2HNAA 2Y1DA 4M1WA 1D03A 3BORA 1YZUA 1IDOA 3LBHA 4HNRA 4URFA 1RTKA 4UCWA 4N0MA 1ZESA 1WF6A 1Y9JA 4CHTA 3K9GA 4P3OA 1XHLA 3GJXC 5HW0A 2DBYA 4C0LA 3B51X 3UB4A 4B0PA 5C7YA 2VF5X 2WD8A 1FS6A 3H13A 4GM1A 3LYLA 2K87A 1G6HA 3LV8A 4MUAA 4MMYB 4C1NA 3TIVA 5H16A 1U81A 1ST2A 1DAGA 2QV0A 5B58C 1E0JA 3R7NA 3DWIA 1T9HA 4RMNA 4KVFA 2PWYA 2VJMA 2VJAA 4BB6A 3AF3A 5H3LA 1XTBA 2VDLB 1A5ZA 4I6EA 4BVHA 1TQDA 1MVNA 2W8BA 4G26A 3TQRA 3TQTA 2WEKA 3DUFB 1FUEA 3KALA 3K6RA 1UT8A 4J16A 4ZEXA 3EIQA 4Z4CA 4XFJA 5DV9A 1DIGA 3TTVA 5F1OA 1IN1A 3D54D 4RTPA 4LMRA 3O0DA 3UKJA 3LVBA 2JGFA 2R48A 3KWFA 2QUJA 4PEVA 5ALFA 3U2QA 3YASA 1JXQA 2BLLA 4R1MA 4QQRA 1ZBDA 3SNHA 4ARUA 5JNLA 2E21A 1VI6A 3MSCA 1QB8A 1ZM2A 5EMKA 5HUHA 4K8OA 3X0DA 1G7RA 4D25A 2R6GA 3TAHA 2E5LB 2ZGVA 3CKKA 1EUDA 1MV5A 3HS3A 4YQEA 1H2BA 3IOEA 3NR2A 2JASA 1N9GB 5KQLA 4BNXA 1VFNA 1A98A 1JDNA 1RM0A 3QEMA 4IIFA 1TQ6A 4EKGA 4UTPA 2HGSA 1EUDB 1UDXA 1L1FA 1EEHA 3COWA 3WQBA 2W0SA 2BIFA 5JSKA 4X8OA 2AFVA 2G9VA 1L5QA 4RZQA 4B75A 1HUQA 1P1KA 4LDJA 3KVVA 1VDZA 2HIMA 3FRJA 4NS4A 4ZC8A 5ADHA 2WSLA 3K9HA 1VPVA 3IP3A 4CODB 3N8KA 3I0NA 4OXNA 1J39A 4M7RA 4HPXB 2SKEA 4JQOA 1K8YB 2F6RA 1IE3A 1USIA 3NWBA 1T5TA 4NYJR 5F4ZA 5LA6F 3ZNPA 5CB8A 2NTNA 2FTKE 2QUIA 3ORSA 2J5RA 1SB8A 5IS2A 5LBIA 1Y34E 2A9KA 4LJ5A 1JFFA 3NBXX 4BKOA 4UFOA 3KZVA 3U5TA 4TQGA 3NOXA 2J6CA 4OHMA 1WKBA 5JAMA 4PGMA 1I6MA 2F62A 4BU0A 3C8HA 2F4NA 4NI5A 4KHPB 4AZWA 2D13A 4UEKA 2R1TB 1QIJA 2WWWA 2Y1CA 3UYKA 1GAWA 1FFDA 1SHZA 3Q4GA 2R3SA 4FCVA 4FDMA 1V16A 1GNLA 1GZ7A 1R2QA 3EIXA 4KVAA 5JS6A 4JMPA 2J0UA 1QNLA 2ZCJA 1QGZA 5SICE 3VOSA 3FNIA 4IAOA 3E1KA 1CEQA 3OOJA 3ZCTA 4BY9E 1GTVA 2V6MA 5JSYA 5FPQA 3ER8A 5KYUA 1CUUA 5JJIA 2XNSA 3DO6A 4KFUA 5JAUA 3WJ2A 4MICA 4YI3A 4PCLA 3JQ9C 4NEGA 3NNSA 4Q3EA 3BFXA 3GEEA 4KXNA 4R40A 1OZAA 5EUCA 3D6VA 3IJ5A 2QUZA 1X7XB 1YC2A 2IBMA 3VU9B 4AF6A 4UPVA 1S01A 5ILQA 2Q2OA 3JVDA 3U4GA 5H9WA 2PKQP 3KSMA 2AGVA 4LE0A 5TRTA 3CNLA 1DX6A 4ZOEA 3T3PB 1E2JA 5DIZA 5B2ZA 5E6RB 2FQXA 3E3NA 1PF7E 2EDCA 1NDHA 3IQFA 1SVNA 3ZEAA 1C9MA 3IKMB 4YS6A 3GJ3A 3ZZMA 3DMTC 3MRVA 2VAXA 4CM3A 2D1SA 2W4MA 3NVMB 4HJRA 4CLXA 4D96A 4WXRA 5ICFA 1KRXA 2GXQA 4Q9NA 5JC8A 1RP1A 2JVJA 1LTQA 2Q5CA 1U6KA 1PR1A 3PFIA 1FBNA 3EK2A 4IGAA 4J94A 5J59A 4H0NA 1YJAA 1PZHA 4YBZA 1YH3A 3R2JA 1N7GA 2WA2A 3KB2A 4GYWA 4L8FA 4LNUA 1MB9A 5K3FB 3U4DA 5IJZA 3KYJB 4IDCA 2R00A 2WLSA 4UUQA 1RXCA 2IYWA 1RQNA 1GCGA 2J9XB 3ZGXA 3CNNA 1KY3A 5IBPA 3V7FA 4GR9A 1AU9A 2O2SA 1HURA 4K6KA 4MI6A 4R6XA 4YA6A 4BTLA 3NCTA 4E07A 5ABPA 5F76A 2HUNA 1NTRA 2JAOA 2WKWA 3HCOA 1EUQA 3L7BA 5LB2A 4HGNA 1F48A 3IR5A 1YHNA 2X2OA 2GN1A 1JI3A 5T3UA 1U3TA 4YRPA 4OHCA 1NE7A 1XG5A 1BFUA 3QBTA 4CMAA 2OHGA 1JT2A 3JX9A 4KQCA 1TT5B 1Z62A 3KQMA 2X9QA 4MGYR 1ILWA 3AR5A 3FPSA 3U9TA 1OZGA 4TMKA 1M76A 1RPAA 4YX9A 2A1UB 4P3YA 3RVMA 1RXUA 4EY6A 1U7XA 1XHFA 3DOUA 3ED1A 5FI1B 3DZIA 3KYCA 4GLOA 4N5NA 3HFJA 2C5BA 2KX7A 3L9XA 1DKPA 5JBIA 4II3A 1W73A 4I1UA 1N8SA 1VPTA 2GSWA 2WHPA 1TX4B 1VLZA 2XADA 3Q3EA 4ETWA 4PN3A 1OGJA 1GAXA 1FFYA 3QP9A 1KDYA 3ZHCA 1P0MA 3AYXB 4LRSB 1XELA 1Z5PA 2FKNA 3SWWA 3AUFA 4NBTA 1NSFA 2BJWA 3AESA 4KO3S 1Y1PA 3L7MA 4DJFC 1E1QD 2XA2A 3Q11A 4CMHA 1KSFX 4A2QA 2JAUA 3UXYA 3H11A 3H8SA 4O4HA 4E22A 1E69A 3EXIA 2C20A 2XYHA 1J20A 4I2NA 3O84A 5H7XA 2HU7A 2COUA 3GW8A 3L06A 4O59O 4F45A 5HIKA 2EZ8A 2QZSA 1CVRA 3DJYA 1GAEO 4OCZA 1OFHA 5AVRA 4K28A 5EHQA 3NFYA 3OE4A 3MCUA 4L07A 1QVVA 2OG2A 3DR5A 3FHCB 2B4RO 4A1FA 2C98A 4Q4HA 3RW9A 1YF3A 2EG9A 4OAQA 1GUAA 1OC4A 2UYQA 4DM7A 1OV6A 1TJ4A 2FI1A 3F67A 4Q9AA 1C8LA 3A6ZA 5DX8A 4AKHA