2OXGB

The soxyz complex of paracoccus pantotrophus
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
110
structure length
110
Chain Sequence
b'STVDELTAAFTGGAATGEGGLTLTAPEIAENGNTVPIEVKAPGAVAIMLLAAGNPEPAVATFNFGPAAADQRAATRIRLAQTQDVIALAKMADGSVVKAQTTVKVTIGGC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SoxZ protein
publication title The SoxYZ Complex Carries Sulfur Cycle Intermediates on a Peptide Swinging Arm.
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Transport protein
total genus 24
structure length 110
sequence length 110
chains with identical sequence D, F, Y
ec nomenclature
pdb deposition date 2007-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13501 SoxY Sulfur oxidation protein SoxY
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2470 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2oxgB00
2NNFA 2OXHB 2OX5B 2NNCA 2OXGB 4UWQB
chains in the Genus database with same CATH superfamily
4IRZL 3FQXB 5DJDB 1TJGH 3CSTA 3R0MA 1T1WB 2DQCL 1BW8A 2F15A 3B1UA 3BMWA 3U6XS 2AF2A 5DJYA 5BJTB 4M00A 2V9QA 2EE9A 4A7TA 3IPBA 2MHAB 3FOMB 4X5WA 2WBKA 3VXNA 2IH3B 3BRFA 3QUYA 1T1YB 4NWUH 3DO7B 2EDHA 5KYWA 2HN7A 2PCFB 3TJHD 3FN0L 2A0LD 1IQWL 3S8WA 2DLFH 1BQLL 3DVGB 1MG2C 1W16A 2Y6SC 1X5ZA 3UTTE 1AP2A 1WISA 1NAMA 4PWEA 2AW2A 4MX7A 5HHQB 1HZHL 4W70A 4I0CC 1PY9A 5BZWA 5DHVB 2DWYA 2OL3A 1C1EH 2ERJB 3CHXA 1EJ6A 3TA3C 3VFUB 1CCZA 4HIEA 3ME0A 4Z7OE 3NABH 1N68A 1TCRB 4IKJA 1ZHNB 2LOEA 5IQNA 5EF1A 4EOWL 3KLHC 4E9TA 4Z7NB 4AEEA 4WO4D 4PJDA 2ARWA 1QRNB 2Z65C 3WNOA 4LSQL 4DVBB 3LPFA 5BVJB 4GAAA 4PJXA 2O5XL 1ND0B 5C0CE 2QSTA 1BVNP 1BZDA 1N10A 3QORC 4M56A 4ENZA 3GMOB 2Q76A 3ZZ1A 2DS4A 4UQCA 2Y36L 1EGJA 2A83B 3SPHA 3MLSL 4B50A 4EIZC 2CBQA 3HI5H 3LB6D 2W07B 2FWUA 1AR1B 4DK5A 1JWUB 1WQVT 3QO0A 5F7MC 2W0PA 1KCVL 1AQKL 1CL7L 2BMKB 1P2CB 5EZLB 1J0YA 4XWGL 3FN9A 5HGHA 4RGOH 5FKAA 4KK8C 2X89A 4TQ8A 3GEWB 1TZHB 2CUHA 4NC1C 3RTQD 4LVHB 3QQXA 5GS1B 2GITA 2Y3AA 1JI2A 1QSZA 4UT9H 4XBEL 4FA8A 1VEPA 3VSQA 4KROB 4JANA 2B1HH 4OFYA 4CNIA 3PQYE 3FQ2A 2ARJQ 2JI1A 5GHWH 3T77B 4J2XA 2DD8L 4YE4L 1I3UA 4NWTH 4BQ8A 2Z8SA 4TUKH 3V4PH 4IKIA 2UUDK 2LAGB 2UY7B 1IC4H 3G08B 3L3IB 2XKNB 4KITB 4JG0H 2CLRA 3KPQB 5I1DB 1NCOA 1JF5A 2DMBA 4YDVA 3K71A 4R5TA 1SHXA 1I9JL 1OV8A 2QVMA 4Z7VA 4OLWL 4P57B 1HE8A 4QRTB 4HWEL 4OSUH 5DLML 2A9NH 3NJLA 5J9PB 3RJQB 2EEXA 3ISYA 2OA9A 1BXAA 4UUJA 4BE5A 3TN0A 1UWEH 2EXYC 3LZQA 4V33A 5HHXL 3O3UN 2CLZA 2P46B 1R6VA 4FXKA 1N26A 4FFWC 5IHBA 1EA9C 2SODB 1YYCA 3HKFA 2ZYRA 3CH1A 3OF6A 3FB8B 1UWXH 3FCSA 1QFUH 2VISB 3JQOB 3QH3A 4XO4A 3RVUC 2CCLA 3GDBA 1R17A 1JGUH 4LCWD 4XXDA 5HDBB 4NFDA 4ODWB 4Y88A 4DF9A 3QPXL 5FECB 1G7HA 5K69A 1MZZA 1R4XA 3DUHA 3OSVA 5H35B 2QHLA 3TA3B 1YUHB 4NKDB 3MXWL 1GTFA 4R4NC 2PETA 3FRPG 3P3UA 1DQJA 2YUZA 3ARGD 1G6VK 3HKZA 2ZX6A 1IEAB 1HOCA 1FNHA 4G9DA 2G5BA 1XB6A 2AVFA 3Q8CA 3VXSB 2KH2B 2X6CA 4QCIA 4Q9RH 4Y5XC 4Z0XA 2BCKA 4PW4A 5A2LH 4NQVB 3ATFA 2V2WA 3QORB 4L2YA 4OJDH 5KW9L 1SXBA 2ZJSL 5LBVA 3T1FA 4KJYB 1PAZA 1WBYB 2ALAA 2WW8A 1LM8V 3BVWA 1TMCB 3S34H 4PJDF 1FL6B 4KZEH 5BVPL 1TQTA 3MRRA 1IGTA 2RFXA 3FU7B 2VW6A 4PJXF 3FQ1A 3D4YA 4XPGL 3L45A 2YA1A 1UZ6E 3SY6A 1M56B 3FQ4A 3JTTB 4KVCH 5D1QA 4KX8A 4U1HA 5CU9A 2EIKB 4NEHB 5FCUH 4J3OG 3GS0A 4OGYH 1DQDH 1WHOA 1MQKH 1VIWA 2EDBA 2R2BA 1S7RA 1R3LB 1DFBH 5DDHB 3OHXA 4RFNC 4WUUA 2QQQA 2NY3D 4YHML 3CVHL 1PU0A 2BVOB 4QD2E 5E5MB 5EU6A 1CDGA 2OS7A 2DN7A 5E6IC 4KRPD 3IMVA 1IBYA 1JRHH 3CZUB 5EBLB 4ZUSA 1KG0A 2FTAA 3GSUA 3N1PC 2OZ4A 4JDZB 2VH5L 4MD4A 3S4SB 2NY1D 1WT5C 4NZRL 4GRLB 1TYRA 3MV01 3UTZA 4KK9C 1A66A 1PVHA 2ZSVA 3CFBB 3E7JA 1AIZA 2P5PA 4UQ3A 2ZX7A 2IOIA 4PGCB 3WKMH 4YGVA 3INUH 4C56B 1KN2L 3GSVB 2IF7A 4CN6A 1CFBA 2EZ0C 4IBZA 5CSGA 3MRBB 3TBYB 2BJML 2A7BA 5GRVL 1IM9D 1MCOH 1Q94A 5DZNA 3U79A 4ZW6A 1LWRA 5C0ND 5JHDD 3LIZA 3PU7A 2GEQA 5F7UA 1OT1A 1PYWB 4HQQH 3WEOA 4OCSH 2EH7L 1KJ2L 3VA2C 3QR2A 1XGYL 2X42A 1ORSA 3WHE1 1FVEA 1UH3A 2DWEA 1TYEB 3LH8A 3MCLH 3TASA 1N3NB 2APBA 4CVXA 1NCCH 1W2KT 1TQUA 3QNYB 1WZMA 4J3SA 1KIQB 2AK1H 3T0ED 5F3HB 3IJ7A 2C3VB 1UA3A 5C0DB 4G8IA 4Y9EA 4UOW0 3DV4B 2XIIA 5EO9A 5D71L 3S5ZA 3BQUD 5KVFE 5LWYH 2ZAHA 3WS3A 1MWAL 4TUJB 1VFAB 1FFQA 3QZWG 4HKBA 1UXWB 1QFWH 4R83A 4B95C 3UBXI 4OF6A 4Z7UF 3EG9B 3LPWA 4GBXC 3LEXA 3GSNH 1FSKB 3FRUA 4AQ1A 4BZ1H 2AAAA 1HHJA 5IUCA 5F97E 1OF2A 5A40E 5I0ZA 2OW7A 4KI5E 4NT6A 5C0JA 5ADPH 4HU2A 1DN2A 4B9YA 4NGHH 4UIKL 1NANH 2HFFB 3HE7C 3MV9A 4MFHA 5F88B 4OVUA 3BPOC 3CDGA 3LCYA 2E7HA 5DHYA 3RGVD 3DBSA 4KI5D 1RJZB 2IVFC 3BESR 3BYYA 1H19A 4Y5XB 5EB9A 5F7WC 3RB5A 1JMZA 3CMGA 5D9SB 4ZXBC 3SE9L 1AQHA 2YD8A 1OSPH 4YXLL 1KGWA 5TDPB 1NGPH 1M1SA 3O2VL 3DSFH 1OP5K 3MV7B 3MNVB 2BH0A 5HHOE 2OMNA 2NY6C 4GEJA 4X6FA 1U3HC 3F84A 2ZP9A 3F85A 4JQIL 3TL5A 3UAJC 2R8SH 2ICCA 1T21A 1XIWA 3TPKA 1O6VA 1ZHLA 5KVEH 2GK2A 1HDMB 1JG9A 5IQ7L 1S78C 4I13B 4GT0A 3FT0A 2J56A 5HHOD 2FECL 3E3QC 1J9QA 3IBOA 1RUML 1L0YA 1L9PA 3MREA 3NCJH 1G9MC 3H7BB 2YO3A 1I1YA 4LEOA 1NUFA 1QFHA 2BS9A 4RFNB 4A68A 4M8QB 4CSZA 3GSNB 3HFMH 1NEZG 1Q1JH 5KBLA 4W9LC 4KKCC 5E6IB 2NW2A 4KO9A 2VYRE 3PIQA 4PU2A 4NO5A 3NSXA 4K0OA 1TF4A 2Y07H 4KJPD 5CGTA 5EN2A 3RI5F 3QQNA 3BEVB 4Y2NA 1TSHA 1V3KA 5C09A 1Y6KR 3CFTA 4HIHA 8CGTA 3LHAA 5CZXD 3SDXB 2CDFA 5ERWA 1G9HA 3SJVD 2JCCB 4GSDH 5KAQF 3IAGC 1P5UA 2X28A 3ARPA 6TAAA 2CRZA 2YC1A 2XPYA 2P52A 3NCYP 3HHSA 5L4FA 2V8LA 2ZCKH 2A73B 1T5XB 3BDYL 4OLXL 3GKZA 5HDLA 3WAKA 2X88A 3F12B 1FHGA 3DHUA 2BWIA 2YEQA 2CKBH 2MMXA 3FFCD 1RUKL 2K1MA 2BSDA 2X4OA 4WNQA 5DSCB 1I8MA 3D18B 4PLJC 5GRYA 1T4WA 2Y3NA 3BIKA 3S48A 3VYPA 3HOGA 2OMZA 4G80B 5CN3A 3DTXA 4B3EA 1ILSA 1PZ2A 5F9AC 2D7NA 5F1IA 3WHXA 5ESAB 4JQVA 1MHPL 5IK3B 4BV1A 2IH1A 2CGYA 3CZKA 1G9MH 4B9FA 2IH9A 1GY1A 2Y0SA 3J27A 4GBXB 2J88H 1C5DA 1HXMA 4PJHB 1WEJH 4LDEB 1NDGB 3V0WH 3GMNA 3HNVL 3QWOB 3LD8C 1K5WA 2P43B 3LHPH 2K8QA 3QS3A 4K5LA 4DKFL 1AJ7H 5HHPA 4YSRA 5AEAA 3HE7B 5F71A 5I71C 3ULVC 4KQ3L 5IQ9B 5LGHL 3D0VB 1ADWA 1TKWA 3BPOB 3JV5A 1M3IA 2BC4B 1QLEH 3EJTA 3OKKA 3PRZA 4MJ2A 4WY7L 4ORZC 4PRDA 5F7DA 5FDWA 1YMMD 4OQTA 5TF1L 4KKPA 3QRLA 5I8OH 1OCWL 2A9CA 2YD9A 1D5XB 4M48H 4OFPA 1F02I 2ADIB 4EAEA 1A9EB 2CKBB 4ZXBB 1UEMA 2DLIA 4HPYL 4LOFA 3S98A 3RA7L 3QUHA 4U6TA 4Y4KA 5IMOB 1F8TL 2XWZA 2FB4L 4X6DE 4ZMYA 3L5JA 4PFEA 2NY6B 2VZVA 1NGQL 1U3HB 3I9AA 3PUUA 3W38A 4QR7A 2I9TB 4A2LA 1L7TH 1GJUA 4FTVB 4WJG3 4XNMA 3NIFE 3PV7A 4UQAA 3IMWA 4OJFH 1E8XA 2FL5A 2NX5B 3DGGA 4MJJA 3S96B 4R6UA 3W5MA 4FEMA 4P4KC 2C9SA 2HJKB 5CUSH 4ODBD 3NJJA 3X13A 5AVWB 4OZGF 2ZUTA 3A23A 4X7TA 3VQMA 5FFGA 1S5HB 5KEZA 3FHEA 1TVDA 2WM0A 1MXDA 1UH4A 4NLAA 1D5RA 4R5XA 5JUEH 5FLVA 1MCDA 2YWYA 1Q9WA 1RUAL 3VA6A 4AT6B 2EILB 4M5SA 2ATKB 4L4TE 4KNQA 1QLEB 2IBZX 3MVSA 4YXKH 3TBTA 2E6JA 2GUYA 3ULVH 3KDPB 5E1AA 5A2BA 4GPVA 2DIEA 1JN6B 4K3JH 3LPOA 5IREA 1MJ7L 4AIXA 4WJ5B 2GTWB 1EK3A 3TYGL 2OX5B 3UCQA 5CJOH 3VFRA 1QEWB 2GSIA 1EFXA 3TFBA 2HSIA 4FFZA 4I3RH 4RBPK 3QR0A 3ZL4L 3EBIA 1JF1B 2G60H 4U7MA 3MA7B 4IRJA 2X2IA 3ARZA 3HMXH 3APNA 4PRNA 4YO0B 5ICYB 2FJGA 2GJ6D 3LN4B 5JW3L 3EO1A 4OW6A 3EYVA 5SWSB 3V6ZB 2FYYB 3BP4B 1R3JA 2EXWC 3HUJB 5KSBA 4HUXA 4FLOA 1LO4H 1FBIH 4QHLA 5F7FA 5KZCB 2XFXA 1LEKB 3PNWA 5F1KC 1NFDB 2VKWA 2D3VA 2NSQA 4R4BB 2ZKHH 1J86A 4LCIL 5ILTL 3EO9H 4AY0A 1U8MA 3RAJL 4QNPE 3D08A 4H8WL 1O6SB 1ROWA 4MB1A 5CD5C 2WQ8A 5E94B 4HH9A 5L9DH 2WB1A 3BLPX 4N8PA 4N0FB 4S2SA 1DJWA 2P5WA 4OZIF 1BQHB 3UOAB 3LD8B 2Q7YB 4XCNA 2VGLM 1FFPB 2MNJB 4NJ9H 1VSCA 3CGTA 4U3CA 3NJKA 3SGJA 1CU4L 5I71B 5MEOA 4XGZA 5ESVA 4YWGL 1BMWA 2B9AA 4C8XA 1P1ZA 4YN3A 4R0LA 4UDTB 3VXTB 5E9DB 4XP9H 3L4YA 5HHVH 1PZ5A 3WLWC 4JHWH 2I27N 4BHUA 3VVWA 4DPAX 3GQFA 4ADJA 3AS2A 3T71A 5FO7B 4ZX6A 1U8CB 1CE1H 2F53E 1A6WL 1NBVH 4ANKA 1DBKH 1V8HA 2MCMA 4XB3A 2XG4A 4JKMA 1MCSA 2VRQA 3JWDC 2Y22A 3L5WB 1ZMYA 4YHNA 1KTLB 3BFQG 3SE8H 1QPPA 1UH2A 1AANA 1AGFB 1ET7A 3Q8AA 2F53D 1P7QA 1VERA 3BFWA 2AQPA 5FX3A 5I1EH 1G0XA 1JZ8A 1U2HA 3QEHB 1OE2A 4YDZA 5EU3B 5C0IA 4ZD3L 4RNRA 1B0RA 1XCTA 2GBAA 2OZNA 4P4KB 4Z1PA 1BM3H 1Y1DA 4XB8A 4Z8FH 4RMUA 2YAPA 1BEXA 3PAZA 5BMFL 1D5IL 5K9JH 2DJSA 1DDTA 1OE3A 2J7LA 2CKNA 4G8GA 4FQQB 4JFDA 1OP4A 3OXRB 4FQ2H 3FUFA 4PJ8A 4XX5A 2ZWLT 1CDYA 1Q0EA 4FHKA 2K6WA 3CVCA 4IMKC 4HOMA 4AEFA 5L2JA 5IW3A 2YXFA 4WZ9A 5B1JC 3E8VA 3HAEA 2WTRB 1KB3A 1RUQL 1XDTT 1IAIL 1K85A 3FFOA 3VXUD 4G6ML 3RI5K 4HZLB 3SGDH 2IPUK 3GXIA 1CIUA 3GB7B 3VTTA 3A6CH 3F7VA 1UQSA 1VDGA 4A39A 4P46D 3SOBH 3WFBL 4K3EH 3JWDH 4X7SH 2W9EL 4QJ5B 4XMVA 4BDVB 1T03H 4UNIA 2F68X 2YQ2A 2CBOA 2Y25A 2AABH 4KNTA 4MVBC 3TONA 5MEQA 5GGSY 4DETA 3KVPA 1UCTA 1UASA 1MH5A 2XWXA 2R0KH 5KSBF 5A2FA 3GHEH 4KX7A 4PRAA 4BFGA 1MREH 1RXLA 1ZXKA 1T04A 1R0AH 1HJCA 3SPVB 1OCCB 5DEZA 2JKRM 5LXGL 2AKRA 2MTAA 1BX2A 3P2TA 2XIBA 2AAVA 4BUHA 4D8OA 4MYPA 3D85D 5IW1A 3NJFA 3WFEH 5I1KH 2AJ3B 1YEGL 3K4DA 1BDYA 4GXUM 1CXLA 1SM3L 5B3NA 4OD3L 5KVFL 2EDXA 1DBJH 2HG0A 3HZYB 1U8PB 3O3EA 4ZUWB 4HIQA 3HC3H 3RJOA 4AJVA 4IRSD 4DVRL 4P2CG 4PJFF 2OR7A 1L5GB 4JFFA 3W9EB 3T3PB 5I1HL 3KM2A 4NZJA 3OLGA 5HP5A 1QUNA 1S7TA 2ZKXA 5GRXG 4BK5C 4AYMC 4BFFA 2XTLA 1FYTD 1R19A 4M1CD 3ZSSA 1JZ5A 1ZK5A 1E42A 3MI6A 1MAKA 3IKCA 2R7EA 3F6LA 4J28A 4TQEL 1R3HB 3DXAB 4OAWA 2X12A 1I1CA 3MUY1 4GW4A 2FBOJ 1F58H 3VWKA 4EXPX 1RCYA 3PAUA 2R1XA 2W9LA 1G9NC 5F7LB 5FO9A 3D87B 3SYAA 2RQEA 4YVUA 1Y0LA 3ARBA 4JJHA 1P84K 1QSVA 5IVXA 1T20A 2FX7H 2OP4H 5I5IA 1UD6A 1QABA 5HD8C 5L2KE 1QEXA 4NRZA 4CDGC 1XB3A 3ESVF 4OCYL 3FUIA 2EYTA 1BJMA 4TLKA 5INCB 3MRFB 2VXQH 1S8DA 1C12A 4S1SH 1GHFL 1A6TB 4I5BB 5IB2A 1EJOL 5L2KD 1OAXH 4TUOB 5DJXA 2VN7A 1KTJA 4KX9A 2WLYA 1XH2A 1RZPA 5I16A 2JTDA 4TN9A 3GBDA 5JQ6L 1TJIH 4JZJA 1KJMA 3TBWA 5F7NC 1F41A 4KU1A 4TQIA 3LSOA 1JHTA 5D7SH 5EZIH 1XCQB 2Z34A 1KJVA 2EKJA 1UT9A 4YUEL 2ZG2A 1ETZA 3FOMA 1F1AA 4X4ZA 1HILB 2E7MA 1MLBB 4UAOC 1J18A 4X0NA 5IB3A 1N6QH 1U92B 5EV7A 3L4UA 4N87A 2YFNA 1I8LC 4EO5A 2FGWH 2H0JA 3B2MA 4L8SC 3ZYZA 3M1BA 3DVGA 1MHCB 3FUKA 4NM8H 4Y2OB 2FH8A 4N8VB 3DX4A 3ZE2B 4CGTA 2XBDA 3VFTB 2O72A 4LFHG 5HHQA 4LF3A 4GMSH 1T6WA 1WFMA 2X41A 1CLZH 4JDTH 4LSTH 1G9NH 2JJSC 3NJMA 1J5CA 1Z3RA 3NEOA 5IF0B 2DWDB 4YL9A 4OLVH 2NUTB 3NJGA 4K73A 1XD0A 5AB9A 2IBGA 1D9KA 3B6SA 4JPVL 4NQEE 3KR3H 3JBG7 2IAAC 3FQUB 5EEYA 2YZ8A 4DP2X 3D48R 4HWZB 1CICA 4P05A 3DURB 1PBYA 1A6UH 4ANUA 1P0SE 2ATPB 2VDML 3G6JA 4QXGL 3GHBL 3R8BB 4IHBA 1P9MA 4DVBA 3BAEH 3FT3A 3HZKA 4QO1B 1ZANH 4PAZA 4W9JC 2B1OA 2XZQH 1E40A 3HE6D 4NNPH 1IKFL 3GMOA 2JJVA 3MRDB 4HLJA 4K3DH 1GYUA 2AEPH 2R23A 3R4DA 2GUOB 4GI9A 4TULL 4XI5C 3ZT5A 1ZS8A 2X1XR 5FYLE 2HKFH 2JIXB 4YSPA 3QZMA 3ZTDC 2AQQA 2OXGB 5I26A 1KSRA 4XVTL 2J4WL 3IGFA 5FGRA 1YQVL 5H37H 4PJ5B 4TVSa 5DT1H 2WNGA 2BP8A 4JDEA 4FP8H 2IADB 1SHSA 4Q9CA 3IETB 5AENA 1ONQB 4WHTB 3H0TB 4POUB 5FYLD 2XVGA 2V5YA 3RYMA 5DQ9A 4QKTA 3S3DB 2VXVH 5C3TA 3BZFA 4Y4HD 3UEZA 1OL0A 3JYBA 4WENB 3ZDYB 3VXQB 3S36L 4F37F 3UZVB 1XSIA 3CZSA 1F6AA 3K7UA 5I19H 3RDTC 3EYQD 2J1KA 1M2VB 2VDKL 4OI9A 3PXLA 3PGCB 1S9KC 4IW4C 4HXAL 5I6LA 3H8NA 4YS4A 2X6VA 4JUTA 3T77A 2HX8A 1Y1UA 2MQCA 3U0TA 1B4JL 4WU7B 5DRNA 1VPOH 4MA3B 5FR3A 1PCXA 2AV1A 4GRWE 3U1PA 4DEUA 1MDAA 4LPVA 3G5XB 4PGDA 2QZQA 4H8VA 2MOGA 2YKLL 5DMKB 1IGIL 4JJ5B 1U8LB 4PIBA 1SEQL 1DLFL 1KBGH 4G82A 4AEIL 3V0AC 2OMTB 2ETWA 4PV8A 1R24A 2MPAH 1SMOA 3N50A 2DTMH 4AG4L 2UZIH 2HJLB 1CXKA 2XPGB 3IN0A 4XR8C 4UAOB 5CZRA 3BZ4B 1ZK9A 4HX1B 4OM0L 5IR1B 1CD0A 1E5BA 4FI6A 3TO4A 1RY7B 1VKXB 1E3XA 3PGDA 4L8SB 5HI5D 2YSSA 1ZT1B 3L7FA 3DX8B 3P4NB 5C6PB 2VISA 5JIKA 2YGQA 3LQMA 3K72A 4KKAD 2CK2A 4NOBA 4ODWA 5DVOA 5FYJU 5B7MA 1NL0L 1CFQB 1ITBB 1SVZA 3M17B 4HCRA 5E2VH 5H35A 4N0YH 3QQ4B 4LLMB 3WNNA 5ICZA 3NRPA 3UZQB 3CHPA 5TJWK 1QBMH 3VGHA 3NAAH 2PO6C 1GGYA 1BQLH 4NUJA 5DI8A 1CLYL 3WXWH 4WCYH 1QSFB 1SYSB 2QKIA 2VMJA 4JO1L 3HN3A 4DO4A 3MRPB 1CXEA 4TL4A 3WUWB 2YRZA 1HZHH 3L3KA 3IFPA 5AVYB 2CIKB 5BNXD 4P2RE 1ZVSB 4JO4L 3VXSA 1EAJA 1J5IA 2NSXA 3S3CB 4HCFA 1C7SA 2ID5A 4FKEA 4NN7C 1KY6A 2X2YA 3ARFA 4KVPA 5CLYA 1FC2D 1PGRB 3DVNA 5MI0C 1EXGA 1VESA 4FMFA 4XBPA 3G6JF 4Z7NF 4EOWH 3N0AA 3MLPA 1B2YA 1JJUA 3JV6A 4P59H 2XJKA 4YSUA 5LQBL 5C07D 3UACA 1A6VH 2OMXA 4AK2A 2QKSA 3P73A 2W91A 5DRZB 4FE9A 3PDDA 5CR8A 2K6YA 4K7FA 2ZXAA 4ENED 4MNHB 1MWOA 4JE4B 4XWOD 3L2MA 4K23L 2O6FA 2BIPA 2JKIS 2Y36H 1RZFL 5I1IL 5DC2A 4PW3A 1R3LA 3PPEA 2ZOKB 4M62H 3MLSH 43C9B 1NKOA 1ED3B 4PB0L 2IOMA 3GJFK 4HJTA 5T3XH 3RNKB 4KVNL 5TD4A 4TNVK 3RDTB 4GLRH 4Z3HA 5I17A 4IBUA 3KW8A 2VLJE 5JR1L 3DPBA 4OUUB 2V3FA 3FYEB 4GRLA 3VU1A 4GXUN 4FLRA 3RGHA 3VG9C 4XMWA 3DVFA 5KJ4A 2ZXBA 4Y1TA 1FL3A 5HYJB 2VLJD 3HCVB 4RGNE 1L9NA 4XRCA 4MNGE 3A6BH 4OGAD 3F7YA 1AS7A 4WK2B 4HMEA 3BSHA 5C0AE 2V9UA 4U0RC 3UADA 1XQ4A 4A2HA 1MRFL 4WO0A 2HTLD 2XJLA 1R1CA 2PUQT 5E2JA 1WCBB 2Y69B 3SDCC 2LU5A 3KPLA 5AYUH 3VQ2C 3WFZA 1GS8A 4EN3A 4K8RD 4QDGA 5I1LB 5HYFA 4XXWA 5JXEC 1O9VA 3UYPA 1BFOB 3KHQA 4PRHB 5C0AD 5FFLA 3UL4A 2BIIA 1N8OE 3UG5A 1DSWA 5DVKA 5HHNA 1CGSH 2HFGL 1R3IL 4HK0B 3MNZA 3QA3B 4EUPH 3HLKA 4ANXA 3PWUB 2OULB 2QADC 4NM4L 1MI5E 5K39A 5F3HA 1ZY9A 5DMYA 3IXAB 4X98B 4G1MA 3C5SB 3DV4A 3LKQB 5J3HD 2OSYA 1NFIA 2A6JB 2PXYA 4OLWH 1OAZL 4OJYA 5CMAB 4BSVA 2APFA 3KPSE 5FF6B 2J5LC 1UXWA 3W11D 4PTUB 5FV2A 4P9HL 4WI8A 3P4MA 1MI5D 2H0FA 4QJ4B 1FL5A 3ARDD 4G6FD 4U7SA 4R96A 3VO0A 5K9KA 1PEWA 4WTXA 3HB3D 3O11B 1S9XA 5HHMB 3KPSD 4EVNB 2H4EA 1VFBB 2HLFC 3D3VE 4LE8A 4IK7A 4XE0A 1CGWA 1IT9L 3EZ8A 3J07A 4XP1H 2PO6B 3RIKA 4H7VA 3SPCA 1OB1B 5CS7A 5HDBF 5B39G 4PVBA 4WW2A 3R1GH 5KUMA 2WZ0A 1IL1B 4N9OB 1P1VA 1SJHB 3D3VD 3K8LA 1I7TA 2ADGB 1RJZA 3QPXH 3QO1B 4QTHB 3VFSB 3D7PA 3DX0A 1Z5LB 4G42A 2R69H 5EFIA 4F9LC 2R29A 2ZZUT 2BVUA 3BT2H 3PHQB 3QFDB 2X9YA 1I9IL 3GK8L 2X6AA 2C26A 5D5ME 4NN7B 3F3HA 4PI2A 1CGTA 3OAUH 4UWQB 1VGEL 2EE0A 4OGXL 3ROLA 3LH9A 5MI0B 1RIUL 2CDEA 3QZNA 3U0WL 5A2IH 1N5YL 1B4RA 1AZRA 3MV7A 5D8JH 2XXFA 1DTUA 3HRZA 4PP1C 4EUPB 3BOVA 4JKPH 4KXAA 3JSSA 1UD3A 1RU9L 1W0VA 1IBHA 3NN8B 1RK7A 1K3ZA 1A9VA 3T5WA 1DSYA 2O26U 3E6HB 4MCZB 4EEEA 1XF4A 2UZYA 1LO5A 2IWGA 4GOSA 3VFNB 2AGJH 3QUYD 1BFVH 3RY6A 3A67H 4PGBA 3NA9L 1MCFA 1T3FA 1VFMA 2AXHA 3BUDA 4WUKH 5B38A 3M07A 3QS2A 4YDKH 4HKZA 4N2BA 3ZPDA 3HI6H 3K2MC 5DD1H 1CLVA 2E56A 4GIOA 4R97C 4P5TA 3VG9B 3NTCH 3FS9A 3GSOA 3U0PB 5AG9A 1E43A 1K8IB 1HH6B 3SDXA 3VW3H 5C2BH 4WKZB 5AYTA 1NJ9A 5CJ5A 4ONHA 5BOJA 3L4TA 2B4CL 2EDMA 2X6UA 3LJ3A 1AO7E 3K2IA 2WXFA 4JX0A 4ZPVB 4TNWF 3BISA 3MC0A 5B4MD 3SDCB 3FO2A 4KJWC 1F3DJ 3D06A 1FA4A 3BE1L 2CO7B 1JMXA 3HLAB 1S4IA 2RR3A 1TTBA 3G5ZA 4PB9H 4RIRA 4LSRH 4X9BA 1ZTXE 5IOPA 4KZDL 3ALWA 3LKNB 4YSAA 2HT2C 4N6QA 2BSTA 2VDPL 2QADB 5FKPB 1HQ4B 1CR9L 3C12A 2FO4A 5LNGA 4PRPA 2PP7A 4XMPH 4KKBC 3TBVB 4UT7H 2UVEA 1KJ2H 4MD0B 5GGQH 4HK3N 2J5LB 5ABDE 3QUZA 3AREC 4KTYA 4GUPB 4XCEB 2Y7NA 2IJ0C 5I8EA 4JG9A 5E9AA 3S5LG 2AXWA 3HS0C 4ONGH 3M45A 1FFNA 3MGTA 1GRWA 4X5XB 3QDJB 1GC1L 2CJSA 4KHXL 2DY2A 4FZ8H 5LN8A 2X89D 5FM4A 5C97A 5AYQA 1TFPA 4Q74A 3TEWA 5D71H 1J8RA 1P6FA 3Q5YA 1WO2A 4N8CH 1DQQB 3UJTH 4UOZA 4JFQA 3LZNA 3ZVVA 4NFBA 4UB0H 1KYOJ 3U1SL 2IAMA 4OFYD 5GGTH 4CMMA 2NYYC 4NQCB 1FORH 3NIDB 2W0FA 1EDYA 2Z3FA 2Q20A 4BK8A 2GFBA 4BH7B 2JVUA 3M8OL 4FEIA 3D09A 3P02A 3ESMA 4JFZL 2F58L 3P11H 1X5FA 3Q1SH 4JM2A 1PG7W 1YY8A 2DBLL 5EN3A 1YJDC 2OYMA 5EBWB 2NR6C 3EJRA 1RIHL 1XEUA 4OLZH 2EDYA 4W9GC 4FRWA 5HVFB 5EIQA 4YK4C 5CFAA 4UV4L 3B7SA 1OARL 1KJ2B 4U1LB 2WZAA 4JG1L 3RVWD 5KBDA 3QHZL 4W6YB 4ZO6A 3CZJA 3I9IA 4XNZC 2QPFA 1COBA 1VLXA 2MFNA 4B9IA 4X6EB 2FLRT 4LCYA 3TN0D 1SVBA 4JL1A 3RB7A 1JXDA 4AYEC 1NUNB 2YEVB 4MQSB 4XMXA 3I02A 5AOMA 4ISVB 3STZB 3SOTA 3VDBA 1UACH 2ZF9A 4R97B 1TTUA 3L9RA 4FQCH 4TNFA 4DKEH 1SXZA 1KPRA 3FO1B 2HG5B 3UERA 1UTDA 4L8DA 1OGAA 2D2OA 3TJHC 2X1PA 2Y06L 1FVDA 1HAWA 1G1KA 2A0LC 2E9JA 2I60H 3FNKA 3FT4B 1HNYA 3W0WA 4L0PB 2HX7A 4NZFA 3MRGA 3BVNA 4XHQA 4OT1H 2BFGA 1RK0A 2H8PB 5LDSA 5E8PB 4BGDA 1IE5A 5DD3L 3WE6B 1GS7A 3V79C 4HWNA 4PYGA 1JZ7A 3SDXF 3KW7A 4X99B 5F7EH 2P8LA 4R7XA 3CXHJ 4QAWA 4V1DB 2JCCF 3C6LA 4YHZH 2WUCH 2V4LA 1FJ1B 1F90H 3OD3A 2H6UA 1DN0B 3B3IA 2Q3ZA 2N7SA 4HIPA 4M9OA 5A7EA 1KGXA 3OWEA 1YJDH 4GMTL 4X4XA 5HI3D 4HZAA 1AQMA 3BDYH 2EJ1A 3I9GL 1MAML 5INDB 3I6SA 4K15A 1ZE3C 3LMJL 4YIQB 1JWSB 5D1QE 4M7LL 4PG2A 3TT1H 4Z76A 2Y5TB 3AS1A 2D7TL 4NZUH 3VB9A 2UZPA 1JGEA 1KYDA 4M4RA 5E94A 4O58L 4EZMA 3AREB 1TU2B 3IVKB 1PSKL 5JYMA 2RQ8A 5D1QD 5EU6E 3LVTA 2WKOF 3HS0B 4LARL 5CCGE 4F8PA 1BQHA 1S5IH 4KDVA 2UXFA 1RPQA 3O6LL 2H9GB 3LB6C 4WUUD 4E42B 4HHAB 3ZIYA 2J1WA 5C0FB 1KWGA 5EU6D 1VGKA 3QG6B 3ZYIA 3VNYA 2O6DA 2YUXA 3DIVA 1QR4A 3L5XH 2CLVB 4FL4C 4PJHF 4AQAB 4NUGL 2VLME 4W9HC 4XH2B 2QHRL 3F7QA 3KHOA 3PHAA 4N68A 1SJEB 5AKSA 2DYRB 5SX4H 5BOZG 2ITCB 4MBRA 2VLRA 4PVMA 4F3FA 1INQB 2A4ZA 3RTQC 4MS8D 3PXJA 4DO6A 2Y2TA 3F58H 5CCKH 3FB5A 2RALA 2LQRA 4EPSA 1QVOB 5A16A 1OZUA 1A14L 3TNMA 4J27A 3VXOB 5KYUB 1UOWA 3AXIA 2GT9B 1DUYB 2GPZA 2C9AA 4WTWA 1KN4L 3GRBA 1KIUB 2P5EB 2KERA 5TF1H 1BJ1H 5BQDA 2FJFA 3V6OA 4HMCA 3OKDB 2OM5A 1KCBA 1NSNL 4YK4B 4P3WA 1NGXA 4U1MA 5FYKE 4ZNCD 4JM2F 4U6XA 4HPYH 3NT0A 3RA7H 4ZZFA 1DJZA 1ZE3H 4YQXL 4XNZB 1F8TH 1ZEAL 2AQ1A 1NCJA 2X38A 4J4PA 4J6RH 5T5FH 2P26A 4MNQA 1CWVA 5FYKD 4Z7AA 4Z95L 3KBEA 2WBJA 2R83A 4JRYB 4RISL 2OLDA 2PWHA 4O5LH 2D03H 1B9ZA 4J39A 4LLYA 3DTUB 5EPMB 4BZ2H 3OXRA 3VACA 3EGXA 2ITDB 3OKEB 1SXAA 2VN6A 3CU1A 3KD4A 4KGJA 1AQ8A 2FLBT 3REWA 3MODH 5BXFA 3BXNB 5M7QA 4Z3IA 3NEXA 4OCLC 5IM7A 3DI2B 2JQAA 3UEQA 2VRKA 4WWOA 5DFTA 5KJ7E 4HZLA 1KXQE 4FJYA 4OJAA 5BV7L 4N5UA 4OGQC 2DQGH 4NX0A 1AIFB 1TNMA 5LHDA 4JM4H 1ZIAA 1YAIA 2A9DA 1FPTL 4O51A 3IFOB 3WDIA 4PPTA 2BVQA 4IU3B 1IRAY 1IAMA 1XR9A 3ZTEA 3Q9PA 1GGBL 1X4YA 2VSCA 3ARGC 5I2IA 2EH8L 3HG5A 5CBAA 5I6XC 3FOLA 4WGKA 4WO4B 1W6WA 4FCHA 5JW3H 1XIWD 3HUJF 1URLA 2C1PA 1PAMA 2DQIL 4IIQC 4LCUB 1T4KA 1L0XA 1NFDF 5EU5B 4G8FA 2ADFL 2Y2WA 1BG1A 2RBLA 1H0DB 3DMMA 2ZCHH 3SDYH 2O61B 4EZKA 2OQJB 2WMPB 5TK4A 3U36B 3BGFC 4YPGA 4IGBA 4TRPL 2QFPA 5C09E 5IMKA 1E27A 2Z6FA 3GI9L 3VXPB 1BVNT 5ISZE 1JXFA 3MV11 1HSAA 3PF2A 1J48A 4LEXL 2MIZA 1HL9A 3MXVL 4DWHA 1NOAA 2IFFL 2GSMB 4I88A 4JRXA 4LASH 3X12A 3L6FA 2EVHA 1EERB 3GZOA 3VFGL 5C09D 1Z5YD 2NY3C 4AUYA 2D4DA 3MJ7B 3ULVF 3RTQB 4MZ3A 5IBUB 4KRPC 4ZJ9A 1T80A 3AXLB 2G9HA 5L7XH 4JHVA 1IGCL 1O5PA 2X4PB 1MKFA 4CADB 2CR6A 1JCKA 1RHHA 1YECL 3QXAB 1OOAA 5L4MA 1MY5A 4WK0B 4Y2DA 3BQVA 3W57A 4XN1A 2FJUB 2PYEA 1A6WH 3QHFH 2VQ1B 1KCRL 4YHPA 5I82A 3BKML 1BGXL 4P04A 2W65B 2ICWB 5C0NC 1KPUB 5HPMB 2X09A 4KKLC 4OUOA 3IS1X 1Z3GL 3EBAA 1DQKA 1MFBL 1RQ5A 2QQNH 3QIBD 3T2PA 5LG6A 1IQDA 4JY5H 4K5NA 1RZIB 5M94B 2CCVA 2APSA 1N0LA 3B8SA 1B0GA 2BNQE 5EU4B 3T0EC 2X0UA 4W4OA 3MRFA 3RL2A 2ZUQC 2FSDA 4GAJH 3RNQB 2YQBA 4KTGA 5BMFH 5IEKA 1A6TA 1JZJA 3D50A 4Q6IC 5D7IA 3MJ8B 3B8YA 3TZVC 4HOZA 3TCLB 3AM8A 4LCWB 5DRXA 1M4KA 1YNKL 1DVSA 3EJCA 3TEYA 2FAUA 3V6FA 3QQ3B 3NZ8A 4G6KH 3GJEB 1E4XI 3VI3E 5GQBA 3D25A 5SX5K 4N24A 3TXAA 3Q2WA 3S37L 2Y5EA 2Q8BH 4ZUVB 4GW5B 4XP5L 1ZV2A 1YMHB 3ARGB 5I6XB 3O45B 4JDVB 4Y4KD 3SQRA 3RGVC 3F04A 4KI5C 5I6MA 4HKJB 3VGFA 1G5AA 2GBVA 3KLAA 3ISWA 3UBFA 2IPKA 4JO2H 4N8VA 3WN6A 4IIQB 2IXQB 1X7TA 4ZQKB 2R0ZL 5ACMA 4AEHL 1UFGA 1PNCA 4QTFA 3T0DA 4WI3A 1NCDL 1ZTXL 1UVQA 3SQBB 4LCCA 5GGVL 4OD1L 3PFUA 2D9QB 4YSSA 1D7FA 1THCA 2EIBA 1CC3A 3IPEA 3HZ3A 4KKNA 3BGFB 5J12C 3LQAL 1G84A 3VD1A 3RU8L 3GMMB 1J5OL 4MB5A 1KOAA 4GO8A 5FYJE 2BIMA 2VC2L 1X5MA 4E68A 1SFHA 3DO4A 3MBEA 3Q6GH 3HBPA 5LXGH 2NY3B 3X17A 4E9WA 1F2QA 2WQVA 1YN6B 1EVTC 3NCBB 3MTRA 5F1SA 1KIPB 4GKNB 4KRPB 2NZ9D 3VD7A 1YEGH 4Z7WA 4OVVA 2NY1B 3ZDZF 1RFDL 1QSEA 1Q72L 5JPMB 1GGIL 1PJWA 4HBCH 1EFXD 1WP6A 5C6WH 4M5TA 3T3ME 5CZXC 2ZF8A 5IB5A 1G7QA 1KLFB 1V3LA 2GY7B 3SQOH 43CAB 3T3PF 3VI4A 2CALA 5MEPA 3FTVA 4FFTA 4Q89A 2QVFB 3EGDA 4NCC2 3U30C 4XNUH 1IM9B 2MRYA 5E4OA 3BC9A 1NLBH 1V55B 3DSNB 4IDJL 4R90H 2C7FA 5JHDB 3EH3B 3UO8B 4O4YL 5I1JL 2B08A 1EVUA 2V17L 5ECGA 3CN0A 5KN5B 2XVKA 3PL6A 1FWXA 3U4BH 3GUTB 4Y5VC 2VWEC 2P5WD 3T0EB 4MA3A 5KBKA 2ZUQB 1IVLA 2J71A 1NGYA 1UCBH 4IYKA 7TAAA 1HYSD 1HS6A 1AGBB 2H2PD 1DEDA 4Q6IB 4X50A 4MWFA 4N0RA 4D0BA 2EDRA 1ZT4A 1OAQL 3B2VL 1BSIA 1YNTA 3FUEA 3VG0H 3L13A 3VXRE 4CW1A 5E03A 3UAAA 4LNRA 4XP6L 4FQHA 4ZFZB 2MPVA 5CGYC 5GGUA 4OCRH 4AE1A 2O93L 5F1NB 5KSUB 2W59A 9CGTA 1S9VB 3MJ9A 2GK0A 3SYOA 1J1PL 5DF0A 4E9LA 4LLDA 4HAKA 3VD5A 3IXTB 3EOBB 3M7OA 3RGVB 1LE9A 4F7MA 3U83A 1FC1A 1OQOA 3LNGA 5JQ6H 1LEIB 4H25A 2F0CA 1HCFX 3SZ6A 1ZT1A 3HA0A 5EUOE 3TH2T 3WJJA 1P7QD 2P28B 3A4AA 3DX8A 3P4NA 3CIQA 4LLVA 1PJ9A 4XZUA 3OG4B 3ZMEA 3JVFC 2QDWA 4KDWA 3FCTB 3I3DA 3L4CA 3AAZA 3P2DA 1AKJA 4QRFA 1DCEA 1ZPLA 1R75A 1CTMA 3ZE2F 5J12B 2F7IA 1WAPA 2BFVL 2ZWZA 5E8EA 2F74B 1A6AA 1SYSA 3WEAA 4G8GD 2CO6B 5HHOB 4GP5B 2UWEA 3Q3GA 3ETBF 4JFDD 2D7MA 4JO3L 5EUKB 5I24A 1Y6NR 3HI1B 4PJ8D 5GS2D 2IALB 5TH2A 4DJMA 1A4JA 3FO0H 2WBWB 4FFYA 2OMWB 4ACTA 1IIKA 3F6IA 4QMEA 2Q9OA 3BX7C 4ETQB 4LRIC 3MR9B 2E46A 3AGVA 2BIQA 3GSRB 4XPHL 5F9OH 4WWKA 3CMOH 3T6WA 3FAXA 4XNYL 3TWCH 1JVLA 4H26A 3QJQB 3V4VA 5I18H 2PPDA 3T2LA 3ATDA 4Q56A 1E7UA 4HLEA 5I76A 3SJVB 4MA1C 1UHVA 4IRZA 4N0CD 4TVPE 2AJXH 3NP3A 3U30B 2GTZA 5T1LA 2CIIB 4N2AA 2UV3A 3FBKA 5I66B 4D0DB 5TF0A 5JIDA 4LSPL 3BFOA 1S7WB 43C9A 5T33L 2FLMA 4GKSB 3PWJB 3FFCB 4TVPD 5IROA 3RNKA 4RZCB 1FGNL 3OJMB 2ZCLH 1MY7A 3B2PA 5GZOD 1M6OB 4R84A 3VI4F 1G1OA 5FB8A 2WSPA 3RPBA 5F7KC 1A2YA 5J6SA 4AI7A 1TCMA 1CK0L 2OYPA 15C8L 3DUSB 1EZVY 4Y5VB 5FYKL 3ZDYF 2HH0L 1LNUB 2WYIA 2XDHA 4WI0A 5JMRA 3FRPA 2AEQH 5DQJB 3N44B 4X4YA 2LHAA 2DM2A 3ZT7A 3QNZB 1A47A 2BDNL 1MJUH 3L1OL 4L4VA 4BKLA 5FFOA 4YR6A 2BRRL 3RWGA 2B1AL 4U49A 2WWMD 3MUZ1 3H6AA 1FFOB 5FO8B 4I9WD 3LNIA 1DQLH 4A2DA 3BWUF 4JFFE 2J8UE 1B4JH 4PJGA 4NO3A 2HRPH 4TYUA 3KBPA 1BOGB 2WNWA 1IC5L 3MV8E 1BOYA 3MBXH 3DUUA 2QQLH 4FJ6A 1JK8B 4JFFD 4UU9A 2JXMB 3QR1A 1ICTA 1TPXC 1X5KA 1YMMB 2F18A 2B2XH 4MJIE 2ZNWA 3ZDXE 1N2RB 3SKNB 1S3KH 1SF5A 3JTBA 1W72L 2Y2YA 2XN0A 3WS6A 3T8XA 4ZUUA 3MLRH 4HG4K 1A8ZA 1E4KA 3Q8EA 4KHTL 1ACYL 1IM3A 2Y7QA 4ZOBA 1NKRA 3BN9D 1J8HB 2VSDA 1JPGB 2FJHB 1UWGH 1XR8B 3FQRA 4FNRA 4H0HB 1GAFL 4U1KA 3T4AA 1G6RL 1U91A 1JPTH 2JELL 1VFBA 3P4LA 1EHNA 4HC1L 1QFWM 1WH0A 4XO5A 4HV8B 2DH3A 3QEGL 3IPFA 4KUCF 4M9PA 4OBSA 5DWUH 1KJ3H 1OLZA 1AGEB 2YPVH 4P5KB 3FTWA 5JW4R 1J5DA 1I8IA 1NL0H 3QO1A 3JT2A 3L7EB 3VNZA 1MCKA 5A2AA 1I4FB 2WLJA 1UA6H 3UC2A 3ULSB 4N1HB 1NAKL 4WI5A 2HVKB 4HFUL 4JFUA 4KFMA 4ZFOL 2BSEA 4HT1H 5DUPH 1CDCA 3UO1H 1CLOL 1CLYH 2BVPA 3DIFB 4MMXA 4KZCA 4UILL 4S0TD 4PMFA 2WKLA 5DR5L 3RKPA 4ZTOH 2N1TE 2IDFA 3QEQB 4LPTA 2ARJA 1ZLSH 1FZOB 4JRLA 4NRXA 3V9CA 4DZBB 4MDJA 4JO4H 1TVBA 1PFCA 3AU1A 3KXFE 5LAXA 3X1GA 3ZKXC 4MA1B 1NM4A 4NN5C 4GB9A 4O02L 5SV3A 1XSKA 3F2LA 2MQ0A 1ZLVH 4KNUA 4NRYA 2OXHA 4YHKL 1TLMA 1ZLUK 3VMPA 3D5OF 3ULUE 2GJ6B 3BPCB 5E7BA 2KC0A 3L3JB 3OXSA 4PW9A 1JS4A 3I2CL 1D5BB 5C0RL 3JWOC 4K23H 2AK4E 4I18A 3T2OA 3ULUD 1K8IA 1P4IH 3LZOA 4W1TA 5TE6H 4LPWA 4I4WA 4WKZA 2XRAL 1M9WA 4MRBA 3QXDA 3FB6B 1D5MB 2YJLA 3ROOA 1X6NA 4PD4J 1ASQA 2FQEA 1D9KD 1GL4B 1ZV5A 4WW1A 1SXCA 2AVGA 3DBXB 3RZCA 5ACZA 1DDHB 1GKOA 4G6AD 1CICD 2TSBA 2JMRA 3NACH 4UQEA 1G7IB 3VE0A 1MHHB 3ML9A 4KO6A 1VB9A 1N0XL 3QDGA 3FC8A 2CO7A 3HLAA 4O2EA 3OHMB 1KFGA 3NH7H 1CF1A 4YBHA 5DZVA 3QUKB 3WSQL 3H42L 2OMVA 1C5CL 3OAYK 4M1GH 4PREA 1TPXB 1ZGLB 1N8ZB 3TU6A 4AH2A 1IBGL 4X7CC 1P7BA 3NMEA 4IRSC 4U3HA 4BFJA 5EULV 4GUPA 5IJVA 4FQXA 3BPLC 1T89C 1ECYA 3A47A 1Q9KB 1NEZA 3T6QC 4DGYH 3PWPE 4NHCL 3H85A 3OZ9L 2UZXB 4WU5B 2F53B 3HIZA 5DJ8A 1QA9A 2VR7A 4AYFA 5HI5C 1D2OA 3CVHA 3JWOH 4HS3B 2EYRB 3T2QA 3B34A 4PRBA 2P24A 3AC0A 5TGBA 2CU9A 1HXYB 2GSGA 3CJJA 5FWRA 2DWTA 3SBWC 1E67A 4NQCA 3DETD 4ZMQA 2X4SA 3QFJE 3E1ZA 4YGAB 2ILLA 3IDGB 1M9SA 5H94B 1F00I 1U8JB 4UANA 3T04D 1A7PH 4LAJH 4LMQI 4PJIA 2XNAA 4ZFGH 2DQFA 2WWNA 1CLCA 3OWRA 1A4AA 5F93C 1KC5L 4NNXB 2IO5A 3LNEA 5FYJL 1OGTA 3OB8A 5C7ZA 1Z9OA 3U82B 1BLIA 3ZKXB 2WINB 4NN5B 4Y16C 1FVCA 4LPXA 4PRIE 1U2CA 1MFEH 4Y5YC 2R1YB 1RIUH 1N5YH 1LD9B 3RIAF 2VN4A 3AS0A 3VXUB 5DYOB 1QMUA 2WPGA 4E9XA 1TETH 3AUWB 4GYBA 1FZJB 3CTTA 1NCNA 3WIFA 3MKKA 4JHZA 1NBZA 1U8KB 4AUUA 1MZYA 5ETUA 5IF0A 1TT6A 5AW0B 4WI9A 4AV0A 2UYLB 1MWAA 4WDIA 4HBQA 3S35L 1FLRH 4DCQA 5A7BA 3SGEI 2V5SA 4UDUA 3UROR 4Z77A 2H32H 4ATTA 3HC0B 1FNEA 3ALXA 5I5JA 1LL1A 4J12A 4G43A 4MJ5B 5IVZA 3TIDB 4U1JB 5LGYA 2OSLB 4BSWA 1MEXL 2Q8AL 4FQPA 1U8NA 2A5UA 3FCBA 4Y19A 1SLUA 3TCXA 2VZ1A 4OJCA 5DD5H 5ITFB 1I1FB 1HEHC 5CGBA 4IU2A 3OGCB 5CFHA 5ALBL 1BXUA 1ORQB 4UTAH 4EZLA 3MGOB 2QR0B 2R1WA 4YHIA 1UXSA 1KCLA 1A21A 1UB6B 5JNYB 1BVZA 4UM9A 4F9PA 2QPUA 1DQTA 4JB9L 3G5WA 3UZEC 1WIPA 4HAGA 3QDHA 2HT4D 4YVNA 4BFOA 5HGBA 5F7AA 1KACB 2PTUA 4JQIA 4IRSB 4HKXA 3V95A 3AQZA 1CZ8L 3HE6C 3NOIA 5HJ3A 1XGPB 4ONFL 3IGAB 1EUUA 1Y07A 1KXVA 1BBDH 4HIIB 3BPLB 4XVSL 4KZDH 4OV5B 4IS6B 2XN9A 5EOQL 1AGDB 1IX2A 4NZDA 2WUBH 4XC3L 1P4BL 4DP7X 4FG6C 4HSCX 2I24N 2VDOH 3E38A 3KWWA 1FYTB 1GZHA 4MS6A 5D6CA 1IFGA 1IGYB 2B14A 5CSZB 5GRJL 2X4TA 1XGRB 4MA7H 2H32B 5D4HA 4U1IB 5DHXB 5F96L 3EXJA 1OSZB 3V4LA 4D0CA 5GJSL 4MASA 4HFWA 5BZZA 1ETJA 2J1YA 3RWJA 1ADQL 1S9YB 4S1RH 2DI8A 1SJEA 4Y4HC 2E5EA 4UF7C 4CJ1A 4XX1E 3CCHB 5EBMB 1KFAH 3MA9H 2OTWA 4U6VL 2LV4A 2X4UA 4X6CA 1E8YA 5FGBA 2ZICA 2A77L 1X5LA 3TNNA 1UB5A 1V7NL 1WBXA 3CVIH 3EYQC 2FZ3B 1QVOA 4ZW5A 3R7QA 4BJLA 1MCHA 1T2QL 2GT9A 2WN2A 2R9HC 3KCPB 4IKKA 5T1KD 3ZRCC 1G7JA 1DLHB 1QBBA 3NIDF 3MQIA 3U1SH 3BVDB 2QGCA 2E75C 3ABLB 3TT3L 4EN3D 2VAJA 2F1BA 4AVJA 2IDQA 2X0WA 4XBGB 1WYJA 1CG9B 4Y16B 4M7JL 2VL4A 4Y5YB 5L2KB 4DP8X 5JIQA 3P9MB 5ANHA 1MJ8H 1SY6A 4Q0XL 2Z91B 1E5UI 5KYXB 1QNZH 1RIHH 2HLAB 2PR9A 3LDBC 1ZLWK 3HG4A 2VDOB 4DP6X 2E4TA 2PXYD 1WWCA 4HHGA 4UTBL 3WJLC 3LRSB 4I2XA 1ZHKB 3S37X 5TFSL 1MPAH 2O5ZL 4JG1H 5J1TC 1ETB1 3AT9A 4TVPL 4F2ME 2EINB 1KULA 4L9LC 3PUCA 1GSMA 1JXKA 5B7FA 1ZT7A 4L2LA 2VL5B 4GKZB 5DD6A 2H1PL 2VITB 1E28A 3CZFB 3N1QC 5FYLH 2DTSA 5D7LA 3BHBA 3PE9A 5DS1A 3L3DB 3V5DA 1SUJA 2XSKA 4KKAC 4D2NA 5JHLL 1KNOB 4Q9QH 4MMZC 3WY1A 4J3XA 2J6EL 1MELA 3UTTA 4CVZA 2A74A 2BY0A 1AS6A 1MW2A 2GAZA 3VCLB 5KS9E 1SZNA 3WTVA 3SPGA 5J5EA 2H26A 5FM5O 4M93C 4HUWB 3U9UB 4N0UB 2OJEA 4K07A 4ODSH 1F2XK 4Y7MA 3MRNB 1JYXA 4WO4A 1MCRA 5LBSA 1C7TA 2UXVA 4HVBA 3ECBA 3KNBA 2BIOA 3GSQA 5L6YL 3HE6B 4GG6B 4PWFA 2VDLL 2WLLB 4D9LL 2FX9H 3PWNB 1BZ7B 1ILUA 1MAMH 2FRGP 3I9GH 5D4QA 4PP2A 5C0CA 4KUZH 2X7LA 5ES4B 1J8SA 2VN3A 3NFPA 5TDNA 4FABL 3O4LE 3G5YB 2DQTL 3BVXA 3U36A 3ZXAC 4TLUA 1ZLDA 4ENEC 4LAQH 5EOTB 2XWCA 1XSOA 4EBQH 2EO9A 3N6YA 1YEWA 3QISA 3PJSB 4JMXA 1Y18B 1KGCE 2CCWA 3CN3A 4BSJA 4DP4X 3OSKA 4P5TD 4Y4HB 1H5BC 2JCWA 4XVOA 1XF5A 1XXFC 3VJ6B 1KY7A 2EIZA 1BVLB 4YAQB 3LEVH 1KGCD 4HUVB 5D7JA 4NQXA 1JZ3A 1T2JA 4BXVA 4ICWA 1SDDA 2NPLX 4GI6A 2WXRA 1R5VA 4UV7L 1KGUA 4Z0BL 4NZTL 3LNDA 3OJDB 3IU4H 1JHLH 2OR9H 2QHRH 3MRQB 3NSJA 4HGMA 1UT1A 4W81A 3SKJH 1TZGL 4P4RB 4RQQA 3KGUA 4JR9L 1A6ZA 1EJ8A 2QEJA 3IMUA 2ENYA 3PQYA 2CDGB 4LT7A 3G9VA 4NIYE 4OGAC 5I1CL 2Z31C 1AD0B 1CFVL 2VT0A 4W4NA 2QSVA 1G4MA 2OAAA 2BP0B 4X80H 2WCGA 2ZKYA 4I87A 3WFHB 2BSSA 3APMA 3NA4A 3X3GH 3IFNL 2HTLC 2YR3A 1FO0H 2DRUA 3C9NB 4JHUA 4UMGA 3VWJD 3WY4A 2CQVA 1EWHA 3LDBB 4GP4B 2CJUH 2B5IC 1T66D 4K8RC 4PRPD 1OSYA 4AGNA 2NNAA 3ZUCA 1P7HL 5DO2D 5JQHC 2AV7A 1KELH 3NFSL 3QUZD 5LNEA 3LKOB 2CO4A 2B15A 3MLUH 2UVFA 5CJQL 4M43L 3S3SA 2A99A 4OCNC 4L9LB 4UQ2B 4ODXA 3NJHA 1B2WH 1GW6A 4P3DB 2X2UA 4OLYL 5TE4H 3S2CA 4PGEA 3FMGL 2W9DL 4YLCA 4RISH 3W11C 3ULUL 3ARDC 2WXKA 4OCXL 2IANE 4H5SA 3HB3C 4MMZB 2IAMD 1QYGL 4E5XB 2X1OA 2GHWB 3MLYH 3EH4B 1IGMH 2QLYA 4OZFG 4Z5RB 5B8CA 2VZSA 1KYAA 4M93B 2EYSA 4IBWA 2YPLE 1JGVL 4BA0A 1AG0A 4OCWL 4JDVA 4JM2D 5GGRB 1LO3L 3CZGA 4ODUA 5LN4A 4YDJB 4WFHD 2NYKA 1R3KB 2GJZA 3WCYA 5AZ2L 3X3FL 3TESA 1FRGL 1FO0B 3N85L 4QHMB 3NJXA 2YPLD 1D7DA 3SBPA 1LDPL 4LPCA 1QFOA 4J8RA 3P0VL 3N40F 4CU8A 1JPFB 3CSGA 5CEYB 3I9PA 4LKXB 5DK2B 4BYHA 4FD0A 2NXYD 2WVTA 5GJTL 1HHKB 1W15A 3GS7A 4K8RH 4UINH 2PTTA 1FDLH 4NOFA 5C07B 3VSUA 4JQXA 1IE4A 5FW6A 3TH4T 1U95B 4G7VH 1Q8MA 4XNQB 4R7VA 1PTZA 2Q6WB 3K8KA 4JY6A 2VE6B 2XX0A 3NGBC 4I85A 2EC8A 1H5BB 2WXMA 1CXFA 3QUYC 2J2ZA 3RWCA 3S3PA 4UZUA 1D6VL 2HPTA 3ZR5A 1ASPA 3EYOA 4A7QA 4HW6A 1OGAD 4ALAL 1TZIB 2C3XA 2BS8A 3VGDA 4JVUA 4OBRA 2MOQA 4ZFFA 3W0WD 4MZIA 2MQGA 3IU3B 3L81A 1T0MA 3GTNA 1KZQA 5ID0A 5JPMA 4DPRA 4PS3A 1LEGB 3OKLA 1UM5L 1WDAA 2AMGA 3PABB 4NYLB 4X5PA 3H4FA 1NINA 1REIA 3UIZA 3C6LD 2BY1A 3NCFB 3X1BA 2XVBA 2ZOTA 6FABL 5EOCJ 4ZTEA 1QI5A 5GSVB 1E6JL 1CDIA 3MDJA 2QPSA 5B4MC 1Z5HA 3PWVB 4ZDHA 3RUGB 4OV6F 1V10A 3PYCA 4HF5L 4MNGB 2B5IB 3T2NH 2XWTA 4HWBL 5CU5A 3JXAA 3CPLB 4RZKA 3IGKA 4ZPTB 3UGUA 3G9AB 4IM8A 3ZO9A 1DSFL 4MAYA 1A0QL 6CGTA 5CILH 4CMHC 3DRQB 5CAYB 3VD0A 4LDLB 1S6NA 2HMID 4ZUTB 4QTIH 1X7QA 3H7LA 5CBEB 1FNGB 1VF5C 4MQ7B 5FDYA 4GQRA 3V5KA 2FECI 1GGCH 4KTEH 3X2QB 1AACA 2RHEA 2VOTA 4JPIA 2JJTA 1XVSA 3BQUA 2V2XA 3K3QA 1MFBH 3FH5A 2CRMA 4G8AC 3D2UA 3UBXB 1MI5B 1NEPA 5DVPA 1M05B 3ARDB 4G6FB 1KCUH 3L1FA 3P3SA 4Q6YA 5I8CB 5I0VA 3KVDD 3HB3B 4ODVH 3B2UD 2J73A 1IEBB 1S7XA 3KPSB 1H9VA 2F5BL 4ELKA 25C8L 2VLRD 1Q9LB 5CP7A 1NAMH 3TO2A 1OAUL 2AJZB 1WWAX 3COOA 3V6OE 3L4VA 1K9TA 3TURA 2FD6H 3IXTA 4XT1C 3K2UH 3KPPB 5IG7B 3D3VB 3TEUA 4GQPH 1HZLA 5L4JA 1MJJB 2HFEB 2OL3H 1BBJA 3HN5A 2BERA 2ZXEB 5HYQA 4ZAKA 1HNGA 1O9WA 1NMBL 2W1NA 2ZKWA 4F27A 1K3IA 1SFDA 3UTSE 3PHSA 3S37H 4MXQD 1I3RA 3T6XA 4LLQB 3RVTD 5FIEA 4X8XA 3QAZC 5AVXB 3UTSD 3DX2A 3G7TA 4J4PD 2ICES 2VCOA 5IJKA 4MNQD 1XGTA 4OD2B 2K3TA 4EZJA 4G6JL 4OF8A 4Z3JA 1W9XA 5DJYB 4EIBA 5EC2A 1SUHA 4AEHH 1MNUL 1EGJH 4W9KC 4D3CL 3RVWC 4XPBH 3SY0A 3NGBB 4GAYA 1BZ8A 3D4ZA 3FK3A 4X5WB 4M6MH 3VXNB 3MLWH 2NTFB 3QUYB 4YXLH 5KJRL 3TN0C 5KYWB 2HN7B 2D0GA 4FXKC 1HSBB 1F4AA 1GYCA 2VIRA 4JFTA 5B3JE 1AP2B 1NAMB 4CN1A 2WVUA 2FGZA 4PM1A 3IWVA 4C59B 2VC2H 5C9KA 1VAHA 2ZOUA 4MX7B 4N9GA 2BXZA 2VDQH 4TVUA 5CHNA 1JK9A 4E41E 4DAGL 5ESQA 1U93A 4TV3A 2D3JA 5E1IA 5BZWB 1GW0A 3L95A 2OL3B 2GTQA 3MRHA 3QUML 5F72S 4HIEB 3ME0B 1YPZA 2CIIA 1KCSL 4A7SA 4D0DA 4MQXD 4XPAH 2W60A 1OALA 4DN3H 5LNDA 4IOIA 4K9JA 5DZ9A 1KGIA 3L3HA 2X44D 3WHE0 5C6TL 4QAMB 1M6OA 4YHOL 3L08A 2F8OA 4PJXB 1E4WH 4NPYA 3U4KA 4F2FA 4OFQA 1F56A 3DX9A 2GHZA 4CMHB 1DEEA 3QRFM 3DJSA 2Q76B 2WSDA 3ASWA 5HI3C 1NA8A 1LILA 3WKPA 4H1LG 1LO2H 4O4YH 1DZBA 4Y2LA 1EHAA 3DMMD 2I07B 3W82A 5IEHA 1Q0YH 4HDIB 3EOTL 2AEIT 4IGBD 3CQQA 5J11B 4BINA 5D1QC 1AY1H 3QO0B 1BWMA 1MFCH 5CEZE 1AC6A 3B43A 1A64A 4M5ZH 2VC2B 4UYQA 4JRXD 4ERSH 5HGHB 2HVJA 5B22A 5TPWH 2VDQB 3OHXC 5D70L 1OD9A 3IF1A 4L0YA 1EZLA 3QQDA 2GITB 1L3WA 1M3JA 2Z7WA 1UXMA 2IGTA 3N1FC 3LKRA 3GXDA 2Z8RA 4CNIB 2PYEE 2WD0A 3EADA 4KY1H 2GB2A 3HPLA 4CBZA 2YZ1A 2A2QT 2PW1A 4Y2DD 4ODHL 5KVGE 3EO0A 4MS8C 1J1PH 4XMLH 1HHGB 3QCTL 3RE0A 2PYED 4GUOA 4F8OA 5T3ZL 1MCWM 3RL1A 2CLRB 4DW2H 5LJYH 4KI5F 2R0LL 2D7QA 1HIMH 3CN4A 3TGXA 4YDVB 2Y1YA 3QAZB 3K71B 1P53A 4N2FA 4HV8A 4Z7VB 2NW3A 1O7DE 3V5HA 4RMQA 3AY4A 4X6DA 1WG3A 4NKIH 1MSPA 3WFCL 5EIIG 2NY5L 3TTYA 1EQWA 4RX4D 1JFQH 1A7QL 3BWZA 4UUJB 3TN0B 2ZPKL 3HR5A 3OR7A 2CLZB 3O3DA 4AUJA 2QQKL 4FXKB 4YE0A 5CEXA 1UJ3A 1OT2A 2KKQA 1QAWA 2BFVH 5D1XA 1IMHC 3CH1B 3FCSB 2QVIA 3IMTA 3QH3B 4HJUA 4W6XB 3GBEA 4XXDB 7CGTA 4FNLL 3K81A 2KUTA 1MXGA 4Y8DC 1G7HB 2VUYA 3RHWF 5ENWA 4PHZA 3GTTA 4AQ1C 3N9GH 3OX8A 4XN5A 4QIRA 5D6DA 1SN0A 2CHWA 2Z1PA 1L4IA 5TQ0L 4F1ZA 3J8F7 4FQLL 1SBSL 2OZ4H 2VO8A 2Y7MA 3FL7A 4L4TA 1JAEA 1JZEA 1IU1A 1OTSD 2TRHA 3FCUB 3LN5A 4NCC1 1BZOA 5IT2L 3O8XA 3HS9A 4GUCA 1DQJB 2B3RA 4IHOA 1OPGL 2XACC 3CFUA 1O7SA 3GLAA 4XX1G 4MYWB 1HOCB 1UFUA 2P3YA 2G5BB 4LVOC 1K2DB 4B97A 3KPRE 1T22A 4BQ9A 4OZHE 4QCIB 5IKCA 4Z0XB 3SYCA 4Z18A 3UBGA 2V2WB 5CWSB 4KKQA 3BRGC 3O6MH 3Q5OA 1BD2A 1XH3A 2GIYA 3LIZH 2X6MA 2MKLC 4LSPH 4QYAA 5K5YA 3HZVA 3MJ6A 1UZGA 3MRRB 2D73A 1IGTB 3GIZH 2RFXB 5E4IA 5B39A 1LMIA 1EAOA 1XIWC 3VGGA 3RY4A 2X3AA 2YBRA 5D1QB 3LQZA 4U1HB 1G7IA 1WC7A 3BUPA 4MCYA 2IGFH 5EMYA 3MBED 5FYKH 3U6XA 3O41A 1S7QA 4Z7WE 2R2BB 4HD9A 4AM0Q 3OHXB 3LPPA 2EXSA 1UKSA 1K8DA 4FLQA 4U33A 4WUUB 1QSEE 1X9QA 9PCYA 4OZGE 5EU6B 3IMBA 2BDNH 1R46A 3OQRA 3NRQA 1SJVA 2WZ5A 3GSUB 2VR8A 1Q0XL 5CZVH 1SVCP 4MD4B 1E4XL 1SF3A 5IY5B 3CXHK 2R0WL 1QSED 1DL7L 3MPCA 3U7WL 5I15L 2BX5A 3UTZB 4ELDA 2PR4L 2ZSVB 4UQ3B 4ZMTA 1IC5H 1YEEH 3L9EA 4NAJA 4YGVB 4WI6A 3FU0A 1P5UC 4KRMB 5J7CC 3H9ZA 3QRGH 4CDHA 1V54B 1QFWI 5IHZA 1AHWA 1DBAL 3ML8A 1EEZA 2AEOA 4WF7A 3HNTL 2DM7A 1NPUA 1A7RL 1V05A 4H20H 2XOTA 1Q94B 2UZXA 3W9DA 2F53A 3U9PL 3S7GA 3PXHA 3NSYA 2EDOA 1TTAA 4KHTH 1ACYH 3MO1B 1ORSB 1FVEB 4FZEH 2EKSA 2DWEB 1NUDA 3DNKA 1TEYA 3PL6D 4EDXA 4LMQE 1JF6A 3H3PL 2XQYG 1YN7A 2DEWX 4WVRA 5D2LA 3NZUA 5J8OA 2V9TA 4G8IB 5EO9B 2VLKE 3GBNH 3Q8BA 5EORL 3MOAL 4GAGL 4JQVC 4X5QA 5FC9A 4HKBB 1FGVL 4G1EA 2KS0A 4PS8A 5DJZA 2YHGA 1FAKT 3MLTA 1YNLL 4FYTA 1KV7A 2VXTL 3SO3C 1RURH 2VLKD 4HALA 1CDUA 3T0AA 2CBPA 1I53A 1HHJB 1JFHA 1OF2B 1L7IH 2C9PA 3L17A 1FP5A 4NENA 4NT6B 4RMWA 1SYVA 5EO0B 2EIDA 1RSYA 3MV9B 5BZXA 2MQ3A 1SMDA 1EXUA 4JKLA 5DYOA 3CDGB 3ZQXA 5DHYB 4FQIH 4OTXL 1MCBA 1SQMA 1FZJA 1M71A 1TQSA 1U8KA 4L9DA 5F9JA 4P46A 3S6CA 3S5LA 3BKJL 2Z7ZA 4DEPC 3N04A 3L3OA 2O5NA 3ARSA 3TPUB 5I5MA 2ZD0A 4GQ9H 4LBAA 3SB3A 3ZTCC 5IMLA 3GO1L 1PZDA 3GI8L 4RRPM 4Y4KC 4TSBL 2BCMA 2JWYA 2HTKD 4DGVL 1HK6A 3WELA 3ZL2A 2F19L 2E9GA 3FJTA 1JYVA 1T21B 3GXPA 1AKJD 1XIWB 1ZHLB 2QZ5A 5AAMA 2VLLB 5DJ6A 4XCFL 2WN3A 5EDXA 1H8NA 3MNWA 4P5SA 3V0HA 4K2UL 2YQ3A 4NC0B 4PJ6A 2W80C 3V4UH 2Z4TA 3JWNG 3K6OA 3MREB 4QGTA 4KXZH 1U42A 4YX2L 3ZTJG 1HWGB 1I1YB 1LGVA 4LEOB 3FBQA 4KAQH 3D85A 3EBHA 1AI1L 3GKWL 4UOJA 5E2WH 5KVDE 1CD1A 2NW2B 3NK3A 4Q58C 3PIQB 3TFKD 2OR8A 4NO5B 5CJXA 2G2PA 2BS71 2H0EA 4AZ8A 4G2AA 4QNPF 1WAAE 4OM1L 1NGZA 2VO5A 4UIMA 3R0NA 5EN2B 3P9LA 5IVNA 3LZFH 2FT7A 2LVCA 1N0XH 5C09B 3FQTA 4HIHB 1MLCA 4P2OA 2CDFB 1XGPA 5ERWB 5H4YA 3V52H 2CHNA 1IC1A 1P5UB 3WSQH 1DVFA 1ZAGA 3H42H 2YC1B 4WSKA 5T1LD 3HHSB 4OQTH 4EMZA 3L9BA 4V2BA 4IJTA 2V2TA 4R4FL 3UPCA 1BIIA 1FE8H 4OIIH 5IROD 4JGJA 2MKWA 4IRJC 4PJEA 2BPBA 5C0BE 1WLHA 5KWYC 5G5DA 3S9DB 2HLEB 4WNQB 1I8MB 1IBZA 4P9MH 2BXYA 5FGCB 3BIKB 3SDDA 3DJ9A 4OF7A 1N64L 4L4VE 4RAHA 3II1A 5C0BD 1B6UA 1KPVA 4ADGA 3DTXB 5JIHA 5L88H 2BSCA 3GNMH 5F1IB 3WHXB 2C1OA 1VCBC 4PR5A 3AY2A 3QIBB 2XTJE 4GQQA 2Q5BA 3A22A 2DMKA 4L4VD 2IH1B 2MSPA 1JHKH 2DQEH 2KLTA 4PWKA 4N3TA 3SO3B 1C5DB 1HXMB 1OXYA 4M6NL 4TTGA 3GMNB 1MCJA 2A6IA 2XTJD 3ZHDA 4C57C 1AZCA 4OFKA 1HYSC 4X42A 2H2PC 5HHPB 4LHUG 4FLSA 3SGJC 1XTMA 3CV5A 4EJ1C 1A1OA 1SLVA 1IKNA 2EDFA 1LE9B 3TYFA 5CXPA 3H2QA 1KC5H 1DVZA 3QCVL 1BZ9A 3I6LE 3L2NA 4PRDB 4R0LC 5F7DB 5FDWB 1X3DA 4APXA 1KEMH 1KXTA 5JTWA 2WYTA 4NHUA 1FNLA 1HHIB 4J3OD 4DEPB 3W1ZA 3KGRA 1IM3D 5D7KE 2NLJA 1KEGL 1YEKL 4KKZA 3KG5A 1BAFL 3KJ4C 4FFZH 4Y4KB 3VI3B 4XPFH 4CGUB 3DC0A 1GZQA 4U6YA 2JKLA 2GW5A 1XBDA 1FG2A 3BW9A 3CZFA 4TSAH 4GSUA 5D7KD 5EOCL 3IJYA 4XNMB 4EI0A 5FUOH 2DQUL 2Z8VC 4QRSA 2FL5B 1YEFL 2PF6A 2VABA 3DGGB 1IARB 4CVUA 3CD4A 2YRPA 3X1NA 1MCPL 5MENA 4FLHA 3A0OA 4W9CC 4DGUA 3X13B 5CINL 4FNPA 2HKHL 1D7CA 1V27A 1CBJA 2YMXL 4X7TB 1PNDA 2BSED 2NZ1A 4MMYA 1I8LA 4Z3FA 4F57L 1UD2A 5AW2B 1GKEA 1Q9WB 4PJ8C 4AGLA 4GRMA 4AMKL 4M6AA 3IBEA 4NQEA 3BDBA 5D2NE 2XZAH 1JTOA 2HJFA 3LH2L 3TBTB 5CEZL 2JKXA 5ALBH 5D1ZA 2WLLA 5E2TL 5HGGS 5IFAH 1PQZA 2P47B 4OF0A 5FHBH 1OAJA 3AWGA 3DHMA 3VFRB 4NNYA 3NVQA 2GSIB 1EFXB 3GRWL 3JV4A 3ASOB 4V11A 1IBFA 4LLAA 5H8DA 4NKOA 4PRNB 5E0FA 3U7YL 4TOYH 4DPBX 2FJGB 3EO1B 1OGSA 4N0CC 3EYVB 4KJQD 1NCTA 1JZDC 3II3A 5KSBB 1R3JB 1PKQA 3CDZA 5EOQH 5FO2A 3LEYH 4WI7A 2TAAA 1T0OA 5KVGL 3PJLA 4JFEE 2XFXB 3GT6A 3PNWB 4G83A 4KOBA 3AJ7A 2DWSA 3ZZLA 3TV3L 3QJSB 4HLZG 4XAWL 3NIGE 1U8MB 3LZRA 2OV0A 1WWBX 4NKMA 2R4RH 3RZCD 1KV3A 2LT9A 4LQFL 2H6OA 4HH9B 4I0PA 3T4YA 3WU1A 3CXFA 3B5GA 3MRQA 1PPIA 4S2SB 5I1GL 2P5WB 4JHAL 4TPRH 3QDGD 3TVMC 4P0DA 3GXUB 5T5NF 4XCNB 1FV1A 3QYCA 5DEFA 5MEOB 4XGZB 5ESVB 3RG1C 3WFHA 2XBZA 2DQMA 2WWMC 2E27H 3BAYA 2DDQH 1P1ZB 1R33A 4R0LB 1LE5A 2J8HA 1J7VR 2QELA 4MJ6B 3OB0H 2ALWA 2P42B 5E51A 4HPOH 4PCSA 3WD5H 1PZ5B 3DPDA 4RCAA 4NAMA 4ZW7A 4L18A 3DHPA 3HAEH 2G2RB 1JNNH 1NDMA 4FQXD 4IBVA 4JZNA 5EA0L 4I77L 5KTEH 2YPKA 4WFEE 3CSPA 3KJ4B 2XG4B 4FXTA 1PG7X 5E99L 4UQ2A 1NICA 4LSSH 4YHNB 1SEBA 2WLIA 3I75B 5K9OA 1P7QB 5FA3A 1LYQA 4JN1H 5ITBH 3EOAA 2X9ZA 3BN9C 4WQOA 3OVUB 1QQDB 2YS4A 3QJHA 5C0IB 3P77A 4RNRB 1B0RB 2CMRL 1CN4A 5IQMA 2F7PA 1XCTB 3F65A 1CVSC 1TJMA 5EUOB 1Q9OB 4HUCA 1N18A 1J1OH 2E6QA 4L5FE 3VWKC 4DO5A 3RIFF 3ZMNA 2PNDA 2BNUA 1JPSH 1LXMA 3ARBC 2AXGB 2XI9A 4G8GB 1GZPB 2NXZD 1JZ4A 1TJHL 2X87A 5GGRA 4F7PA 4JFDB 2R56H 4YDJA 1F4XL 4PJ8B 1AFVL 3FHQA 5LB1A 3MRLA 1HKLL 5SWZE 5ANME 3EDKA 4F58H 5GS3A 3MROB 4OQ1A 2EE3A 3O3BA 4R3SA 3LRGA 1IAIM 3QWRA 4KRLB 4DKTA 5L2JB 3I50H 3FFDA 5CEYA 4P2RA 2C3HA 5DZLA 2OMUA 4N6RA 3UIYA 3C60A 5IJBC 1F1DA 1IFHH 5HXMA 2ZYHA 1AXTL 1FH5H 1LO0H 4JZJC 1NDTA 4GG6F 1EMTH 3MACL 1J0HA 4DN4L 1UQSB 5L6YH 4H4NA 3UJIL 4F7CA 4LOEA 3SGKA 1OAYL 3S3BB 3T6VA 4JPKL 2CJTA 1ZLVK 1HH9A 2CK0L 1GIGL 3AU0A 2IV8A 3O2DL 4KZ0A 4LU5H 2BOBA 5MEQB 3BP5A 4NERA 2IPUG 1MH5B 4Y19E 3PV6A 4JLRA 5AWNH 4BQ6A 2JJWA 3LZPA 1E30A 1BFSA 5KAQG 4PRAB 4CJ0A 3WMQA 3BUIA 3CXDL 3B5TA 4WSJA 2YGNA 1T04B 5DMIH 4F91B 3KYNA 2LAAA 2Y5QA 4Y19D 5JORA 2J20A 2VLJA 5IB1A 1ZPUA 2AKRB 3D9AH 3P0GB 4ZO7A 3VB8A 2QPDB 1AYRA 1BX2B 2X5PA 5IW1B 1D9KC 4PUBL 3ARUA 5GSVA 2EDTA 3VFVA 1I8KA 2O5YL 3NJVA 1TQBC 4G6AC 4UM9D 1CQKA 2OSWA 4XN7A 1CICC 3EFDL 4MNGA 1I8AA 1TVHA 3O3EB 4DTGH 4FCAA 1P9MC 2XN9E 1URZA 5IGXH 1HHHA 2F7RA 3BH8A 2YAOA 5C0AA 4ZZKA 1A1NA 2EDJA 4LSVL 2H3NA 3EYUH 4M6OL 4JFFB 2A9ML 2J8UB 1DJGA 2JKWA 1B3JA 2K8MA 3EDJA 3O2WL 2XN9D 1FNGA 1DQMH 3FU9A 4XC1H 5C71A 4LESA 3V0GA 2YAFA 1QUNB 1S7TB 5KYYA 4N90E 4DGIL 1QRNE 3EKCA 3DROA 4X5LA 1CXHA 2JB6A 4G8EA 3IKCB 2R7EB 3IDXH 1I3VA 3S0PA 3AABA 4J3VA 4OAWB 4X6CE 1ZA3A 2DKUA 1G7LA 4N90D 1QRND 4ETYA 3EFFA 1EO5A 1IC7L 4MHHG 1Z7JA 4GW4B 4I7ZC 4XTRD 5AW9B 2WXHA 4RWYH 4F7TA 2YAQA 3VWKB 3NCEB 5AL8A 2R1XB 2FEDD 2P48B 3CVDA 1PLGH 4MB4A 3APFA 3REVA 2X70A 1Y0LB 3GGWA 3W2DH 2X4RA 3EBGA 1O5DT 1ECZA 1T1XA 5IVXB 1T20B 4PS4H 1AE6L 4KROC 1DBMH 1AR1D 4UMSA 1JGLL 3DETC 4NRZB 1MVUA 3VD2A 2F54A 3IDMA 4DZ8B 1OVZA 1XCXA 3DOSA 1P5VA 2EYTB 1CE6A 1S8DB 4F7EA 1C12B 5F0PB 1A5FL 5IB2B 1U8IA 2M2DA 2R4SH 5DJXB 1KCKA 3V4VL 2CRIA 1GOGA 5KVDL 3CFIC 5D5MA 4OU3A 4ZTPH 3DI3B 5I16B 3WBDA 1I9RL 35C8L 1OLLA 1KJMB 4JZJB 5AZ2H 1YEJL 4G7YH 4G7QB 3SE4A 4OD2A 2TRYA 32C2A 3TBWB 3X3FH 5J6HB 3LSOB 1JHTB 5GS0D 1LDPH 3FZUC 2KL6A 3O4OC 3P0VH 4Y9BA 1KJVB 4BH8A 3BUTA 4TSCH 1CUOA 4ATWA 1ETZB 1WS7A 5GJTH 5D7LE 4EKXA 4H0IA 4OFDA 2NTFA 3BAXA 1OM3L 1QBLH 3VM5A 4K7PX 5IB3B 3PWLA 3BVUA 1EX0A 2VZUA 3NESA 5G4MA 3TO4C 3WXVL 1HSBA 3M1BB 1AZBA 1DJHA 1SHMA 5D7LD 3WEMA 1SBBA 4ZBJA 3AGWA 5IV2B 4NAQA 4LF3B 4WNSA 3GDCA 3MSPA 2GJJA 2EADA 5DJCA 1D6VH 2R27A 3UTTD 1NCAH 5CP3A 3DX7A 4QLRA 3WV0A 3SKOA 4F80A 1K72A 2CO2A 5H2BB 2AS5M 3B6SB 1D9KB 1P69B 3N41B 4HIXH 4FQ1L 4H8HA 2G3ZA 3EF7A 3V0IA 1TQBB 4NXKA 2QKIC 1YYML 1CICB 5EU7C 2VTFA 3G6JB 3OLDA 4NQSA 5EZPA 3SBRA 3T0VA 4Z7QE 2L3BA 4JPWL 2Y6SD 3HZKB 3FT3B 2ZCZA 3BWSA 1AO7A 4P3CL 1BM7A 5FV1L 4E0RA 3ARFC 1DUZA 5D1ZI 3RWFA 5GISL 4O2CA 2R23B 3RUGF 5E24E 1N4XH 5CKAA 3P30H 1ZS8B 4AVHA 1MAJA 2HT4C 4RWHA 3CQPA 5C0CD 3VD9A 2FUQA 2I07A 4HDIA 2RJMA 3MX0A 3PDOA 4JDEB 2BP8B 4UNTA 3KLHD 2AQSA 1EO8H 2LW3A 5J1AA 1EZVX 3WDJA 2V3DA 3RURA 3VRJA 3CG8A 1M7DA 5DQ9B 3L4ZA 3BI9X 4A6YL 3F7RA 2D3NA 4LQ1A 5C7XH 3BZFB 1RJYA 1NEUA 2KPNA 5I6NA 1PIGA 4L8BA 1YEHL 4PD4K 3BKYL 2ZSWA 2P8PA 5HYSG 1RZKC 5BQ7A 1F6AB 5DEGA 2BOLA 5D7JD 5E6UB 3FHAA 3O6KL 5E00A 3RGBA 4FYRA 3DJZA 2WXLA 6PCYA 5IFHL 4WKXA 4APQA 2H6PA 4HCRH 4GRLC 4J1UA 1EBPA 3U0TB 4YEFA 1MRDL 5DRNB 1KB5A 2JI3A 4XBMA 4NC1E 7FABH 3KBFA 2AV1B 3KYKH 4XPTL 2YD4A 1HHGA 5A6LA 1IAOA 1C5BL 3BMVA 3GWJA 1U6AL 3PQYD 4PGDB 4YMPA 1ZJAA 1EV2E 1T0PB 3GBMH 1PG7H 1PL3A 1L0PA 4OKVA 2BY2A 1JI1A 2Z4QB 1WFTA 3CFCH 1MFDL 2DQJH 1WZ1H 1IGFH 5BRPA 1E6OH 3UJJH 2RGSA 4EN3C 4XXWC 4PV8B 4C56E 1R24B 1NMBH 1QLRB 3O4OB 1E3ZA 1I82A 1J0ZA 1HEZA 2HWZL 1KBWA 1SNRA 1E4HA 1F4WH 4O00A 1ZDSA 2I26N 2XU9A 4YFDB 1TSRA 3ARRA 3TO4B 2IPTH 2UUDH 3PGDB 3CLFL 4IKNA 1MFMA 5KOMC 4MZRA 2YSSB 1CDJA 1A3RL 2PXYC 2Q3XA 2VM9A 3L7FB 3WFDH 4WEUD 1MNUH 3UH8A 4D3CH 3C8KA 3K72B 4RDBA 2BHZA 1FSKC 1RZKH 2E0PA 3EFOA 4NJAH 1CFNA 4DGWC 4URKA 2CHZA 2YA0A 5ICZB 5HDWA 1PLBA 4MAUL 4HS8L 2CBMA 3EH2A 3OAZK 4GIAA 3OPZH 1CGVA 4NUJB 5DI8B 5DHEA 1HI6A 3RWIA 4M8VA 2QKIB 4LKCA 3IJSA 3JTSA 2G75A 4WW2C 4CVWA 4AV4A 3L3KB 3IFPB 4QHNA 3GZQA 4ZOEA 4DAGH 1K2DA 1K4CA 4LIQE 3GBLA 1QX1A 3K4ZA 3B7RL 4GO9A 3RVUD 4PSPA 1ZGLM 5IBLD 3QI9A 4GLRI 5CWSA 5HVHC 5HJBA 3ARFB 3K6FA 1H15A 1KCSH 3DVNB 4XBPB 1YO4A 5IHUH 2C9UA 3JV6B 1Q4NX 2PYFA 4F93B 1JIBA 3HRZC 4O2FA 4FG4A 2OMXB 3P73B 2CE6A 3RX5A 3Q44A 1MF2H 5IESL 4TLTA 3Q01A 2XWJA 4K7FB 1HQRA 4LLWA 2YGPA 3X1EA 1CYWA 1CYGA 4YHLL 12E8L 2GBTA 2Y7LA 1SRDA 1H9DA 1Z9PA 2Z64C 3K1DA 1JGDA 1I75A 2QVKA 3LV3A 3MLXL 4XAKE 5EWIL 3IJHA 4N1EA 3RY6C 1MNNA 2IIJA 3M1OA 3WLBA 5AD0A 5I17B 3ZKSD 4BFBD 3DPBB 3EZJB 2XVLA 4XAKD 1PZSA 5BRZE 1N5AA 4P5TC 1IILE 4RLDA 1O9ZA 2Q7AA 3T65B 1FL3B 1CGUA 4U1SB 2HT3D 2JH2A 3A5VA 5JW5A 5DC9B 4XRCB 1LJMA 4L5FL 4M61B 5BRZD 3F7YB 4B96A 4JJOA 2XQYK 1XF3A 4U3SA 3A6OA 1X5JA 1UM4L 1AXSA 1PIFA 4JNXA 2R29H 3HNSH 2C4FT 4URTB 3KPLB 3WIIH 4EN3B 4IBQA 1EO7A 4LFHD 1CIDA 2Z92A 3MO1A 2JCCE 3UYPB 5JA8B 2XHNA 1FCCA 4MAYD 2QSCH 3UC0L 3QCTH 1LK3L 3MOBL 4KK9D 5HHNB 5KBNC 1M7UA 4F7KA 2NCEA 1S46A 3MNZB 3VFOA 4BK4A 1AD9A 2L7QA 3MNDA 5K39B 3ILDA 3D0LB 4Z7VF