2OXGB

The soxyz complex of paracoccus pantotrophus
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
110
structure length
110
Chain Sequence
STVDELTAAFTGGAATGEGGLTLTAPEIAENGNTVPIEVKAPGAVAIMLLAAGNPEPAVATFNFGPAAADQRAATRIRLAQTQDVIALAKMADGSVVKAQTTVKVTIGGC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The SoxYZ Complex Carries Sulfur Cycle Intermediates on a Peptide Swinging Arm.
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Transport protein
molecule keywords SoxZ protein
total genus 24
structure length 110
sequence length 110
chains with identical sequence D, F, Y
ec nomenclature
pdb deposition date 2007-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13501 SoxY Sulfur oxidation protein SoxY
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2470 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2oxgB00
2OX5B 4UWQB 2OXGB 2NNFA 2NNCA 2OXHB
chains in the Genus database with same CATH superfamily
2KDGA 2DMBA 4OCWL 4YPJA 2JI2A 2RGSA 4QXTA 4FFZA 3ZTJH 1T4KB 1ZK5A 2EDXA 3X13B 2YWYA 3QCUH 4G9DA 4Y7OC 2VW4A 2V9RA 2F7PA 2CR6A 2FWSA 1B0GA 4WI3A 1ZVSB 3MV7A 3ZTDC 2QVMA 1V10A 4OD2A 3LB6C 4MFHA 3ULUH 4X9GA 1I1CA 1PAMA 1GC1L 4FQHA 4IIQC 1YJDH 4MZIA 4JQXC 3CDFA 4MJIB 4N28A 3TEZA 3KEHA 1CB4A 5SWSD 3CFDA 5IW6B 2VDPL 4X9HA 4ODXB 3QC6X 3QJHA 4LCWE 1OCZB 1TSHA 3RNKB 4P2RA 4X4ME 5DD3H 5DEFB 3VH8B 3ZZSA 5AVXB 5HJ3A 3MNDA 3MC0A 2JVUA 4GLRH 4DZBB 2W92A 1NAMA 4WUUA 3QUHA 5HYQA 3FDWA 5EUKB 4HPHA 3MX0B 3IF1A 1RHHA 1JZ6A 4X7SH 2Y7LA 3SO3C 3WU1A 1TVBA 2X10A 3CFBB 5IEKA 3NCWA 1CTNA 5DHEA 3OZ9H 3VACA 4FNLH 1RSYA 3NJIA 3IFNH 2D3VA 2K6YA 3U2SA 4DESA 1N4XL 3F83A 4MMXA 5D1XB 3MFFB 4MJ2A 5HVFB 2GBUA 4YE0A 4RWYL 1YN6A 2YD0A 4F8QA 1KULA 3AY2A 1D5MA 3ATEA 5JQIB 2HYMA 4G8EB 2CIIA 4YPGA 2VXUH 5G5DB 3DKHA 2H3NA 1UJ3A 3CD4A 4PRBA 2E56A 3KPLB 3DO7B 3W0WE 5DJCB 1T1YA 3NACH 1GS6X 3PWPE 1NDGB 2I9TB 1HKFA 4RDQF 5AALA 4PRNB 2HJKA 1EZLA 1BZ9B 1L7TH 3FSWA 4OY9A 3FQTA 2BP3A 2YD5A 1QTSA 1YMHA 2F58H 4IW4C 2P4AB 4PLOB 1LO0H 3VRIA 4G83A 4LVOB 3KPOB 3EHBB 1KY7A 3VMOA 1FVEB 5T1MA 4K3JH 4F3FA 1AZUA 1WFNA 4LOFA 4EPSA 2V7HA 3NJFA 1HHGB 5C3IA 2WLMA 3VQLA 4ANXA 4R7DA 2WTOA 4OGZA 5JQHC 2YPVH 3NK4A 5DMKA 4B5ZA 1RVFH 4Z3JA 5I71B 5KVGH 1E28B 3U7YH 3OR7A 4CC0A 4D0CB 1QW9A 4N90D 4GW1B 1DVUA 3FN9A 5BV7H 3NFNB 2Z31D 4WV1B 2BSEA 1CIDA 1PNCA 2HKFL 2K6WA 4PJHF 5IBUB 2HFFA 2A9NH 2CDGA 2GC7C 3FB6B 4LSUL 3RPBA 4U4BA 4LIQE 4HV8B 3FFCE 1N2RB 3GJFH 1MLCA 3IBOA 1YEJL 2V17H 5K9QG 3ZDXB 5IROD 4PR5B 2CHWA 1U91A 2Y7SA 4KRPC 2H3KA 2LT9A 1Z3GL 2Z9TA 4PP1D 2B16A 3L3HB 5J06A 1OV8A 2ZCZA 1MPAL 1FL3B 1U9KA 4P57A 4L9DA 3MZGB 2FJUB 4ABVA 2FJFB 4OLXH 5B7EA 4B9JA 3DX8B 5CF3A 3SKUD 1C12A 1FNSL 1Y6NR 3BVWA 4HMCA 2DDQL 4X5QA 2YKLH 4KGLA 4XXDA 3UTSB 3T1WA 2VJ0A 5FHAH 3TX4A 1SM3L 2BCKA 1OSPH 4PV9A 4XPBL 1DQVA 1ZVSA 4CN4A 4NI6A 1PZUB 2XWBB 2PCPA 3PDDA 4OVVA 5BQ7A 3CBRA 2YD4A 4GXUN 1I75A 4R2GD 1UM6L 1T66D 4YUEH 5HHXH 5F0PB 3QXDB 4G8IA 2WD0A 2Y7NA 3QDJB 5G4NA 4LF3A 2IAMC 1EO5A 5CSZB 4WTWA 3I6SA 1HE8A 4MD0B 5FYLD 2WKGA 2IMNA 3BZFB 4N0CD 1I9EA 1X5ZA 2R23B 4NO2B 5CN1A 2O30A 1GGIH 3CXDH 3FYIB 1FORH 1U8OB 3U4AA 2J88L 3O6FD 4OT1H 4CW1A 3FHQA 2ZWLT 1WUZA 5FOJA 1XXFC 2VDNH 4NQCD 4MA8L 4BQ8A 2BNRB 1HC1A 1UJ3C 1KIPB 2F2HA 5F9JB 2IBGA 4OGQC 3Q8BA 4RGNB 5DT1H 1L9QA 3EJUA 5BS0A 4N2MA 1MJ8H 3HE6D 2F7QA 2NR6D 4NCC1 2RACA 3R19A 3PGFL 1I8LC 3I9PA 1D7FA 3T1FB 5C08D 1FYTD 1AIFB 4MA1C 1RJCA 3KLQA 5HYEA 1RUPH 2V7HB 1YY9C 4XP9H 2B0SH 5GZNC 1DBKH 1BFVH 3LZRA 4BUGA 3QPQC 5GRXG 3C5JB 4CSTA 1D9KA 2CBOA 3OJDA 2EDHA 2JWYA 3F7YB 4QXVA 5FUCE 1RZKL 3AQZA 2C1OA 3ULVH 2J1XA 4UZSA 4PREB 5IHLB 1BWMA 4BFKA 3RKDD 5I75C 2VMDA 3ABZA 3A67L 1KLUA 3L7EB 4AE0A 4YDLC 4O9HH 1HZHL 4EI5B 3Q6FA 3UPAA 5AW0B 4K5MA 4NQCA 1SQMA 3C87A 3RDJA 5C0GB 4Y0GA 3DSFL 4B9YA 1S2EA 3GYRA 1VADB 1JNLL 2IAAC 2OJEB 3QO1A 3FRPG 4IDJL 2ZKYA 5ESAB 1EJFA 3CVHA 3M8OL 4ZUVA 5LNGA 3WD5H 1P5UC 4HFWB 1DQDL 2OMWA 4X7FC 4J3SA 1TQBB 3P4OB 4FNTA 4A7GA 1JK9A 2F53E 5B3JE 4D0DB 2DAVA 4M7JL 1HNYA 2CGRL 2CSPA 4QRPD 1NMCC 4WDIA 5I19L 5D1ZI 4ZMZA 4M8UA 4YXKL 2AAAA 4PRDB 3FU6A 4UCFA 2OX5A 6TAAA 3PJSA 1U8HB 4IGBB 2A6DB 5AZUA 3R7QA 2OXGA 1QI4A 3CDCA 5HHOA 4AQ1C 1P7KB 4PH8A 3FC8A 2EACA 5C6TH 1WBXA 2WQRA 2YN3A 1Y0LB 4MD0A 4TQEL 4YHKH 4DQAA 2QFRA 3N9GH 5DEFA 3B4NA 4H40A 4DTGL 2QADC 2K78A 2MMXA 3FAXA 4LF3B 3TTYA 1IZKA 4KITB 1FVCB 4GG6A 3QJHB 1LO3H 5EU6E 3BWUC 1Q9OA 4LARH 3T2NL 1F18A 4FAAB 1BBDH 1F6AB 3OJMB 5CD5D 5SV4A 3LKQB 2E8YA 5CJXA 3PL6D 4PJAA 3SKJH 1QA9B 2XPZA 5FYLH 5I74C 4DP6X 3WEXA 2BOCB 2D2OA 4YHIA 4PJCF 2KZKA 3QARA 3DUUA 4JRXD 3WL9A 3HZMA 2XBTA 3MX0A 4FXLA 3MLRL 5I73B 3U30B 2EVHA 4XMLL 5JHDE 1ROCA 3CDGB 1U33A 3MUUA 3N1PC 1MCDA 3GBMH 4HLJA 4OCXL 3UCQA 5EBWA 4AMKL 2WKOF 2KZWA 2NSMA 4MXWL 5F7UA 3NABL 4OLWL 3LN4A 5I18H 1JZJA 3V0DA 2FE0A 1N64H 3C5JA 1L9MA 3KXFE 4WEMB 3E1F1 4NERA 1HXMA 2YRZA 1U3YA 4U3SB 3U6XS 1ZA6B 4N24A 2FGWH 4BFJA 1AXTL 1CFQA 2JFCA 3RY6C 3ZTNH 1TMCB 3KPNB 4XWGH 5KOMC 4IRZA 1N26A 1F3JA 1FL6B 4MGXA 1HXYB 3S88H 3VFNA 2OS7A 4RIRB 3CCHB 2IDFA 4U6XB 3S34L 5I30H 3ZT6A 4WW2A 1D9KC 1SXAA 4PRHD 2VERA 1IBZA 3QEUA 3WKQA 3MV7E 4JM2B 1ZLSH 3HPLB 4H7VA 4X9IA 3SBWC 2DMKA 3QUMB 1S7QA 5IVZA 1IX2A 4UMSA 2PP9A 1MDAA 5FM5M 5CD3A 1RIHH 4X5XB 1I7RB 3I9GH 4R7DB 3T4AB 4UM9B 4ODVL 1J05A 1I8LA 5C09A 4JPWH 3VE0A 1QPXA 3ARBD 3BVNB 3EXJA 4MAYD 4G82A 2RFXA 4HHAB 4N8VB 4PRIA 4MMYB 3VFSB 1YEDB 5B38A 1HIML 1QHPA 3ARSA 1B2WH 4FJ6A 2ARJB 3HZVB 4IBYA 1ZRUA 1UATA 3RVTC 2VM4A 4AIZB 4TNEA 3OLDA 4H1LB 3ZHFA 2FR4A 1WV7T 2P8LA 3IE9A 4P46B 4JRFA 4TNVK 5TFSL 5EEUA 2YIHA 1Q0YL 4GQ9H 4KROC 4WHTA 4ODWB 2R69L 3RA7L 4D9RD 3LVTA 4OCNC 5CP3H 5C9KA 4PJXB 4QRRA 3A47A 2J6EA 4JE0A 1IM3A 1MNUH 2BSRB 4P9HH 4PW9A 4QI3A 3DK0A 4TSBL 2W38A 1W91A 3DBSA 3LX9A 4APQC 4QKTA 5C08A 2HLAB 1IGYB 1X44A 2FRGP 4Q9BA 2WOBA 2CBPA 1JDCA 2WYTA 1Q9OB 4LMQE 3FW6A 2CO7A 1FO0B 2UWEF 3B3IA 3WNOA 1XIWA 5IR1B 2AJXL 1RK0B 3GEFA 3RGVA 3BH4A 4MAYA 5EU6D 3M1CA 3PHQA 4FKKA 3EJYC 1XTLA 1KGYE 1LXMA 4AKQA 2UZXB 2L04A 3FO9A 4LCYA 2BPBA 4Y16B 3FRUA 2RBLA 4E9SA 2VDKB 4H26A 1BX2A 3KR3H 3L4VA 1NFDE 3WJJA 4CN1A 4WAFA 3V0JA 4X0KA 3N1FC 1GJIA 3D2UA 4EF3A 3AT9A 2VSCA 2ORBH 1U3HA 2XVKA 1F3RB 2G30A 4EUPB 1E6JL 4N2IA 5CZVH 3NEXA 2GTZB 3Q5YA 3QGVA 4Q56A 5D8JH 5DD6A 2JV6A 4OZ4B 3W81A 5SWZA 5C70A 4JRYB 1S3KL 2ZWSA 1FZJB 3RWHA 3DTUB 3OKNB 2B39A 4TUOA 1YNTF 4HDIB 4E9QA 4G9FA 1A7PH 1O7DC 1TQCB 1AP2A 2DWEB 1R19A 1RUQL 5EEVA 3RWGB 3DVNA 1KCKA 1NCDH 2O5ZH 3I50L 1AVAA 2GSIA 4FEMA 2NY6B 2OLDA 4R4FL 2GEQA 3GSRA 3W1ZA 5EZJA 1E5ZA 1CFMA 5GRYA 3WNNA 3HHSB 2E6JA 3SDCC 4X80H 3EW3B 5G55A 1NH6A 2Y72A 3IDNB 4ENZA 3VD9A 4F91B 2MOVA 3GMRB 4X6CE 4DPRA 3N85H 3NCJH 2YPVA 5T33H 1EFQA 1W6WA 5DA4A 5IP4A 4PJ9D 2X9YA 1BAWA 2V9UA 1AD9A 3CFQA 5D7LA 2FVNA 3AROA 1FZMB 3C60C 3I6LD 1ZTMA 2BNRA 4FG6D 1P5UA 2Z3FA 4L4TB 2E4FA 1FC2D 1SZNA 2XACC 3MGAA 3MNZA 1CC3A 5CWSB 5EB9A 5BW7C 3WLBB 5IBLD 3O11A 1UA6L 4MNHB 4JFSA 4W9EC 3K2MC 1TT6A 2HPOA 4J3TA 1KPVB 3QUXA 1LDPH 4HISA 3APFA 5I1IL 4I1NB 4P2OC 1HQRB 3KG5A 4P2QE 6CGTA 5IJVB 4BQCA 3Q8CA 1IBGH 2OZ4A 4CKVX 3NFSH 1R3HB 5FCUH 4BFOA 3T4AA 4U49A 3J8F7 2WZ0A 5T5FA 4C8XA 1A3RL 1QWUA 3NFPB 3QQNA 5ILTL 3JWDL 3GSNB 5EUOB 1TJXA 1XB8A 1O7SA 3EG9B 4WWKA 3IMSA 5DO8A 3E8UH 4D94A 3D3VE 2XCMC 2UZXA 4FJZA 4YC2B 5DTFB 5JO5B 1WGVA 1A5FL 2OL3B 2WZAA 1ZPLA 4L9LC 4LLYA 4NBZB 5DHMC 2H26B 3F7LA 4FXKC 2ZE0A 1BJ8A 1UM4H 3DXAE 1SDDA 3TTSA 3TPUB 3PWUA 1MFAL 3H4HA 1U8PA 3DVFA 2X2UA 4LCUB 4Y4FC 2YEQA 5E7BA 3ARDB 4AUYA 4K3DL 4HIEB 3T8XB 1QSFE 5GISL 3Q3GA 3VO0A 5JOPE 1ZA3B 1TTAA 4H5SB 2UY6B 4JQXA 4QXUL 4UV4H 3QXVA 4UDUB 2IPTH 4QRSB 4UT6L 3EOAA 1H6EA 5FDYA 5FLVA 3BUYB 3I74A 4TSAL 3FQTB 5IB3B 3LXCA 1CZ8H 1YPZA 4BE6A 1ETB1 4HIIB 3UTPE 3AAZB 2FX7H 5IJBC 5EC2A 4MKMA 3BAIA 3NIGB 4QWWD 2FGWL 2F7OA 3T08A 4Z7VE 3HB3B 3HMXH 3VFOA 2Y7QA 1KENH 4O5LL 4XN7A 1JZ4A 4YSPA 2H0EA 5JHAA 3FB8A 4NGHH 3OGOE 2JMRA 3S8FB 4L1TA 2C34A 3MRFA 1WBYA 1Y1UA 4PUBL 2VR9A 1TTRA 2MTPA 1JXJA 5I8OL 5I5JA 2XG4A 3AT8A 4XXWC 4NENB 5IB5A 1NCAL 5DJ8B 3FBKA 3VFMB 1RK1A 3RB7A 1JPFB 4JN1L 3BGAA 3OQ3B 2CG9X 1MVYA 1P5UB 5DJ6A 3DPBB 2PXYC 1CS6A 3L8QA 2IDTA 3GLEA 3IETA 2UXGA 4JJOA 1UACL 4MNHA 2O5XL 4JPKH 3UACA 1M6UA 2I9TA 2APWA 4PS7A 3BP5A 4DP1X 2VDPH 3BESR 1Q8MA 5EN3A 3VGEA 5JW4N 1BF5A 3TONA 1ZT4A 1RPUA 1CBVH 5DWUL 1TZGL 5I75B 5CU5A 2WQSA 3IU4H 3WXVL 3H9HA 2CUAA 1MIEL 1UGKA 2K9FB 5MI0C 2LW3A 4N0RA 3KD4A 3GSRB 5CEZL 3OQRA 5JPNA 1AQDA 4C56A 3DIFA 3CLWA 4JFZL 1T1WA 4Y19B 1YPZF 3BHBA 4F9LA 3OAYK 2A9AA 1G1YA 3VWJB 3FH7A 3D48R 4XPBH 2YR3A 2J8UE 2WQWA 3GIVB 4FEIA 3PCYA 2NY6C 2OMNA 2CHZA 4KX7A 4GLRI 3BO8B 3K6NA 2CLVB 2AC0A 2OYLA 4EIZC 4UBDD 4TYUA 4WK2B 1G7PB 3UYRL 3QWNA 3LKNA 1RZGB 2ZCHH 1Z2KA 1MHHB 4JMNA 3PABB 1LP9B 4X4YB 1GAFH 3ARBA 1DBAL 1TYRA 4OZHF 1F5WA 3HMWH 5ICXB 2M2DA 3DVIA 2IQAB 2JKIS 2UXFA 4QCIB 4ETYA 3BP6B 5HGBB 5KTEH 2BDNH 3MKKA 2Z31A 1D9KD 2DLTA 4HS8L 4OLUL 4JJ5A 4A6YH 2YAFA 5CMAA 2ZUWA 4KTGA 2DIBA 2EILB 4KKCC 3BGFB 2R15A 2EDJA 3AG4B 4LSQH 4W68A 3N42B 5EC2B 3O4LA 1U8QB 3RDTC 1ND0A 1YVLA 2UZYB 3KDPB 1WDAA 4IDLA 3GRGA 3MGOA 1PS3A 4OUUB 4O02H 4PWGA 1M7IA 1ED3A 3P3SA 3GMLA 3WDHA 3EJCA 4TVPD 1LO4H 3MBWA 4PD4K 5L88H 1JTOA 1GMEA 1H5BB 5GS0H 1HTYA 3D52A 4FG0A 2Y1YA 3QUZC 4NWTL 3TYGL 1B88A 1CVSC 4WUUE 4V2CB 3NN8B 5ADOL 2D03L 4OIAA 1LO2L 1FO0A 2FZ3A 4IHOA 1LJMA 4QHUA 2FEEL 1NBQA 4ZO6A 5D6CB 3RIFK 3VSVA 4CVXA 1NC4B 4KK5C 3VXTA 1L9PA 2QDVA 3HE7B 3D0LB 3Q8EA 4NHUB 2ESVD 3CUPA 5FHBL 1Q9WB 1BD2E 4LRIC 2A0LD 3TO4B 2CLRB 3D4CA 4IKIA 4BZ2A 5DZOA 2AXJA 1WHOA 1MY5A 2C9VA 4TUUA 3COOA 1HOCA 3IWVA 4AJYV 5D2LE 2X70A 3ULUE 2CU9A 1ADQL 4LPVA 5INCA 4F2MB 1KWKA 2BOBA 3HG1E 3QEHB 2A6JB 4UQ3B 2ZICA 1YEEH 1OM9A 1HDMA 1AO7A 2FX9L 5IVXB 4KKAC 2C3VA 4QRRE 2XZCH 5DJYA 2X7LB 3OHXB 1R5VA 2E9IA 4UT9H 3QR1A 4GG8B 2WWMD 4YSUA 1EGJH 4ZQTA 4CMHC 3OJVC 3LEYL 1RIUL 3FUIA 1Y18B 2WC7A 5AEAA 2N3JA 4HJGB 3ATAA 1MFDH 1DQML 3DHMA 3MNZB 1G4RA 3APDA 4B96A 2IF7A 2WBJA 2IXQB 4G43A 1JTPA 2CH8A 5CEZD 2IBZX 5GSVA 3FT2B 2J73A 2R4RL 3B7RL 1JPSH 3DRQB 3ZY7A 4YHKL 3B9VA 5CLYA 3O2WL 1P4IL 4Z95H 5E70A 4NYLA 3FT4A 4UAHA 3PWPD 3VGFA 5I1DA 3BWAB 5D55A 1TEGA 2EE6A 1RJYB 5B39A 4XCCH 5J1SC 4L2LA 1LK2B 1U93A 2JQAA 2AQNA 5E1AA 5BV7C 3CWGA 4DGUA 1TJIL 4BINA 5KVFH 2ENSA 4XH2B 1PYWA 2WLLB 4UU9B 2QHRH 1NFIA 2ZKMX 4I2XA 3TBWA 5I1CH 5CZXC 4F7TB 4HKJB 1FP5A 3KH3A 5LBSL 3SJVA 4F1ZA 2G9KA 3J07A 2OMVA 3TZVD 2Y4SA 1M7IB 4FDWA 1AYOA 1CE1H 4ZDHA 4HCRL 4FQIL 4XPTH 2DLEA 2BSBA 4W9GC 1H0DB 2X6MA 2RD0A 5CBAA 3MJ6A 4U3CA 1TZAA 4F15B 5F9AC 4XXWA 1I7TA 1T5WA 3G08A 5DMGD 3ZTJG 4FABH 1HH6A 3B1TA 2GJPA 1VF5C 5KZCB 4R96A 3QPXH 5D71H 3HE7A 3D7PA 1N0LB 1T04B 2PN5A 2GJ6A 5IJVA 5JW3L 4JY6A 4LL1A 4LQ1A 4MA3B 3UTPD 1F6AA 5D6CA 3WKML 1F13A 5L2KD 5F3FA 3C2AH 5J0BA 4L4VB 5LKNA 3HBQA 3TS8A 3L95A 4RISL 1S9KC 2O6EA 2VLKA 5DC2A 4L4VD 4NUGH 3ARQA 2BH0A 3SDCA 1RZFL 4RNRA 2A83B 2X05A 1JK8B 5IQNA 4LPYA 3BAEH 4ODBD 4MJIE 2K4WA 1C8QA 5I2IA 1PDKA 2PPFA 2EEXA 2WZ6A 5CXPA 3U4EB 1E5UI 4JZJA 5F9OH 1V3KA 5F6IB 3D39B 3O3DB 5JIQA 5ICYA 1G1OA 3GMOA 1KBBA 4HJJH 2PYEE 5DT1L 3FQXB 2DEXX 5K9JH 3BKMH 1OAXH 4UTBA 1WWAX 5E99L 4M1DH 8FABB 4JG1L 2NY1D 1LEKB 2DH2A 4OZFG 3PG2A 4JFFA 4M29A 4DUWA 4YHOH 3HNTL 1TNNA 1BLNB 2FHCA 3A24A 4L9LA 3G5YA 43C9B 4E9LA 2DM2A 5JHMA 4NP4L 2WY3B 3MLVL 1CG9A 1RUMH 2VAAB 3S4SG 2VQ1A 3H0TB 1BV8A 4IU2B 1QMUA 2VZ3A 1SPDA 3DOSA 3HB3D 5FUCC 5CGBA 4HJTA 1OOAA 2XV3A 3US1A 1CD1B 1EANA 1IAIM 1OT1A 2J2ZA 1RI8A 1RUAL 3KLKA 4PGEB 5EU7E 4LVNC 3Q1SL 1PMYA 4LSPL 4NNPH 4MQ7A 4I2XB 3TBWB 2ZOLA 2VABA 3TO4C 2OXHA 4B7IA 3U0PA 4J6RH 1X7SA 1I85A 4MYWB 3V5HA 1I9JH 4MD5A 4PJBF 1HXKA 1X9RA 2XU9A 1OTTC 2DYSB 2F54B 3NSJA 1URLA 4OFYA 5DQDL 3KNBB 5HPMB 2F1BA 1KJ2A 1FI8C 4WFGE 5F3BB 1GZHA 1OKEA 5HJGA 2CQVA 2YGNA 2Q10A 4V1DD 4KX9A 5LVEA 3MBEB 3TM6A 4TQIA 3VG9C 2IXQA 3EGXB 4YHPB 2WSKA 4F7EB 2HX8A 5CN3A 3TT3L 2IGFL 4HCIA 4V1DE 4GMSL 5E9DD 3HJEA 1H8NA 3WLWD 4BUHA 1DJWA 1BEYL 1TETH 3OKKB 1FWXA 4G80A 3X1EA 3DX4A 1QNZH 3OKEA 5C6TL 4YHZL 3CHOA 4IEFB 5PCYA 3VD0A 2VSDA 1CICD 1BD2A 1VZHA 2HZHA 4QGTA 3ARDC 3IXAB 4Z3IA 2HJFA 1X7TA 5FOBB 4X0NA 2VYRE 4YJZL 2DQHL 2NSXA 1OT4A 1Z66A 3L5WB 3VW3L 3U7AA 5E6ID 4RRPG 3CDGA 5DK2A 3W9EB 3G04B 2RCSL 3MLYL 5DJDB 3FB5B 1IC0A 3DXAA 4KDTA 3KVPA 4AYFB 1MRCH 1RURH 4L18A 5FYKE 1KTLB 4ZDHB 2YGVA 2XVLA 3H2WA 5F88B 3KVDD 1U8CA 1EBPA 1JNNH 4JFDB 3RWEB 3O45B 4XMLH 2P5EE 3ETTA 4QHUB 5AW8B 3NDZE 1MCPL 5KAQG 3LKQA 3G6JF 5FHBH 4PJGF 4RMRA 3TV3H 5EF2A 1QD0A 4U6HB 4EOWH 3O6FB 5JW5B 2RMNA 2CLZB 4U3XA 3B2UD 5D7JD 2ALWA 1DVFA 5IB2B 5MEOA 3FU7B 4DVRH 1CWVA 3EJZD 2GJZB 1JP5A 4M1GH 3FUJA 2D9QB 4QHPA 2BVOA 3KM1A 2GY7B 4HZLB 1WQVT 4BD4A 2E7LA 5MEND 1B6UA 3ZTNL 1XGQB 3KPTA 4WRLA 4KHTH 3LRGA 3NCYP 3VB9A 5I28A 4LLDA 3P4NB 3GI8H 3F62A 4RNRB 5C6WH 4U6TA 4GRWE 5CP7B 4JPIA 5DD5H 1J88A 3L4XA 3BZEA 4XNYL 2ZXQA 3MV7D 5GRVK 1UKSA 1U6AL 4LSUH 3ESUF 4QXWA 1CL7H 4GAYB 3BPNC 5CEYB 2FJSA 2R0KH 5EEYA 3RVVD 1KGCE 1MRFH 2CJTA 2XPYA 1G7JB 1NANH 2AQSA 2FLRT 5ID0B 1V05A 2CUHA 2QLYA 3UJTH 3O41A 4LU5H 2MJWA 4ATWA 3IMUA 3O2WH 1J8HA 5I6NA 4PM1A 1FZMA 1Q9LB 3QWRA 2PKDA 4MXVE 3LZOA 1GHFH 5K69A 2VDRL 3QJFA 1A1MB 1BQSA 1C5CL 5SX5K 2OV0A 1R46A 3F58L 2NY0C 3H0TA 4IU2A 1TVDA 1VFUA 1BQUA 3CFJA 4U1KA 4X99B 3VX1A 4UZUA 1RK0A 1SFHA 3VXOB 5I1HH 2AJUH 2YA0A 1IEAA 1WAAE 3IM1A 2AJ3A 3BPLB 1P84J 4JO1L 1AXIB 1DHKA 4PS8A 4PS3A 1MNUL 4HFUH 1D5XB 3GLDA 4FS0A 3WY3A 1LK2A 1U93B 3MNWB 1YYML 3C9NB 4RZKA 4OIFA 3SE4A 4NBYB 2VZSA 5ADPH 2WBJD 5KS9B 4BCZA 3B2DC 4H26B 3QQDB 1W2KT 3W0WA 4JHWL 2L8AA 2WO4A 3BEWA 3L2LA 5AW6B 5LHDA 5B4MC 1OCRB 4J4PD 4ZX4A 3T09A 4NWTH 3TYGH 5HHNA 1JZ8A 2Z4TA 1DBBL 1YN7B 2D31A 3S5YA 5IK3A 1XGRB 1N59A 3ZL4L 5E6RB 3D87B 4KO6A 1NGQL 4MS8D 2W07A 3HN3A 4YGVB 2NXYD 3U36B 2AJVL 2Q8BH 4QRBA 3RNKA 1ET5A 3ZT5A 5ES4B 3MV8A 2R23A 1QVOB 1ZLUK 1EVUA 1OAUH 1L9SA 5IESL 5BCAA 1QQDA 3VXQB 3FFCB 3ARFC 1XSKA 2DWDB 2VCOA 5I1LA 1PY4A 4K94H 1SBBA 4JE4B 2F5BH 1JIBA 4UNTA 2XKUA 5I8KL 5CJ5A 1BBJA 2L4OA 4AXWB 4X4KA 2Z1PA 2RQEA 1UUSA 5C0AA 4APQA 2XKNB 4AQAA 5DC4B 5CP7A 1JHLH 1NOAA 5ESQA 4ZAKD 3ZIMA 2Q7NA 5C07E 5DF0A 5ITFA 4XE5B 3ATBA 3LNDA 4P23D 1OGSA 1DBJL 1X3DA 1CICB 1KPUA 1XR8B 4HOXA 4I18B 3DX7A 3ZTCC 1UA6H 1XB3A 2VL5B 2I60H 4K5PA 1ASQA 3S35H 5EDSA 4JCMA 5IJKA 4NKMA 4ALAH 1JBJA 2BS71 4M5ZH 3TZVC 1JGVH 3E7JA 1OSZA 1CFVL 1JD7A 1G7HB 5M7QA 1WTGT 1ZLVK 2YD7A 5D1XD 1U8MA 1X5FA 3C8KA 1I3VA 2VDRB 1O9ZA 4NT6A 3BMWA 4GXFA 4JDVB 4L5FH 1BG9A 3LRLA 4JFDD 3GZKA 2V2TA 4MXVF 3WEAA 3RHWF 4Z7UE 2J6WA 3KYMB 2X4QB 3M7OA 3CHQA 4ZMVA 5HVGB 1ZLWH 3NFPA 1ZV2A 5E4OA 3OR7B 1RIVH 4LVEA 4RX4A 3ZDXF 4OQTA 2ZXAA 2VJ8A 2HTKC 1TG8A 4YFLI 5GZND 3TVMB 5DMKB 2H47C 2OMZB 4RGOL 1Q0YH 4GQ9L 4HU8A 4MJ4A 3TCXA 1BZDA 3X17A 2B4CL 3HKFA 5BXFA 2C5DC 4K7FA 2O26U 4QUOA 3U79A 3V6ZB 4NZDA 4CN6A 1E6OL 1G7MB 1IBGL 4Y1TA 2AABL 3D85D 1U8PB 2XWCA 1UZ8A 2TRYA 1RAMA 2A6DA 2WXNA 4EN2A 1YQ2A 2FWOB 3UAFA 5BMFL 3MJ9A 1N2RA 3O11B 1FNAA 1VFBA 3QXWA 4K9EH 1NCHA 4J3WA 1JHTB 2H41A 1M3JA 3B56A 4LKCB 5H35B 1J0JA 3B9EA 4KKPA 3DMMD 3TFBA 2GSGB 2WOYA 3D0VA 1SDAB 1UWFA 4FE9A 4TTDC 4UDTB 2OW7A 2GIYA 3EJPA 4ZPVA 2CLRA 1NCAH 4CVXB 2EABA 5LBVA 4ZD3H 4JJ5B 4YDZA 3WXWL 3DTDA 4NGHL 4AV0A 2P42B 4NO3B 1B0RA 1KSRA 3U46B 1B4TA 2UZIH 4NAJA 4DT2A 3U6XA 5DMIH 2P5WE 2P9RA 2WQXA 1ETZA 1G7QA 4NKIL 3T5WA 3OSVA 5FYJL 5FGSA 2MCAA 1MAKA 4OV5B 4M6ML 5EUOE 2Q7YA 4WF7A 2Q76A 3JV5A 3OGCB 4G70B 4Y2DD 3B2VL 3D08A 1I8UA 4MJ6B 1VGEH 1JGUH 3QIBD 4KKLC 2WXQA 1PZDA 4HJIA 1A22B 4BZ1L 5GZOA 1JPFA 2ZPKL 3Q06A 3A4DA 4LEXH 2WMPA 1KJMB 3UTSE 3O6LL 1I7UA 3CXHK 1DUYB 5FYKD 1INQB 4HLZH 2X2JA 1TZGH 3HCVB 4P49A 4ZFZB 2W80C 3II1A 4L29B 1G9HA 1SJHB 1FBIL 4KJQD 2D7TH 3CZFB 3QQ4B 3NZ8B 2V17L 1JDAA 1W8NA 2B8OT 3OR6A 1I3RB 3Q6FB 4JDEB 4UM8B 4W9LC 1XO8A 4WHYG 2FLBT 3IJHB 2WXRA 2ZCHL 1ZGLA 4KJWC 3UL4A 2FT7A 3WDJA 3EO1A 1RJLA 1J0KA 2XQYG 4XB8A 5EIIG 4JKMA 4L3EA 1JK9B 3QDJD 4EIGB 4NQEB 5TF0A 3WBDA 5KBLA 4BIKA 1UWGL 3KGTA 1BCIA 2O61B 1D9KB 3H2QA 2JKRM 3QUYB 4MAYB 4I9WD 4P46D 4C56B 2DTSA 4FULA 1A6TB 3UPRA 1BXVA 2OA9A 3BQVA 4HHGA 4BCYA 5KBDA 4DHLA 4F58L 3FTWA 3T3PE 4QMEA 4TLKA 5DWUH 2VGLM 4G5ZL 4HK3J 1CU4L 2WVSA 4PJEA 5C0BD 3ROOA 5I1EH 4R6UA 2BIQA 3AS3A 4ZPTB 3U0WL 3M45A 1NBZA 3M7FB 1R5WB 4WHTB 3NVQA 5T3ZL 4GSQA 1DJYA 2ZUQB 3AG2B 5CAYB 2V5RA 4OCSH 4CU6A 5AFAA 5ID1A 2JTYA 5IGXH 1ZLEA 2NTFA 3C6SB 4JUSA 3UIZA 3UMNA 3IJEB 4WW1B 2EXYC 2GTZA 4FQ1L 4DVBB 1YNLH 3A21A 3VRLE 5DYFA 5JW3H 3QEQE 3IMRA 2HKAA 3TBYB 1G6VK 2MHAA 5CZRA 3GM0A 3L7FA 2PWFA 2VLKD 1DSYA 3ES6A 4FFZL 5DRWB 2H5UA 1UD3A 2CZNA 4ETQB 5T1LA 1UZ6E 3CQQA 2GK2A 3AITA 1CXIA 1KCRL 4HKXB 5FA4B 3VYOA 3MJ9L 1A6UH 3FN0L 4Z3HA 4MTMA 4DUVA 2OL3L 3LHAA 5F1OB 1FYTE 2DYPB 2ESVE 1P6AB 1WISA 5AWNL 2YXFA 3ABMB 1G9NH 4JANB 2PR4L 4N0UA 1SN0A 2J6EH 1AD0A 2VE6A 4R0LA 3U82B 4N1EA 4I7ZC 3CCHA 3RVVC 2P47B 3NDYE 3FTUA 4O2FB 3MUZ1 3AABA 4JQIH 3CN2A 2BMKA 1A14L 5DD3L 3UERA 5GS0L 3H53A 1UASA 1MFDL 2DI8A 3VXSA 2XT1B 1HX0A 2FL5B 4M7JH 5I19H 3IKCB 2ICWB 1PBYA 1I7RA 3IXTA 4PWHA 1DANU 4AY0A 3RFZB 4Q0XH 1YMHB 5IFHL 1DVXA 3WTSA 1S7QB 4KK9C 1Q94A 5D2NE 2FECL 1YNKL 2BVTA 4KI1A 1JRHL 3NPSB 5KSAB 1GY1A 2FT8A 35C8L 1JZDC 3A0OA 3OV6A 4Q9QL 2P80D 5GS1C 2D0FA 4JRLA 4FN0A 1BZ8A 1M57B 4AIZA 4EDXB 5IFJA 3KPPB 3QIUD 4NZRH 4AEIH 4EBQL 1NEZA 2FZ3B 4WWKB 1MFEL 1UQSA 5E6IC 2DBLL 2C1PA 4Z7WA 1TU2B 3BXNA 3EFDL 3BVVA 1HJCA 2EC8A 1HZLA 3EO0A 1A7RL 1WAAA 3AC0A 2FO4A 2NYYD 4IIQA 1IJNA 3EFFB 1HYRC 5LGHL 1J0YA 3BDXA 2ZAHA 4FXKB 4JFVA 5C0IA 3A4FA 5F7KC 4LP4A 3QEUB 1RZQA 1NAMH 1OTSD 1MZYA 4P2OD 3S3BB 3EYSL 1PX3A 3J2PA 2GC4C 4S1DC 4H0GA 3QPXL 5EZOL 2YD3A 2D73A 4RFEA 4CMMA 4XPFH 2JNZA 5C0BA 1NCCL 3AJ7A 1E4XH 5HGHA 2W59A 1D5BA 1D6EB 4LK4A 1OK8A 2R1WB 1AACA 4AW7A 2K45A 1WZ1H 2DKUA 3MRNB 4K7PX 5D1XA 4XN2A 3OTTA 2EINB 3W0WD 2GITA 2EC9U 4E9TA 5DK0A 2BP8A 4WK0B 1RXLA 4WJ5A 5KVFL 4F80A 1XF5A 2IPKA 3D07A 4K5LA 1BM3L 4Z3EA 1C16B 3ML9A 2IPTL 3ISWA 4HEPA 3BX7C 3ZN6A 1NDGA 4RX4D 2O72A 5F7AA 1WC7B 5IOPB 1SYSB 4JRYA 1TR7A 4EUPA 4GO9A 3ARFA 5F93C 3CG8A 1UADC 1A1NB 3L81A 4M43H 5F8RC 3RDTA 5BUPA 1P84K 3PWNB 3RWCA 1FV1B 3ZU8A 3DGGB 3L4CA 4AKOA 1QRNE 4L3CB 4XPAL 4FNSA 2J4WH 4V1DA 1QFUL 5D7SL 3LV3A 4QRFA 4LCCC 3BZ5A 2R69H 3RA7H 4JB9L 4JO3H 4NQEE 4XO8A 3RZCC 4KKCD 1VZGA 4MHHI 3BIBX 3K6OA 3BVTA 3IPEA 4CILA 1GXEA 4BK5C 2HP4A 1GC1C 2ODHA 3QORC 3AZUA 1DBML 2O5NA 4PD4J 2H0PA 3QIBA 3VQMA 5CFHA 2BSTB 3GMQB 1J9QA 3WFEL 4D0DA 1BQHG 2QPSA 1A9BB 3OJDB 1M1XA 4I8DA 2WZPD 1JV2B 3DI3B 2YPKB 1UXSB 2WWNA 3E3QC 3I6KA 5J1AA 5TDPB 4UTAH 1OLZA 3D05A 4NDMA 5IB5B 1SJHA 1PD1A 1USQA 2BZ7A 5E5LA 1MH5A 1RP9A 1QZ1A 3QJSB 2XUWA 3BEVB 1DVFB 5PAZA 3QHTC 4FD0A 1OAXL 2BK8A 4NZFA 2OYPA 4MNQA 2ZKWA 1B9ZA 4JRWA 3V0GA 5IFAH 3FHAA 5E8OB 3ZKND 4FLRA 5DZJA 4QF1A 4XP4H 4LIQL 5CBEB 3WTUA 4YR6A 2EXWC 4EN3B 2CWRA 1ZY9A 3FQUB 5SWQA 5C97A 1FL5B 2DJUA 2Z0BA 2N7SA 3HUJE 2J55A 3DUUB 3LEYH 4OW6A 4Z5RA 4Q58C 6PAZA 4R7NA 3KPNA 4DCQB 1Q1JL 4KFMA 4RAUB 1WUNT 4GUPA 1E9PA 2VERN 1ZEAH 4XMVA 3KWVA 3UZVA 1GL4B 2P8MA 3VFVA 1KTDB 3OB8A 5FM5O 3D85A 4CDHA 1F1AA 1N19A 4GRLD 4AIXA 2UV3A 5A7EA 1AFVH 1R3LB 3KLHC 4HIEA 4YHPA 3FUFA 3AB0C 5HI4D 1RFDL 1RUQH 1YY8A 1F58H 2W1NA 3LSOB 5ETUB 5AB2A 5D2LB 1ZVHA 5FDWB 1JNJA 2O6CA 3A67H 3FYEB 5CLTA 3CFEB 1LQSR 5EBGA 5KYYA 3AM8C 5J6GB 4PJ9B 1H3VA 4J1UB 2VXTL 3ZGIA 2VRQA 5CZVL 5ACLA 3CUPB 2Z1KA 4W6YB 3TBBA 5E9AA 2NR6C 2SEBB 3THMH 2HN7A 3KWXA 3N1MC 4HCRH 4U1GC 4KTDL 5F6HI 3FQWA 1OE1A 1DFBL 1FV1A 2D7QA 3AREA 1DEEA 3FT3B 4G7RB 4G8GB 2O6FA 1N8ZA 3IMTA 4S1QH 5C0FB 3R1GL 1ED3B 1Q1PA 2VDKH 3BIAX 5KSUA 5DD0H 4PJAE 5FF6A 2R4RH 2ZSVB 3CFTA 1LE9B 1FG9C 2APFA 3CU7A 3M1BB 1VGKB 4X4XA 4IKNA 5IK3B 1O7DE 3C2AL 3GSOB 1OGTB 5DEGB 5K33A 3CVIL 4ICXA 1P4LA 3INUH 3TCTA 2DJ4A 1SYVA 3SY6A 2JLPA 5DJ0A 2ARWA 4JFTA 4JO8A 5EU4B 3HB3C 2AEPL 4DPCX 1W15A 4GQRA 3WIAA 2XXGA 1PAZA 2MNWA 4UUJB 5HDQL 4NZJA 1B9KA 5E2VH 3BSZA 4W93A 1WZMA 1QWNA 2EEDA 2KZBA 2ZKHH 5E4AA 5C07B 3ESPA 3SCMD 3TWYA 2EUWA 2RQ8A 5I16A 1Z5LA 2PTTB 1QSFD 2I9LA 3OXSB 1YEIL 4JW3A 3OKOB 1IBFA 2BWIA 3K2IA 1F45A 2HUEA 3MU3A 4N2LA 4PRHA 4JY5H 4RGNE 5DVLA 1JF1B 3JV0A 1WT5C 1GKEA 2NNCA 3LZLA 3VFTA 5DJ6B 2BNUA 4G1MB 2N7BA 3B1UA 3ILPB 4P5TC 4S1RH 1U3ZA 4A2MA 3FO0H 4HBCL 4NENA 2OR8A 3NSXA 1J5HA 1QHOA 2HH0L 2HT3D 3ETBJ 5C0ND 5MP6H 2UWEE 3O2VL 2PCXA 4NQXB 2IQAA 4ODXA 4X0KB 4JQVA 5B1JC 4XCEB 2RA1A 3OPUA 2QGDA 1K4CA 2IFFH 4QHMA 4W81A 3JT2A 2NY5H 3P4NA 1XX9C 3IJYA 5F7DB 2HFTA 2OR9H 1HCVA 1KIUA 1J8SA 2VC2H 1PG7X 5E7FA 3IPBA 3B3BA 4PJ9A 4GMTL 4FQXD 1E4HA 2BZCA 3QFJE 2Z7UA 5EOCH 2H2PD 3FT9A 4M6AA 4TUJB 1MJ7H 3OZLA 2H6UA 2XY2A 3QG7L 2NY2C 5KSBF 1IO4C 1ONQA 4NSKA 4NWUL 4U4IA 2QPEB 4PPTA 3UDWA 3I9IA 5CO1A 5E0FA 5GGTL 4F7TA 5F97E 1OAJA 1N8OE 3MTRA 4I3GA 3PL6C 1GYVA 3KYNB 4PLJC 2CO6A 1S4IA 1SMAA 3SN6N 1NMBL 2E7MA 4MAZA 5DZPA 1IAIH 1S9VB 1U3HC 3CC5B 3ZQXA 2COVD 2LAGB 3CHPA 3KPSD 4WKXA 3VGGA 4AH2A 2XFXB 3QWRD 3KLHD 1J1OL 4RQQA 3X3FH 1MG3C 3PDGA 1JGEA 3LS5L 3ZX1A 1VGKA 4I5BB 4ODTL 4S0TD 5LG6A 3WV0A 5J13B 2P5ED 3WXVH 4JDZB 2DQTL 2GUOA 5TQ2H 4K7PY 3V0FA 2IANB 2GAZB 4WLCA 1CFVH 3UTTD 3RU8H 4N2AA 32C2B 3BLPX 1TTCA 3CE1A 3FQ4A 4HIQA 4AWJC 3N41B 3VWJD 4M3KB 5DJAA 1QFWL 4M48L 3BVNA 2F8XC 4DGIH 3RWIB 2FWUA 2A6JA 4UQ3A 4F3FB 5D7HA 3O0RL 4JN2A 4Y19E 4LLVA 2GVYA 5BO0D 1KLFB 4PJFF 1T5XB 4J4PA 1CGYA 2HT3C 3Q2NA 3QEHA 5C0NC 1LMIA 4KVNH 2XVGA 3CX5J 2VUKA 5EZLA 4Z23A 1UWGH 3MQIA 4JHBA 4WKZB 5HYFA 4PHXA 4J3OD 1F4AA 3K46A 5D7IE 4PB0L 3SO5A 3LQZB 3HFML 3F05A 3LPPA 1ET7A 2H6OA 4GXVL 4PRPD 3FULA 4GG6F 4JGJA 2DWDA 4BH8A 1OSZB 1PLGH 3LY6A 4XVSL 3OXRA 3SCMC 2IPUK 2WQUA 3IGLA 5LQBL 4GS7C 1DVQA 2BZDA 5KVEE 4L3CA 2C7UA 3QZLA 2ZG2A 4P4KA 5J1TC 4M93B 3RVTD 4HUXA 1W6LA 2HRGA 3EJQA 5CINL 2LU5A 1TFHA 1BAFH 5DZAA 3FT0A 5L88L 1YAZA 2J2ZB 2Y3NA 4PGCB 3S48A 3DNKA 1A0QH 3SKNB 4AL8L 4Y5YA 3H9SE 1ZVYA 3RE0A 5BMFH 1U3HD 1CFBA 4R4FH 1O5DT 3O8XD 1TJMA 1U3JA 4TM9A 3UEZA 3H7LA 4RWYH 5LWYL 2CO6B 2A4ZA 5D9SB 3SDYL 1EEYA 1J5OL 4CRPA 4RGNC 2UZIL 4HKXA 5K39A 3TN0C 3UJJL 4ZX6A 4CJ0A 3D2UB 4YSOA 3DYOA 1NINA 4Z7UA 5IW6A 4FQ2L 4EI0A 1CLCA 1ZOXA 4OTXL 1N9PA 1XH3B 4J3VA 3L9RA 3ZE0E 4H8UA 3PQYB 3QDGE 4XOAA 2X1PA 2IDQA 4CGTA 3ARFD 2LAAA 4JREC 5DJCA 4BELD 1JD9A 1XIWD 3PUUA 3WFCL 5L4MA 2JB6B 1EWHA 4OUOA 1ITCA 4FFWD 2XXMB 2DIEA 4RBPH 1JZGA 2XICA 2YAOA 3GDBA 4Y19A 5C08E 1PD0A 2OTUA 1U4FA 2D7TL 3ARED 4QDGA 3HC3L 1DZ0A 3QAZB 4GSRA 3ZYJA 3G5VB 3DRTB 3R1GH 1WWCA 4MMXB 1B0RB 4BYHA 3AREB 4L4VE 3VMNA 5KSAD 3FF8A 5IT2L 4XMWA 3K71B 2YBRA 4XVTH 1I7TB 4LHUD 4PJIA 2DQEH 2YSTA 2ZNXA 3WXWH 3HC4L 2QQLH 3OX8B 1T1XB 2JTDA 2WP3O 1OGTA 4W9IC 3T04D 4BZ1A 3KPPA 1KV7A 3D2TA 3FHEA 4EAEA 2YOCA 5E24E 3TBSB 4YDJA 3QUYD 4BRJA 1L0PA 3QZMA 2AQQA 3DHJA 5FYJH 5IF0B 4M1GL 4UT9A 4ZQKB 2MQGA 4EDWH 1FJ1B 1KB5H 5KBMA 1EJOL 3TXAA 3VTAA 2YFOA 3VXME 5F6HJ 2FBJH 5FAAA 4HK0A 2DI9A 5IROC 1YEJH 3ULVF 3QJZA 4KOBA 3RURA 3HW7A 2MCPH 5DJ0B 1V7MH 2WWOA 3KGRA 5J12B 3GSNL 2LFGA 5FA3B 1UZGA 1QBLL 1XBRA 4FLHA 3AY4C 4PJBA 3CFJB 2ED9A 1FNEA 5D5MA 5HGHB 4N1HB 3RL1B 4TLUA 5TE7H 3U9UB 3GB7B 2Y5TB 5IQLA 4HMDA 4LDEB 5EEZA 1L3NA 3OL2A 3VCLB 1LE9A 1SEQL 4FNUA 5I74B 4YLCA 3P30H 5CNHA 3RAJL 4U7MA 3KYOA 3RYMA 1II4E 3D4YA 3RL2A 4GAGL 3D25B 5D6DC 2ICES 3V4PH 1MFVA 5ID0A 5HGAB 1H3XA 2Y06H 4FF9A 5GXBB 1HH9B 1QW8A 5ALCL 3ARPA 5L6YL 4E0RB 4OZGA 2F1EA 3VWKD 5C0CA 1KEGL 3IGUA 3QQ3B 4MMZA 4G71B 5CSZA 1C5DB 4ADIA 3BAEL 5CD3B 3G5XA 1RIVL 1QX1A 3ZMRA 1CBJA 4G8FA 1BVNP 2IO5A 5INCB 4FA7B 1BECA 1E42A 3ORJA 5D1QE 3CFIC 2BNRE 3GRWA 2WM0A 1NICA 4KXCA 1EGJA 2PXYA 3ZDYE 5CIPA 3DX8A 4R26H 1MIMH 2WJ7A 1XD0A 1E6OH 4PJHB 3WL9B 1UM5H 4OAWA 5DTFA 5JO5A 1FFOA 4I13B 1G9MH 4P3CL 1RZ7H 2EDKA 3F12A 4JFXA 1ZS2A 3OAZK 1JWMB 1TQVA 3ERXA 5EU3A 1J9TA 1FLRH 5C0AB 4IGBD 5DFTA 2VUYA 3MRJB 4XX1G 3V5HB 43CAB 4JJHA 5I30L 2E3VA 3QHZL 1ES0B 5E2JA 3DX6B 1CTOA 4XZUB 3JT0A 1JVOA 3QDHA 5H4YA 1U91B 2J56A 4IOSD 2HPTA 3T3MF 3QUMH 5JYMA 2A7BA 5F88A 1ZHKB 5E8NA 4I18A 4F37F 3NIFE 4HS6B 1E8YA 1E5AA 3HNVL 1KCWA 3T6XA 2NYZA 4TQHA 3WFEH 4UIMB 1XD1A 4HKBA 4N2KA 1IEBB 3DSFH 2MOQA 4GUQA 5T3XD 1SXSA 1N3NA 1PLBA 2A1WH 5AVUB 3DV4A 2F74A 1YEHH 5ALBH 3A22A 3KAAA 3LXBA 3CBKB 1BVNT 4H0HB 1WCBB 2ZCKH 1AR2A 3M17A 5AW5B 5EOCJ 5CM1A 4AENA 8PAZA 5DLMH 3OMAB 3HG1B 4FFVD 2RALA 4PCTA 1VGEL 1G9MC 3QULA 4BZ1H 3ZJAA 1EXUA 1AY1L 4AYID 4F2MA 2Y69B 1IQDA 3HUJA 5B22A 3VAEA 4KFZC 3NA9H 3P77A 1CI5A 5IMOA 1AE6L 4AQEB 3HI1B 4AYGA 3L3GA 4LEBA 1FGVH 1G6RA 4XR8C 4ODUB 5E2WL 4WDIB 4ZNEE 2C3WA 1WFMA 5IUSA 3VXSE 3GT6A 4PRID 4A6YB 5DD6B 2XNAB 2BC4B 5T1DH 5HGDB 1MEXL 3KYKL 4P3DB 1HCYA 4XWOD 1OAKL 4LB8A 4CC4C 2IADA 4PJFB 5D93C 5TK4A 3SOTA 4FMKA 5E00A 2WAHA 2LQRA 3V4LA 4BKSC 4GBXD 1AMXA 1PZ2A 3P11H 5EFIB 1AFVL 2EYSB 1ZT4B 3KBPA 2W95A 2YGOA 3QA3B 5AAMC 1JYXA 3NPSC 2CJSA 1PZ5A 1AIFA 4PS4H 1J9SA 2JELH 3FCGA 1JGDB 3B6SB 1E27A 1UJTA 3VXOA 4B9KC 3RBSA 3NG5A 2YQGA 1RV6X 4B9CA 1JNNL 4QHLB 3BGMB 5I18L 1MQKH 4JPIB 4F7MA 1QR1B 3PQYE 3VXRB 4YSAA 3QEQD 2AABH 2ZCLL 1WO2A 3EYSH 3FONA 3ECQA 1G7LA 1OAQH 3IRZA 1IQWH 1OW0C 4PW3A 1DCLA 1RULH 3ARZA 3AGWA 1QFUH 2HCZX 3VDCA 1IGML 3QQDA 4S2SA 4H4NA 1A6VH 4JB9H 4AGQA 4O51A 4XODA 2IEPA 5F96L 5I15L 4PYGA 2GHZA 1MWOA 5MEQA 1ROWA 3UIYA 2VISB 2Y7MA 2VLJA 3PABA 4X4YA 5ICZA 2Z8RA 3CH8A 2AV1A 4FQCH 3U0TA 2XIDA 4HKBB 4RFEB 2J8UB 3SDDD 3QZOA 1JHKL 4Y5YB 4LLMB 1M1SA 3FRPA 2VZOA 4XE0A 4UQ2A 1ZJAA 1WZKA 3ZHNA 1IIKA 3B7YA 3F3HA 1OP5K 1AR1B 3BCDA 5F7HA 2XPGB 1HNGA 3QEQA 1TQSA 2BINA 3QO0B 4MS6A 2EE0A 2MEJB 1WITA 25C8H 2NY0D 5IEHA 1BVOA 4JPWL 4LCUA 5AKVA 2YQ3A 4C58B 1QSFB 4PWKA 3VFUB 3EGXA 4HH8A 4J8QA 4JL1A 3HZKA 4ZTPH 1CICA 2ODIA 1J10A 5F72S 2P28B 3W82A 4M93C 4UILH 4X6DB 3LN5B 1EHAA 5FCUL 2QGCA 4GT0A 4HS3B 2MCPL 1FL6A 1NCNA 5D5MF 4BGDA 2EIZA 4JRYD 1A66A 4P9MH 5I1AA 2DWSA 4NI3A 3ZZLA 1F4WL 2X4SB 3X2QB 3HS9A 3WIHH 3S8WA 5I1LB 1RJYA 5FGCB 4EQ3A 5B39B 5B7MA 1S6NA 3VXUE 3MJ9H 3QORD 4X7EC 3W39A 4HD5A 1SXNA 1BZ7A 3T0EE 4JFWA 2FK9A 3PIQB 4HF5L 5E1IA 5I0YA 3V0HA 3OD3A 4N1CA 5AWNH 3P3UA 5LWYH 3GXMA 3MBEC 2BSED 2XV0A 4HFUL 3D25A 3O0LA 4YDLB 3ZW3A 1BFSA 2DOCA 1X6LA 2FAUA 1NEUA 2B3RA 4GI8A 4XAKD 4HJGA 3EBAA 2DW5A 5HD8C 3ZUNC 5EV7A 5CGYC 1KXTB 4Y4KA 1T7WA 2AQTA 4MZRA 3QB7C 3THML 1TOXA 1P9MC 3QUYC 3QEGL 4JFED 4AI7A 1T2XA 3QIWC 1S3KH 1YDPB 3UC0H 3V52L 1KXQA 1NGZB 4BSJA 3AWEA 3FPYA 5G4MA 1HT6A 4FP8H 3TIDA 2NX5D 3B9KD 4KRPD 2OSLB 3AMKA 3SDAD 5CJOL 1VA9A 4K7PH 2XN9A 3H1ZA 1VEMA 3TL5A 2DQIL 4XPGH 1OP5H 3RWHB 4TLSA 2ROYA 2W81C 5FXCH 2G5BB 4K3GA 4WV1C 1ET8A 4Y4HA 1SY6A 2QVFB 4QJ5B 2GBVA 3ZKXB 2VXTH 2WSDA 4AVIA 3V2AR 5DFVC 3FU0A 1THCA 1WIUA 4Y16D 4Z0BL 4CVUA 2RH0A 2YEZA 4KJPD 2K1MA 4P2RB 1NGXA 4S2SB 4KJQC 3WIFA 4U1HB 1AOZA 4UTBL 4FQXA 4DETA 3N40F 2QZ5A 2GJ6B 4W6XB 1AO7E 2Y6SC 2ICEB 1GYCA 4FFYH 5H2BA 1KYDA 3VVVA 2BWDA 3FB7A 4NP9A 1HE7A 1UQSB 3NAAL 2GJ6D 2VMJA 4JO5A 1NGPH 2HRPH 4N9OB 1OK0A 1RHHB 4L48A 5I8CB 1IEBA 4RESB 3L2MA 4FTDA 2EE2A 4H2AA 2GBAA 3GPEA 5DFWH 4R3SB 1UOKA 4HZLA 5AW3B 4JY5L 4EZMA 4POZD 3SYQA 3BAJA 1UVQB 5C0RH 4TF4A 3ZQWA 2P26A 3GLAA 12E8H 4AKPA 4YXLL 1GGYA 4ILDA 4NUJA 3KPRE 3S4SB 3H9SD 5IW1B 3U1QA 4E36A 2IH1B 4L8CA 2ID5A 3ZE2F 4FKEA 3VW3H 1BM3H 1L5GA 4X7TA 3V4PB 4IBTA 1D5BB 3B83A 5GRUL 5I1KL 2MPVA 5KWYC 4J39A 1R24B 3QJVB 3VYPA 4U6YB 3Q0HA 4K3DH 3QS2A 4MDJA 3RP1A 1IFGA 4NQVB 3WUWA 3B9DA 3MUGB 3DBXB 3HE6A 4Y4FB 5KSVB 1ILSA 1SY6H 1T0NA 4I0PA 4H8WH 3D2UD 3QDMD 5EIVA 2M83A 4G8GE 3GSUA 2AJZB 5EMYA 4L4TD 2RTTA 4JM0A 4CBZA 4ZUTB 2HFGH 1CLOH 1I9IH 3LAFA 4QYOA 3VE0B 3LS5H 1E67A 2BOBB 1T2QL 4XP1L 2P43B 3MXVL 3V5DA 1T7YA 3HHMA 2C3VB 2WWMC 1H8OA 4KKRA 1SJEB 2P5EB 2GYSA 2UX7A 2ZTBA 2DLIA 3MJ8A 3LH2H 2HTLC 4NM4L 1XR9B 4XVJH 4R97B 4FA8A 2H6PB 5IVNA 5AG9A 4WI0A 1L6XA 3IDYC 5J9PB 5JXED 1WZLA 3ECWA 3IGFA 4PV9B 1YRKA 1MCQA 2C9SA 3P9LA 4HU2A 5D4JA 3KNBA 1FG2B 5F21B 3SZ6A 3RVWC 1NUGA 2IWFA 1YNTA 2G2NA 4JFPA 4NKIH 5KOVC 3MCYA 4KMTH 4OZHA 2KHAA 3LRHA 4KKAD 2EKJA 4KTYA 2F8IA 3RU8L 1R75A 3B5TA 4O4YL 4ZPTA 4I0PD 3GRBA 5IHWA 3L45A 4HGKC 3NP4A 1DQJB 3NCXA 1XMWA 4G6KL 3ARDA 2FIKB 4Y7MA 2NSQA 3W11C 1E3XA 4YDKH 2BMKB 4MSWA 3UAEA 3DHUA 1GCYA 4HWBA 2DL9A 4A2LA 2GSMB 1KTCA 3LZNA 1LK3L 3SQRA 4Y8AA 4P5TA 4ZQKA 2NY1B 3HFFA 1WT5A 3H8NA 5TDNA 3L5WA 4EO5A 1QRKA 3X14A 5KVGE 2XBZA 1EHXA 4KO5A 2DD8L 1CD9B 2DYRB 2FX8H 3IS0X 5FOBA 4MXQD 5C8JA 4F8NA 4XWOC 4Z7WE 3QNZA 4NUJB 2R9HC 4OF6A 4L8CB 1SGKA 3ULUC 3GKZA 4PJBB 5FA4A 3QUKB 4URTB 5A2JH 1MXDA 2ZQKA 4IRZL 4FKHA 1S7WB 3L3KA 1KJ2H 1KV3A 1SEBA 4KMLB 4D9LH 3WY1A 5CEZH 1J8RA 1LEGB 4F57H 1AKJD 4AV5A 2WINB 4MJ5B 5DYOA 5LCVA 4FXGA 3T3MB 3T0BA 4XBEL 2R2EB 4X2UA 5KSVA 3ROLA 2JJUA 1U8HA 1M1XB 4PJCE 4M7KH 1U8NA 2ERJB 3ZL4H 4AMXA 3TO4D 3N50A 2VDOH 1BF8A 2C9XA 2MPAL 4U7SA 3RGBA 3UJJH 3VWKB 5LLIC 4UBDC 2J3SA 5GS1B 3SDCB 1J5IA 2YD6A 3DV6A 3HC0A 3ZHKA 3R06A 3LKSA 4Y16C 2Z4QA 2VDPB 3NTCL 3GK8L 2D2CC 4K4KA 3FTZA 4KNQA 4NN5B 1D5XA 2CMRH 3D18B 1G1KA 5JR1L 3H9YA 2JLLA 4CSPA 1IEAB 2ZUTA 4Y9FA 5CILL 4ERSL 1B6DA 2PW1B 4H13C 4EEEA 2KL6A 3ZE1F 4PJBE 4EI6B 4GSUA 5IEKB 4J8RB 4EZKA 4XVUC 3EYVB 1XF4B 5IFJB 4XWGL 5BRZD 4DFIA 3ILDA 1HNFA 3C8HA 5HBBA 1DSFL 3QUGA 3ARGB 8CGTA 4JQIL 4IOIA 3GMNB 5HHOD 3VI4A 4A2EA 1RUPL 2CCLA 4UQIM 3NSCA 4OV5A 1IRAY 2V4LA 3QIWD 3BW9A 4JFHD 5HJDA 1C16A 2FWOA 3OR6B 4JDEA 1NKOA 3D12B 4YSTA 1JGVL 4Z7AA 3UAJD 1GTFA 2AEPH 5F1IA 4XB7A 2QSCH 4LNRA 1CURA 1DQJA 4GG6B 3FU8A 3T4YA 2JCCF 3L5XH 3KWWA 4J6IA 4RGMB 1I7UB 1Q4NX 1I3GL 2YGQA 4U1KB 1OB1A 2X4RB 4M61A 5MERB 1AGEA 3TU6A 3VI3A 2APVA 5K9JL 4FI7A 1FH2A 4ZW7A 1NEPA 2KLRA 3C2SA 4G42B 1ZE3C 5FB8B 5C0BB 4PJHE 3S0PA 2XWZA 2VR3A 3E0GA 2XRAH 1Z9LA 4G7QB 5DR5H 3CSYA 5F1NB 1VJSA 1UWXH 3GLZA 3L08A 3MOBL 2WUCH 3QZPA 4LL4A 4GPVA 3RFRA 4X4MA 3CSBA 3HEIB 1GTNA 4PQXA 1NM9A 2GKIA 3VM7A 4U1HA 4DW2H 3WTXA 3M46A 5ILTH 4H8VA 3MLZL 1HHHB 1IAOB 5ABAA 1R5VB 3OC5A 4OZIE 1S78C 4Z7NB 4BH7A 3MRMA 1XCWA 3Q6GL 4YK4B 4YXKH 2BY0A 1OP3K 1NKGA 2ALAA 1MJUH 3BAXA 3DX9A 1MFCH 1MXGA 4FTVE 4GAAA 3E38A 4HIJB 4M62L 3VG9B 4KNSA 4DVBA 1B4LA 4PJ5B 1YHPA 4N6RB 1ZDQA 4KZDL 3F85A 4GIAA 3RTQC 2WANA 1H15B 5F7MC 2PCFA 3MMEB 4MB5A 4FTVD 3C6LA 4OLVL 2JXMA 3N9GL 3MV8E 3P02A 4JFOA 4PMEA 4NUPA 4BWWA 1YPZB 4P5TB 4C4BA 4ZFOL 2EO9A 4GBXB 5LAXA 5IMMB 1MCNA 4G7VL 2B14A 1CMOA 5ESQB 3E6FB 2PPEA 4CNIA 1AGCB 1UA7A 2CO7B 5TF1L 1AQMA 4KVCL 5E03A 1ZSDB 3S37H 2IH1A 3B5HA 2H1PH 3KXFA 3EFOA 4DERA 3KZ8A 4FC3E 4AYMC 1U21A 4RFOL 4A7GF 4TPRH 3NSFA 3O45A 5CKGA 3T0DA 4WIQA 2WIIB 1MCJA 3CX5K 2R0WH 2JCCB 1XR8A 3MLPA 1ZJBA 4WFHD 4DAGL 5TE4L 1ILUA 4MNGB 5LBSH 3ZDYF 5TE7L 3SE8L 3QR2A 5T5FL 1S9YB 4TVUA 4X9FA 3JYBA 4MDJB 4UOJA 3EHBD 3IN0A 5I17B 2ZPKH 2FBOJ 3SKJL 3IDMA 4N5UA 3WO4C 1OGAD 1T2QH 4GKOA 3SPCA 4OZHE 3ZIYA 1QFWH 3BZFA 4M48H 4AGMA 5CZKA 2I85A 4QTHA 4M61B 3V5KB 1FNEB 1PG7L 1ACXA 1LNUB 3UTQA 4JFHE 2E74C 4YSSA 1PG7W 1L9RA 1U95A 5F89B 1AO7B 3F6LA 3NIDE 5IBLC 1P53A 2UY7B 5DD1H 1M2VA 4XXCC 4MDIB 3C8DA 1NIBA 2O5YH 4HDIA 2AFNA 3GSXB 4QHKI 4UQ2B 1A7QL 3EJTA 3K4ZA 2XHNA 4G11A 2J5LC 1JK8A 3NCFB 2F53A 3EYVA 4O4YH 4NQVA 3WUWB 4XNXL 3IPFA 5EEXA 4JG0H 1J87A 1C7TA 3ARGA 1D5MB 1YUHA 2R27A 3RJOA 3UXFA 2QSQA 1Q9LA 3HZKB 1E9QB 2B1AL 5A2FA 1AGFA 5HHQB 3T2QA 3NOIA 5JMRA 5E5MB 5B7FA 3GMRA 2QR0B 3ASWA 4LRNH 1T22B 5DA0B 4IKJA 4JY6B 3WAKA 5E9DB 1ZV9A 1VRSA 5IQOA 1NDTA 5F1IB 2PWHA 5D7EA 1U8JA 2O61A 4XCYA 3TV8A 2BXYA 3TJEH 2XLLA 1SUJA 3I9GL 1MW3A 4U1IA 4LPXA 1MHEA 4AYSA 3CQPA 2ZUYA 1J9RA 4W9KC 4W9ZA 3FRPB 3BP5B 1MRFL 3SGKC 1B4JL 1RMFL 2I27N 2UZYA 3VXMD 4LP8A 2Z7WA 1R3IL 5IB4A 2KPNA 5AW4B 4KK8C 3INOA 3C6LC 1E28A 3DO4A 4FLOA 5FV2A 3UX9B 3IYLW 3G6DL 2F1AA 3L3KB 1BFOA 1IGTB 4XPHH 4I88A 3NPZB 1WS8A 2R1WA 1LEKA 2IDCA 2ZCKL 1S7WA 4F9LC 2BNUB 4G1MA 1SXBA 1EAPB 1EV2E 2EIBA 1KB5L 4DJMA 1BYNA 1I9JL 4ES8A 2AERT 4PGZA 3F7PC 3HVNA 4A6YA 3ZT7A 3IDMB 2YARA 4AJWA 3ZKMC 1LO0L 3MACL 5K9OA 5DQDH 4TUOB 4KKBD 2R1XB 5KYUA 1RZ8A 4GRLC 5EOTB 3MRBA 2R7EB 4ZOCA 1JGDA 2X2IA 3B6SA 3NJLA 3O6ML 3VXMA 3UFIA 4ZW6A 3QULB 4CADA 2F58L 2X2YA 4ZXBA 1DE4A 2P46B 3D51A 1U2HA 4OLEA 4QRSA 1XF3A 3TIDB 3RAJH 4Q89A 3SDAA 4PJ5D 5BV7L 3EJSA 5E8DH 5IFHH 2BNQE 1FCGA 3HC4H 5C6PB 3F04A 1Q90A 5CJQH 5LGJB 4Z7OE 3LRSA 3WNIA 3NIGF 4Q9QH 1IAMA 1O6SB 2GPZA 3MRIA 2HWZL 1N7MH 4IRJC 3K72B 1E2VA 1TJHH 4EVNB 1YEKH 5D7LE 4HUVB 4ZJ9A 4N6QA 4HYTB 1WSST 4KK6D 2OL3A 1F4YL 4AYFA 4P4KD 4B9IA 3BKCH 1JUFB 1S7SA 3QAZC 3ME0B 1RJZB 2P5WA 4G3YL 5KG9A 4HALA 4PJEE 2CHNA 1X9QA 4WTZA 1ZA6A 1HWGB 5I6LA 3ULVE 1NCIA 2XG4B 2PTUA 3WYRA 1A3QA 3IAGC 4LP5A 5C0EB 4KDWA 4KTEL 5JOFA 1T6WA 3OC8A 3I6LE 1NCTA 4YQXH 5E1AB 2FHBA 4UAOC 32C2A 4EOWL 2OMYA 2VABB 2WVTA 2C9RA 1JV5A 2GAZA 3FMGH 4PY7B 3MCKB 1KIPA 4HPOL 4I48B 5FW7A 4JM2A 1G7LB 2CCVA 5F44A 2IDSA 4ADGA 4F15C 1HOCB 4JKLA 4PG2C 5LGKA 1SLWA 5D7IA 4DW2L 4JQVC 4LMQI 2YKLL 4OQTH 3PXLA 1KJ2B 2R0KL 1WA0X 2LU7A 1KXVC 2DYPA 4Y1SA 4OQ1A 1QSFA 4QXTB 4LHJB 4ZFOA 2H8PB 3EUDA 4HWZA 4FI8A 3ALWA 3V4UL 4AH2B 5IW1A 5DHYB 3NZHH 1WD9A 4APQD 4PU2A 3V9CA 4BH7B 5GHWH 4L8SA 4G8IB 3TT1L 3DWTA 1EEZA 1U58A 1L6PA 1P7HL 4Y88A 4RAUA 1QFPA 2VDOB 3BZ4A 2Y7OA 3GS7A 3BFQG 3JV4B 1L4IA 5T1KA 1AHKA 4LLWA 5DRNA 3BDYH 2BNRD 3F6JA 5G2NA 4NQDE 4WNJA 4HBCH 2LLNA 5ANMB 2L0DA 1FJ1A 3ILEA 4YHMH 3MRBB 5K9OB 4OF0A 1Q72L 4DO6A 3QUXC 2JXMB 1CT8B 4BQ6A 1KJ3H 4W4OA 2R1XA 2EZ0D 5KYUB 1JZ2A 1AY1H 4A7UA 4YNYA 1OGAE 4L8BB 5C2UB 4WTXA 3CMOH 1PQZA 1ZAGA 1N10A 4FYTA 4JR9L 4XNMA 3RJQB 4YVUA 1HHHA 1OF0A 2APBA 1UM4L 1BFOB 4PGDA 4OU3A 4JM2F 4YAQB 3QYMA 3WMSA 3OZ9L 1NBYB 1ZIAA 3ZE1E 3ZRCC 2NYYC 4A55A 5J11C 2YQBA 3MBXH 2DQTH 4N90E 1M7DB 3H85A 2AP2A 3TOPA 5JYLA 1S7UA 2AW2A 4UANA 3L7EA 3MGOB 4PRNA 4EI5A 4PREA 2OZ4H 1WG3A 3GMLB 2K7PA 1O6TA 2JKLA 4JGMA 3HTLX 2NY7H 2BXZA 5DJ2A 2IPKB 1E4WL 4OB5L 3M8OH 5EA0H 3LEVH 1UJ3B 4LAJH 2EQDA 2KI6A 2P7TA 3BQUA 5EORH 4DOHE 2N7AA 3I3DA 5IV2A 4YHLL 4GKLA 2X12A 3GPSA 5E6UB 2X9WA 3RWCB 1LYQA 4JFYA 4W1TA 3B2VH 3JYCA 4GKSB 3ZMEA 4DFHA 2AJ3B 1X7QA 2Q9OA 1WWBX 4JFFD 1I31A 3VXRD 3ZTEA 5J6HA 3RI5F 5SWZE 3MKGA 1AP2B 2DWEA 4H25A 4IKLA 1Z0MA 2YPLA 5FHAL 3MO1A 2A38A 4KXAA 1CBVL 1OIOA 4I0PC 2YN5A 4K71C 3SPVA 1T0OA 2JCWA 4HAFA 1XF5B 4LHQB 1RZKC 4HCRA 1T1XA 4Z0XB 1ODAA 2AJSL 1KZQA 5EOQH 2R2BA 3N04A 5AW1B 4FI6A 4WFEE 4DKEL 1ASOA 4DOHB 4G7YH 4WZ9A 1CFSA 3CFKB 1ANUA 1UOLA 4AK1A 4FQXB 1F1GA 2C3GA 2VLJD 1MCFA 2L3BA 1GJUA 1PPIA 4M03A 1KCVH 3C5ZB 4TSCH 4ZNEA 4O2EA 5JW4R 5AVWB 3BD4A 3BPOB 1ZHLA 4K07A 1AYRA 4ZOEA 5HI4C 4PJXF 3HLKA 4CU8A 2YHGA 1FAIH 3WTYA 1QBMH 1L7TL 4DP8X 4PJAF 3GS0A 3SQBB 4GP4B 3KPSB 4RFOH 4Y5VB 4YO0B 3GUFA 1JZIA 2JKJA 2OW6A 3CLEH 1G84A 1OALA 1XL6A 1TYEB 2P80A 5KW9H 3RIAF 2OYMA 2NY4D 2DDQH 2P52A 3L3DA 3TWCL 3ZDZE 4ANVA 2CXGA 1I7ZB 5JIPA 5JHDD 3IDUA 2OMZA 1KTDA 1VPOL 2JH2A 4NM4H 4A7TA 3MACH 5D96B 4CU7A 4MASA 1CCZA 4XB3A 5AB0A 1BD2D 1Z32X 4B7LA 5DVOA 4QRRB 1R0AL 1CVRA 1MREH 4ONGL 4XP1H 3TYFA 3S97C 2WXIA 1B3JA 4ODWA 1H6TA 3PXHA 3GEWB 2YEVB 2L7QA 1MHCA 3QXAB 3V0AC 2YAHA 1HFUA 1E9OB 2BX5A 2IG2L 1QTPA 4QF1B 4FQ2H 1NWPA 4YR6B 1NMAL 3QI9C 5E1QA 1NIDA 3II3A 4YDKL 1XZ0A 4QT5B 1MQKL 1M9SA 4MMYA 3DSNA 4LOUC 2O6PA 2WYIA 4NC1C 1OQXA 5DVKA 3VFSA 1KFAL 1UENA 1WGOA 4Y5XC 3MJ7B 1ZIBA 2OZNA 3V9FA 4H8PA 1EJ6A 1CPUA 5TFSH 2YD1A 2EVIA 2ENQA 2W9LA 1CLOL 1I9IL 3LPGA 4Z7OF 4N20A 2F53D 5C7XL 1ONQB 4NSKB 1ODUA 2DD8H 1HH9A 3G5ZB 2GW5A 3DBXA 3HE6B 3HC2A 3LXUX 5ENWB 1PSKL 4LSRH 2VSKB 5E5UB 2WVVA 4HUUA 1F90H 2EDEA 3QXTA 4WI2A 1T1YB 4G8EA 3TASA 1UT1A 3Q9PA 5B1BB 3ZR6A 5KYNA 2GABA 4OZIA 2WXHA 2J5LB 3WS6A 2VXQH 3QFJA 4PRBB 1EMTL 3L4UA 5M94B 1ACYL 1NDMA 2IANE 2DICA 4A1RA 2MKLC 3CAFA 5HYJE 1J11A 4O9HL 4XHJC 5E8EA 2QBWA 3EIFA 3DVNB 2BO0A 5EBWB 2R2HA 5F9WB 4LASH 1Z9SA 1TVBB 1CFTA 3U48A 2G3NA 2CUMA 4X8JA 4XBEH 3UAJA 5CBAB 2YC1A 1KEGH 1RZJL 3ETBF 3FTVA 1LTXA 4I89A 3NABH 4OLWH 3L3GB 1JFQL 5I1EL 1N64L 2AMGA 3GWJA 3LNHA 2CR0A 1E6JH 4JFFB 4TOYH 2VWEC 5JPMA 4ZK8A 1GIGH 3GMPB 4KKNA 4YHML 1S5HB 1L9TA 1J0IA 1WTLA 1KGIA 4FLSA 4LLAA 2DL2A 2A74A 4JS7A 3TH2T 4IBWA 3UADA 3ILPA 3IU3B 4DAGH 3UTZA 3U6RB 4NAQA 1Z9NA 4LT7A 5GS1A 4GO6B 4H88H 2FB4L 5SWZD 1GGTA 1NBCA 4HJ0D 4XI5C 2DLFL 4DTGH 3NZSA 4Z7IA 2P1YA 2WYZA 3DV4B 3IWUA 1RJLB 5D4QA 3PXJA 1BMZA 2KPWA 2Y2YA 4W9JC 3X12B 4ZZFA 5FO8A 2Q8BL 2AJVH 2EIKB 3RVUD 1T4KA 2HSIA 2LV4A 4HWEL 5D1ZD 5C07A 4EUPH 4C59B 3L5XL 1WFIA 4LNVA 5GRUH 3T65A 3TA3C 5E4EC 2V8MA 3OKMA 2VXQA 1E27B 3EXLA 2XXCB 4PVMA 2JKTM 4Q4IA 2HWZH 4Z76B 2VN3A 1WEJH 4MJ5A 3WFDL 3S5LB 4PJCA 1EEZB 5J7CC 1KWGA 4IMLA 4XNMB 1X5MA 4FNQA 1X5JA 2WMPB 1BQLH 3IDXL 5AZEH 4GP5B 4BUQA 3O4LE 1G5GA 2Z8VC 4RA3A 4JK0D 1LGVA 1CO1A 2E59A 4FHKA 1XGPB 1T03H 1T21A 3FSOA 2VITA 5I17A 4HOZA 3JWNG 3V52H 3WHE1 4Q9CA 4ZSOE 1UH4A 1AQKL 4OKVA 3GXIA 5SX4I 1ECZA 3EZJB 4J27A 4WWNA 4BFGA 4UZGA 2I60L 1AJ7H 1M7XA 3NH7H 4KRPB 3O8XA 5EUKA 4FHBD 4IQHA 2FJFA 2EXYD 2DQFA 2CDFA 2DLGA 4M5ZL 3MOBH 3O6FA 4PV8A 5LXVA 2QKIC 2LFEA 1IB5A 5EUOA 2LTQB 4UU9A 1BPLB 2V5MA 4XNAA 3BRDA 3T71A 5CGMA 2FL5A 3LN9A 1AG6A 4ZMNA 3B5GA 5EBMA 2CDEB 4ZX5A 1E9PB 3UZVB 1CGXA 1XXDC 3K1DA 4NO5B 1DJZA 2DQ6A 4KQ3L 5H8DA 1I3GH 1DN0B 4ODVH 5HGAA 3TPUA 3X1GA 2QQKL 4JFEA 2ZXEB 4WUKH 3ASOB 1VFBB 4LLYB 2CKBL 5JA9A 4ZX3A 1TF4A 1DBAH 4B6ZA 3ULUF 2YMTA 1P0SE 4QAMB 5B1AB 1OSEA 1J5OH 5DUMH 1NGWA 5EZLB 3KLAB 2KUTA 3VFUA 3C75A 1BMWA 2DIJA 3OKLA 1UUNA 4W9HC 3MRMB 2VDLH 1Y18A 5MEQB 1OB1B 2AJUL 2PF6A 2ORBL 2FHFA 4H5SA 4M6NH 3KPMA 3TBYA 3UG5A 3S3PA 5HVWA 1MH5B 4G5AA 3KPOA 3MLZH 2NQDA 2R7EA 3WN6A 3NIFF 5FW8A 2BIPA 4CNIB 4JFXB 4LE8A 5ADPL 1RZ8B 2GSIB 1YMMA 2CRYA 3MV9B 5D4IA 1QPPA 1S9XB 3TWCH 5GZOD 5H94B 1A6VL 4HETA 3HG0A 4ORZC 2H7WA 3BCFA 3BAYA 2N0MA 3MJWA 3IDJA 3MRKB 4QKXB 5FGRA 5HD8D 3SE3C 3CVHL 1NQBA 2Z92B 3PWPA 4FXTA 1NBVL 1T1WB 4GYBA 4NNYB 4NPYB 2NTSP 4DN3H 1IEHA 1Q0EA 1OW0A 4DH2A 2Z93A 1BXAA 4P5MB 2Q6WB 1HEZB 2IJ0C 3TF4A 4WFFE 1U2CA 1SYVB 4M02A 3CXFA 3IDYB 1P7KA 3K80A 3MPCA 4XMPL 1EAOA 5JMOC 1DFBH 1QNZL 3ZE0F 1FHNA 2IVFC 1N5YH 2VITB 2G2PA 5FWQA 3EO1B 2XN9E 2PWDA 4PJ5E 1EJOH 4ZFFA 1XH3A 2DQJL 4KAQL 3KCPA 4OJDH 3A6CL 4S10A 1H8LA 4JRYE 1I82A 4HG4J 4R9HA 5CCGE 3H2PA 3WEXB 2Z8WC 3PWJB 5CMAB 4QLRA 5L0QB 2G75A 2WBXA 1CGSL 4P3WA 5G4OA 4O58L 3WS6C 1XZWA 5L9DL 4KI5D 3Q2LA 1ZXKA 1WRFA 5E2UL 5HHOB 5F7WC 3GI8L 1R3IH 5HHQA 2CK2A 4P3DA 4PRDA 1M56B 1SUHA 2CLVA 5DLLA 1N59B 1ZHNB 4JO3L 1MHHA 4NQED 3H55A 3QCUL 5D2LF 3L5IA 3MNMA 1W0VB 1F6LL 3WCYA 4N2OA 4LFHD 3KL0A 2W9EL 4F5CE 3HZYA 3TT1H 4CGUB 3VD5A 5HHMD 4XCFL 1CF1A 4GG6E 2AV7A 1PLAA 5T1KB 1EFXA 2FJGA 3HBPA 4QIRA 3NRPA 4N2BA 5KVDE 4YMPA 4NKQB 2PWEA 5C09B 4JX0A 1KDIA 1ID5I 5HHPA 1X5LA 4Y2OA 4KI5E 2DLHA 3O4LD 3REVB 3OG6B 5EWIL 5C09D 5TPWL 2YAEA 3VI3F 3QCVL 5HPOA 5AKSA 3WE1A 1A9VA 5H94A 3BPOC 3CMOL 4JFEB 4GKZA 2CXKA 2Y07H 4YN3A 3ARTA 1IQDB 3HUJB 5E6SB 3V6BR 5JHDA 1S7UB 5ECGA 3VFMA 4JR9H 2FATH 2G4GA 4NHCH 1CDBA 1IGJB 1TCRA 3HS0C 4C56E 4OI8A 1IC5L 3B9KB 4NPYA 4NOFA 1OM3L 5I1JH 1OP3H 5CJOH 3QUML 3QC5X 4L8DA 4MCNA 2IBZY 5KVDH 1XH0A 1VKXA 3VXSB 2FQDA 3KHQA 4FTVB 1MFUA 1FNFA 4MKTA 1JGLH 5ITBH 4GJTB 4NQSA 5GSVB 3AAZA 5GGTH 3VB8A 3SJVE 3R8BB 4E5XG 1IKFL 2VKXA 2ZUXA 5IOKA 5SWQB 4H8HA 1NMBH 4L4TE 4FA6A 5ANME 1MELA 3PGCB 1M3IA 3ESMA 4EN3A 3RWDB 1JRHI 4RH4A 4B41A 1T89C 1TXKA 2Y5TA 1TJGL 2V9TA 1V27A 3QCTL 3HI5L 3BN9D 3MDJA 1CK0H 1CLYL 3ARWA 4Q0XL 4TRPL 1ACCA 1ES0A 4Y4HC 4GG8A 4OJYA 4ZAKC 4NC2B 1FGNH 5TD4A 4FZ8L 5LDUA 4Y2DC 5AAWC 1GW0A 2P8MB 4X6BB 3D4ZA 3BOVA 3VFVB 5E6YA 1GOGA 4EXPX 2XA8L 2A9DA 5EDXA 1QI3A 1EMTH 4GRLB 3GZOA 4HPOH 1SBSH 4N0UB 2F5AL 4PSRA 4P8QA 2D9CA 3B8SA 4Z7NF 3HMXA 1TVHB 3KPLA 3DO7A 1HILB 3QZWG 4IBQA 4XAWL 2K4AA 4NCDA 2VLJB 1D3CA 3HMWL 3JWOH 3SGKA 1EXHA 4S11A 2FWLB 1JV5B 2AV1B 1HSBA 3NJJA 1LO5A 1LE5A 4E5XA 1YAIA 5I73C 4O2EB 1BMGA 3QNFA 4Z9KB 4Y4KD 4Y1AE 3I84A 3L4ZA 2O93L 4DP5X 3WJMA 5J3HD 4ZYKA 3U2SB 4OF7A 4X6CF 3RTQB 2N01B 3WFBH 5AZ2L 2A5UA 2EDTA 5I0XA 3E6FA 1MSPA 3SDXF 4KXZH 5ICYB 4QJ4B 1FYTB 4PJFE 5FUOL 4CAGA 1XGRA 2XYCA 3P9WB 4GKZB 4JZJB 5E2VL 5GSRB 5FCSH 3S37X 2HTKD 5GGRB 3MROA 5HTSA 3U1PA 5BVJA 2O1AA 1D2PA 3RIFF 3IMWA 2ENJA 1T2JA 1ZS8B 3CHSA 5DUBB 1MAML 3S2CA 3MODL 3CZGA 1FZOA 1CDHA 1BLNA 4H88L 1URIA 2FO1A 3H6AA 3ROOB 3QZWB 1DUYA 3ULSA 3LEXB 1EUTA 4YS4A 3ZPDA 3VRIB 2JQMA 2JKSA 3BT0A 2BFGA 2Z4QB 3BKYL 5LUMA 1FDLH 2NY7L 3VA6A 2HB0A 5EZJB 1JZFA 4LBAA 4E41B 1N70A 4NQEA 5IHUH 3VU1A 4YNYB 3VQ2C 2KDYA 2Q7YB 3PUCA 4DN3L 3MXVH 4WO4B 3QJXA 2XN9B 3BYTA 5LB1A 3QRBA 3M1BA 4X4XB 2APSA 3IRPX 1BVLB 4WENB 1KFAH 4FXGB 1MCOL 2IGLA 2QPFA 2PO6D 3EF4A 4ISVA 3LPWA 4N8CH 1MJ8L 4XVJL 1E90A 1SEBB 4KY2A 3WS3B 1MLBA 2YAPA 4N86A 3L4TA 1DJSA 4ZO8A 1FNGB 1NUFA 3ZDXE 1U41A 4PRAA 2OMTA 3VGBA 1MFNA 5KVDL 4YHYB 5JIHA 1NFKA 3ZSSA 3QXDA 4U0RB 1NANI 3A5VA 1J7VR 3UABA 3ZR5A 4OZIB 2F18A 4IS6B 3NGBC 2E46A 2AJSH 1H3GA 2VM9A 5IY5B 4XO9A 2VH5H 1E9OA 1I8IA 1PZBA 1AHWA 2NT0A 1AR1C 4Y1AA 1GAFL 4N5EC 3SDDB 3MA7B 1U3NA 4U6VL 1LHZA 2XG5A 5D1QB 2OSLA 4D9LL 2X1OA 4U1IB 1CFTB 1C12B 3RTQA 4RRPA 1UYWL 4MWFA 2BVEA 1PZAA 3V6ZA 1MRDH 4KVNL 1FUNA 5JIDA 1JMZA 2YK1L 3ISRA 2F8VA 2FX8L 2X9XA 4G7SB 4KK5D 1UH2A 3FB8B 4LIQH 4CSSA 1BZEA 4ELMF 5FYKH 2DWXA 1T5WB 1CE1L 3QHFL 4TKWA 1CD8A 1KGCD 3VFOB 3HBGA 5JNYB 2YKKA 1PEZA 1KTLA 3Q2WA 1KCUL 3J27A 4MJIA 4XX5A 1YUHB 3VGDA 4K5NA 4R0LB 5AKRA 1L0YA 3DRQA 5LG1A 3QWOA 4XGZA 3F58H 1D7DA 4WEEA 1S8DB 2CM5A 3TA4D 1G43A 3EUUA 3WEMA 1JGEB 3U9PL 4BZ2L 1CU4H 2PCFB 3MMEA 3K81A 5CUSH 1ZHLB 2AVGA 1JI1A 1DQMH 2G3MA 1KELH 3IKCA 3MCG1 3VD4A 3C5ZA 3FH8A 3RDTD 3WIIH 2IGFH 4HUMB 4TQEH 4QXGL 1BG1A 4CKQA 3ARGD 4Z78B 2UVFA 3LYRA 2MQ0A 1P4IH 4Z95L 3A4EA 5I6KA 4TQPA 4NYLB