2OXGB

The soxyz complex of paracoccus pantotrophus
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
110
structure length
110
Chain Sequence
b'STVDELTAAFTGGAATGEGGLTLTAPEIAENGNTVPIEVKAPGAVAIMLLAAGNPEPAVATFNFGPAAADQRAATRIRLAQTQDVIALAKMADGSVVKAQTTVKVTIGGC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SoxZ protein
molecule tags Transport protein
source organism Paracoccus denitrificans
publication title The SoxYZ Complex Carries Sulfur Cycle Intermediates on a Peptide Swinging Arm.
pubmed doi rcsb
total genus 24
structure length 110
sequence length 110
chains with identical sequence D, F, Y
ec nomenclature
pdb deposition date 2007-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13501 SoxY Sulfur oxidation protein SoxY
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2470 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2oxgB00
2NNFA 2OX5B 2OXGB 4UWQB 2NNCA 2OXHB
chains in the Genus database with same CATH superfamily
1NDGB 1D5MA 2Z93B 4Z7NB 5HYJE 1TTGA 1YYMH 1I8IB 4FQ2L 2PR4L 2VR8A 3ARSA 1EAPA 5D7IF 2Z7WA 4FQHA 4GINA 3FCTA 3KM2A 4FQQA 4X6DA 2YLHA 4J2XA 4QHUB 1LEIA 4MJJA 3W9DB 4FG6C 3WN5C 2H26B 1T1ZA 1VENA 3JXAA 3P0YH 4RMRA 2IPKA 5DD6A 3NK3A 3MJ7B 1MUJB 2ED8A 3H1ZA 4D8PA 2AAVA 1CL7I 4E41E 4X0NA 2G2NA 2AQ3A 3MLYL 2ZYIA 5FGCB 2EJ1A 3B9AA 3ZKXB 4CMHC 3N1GC 3ASOB 3CFCH 3QJVB 2KQNA 4PRIA 4OIBA 2IG2L 1IBFA 2Q86A 2V2XB 4NZ8A 5HDQH 1MDTA 3VI3A 2L0DA 4LGRB 4GG6F 1RULH 3PJNA 5IMKB 1S7XB 4Y2DC 5C6PB 2R1WA 4QXUL 2F53D 1AQDA 2EDBA 4HXBH 3E6HA 1EAPB 2MQCA 2PNDA 4FFZH 3S98A 5DJ2B 4BK8A 2XXGA 1GPOH 5F7FA 3EO1B 2EVHA 5I6KA 1PPIA 2JH2A 3BKMH 3KGRA 3MRDA 3O4OC 3OLEA 1Y18B 2WINA 2Y0SA 4YNYB 3IXTB 3WNMA 4NN7B 3Q2CA 3WDJA 2HVKA 3TT1L 1G7QB 2GUOA 3GBDA 4H8PA 2OAAA 1CICB 4HISA 1P7QA 2NY2B 3RGBA 4C4UA 3MGAA 4KRLB 4KH9A 4MMZA 1UCBH 3TBBA 3LQZA 3ZL2A 4YQXL 1DE4B 4OFIA 5I30L 3PFQA 2YQGA 1G0YR 2EIDA 5D4HA 4YR6A 1JV2A 4GRLA 4IRJD 3TT1H 3EG9B 3UTSD 3WLBB 1A9EA 4XOCA 2IJ0C 1EVUA 3WKPA 3C2AH 2FO4B 3QUMB 3QDMB 3SOTA 2J1YA 5CHNB 2J8UB 5D1XB 4M48H 4X6BB 1JRHH 4HCIA 4I5BA 4LEXL 2XN9A 5KVEH 5F3FA 3TO2A 1GS6X 3L4YA 1NWPA 4XT1C 4YC2B 2P8MA 3LS4L 3QWNA 3RWJA 2G2RA 3CLFL 2CNZA 4Z7WF 1AQHA 5JNYB 2BS9A 1ZHLB 5DLLA 2DIEA 2A9MH 5CP3H 1IBZA 2MEJB 3ZU8A 3PGDA 3IDMA 3CWGA 4P57B 4TQEL 4ZZFA 3HG1A 1CN4A 2ZJSH 1KBPA 4HC1L 4AIEA 4LCUB 2ATPB 1AGEA 4BWWA 3QQ3B 1HEZB 1QYGL 3GI9H 2DICA 4KTGA 4WWKA 4FG4A 4C56E 2X6UA 5KJRH 1LE5A 1RJYA 1LO2L 2IV8A 4C59B 3P77B 1DQQB 1DJGA 1FYTA 3GXTA 2D7OA 1WF5A 3STZB 3K6IA 5IFJA 5J06A 5D6DC 4OLUH 4N2OA 1SJMA 4RFEA 5JXEC 5LGHH 3BWAA 1DQJB 3FXIC 2VUKA 3WE6A 1E2ZA 3KLHD 3BDYH 2C8NA 1XMWA 5EUOA 2HJKA 3UBXA 3V0EA 2DYPD 4UUJA 5IJKC 2E4FA 4HK0B 3FUDA 4S1QH 1TQBC 3O0LA 1BJMA 2UZXB 1KG0A 3UACA 3B3BA 2J2ZB 4Y1TA 1AG0A 2DW5A 4RRPG 3NIGB 3SYPA 1FFNB 5J6HB 3IWVA 3RFRA 2V8LA 4ABUA 3ABMB 4QKTA 1EO8L 1S7VA 2VH5L 4W9KC 5ID0A 2FCBA 1QBLH 1PZBA 3FQRA 4JFZL 3HFML 2R23A 4JVWA 2IPKB 5DD6B 1MPAL 1I8AA 1DL7H 1T1ZB 2FIRT 3GEFA 2ZCHL 2X87A 2BP5M 2I85A 3W9DA 4UT9A 1CLCA 4X8GA 3T71A 2JJWA 4AEIL 3ROLB 2HG5A 3MJ9A 3MLWL 2XRAH 5IF0A 3RLSA 1A7NL 3KPNB 2KHAA 2FSDA 3BYYA 3LRGA 4IKIA 1VFUA 5CEXB 2H0EA 1IRAY 4QXUH 4GP4B 1A1OA 1BW8A 1HXKA 4OUOA 1Z2KA 1HCYA 2VN3A 3P69A 3ZHDA 4CKQA 1QR1B 4FN0A 1LJMA 1E28B 1PZ2A 1ZLDA 4JRYA 2XQYK 2E9IA 3FU5A 3LKRA 4NHCH 1BQHG 3PDOB 1XH3B 5AWNL 3ROOA 2HT2C 1N9PA 3I6KB 4JFDA 3WMSA 1E4HA 3COOA 4PJ7B 1MQKH 4XXCC 5HHPB 4L4TA 4UAOB 2ZX8A 5CZKA 5K93A 4YXKL 2A4EA 3EO1A 1MFCH 3OAYK 2F5AH 4U6VL 2EIZA 2NNXA 1MY5A 4BINA 2O61B 3TFKC 4CSPA 2C9XA 2AABH 2QGCA 3BI9X 4H20H 2HLAA 1T04A 5CILL 3INUL 3QJHB 4ZPTA 4LIQE 1WC7A 4QGYA 4P5TA 3WEMA 5DMYA 4ZOCA 3IKCB 4UZUA 2X4PB 3C5SB 3BDBA 1M56B 2RBLA 4M7KH 5IBTL 4X99B 3KYKL 2NZIA 3VA2C 2VLKD 5F7DA 4ZW5A 4K3HA 3RZCC 3NCBB 4YQXH 3L2MA 1UM5L 5E51A 4EDWH 1YDPA 1FLTX 3MCLL 1MCBA 1KGYE 1HXMB 5F6IB 4I0PB 1YEGH 4PW3A 1C5CL 1TT6A 1S9XA 2Q20A 1N2RA 1KXHA 4P4KB 5LWYL 3GSVA 2Y2WA 4Q6IA 4OD1L 4TUKH 1M4KA 2KL6A 3TBYB 4M7ZC 3RL2B 5DC9B 5DK0A 3ZHFA 2XKNA 2W0PA 3QT2A 4XPGH 1R9FA 4FXKC 3Q2VA 3BZEB 3MLZL 3KYMB 1C16B 3O4OB 3SBWC 4FNPA 1ECZA 2OW7A 4Q89A 2ESVD 4ZD3L 4DGUA 2JQZA 4AEFA 1EXGA 2H7WA 1P6FA 1JWMA 2DV6A 2EE6A 1W8OA 2YAPA 4KKLD 1MFNA 2DI8A 2W07B 3R0MA 2WBJD 4JANA 4QXWA 5CLXA 3WFBL 4BHUI 4BH7B 2V33A 3QWOA 3NOIA 1RZ7H 2Z4TA 1AGEB 1UEMA 4ZX3A 3V0JA 1U3HB 1SOKA 4OQTA 3UTZA 1E3ZA 4I3RH 2EDTA 1HH6A 3HKFA 1U93A 3VXOB 1R5WB 2Q1EA 1E5YA 3BSZL 4UIKL 3Q6FA 2LLGA 1Q0XL 4DGVH 3EJCA 1P7HL 3KVPA 5KSBB 4IBVA 2P26A 4K73A 1T83A 4XPHL 4HU2A 4AL8H 5C0DB 1JZFA 35C8H 5JHDE 4GW5A 4I2XE 3SKMB 2DIBA 3TYGH 4G7RB 5ICZA 5I8OH 1XZ0B 3IM1A 3OHXB 3CFIC 1P6WA 2FK9A 2VC2H 4FX5A 1XCTA 5DHYA 2A6DB 3B2VL 1K85A 4OZIB 3EJTA 4UOW1 4DT2A 4G9FE 4MAYC 2DMHA 2GFBB 5EUOE 2KPWA 3M1OA 2AQRA 3RU8H 4MNGA 1WIOA 2DTMH 1AOZA 4L9LA 2ZYSA 3WO4B 1OGTA 2OMXB 3ETBJ 4LCVA 2FNWA 3WFCH 1IBBA 1QA9B 1AR1B 2DQ6A 4WTZG 2AKRB 4Q74A 2LU3A 3Q5YA 2QADB 3MRGB 5IVXF 3OX8A 1TCRB 3WKYA 4H8WL 3VFGH 3QH3B 4X4YA 3ULUH 4LAQH 4L0ZA 2VLRD 3NSCA 2R2HA 1BP3B 5EO9B 3BP6B 1YEJL 5CJOL 3B9DA 4MX7B 3KWWA 2FSEB 3C2AL 3DX0A 2LQRA 1U91B 4QOKB 3QG6B 1IFGA 1WBYA 5AZ2L 1M3JA 1CGUA 4MCZA 1B4JL 1TMQA 2E7HA 3DVIA 2AXGA 4DN4H 5KWYC 1BFSA 3DHUA 5ETUB 4YS4A 5IFAL 4PJCE 1KC5L 4FNTA 1IGYB 4BFOA 5GRJL 4YDMA 2HRLA 3L5JA 4GAJL 5IJKA 4FKKA 2YKLL 5DRWA 3VFUB 2YPLA 1OXYA 2NYZA 1GS8A 2OMVA 4FQCL 2V37A 1QBBA 4Z5RB 1SQ2N 5I5JA 3R0NA 4IEFA 1SY6A 1UKQA 1RD6A 2Z91B 1D5BB 5JPNA 2AK4B 3EJZC 2C7FA 2VDKH 5F1SA 1AMXA 3TCLA 4AV0A 1I9JL 1NOAA 3FU0A 4A37A 3ZR5A 5D5MB 1MWAA 1VGKA 3KH3A 4HZLB 1I82A 5DR5L 2NUTA 4PRBA 5ERWB 2J1XA 4GW4B 4LLWB 4NZRL 3B8SA 7CGTA 4FQQB 4X6DB 1ZAGA 1NLBL 4F2ME 2FX9L 1RZKH 1CYWA 1H6TA 1YNTF 2WBJC 5E0FA 1UURA 5ICUA 2F54D 4Z3TA 1GXEA 2JXMB 4LSQL 4N0CD 1Q0EA 3FTYA 4CA4A 4HPHA 4DFHA 4KI5C 3OL2A 3ALWA 3O41B 2V4LA 5J11C 5AW3B 2WKOA 2FEDC 3SO5A 2YK1L 4MNHA 1BVKA 1CFSB 3VVWA 5KVFL 5T1DL 1FBIH 2X6MA 2PWHA 3CSTA 2CMRL 3I9IA 3VI4F 4AKPA 5GSVB 4DCQA 3G9VA 4YBQC 3QZLA 3TBWB 2NT1A 1KXQE 2WMPA 5D55A 1YEWA 3QUKA 4XZUB 1K4CA 4K7FA 1NBCA 3V55A 4JZJA 2EXTA 4OD1H 1CU4H 1JWMB 1KXQA 4OCRL 3GM0A 5EU6B 4L1BA 4NHUB 4ZS6D 1FBIL 3DARA 2X38A 2OZ4H 3JWOH 1N68A 4I9WD 4YK4B 1TJHH 1SEQL 3BH4A 1SM3L 1E4JA 4PJ9A 4WNQB 3NK4A 3V5HA 3VQ2C 4K7PH 1MI5B 4XXCA 3GQFA 1ORSA 1W16A 3CZKA 1XZWA 1L5GA 4IRJC 2W92A 1G6RH 2PXYD 4ZFZB 3M1BA 2WYZA 3TEYA 2FYVA 4WCYL 1BFVL 3TFKD 4GUQA 1Q9LA 2X4SA 3UG5A 3IFOA 1HAWA 4ICXA 1S5HB 2VXUL 4L3ED 3FU3A 2MNUA 3GI8L 3X11A 4RFOL 5BXFB 3HUJA 1BAFH 1JDDA 4JY5L 3LH2H 3DRTB 4XP4L 4DKEL 4XPHH 1OE2A 4HWBL 3QPKA 4BZ1H 5E6IA 4XN2A 4TVPL 3SE8L 3WTYA 1Z5LA 1DQLH 2LR4A 2PPFA 1Z1WA 2OLDA 3C12A 4TVPD 3HG2A 2BIMA 2VR3A 3B43A 1A1NA 2PLTA 4HX1B 3SE3C 5AVTB 4FL4B 3W9EA 3G08A 1CQYA 2NY5H 2QPSA 4PJFE 3ZUCA 4KXBA 1EAJA 4HGKC 4YDVB 1HTYA 1YQVL 4LSVL 2EXWC 4TKWA 1ZDSA 3U6RA 2FQEA 4FKEA 1AZNA 4OLXH 4U1LA 1ZEAH 1BFOA 2DWEB 3L5XH 2QTVA 2HFEA 3ZE0F 1VADB 1P9MC 1U92A 1XR8B 5FUOH 3SQOH 1U8IA 1WAPA 3MLTA 3GFUA 3RB5A 2Z35A 3L3OA 1UXMA 2F5BH 3RX9A 3UTTB 1D5XA 2ADFH 4HJTA 4TUJB 1OKEA 1HDMA 1IGML 3AQDA 1TYJA 4JW3A 2APBA 3QDHA 2R39A 3PWJA 3FTGB 5D6DA 4RCAA 2EDLA 2D4DA 1T1YB 5AAWC 3V5DA 4UNUA 1R3JB 5E8NA 1JG9A 1VJSA 2BIIA 1YAIA 3F01A 5BVPL 3G5VA 3WL9B 3T6ZA 4RDBA 4X5RA 4ANVA 2NW2A 4U3SB 2OK0L 1VIWA 5E8DL 3A24A 3T0DA 3MUJA 2BJMH 5KOMC 5E1QA 4UT6H 2FL5B 3QORC 5H37G 1DO5A 2FTAA 5F1IA 5F3BA 5IQ7L 1NCTA 1DEEB 5KYXA 1HU8A 4PLOB 5F21B 4LCUA 3F64A 4QYOB 2I24N 1FNGB 3OJDA 4IRZA 2J5WA 1PS3A 1KSRA 1R3KB 2UZYA 4NZRH 3US0A 1NKOA 3CK0H 2NY3B 1ZHLA 2CD0A 3P3SA 3SDDB 2V0AA 2WWNA 4NZJA 4O02B 4R0LB 2R0LH 4FTVA 5JHDA 1QSFE 1UJ3C 2BIHA 35C8L 4MJ4A 4ZO7A 1U6AH 2EDDA 4BSWB 2WTRB 4FQJL 2MKWA 2RQ8A 1QQDA 2FYYB 1N4XH 4JM2F 2RAMA 3KDMA 3QUML 4MJ5A 4RNRA 4XH2B 5IFJB 1Y1UA 3LKSA 4IHOA 1DQQA 2F6AA 4AK1A 4YFLF 1T3FB 2X28A 4GMTH 4QRRE 2CIKB 1KBKA 1MDAA 1MRDL 2YPVH 3P4MA 1AH1A 1F00I 2MPVA 1TTRA 2E6PA 2WB1A 2OL3H 4P23D 5CNHA 1SF5A 1A7NH 4EI6B 1TEYA 3ZIYA 4IOFC 2D8KA 4YNYA 4KDTA 3LPGA 3ARUA 2WXRA 3G6DH 2UWEA 1NGZA 3MRJB 5BOJA 4HEPA 2Z31B 4QRQA 2P28B 3CZSA 2XTSA 5EIIB 5BVJA 1ZGLM 4YHZL 3DTUB 1JGEB 1NANH 4MS6A 3VGDA 3IAQA 2XTLA 3LRHA 1ASOA 4G1MB 4P4RA 4ADIA 2OJEB 4OJYA 1CFTA 5FO7B 5AAWA 3TN0D 4UTBH 5CN1A 3GZKA 3S35H 3FSWA 1UEYA 4ACPA 3LXAA 3MBED 1XF3A 2MJWA 2ITEA 3MACH 4E5XA 2YMXL 4Q6KA 4G7SB 4AW7A 1TNMA 3MYZA 2F1BA 2VC2L 1DCEA 2WXPA 2WTPA 1HHGB 1VA9A 3N50A 2WZPD 3T3PF 4PHXA 3OXRB 1OP4A 4A55A 2B14A 5E95B 2OR9L 1JF1B 3ZRSA 4Z0BL 1U4EA 4PRPE 4NKMA 2GTZB 2BOLA 3F2LA 4XXWC 4JZOB 2QZQA 3GT6A 3P30H 5GISH 1GHFL 2ZUWA 5AFAA 4AK2A 1B0WA 2Y7LA 4JHBA 4K3JL 3HR5A 2PCYA 2VIRA 1GTFA 1ZANL 2ICEB 3CFBA 4XC3H 3STLB 2PMZA 2L7EA 4YK4C 3FB6A 1GGIL 4JPWL 2WZ0A 4N0UA 4KROC 1GCFA 1O6SA 2BIPA 3W39B 4AZUA 4QF1B 4UT7L 3O8XB 2X4UB 4M1DL 2B39A 4JFHE 1GGYA 4R4FL 2HTKD 2DQGH 2IBZX 1UQSA 3NIGF 2IWGA 2BS71 3CX5J 4AYDC 4LVHB 5HI5C 3MRHB 1CFSA 3O6FD 4UIMA 1IAKB 1VZHA 2GBVA 1XV8A 4I9WE 1CXIA 1AE6H 5F7MC 1L0PA 4Z7OB 5EZPA 1PZUB 3KYNA 3GHEH 4KVNL 4P59H 3VI3F 3BP7A 3GO1H 2KT6A 1LMIA 1GY2A 3FU7B 1JYNA 5DGRA 2OX5B 5EBWA 1H19A 2COQA 4Z0XA 2APWA 5AW1B 3ULVD 1A3LH 3I6LD 1U58A 2EECA 4XMZA 4Z7IA 4MDJA 4P9HH 3GSNL 4PRDA 5IQ7H 4BZ2A 1MRFH 3OC5A 2WVVA 3DK0A 1NDGA 1OW0C 2Z93A 2JKWA 4ANWA 3QIBD 4WEBL 3FH8A 3KVQA 4FGMA 3D18B 1X5GA 4A6YB 3FO0H 3FAXA 3JWDC 4FAAB 4NZDA 1ES0B 4NZFA 3ARBA 3PAYA 1NFIA 2Q9OA 3MLXH 4HLZG 4U4IA 2ROXA 4Z95H 5FO9B 5HDBE 4J8QA 4GG6B 2X6BA 3T2PA 3MRBB 4WNQA 2ISDA 2F54E 5I6PA 2YJLA 2YD1A 4I48A 2D9CA 4W9LC 5ANMB 4IU2B 4XBPA 5ABZA 4TSCH 4AENA 2AF2A 4K8RC 3WTVA 1IGCL 5IHZB 1ZRUA 4LLVA 5HDLA 1AP2B 1UD3A 2LVCA 3TNNB 4N0UE 4HZ1A 1AKJD 4HWEH 4V1DA 3O4LB 2HWZH 1X9RA 2VSCA 1U8LA 25C8L 3H7BB 3SODB 3U0WL 2H3NA 1T5WA 1NGQL 5DEZA 3FB8B 3P54A 2QFRA 5E8EA 1V3LA 4WHDA 3ZDXB 2WXFA 3IU3B 3TESA 3MUUA 1NZRA 5IVZB 5KOVC 4UQ9A 2W9DL 5DMKB 2X9XA 2VZVA 1VERA 4WI6A 4B7IA 3FT2B 3L5WA 2ZWKA 3VFRB 4N9GB 4YBLB 5IFHH 1I8LA 2VDLB 4B9IA 2P8MB 1O9WA 4IDJH 2B1OA 2KLSA 1CO1A 1F2XK 4U0RB 3POHA 4P99A 2NZ9C 2VZOA 1ZIAA 4LE8A 4LBAA 1N5YH 5DT1L 1JFQL 1AKJB 3WJLC 2RA1A 2HB0A 2K0RA 4WHYH 5EN2B 3KPRA 2H2SD 1NGWB 1FA4A 2GK0A 2NQDA 4K8RL 3BWUF 3W5NA 2NX5B 3EFDH 1FQ9C 1G6RB 5IFHL 1UACL 4W4OC 3VH8A 1JV2B 4XP5H 2WLMA 2R2BB 3IT8D 3OR6B 2WANA 4JO1H 3LNFA 4JFVA 1GZPA 3KWTA 4KK9D 4N22A 4OV5B 2X1OA 1UGNA 3I6SA 4NENB 4PI2A 5J3HC 3K7UA 4Y2OA 1RY7B 2FWOB 3QJZA 2UZYB 1Q0YL 4YSEA 1A4JA 2HLFD 4WVRA 4POYA 2IOOA 2P8PA 4M4RB 2DTSA 4N2NA 2UZIH 1YUKB 2OMYB 2GHZA 1RU9H 3ERXA 3AMKA 1B2YA 4PRBB 3FF7A 2GJ6E 2YK1H 1TLMA 2YEQA 1OD7A 1UD8A 3N55A 5JHLH 3Q6GL 3TCLB 1KGCD 4G8EB 3O9WA 5E8DH 4JG1H 5MERB 4HYTB 5LAXA 2ORBH 3S3PA 2WLKA 4NBXB 3SDCA 3FO2B 1P4LA 5B21A 5BOZG 5TDNA 5KTEL 3GHEL 3N40F 2MPAL 4XX1E 4DP9X 2N59A 2OYPA 1UM6H 1QVOA 1Z9SB 4M5ZH 1A6UL 5CGYC 4K71C 1A6AA 1KTLB 3TWCH 1I1FB 5CSZA 3ECWA 4DPBX 3BWSA 5DD5L 4A7TA 5SWQB 3JZ7A 2Y6TE 4X7DC 5EPMA 2AXGB 1AXTL 2C3HA 4X8CA 2A9BA 2X70A 3H42H 4RIRB 3APNA 4ODUA 4H7VA 4HMCA 1ZT4A 4J39A 1KJVB 1FL3B 4N0YL 5I75C 5E6RB 2VYRE 1ASPA 2R4RH 3QUYB 4GKSA 3EGDB 4BJLA 4BK4A 1MCPH 3FUJA 3P0YL 3SDDA 2HLAB 1OP3K 1F11A 3QNXB 4LRIC 4OCWL 4L8CB 3QH3A 4X4YB 3SQBB 1W0VA 5ADOH 2DQDH 4A7UA 2Z65C 1VEOA 2F68X 1CFNB 1LYQA 2EIZB 1N6QL 4FQ2H 4RISL 1H3GA 4Y9GA 4J3WA 3S0PA 3RX7A 5HTSA 4MXWL 4Y9FA 3VXRB 1JZ6A 1Q9LB 4HHGA 1N59B 5EIIG 5SWZB 3NMEA 5J57B 3KWXA 2YN3A 3ULAB 4XN5A 4RGMB 1P4IH 2IALB 1GZQA 4ORGB 4EOWH 3D50A 1AY1L 3PG2A 1U8JB 1SYSA 5CJQH 5F93C 3DMMD 1ZT7B 5I1EL 2MQ3A 4XE0A 4X4ME 4OU3A 1UENA 1DR9A 1TQTA 3LN5A 4M1GH 1TVHB 3WD5H 1EPFA 3RL2A 1VFAA 5D7SL 5C7XL 1EEUA 3B56A 3M46A 3RNKA 2BDNL 4JPQA 2CCVA 3T0EA 1DDTA 3SBPA 2YXMA 4FFWC 3L9BA 4HJ0D 5F1KC 3UTSB 5KBDA 3DXAD 2EUWA 3GS7A 4A04A 4JY6A 2UV3A 1BFOB 1UFUA 2DWEA 3VXRA 2IFFH 2JJTA 3JV5A 5AYUH 1A1MB 4HPOH 2DRUA 4HUWA 3W38A 4NUPA 5C0CB 2FD6H 2HTLC 4OF6A 3HC2A 4BYHA 2J57A 4GH7B 5SWSD 4IRSD 4WK4B 3IVKA 3EIFA 1Z0NA 4R83A 3MROB 3GXIA 3G9AB 4Z7OF 4M7JL 3WXWH 2GSMB 1MHPH 3QA3B 1D9KA 4WY7H 2BVYA 5LB1A 5DHDA 1ROCA 3MKKA 1GYCA 5CZRA 3SBQA 1HEJC 1V55B 2L3BA 3SGDI 1N2RB 4HS8H 4JFYB 4L8SA 4KQ3L 5J12B 3KXFD 2PWGA 2XV2A 2CKNA 2X6CA 4JZNB 4W6WB 3RPIB 2NY4D 2JJVA 4PRHA 4WWOA 5E5MA 4D9QE 3N1FC 4I13B 1E6JH 3C5ZC 4GXFA 5HP5A 5HVWA 1QLRA 3B4NA 4JM2D 1I3RB 4XB8A 1R3LA 5E08L 2ZSWA 1BX2B 3AADB 3B9KC 5K9KB 1N6VA 3MRGA 3QUXC 4G8FA 2FQDA 1BLNA 3IDMB 4D7PA 2QDWA 4LLUB 4JG0L 5AOLA 2IH9A 3UIYA 3V4VH 3W0WB 4YZFE 5J13B 4EDXB 2LU5A 2EDWA 2O5XH 4DHLA 2CBPA 2VB5A 2X09A 5JXEA 4H88L 5LBGA 2Q10A 4X6CE 4UT9L 2VL4A 1HL8A 4UDTA 4W9JC 4XPTH 5E94A 5AW4B 5FDWB 4NWTH 1WWCA 5AQ0A 4A6YH 4WU5B 5CGTA 1XB3A 3ZO0A 1J8HB 3ZYOA 4NYLA 4OKDA 2PO6A 4BE6A 3UTTE 2J73A 1I1YA 1SYVB 3PJLA 4AQ1A 5J1AB 3BP6A 4G6KH 4GFXA 3LEYL 4LVHC 1SEBB 1KGIA 3OR7B 4QGTA 4P49A 3UG3A 4DP6X 5BQ7A 1WPCA 1UTDA 2NXYC 2XJLA 1OGAE 1GC1L 1DVQA 1QHPA 3N41B 5JMRA 5FYKU 2FWLB 4UUJB 4MQ7B 1ZLUH 3MA7A 4Z8FH 1KBVA 4WI7A 4X80L 1XMEB 2AK4D 3FN3A 3A4AA 3MRFA 2OMXA 4MMZB 4HULB 5A7BA 3IFLH 1C5BL 4MHHG 4Z18A 3NJXA 4BQ6A 4V2CB 5C07E 3TV8A 1V8HA 1E9OB 2Y9RT 2Y1AA 5M94B 3ZE2B 2FRGP 4M03A 4I3RL 3NYKA 1GC1H 2QHRL 4ODTH 4QAWA 2RALA 2WYHA 5IR1B 3S9DB 1T1WB 4ZMNA 2CBMA 4RAHA 2B16A 3VWKD 2E74C 1K3IA 3A0OA 4RLDA 2A77H 1WUZA 2EXYC 4OGYL 1T1XB 3NABL 4KTDL 2WQUA 2ZQKA 4Y9CA 5IHHA 5D1QC 3CDCA 4ANXA 3CC5A 1Q9KA 2BP8B 4M8UA 3WU1A 1RFDL 4MDIB 2YFOA 2TRYA 1MFAH 2IGLA 4HOZA 3OF6A 3GBNH 1OTSD 5IVXE 3RE0A 3WE6B 4AIZB 2EXWD 2CO3A 4HKJB 4LXFA 1J0JA 3MRMB 3QDGD 5D1ZI 1FHNA 5IHUL 1UACH 1KZYA 1YDPB 4UU9B 1WHOA 1KMGA 3S37L 4X7TB 4J3TA 3UIZA 5I5RA 1LK2A 1AGFA 4DH2A 4RAUB 1JNHB 2B4CH 4XPBL 5KW9H 2WAHA 2VXQH 3HN5A 4QTHB 4Y9BA 5AYQA 2J8UA 5D1XA 3PNWA 3ATAA 3BE1L 4MNGE 3L1OL 5EU6D 5JLZA 2ZWYA 3RWIA 3W2DH 4WWKB 3DI2B 3HNVL 3ZTCC 3OG4B 2DM4A 2RJMA 3VU1A 1RHHA 2NDFA 4R90H 4GT7A 1HQ4B 2O93L 4JL2A 1THCA 4EVNA 4GKNA 3SOBL 3ZTJH 3ZE1B 1I8IA 4TUOB 1KJ2B 3HHSA 4QTIL 1FE8H 4MA8L 3SYOA 2WYIA 3BHBA 3BQUA 2AEPL 4X5PA 4G2AA 4W1TA 1MHEB 1AS7A 4UOZA 5JA8B 4X6EA 4GAFB 4PPTA 3MV11 1BD2A 2NY0B 3M6DA 4L3CA 3MGTA 2BSSB 3M8OH 3PHQA 4JRXB 1WQVT 1T03H 5F7BA 4F2FA 5IUSA 3UO1L 1MJ8H 4PP1D 2J6EA 1MAKA 2ARJQ 1K5WA 5DVOA 4ERSH 5I8KH 1F5WA 4JY4A 3RI5K 4FE9A 3VYPA 4LOEA 3U46A 2VDRL 1I85A 3HC3H 1EO7A 4IU3B 4LK4A 4NN6B 1ACXA 2C7UB 1BMZA 5KVEE 3SDAD 2MNJB 1RIHL 3CUPA 4FP8L 2EZ0D 4ZOAA 5ANME 1JV5B 3WV0A 2X2YA 3KBPA 2NY6D 3LEXA 4HS6B 2YD7A 5E1GA 4D3CH 3MRBA 5HDBB 3DXAB 3MNMA 1PF3A 4FEIA 1HQRA 1DBAH 3DVGB 5ECJE 2D0GA 4Z7QE 2VABB 4NWTL 1CYGA 3DJRA 4RSVA 1QSFA 1TZ8A 3U4KA 2BW5A 3NSFA 4U49A 2AQPA 1SDAB 3CN4A 3NFSL 1S7RA 3GSNH 5IOKA 5C07B 3KJ4C 2WIIB 5IW3A 1U8PA 2HRHA 1THAA 2JCCE 2QPDB 5FWQA 4CMHB 5EZLB 3HLKA 3H9SB 1GSKA 2HFTA 5JOPE 4NQEA 3V95A 2FBRA 4HA1A 1UC6A 4PCTA 1Z6JT 4L4VD 1JAEA 4F8LA 4GQQA 4NBYB 4HUXB 4GP8B 3NGBB 2IANE 2GAZB 3MLWH 3MV7E 4IBZA 4OLUL 1NBYA 2FZ3A 3BGMB 5HDRA 2XTJC 2XKSA 4WTWA 2J4WH 2PW2B 5EEWA 1JHTA 3EFFA 2L8AA 2FGWL 3P77A 1JNLH 2IADB 2QBWA 3V6ZB 1XGUB 1NCGA 1NGYB 4FQ1L 3MNDA 3BVTA 2VABA 4FFZL 3QEQE 1E7VA 3CD4A 4O2EB 3VMPA 4UQCA 4PSPA 3HS0C 4DUXA 1A3RH 3KJ4B 2WK2A 6TAAA 3FSZA 3RPBA 3V2AR 4D0DA 2H26A 1R75A 2P80D 4Y2DB 1X5LA 4TNEA 5EUOB 2CHZA 3MCKA 3L08A 2MRYA 2Q7YB 4G9FB 2DYSB 3FCTB 5JR1H 4GAYA 1TOXA 2HH0L 4NQEB 1RP8A 1A7QH 5AZ2H 4ZFOL 3HE7D 1R24A 1MLBB 3I9PA 5TE7H 4A2FA 4S1RH 4AV5A 2BS8A 4MXWH 3GSQA 1S7TA 3NIDE 4ZSOB 4HLEA 3OHXC 5EFIA 5C07A 1OP5K 1PIFA 1XGYL 4X5WB 2AJYL 4I5BB 3DNKA 2C26A 4PIBA 4PEEA 1DBJL 3L2LA 3TGXA 2MKLC 4C56D 2GEQA 4UILH 1IT9L 3BFOA 1OK8A 4BFGA 2IDTA 3C60A 4P48A 3DX6B 4HUNB 3RVWC 4CAGA 4PG2A 1OGAA 2X9YA 3IJYB 5KS9F 4N8VG 3ULSA 3PGDB 2ORBL 1NDTA 5ALCL 1I1AC 1WFJA 1YG9A 5MEND 2ADYA 2KS0A 5I0XA 2ZOKB 1HOCB 3NCYS 4R26H 5DC4B 3HC4L 3VCLA 3D85A 4NOBA 1FL3A 1VESA 4UYQA 4HWZB 2VLJD 5BW7C 1HIML 5BUAA 1RI8A 1E4XH 3Q13A 4JO2H 2YD3A 1ETJA 4XN9A 5D2LE 1CJYA 1TZHA 1DUZB 2X53A 3A4EA 4OD2A 4XI5C 5BVJB 1PX3A 1RZJL 5L9DH 1N18A 4UDTB 3NFPA 2OYLA 3Q8EA 1SMAA 1NGZB 5F6HJ 2ALAA 4Q52A 1V7MH 3PYCA 4LQFH 4XMKL 3QUZD 5FM5M 5KTEH 4XVSH 2P5WE 5HI3D 3UTSE 5EU7C 3D09A 2X7LA 4I9XA 3EH5B 2KLTA 2XG5B 5KVGE 2ZOLA 2R1XA 3MA9H 4ONFL 3WLWC 3MCLH 3SGJC 2VDPH 1USZA 5KSAC 1KTDB 4ZFGH 2CGZA 4HC1H 3WUWA 4DTGH 1G9NH 3IGUA 5EORH 3ZYIA 4OAWB 3MDJA 4LCCB 1WFUA 3CLWA 3MBXH 4WHCA 5E5MB 3RDTD 1T2QL 3BKCL 3ESVF 4XX1G 4L3FA 1P84J 3FZUD 1E90A 2PW2A 4K15A 1AD0B 4OT1L 4KVCL 5SWSE 3OKYA 1DFBH 1TZIA 1SY6H 2OMYA 4PYGA 3GKZA 4NJ9H 3ZHLA 2FHFA 3EJJX 2BVQA 2DIAA 2FH6A 3NACH 1WTLA 3N43B 5GGSY 2X1WL 5KBNC 1EGJH 1U42A 2H6PB 2XU9A 5D7JC 1MCJA 1T2QH 3BKCH 1BOYA 3ILQC 3MRRB 2BRRH 1J5OL 1RZJC 3TX4A 2HJFA 4XMWA 1U8PB 4YLQT 2W0FB 3QUGA 1MXGA 1NEUA 1W80A 5JNYA 2EDYA 1AO7A 3UJIH 3FFOA 3IDJB 1K2DB 4FQXC 5IK3A 1QATA 3FNKA 1Z32X 4YHKH 1AI1H 3FT0A 1NCAH 4ONOA 5IESH 4ONGH 3TN0B 2GK0B 3CNKA 3LZRA 4J4PD 2GYSA 1JGUL 5INCB 1U2YA 3QCUH 3DRQA 3QPXH 2C9QA 2ZKWA 1OEZW 4QRPA 4QNPE 3MOAH 3VXNA 4HG4J 1WWAX 4OZGF 3ARFC 4O2CB 2XBDA 2EDFA 3EFOB 1TVHA 2CRIA 3SKMA 5D7LE 4KAQH 1QSZA 3S97C 1D5IH 3NH7H 1BBDL 1INEL 1QUPA 1K4DA 1UVQB 5C3TA 4CADB 3D0LB 3GJEA 1G7JB 4LLMA 1N3NB 1CE6A 1OF2A 2ZXGA 2JJSA 2WZAA 2JTDA 3CVHH 3UMTA 3T2QA 4JO5A 2LLLA 1I7TA 3SDYH 1FVCB 4HKBB 2J6WA 4PRIE 2HX7A 3GMPB 3D25B 5E8OA 4ELME 1OP9A 1KCSL 4RGND 5KVGH 4G11A 3VG9B 3LSOA 3BPNC 3LY6A 5FK9A 5D93B 1KJ2A 3HHSB 4MLSA 4UNIA 4H1LB 3T3PE 1L7IH 3L4WA 2IMNA 2P5ED 3TH4T 4JKPH 4V1DB 5E1AB 5TGBB 3O2VL 4N85A 1ZPLA 5C0CE 4DZBB 1H3PH 3UAJA 1M3IA 3QYCA 2VDOL 4P4KC 3GMRB 1KT2B 1JZHA 1JZ8A 1T5KA 4Z7WE 1QZ1A 4JFXB 4IIQB 4NNXB 4GG6A 4TNWF 4YSQA 2VT0A 4D3CL 3UYOD 3NG5A 5I16A 2NR6A 3SQRA 5ITFA 4OI8A 3R19A 4QHLB 2VOTA 2Q3ZA 3QSKB 4MNHB 3JV6B 2VDQL 5C70A 1C1EH 2GTWB 2VDRH 1P4BL 4N20A 4POZC 2CGYA 1GGIH 3HOGA 3LQAC 3IMSA 4YWGL 3FQUA 4QRUA 3D48R 5DTFA 1BJ1J 1M6OB 2ZICA 3V4PL 2UWEE 1HL9A 1A47A 4P5TB 4OCSH 2KH2B 4LB8A 4LEXH 4AMKL 2V3EA 4KQ4H 5I0WA 1EX0A 4O02L 3HJEA 3CK0L 3O3EB 4WO4B 1ZVNA 3GHBL 5AOMA 3CMOH 3SZKC 2J4WL 2IAMB 3L3JA 1RIHH 4FMVA 4WUKH 3VQMA 5ACZA 5IMOB 2P5PA 5I73C 4G9FD 1OB1B 1NBVH 3ULUE 5DS2A 5I71C 1BCIA 1RH8A 1D6EB 1Q1JL 1V3MA 1AGCB 3CAFA 3BMWA 2VE6A 4HHAB 3B9KD 1DZBA 1DVFB 1P0SE 3GMLB 3SPGA 1FF5A 1CBVH 4JRYB 1IGYA 1MFDH 4R7XA 3P2BA 1BZ7A 3RHWK 1GCYA 1N7ML 5HYIA 3BP4B 4LNRB 3U2IA 4NXKA 5FAAA 5AW7B 4JPSA 3KPRE 2M83A 5LGJB 2VDKB 1ZA6B 5FF6B 5LNEA 3N85L 4TSAH 2AW2A 4WTQA 3HBGA 4G7QB 3ZE0E 1W72A 3IU4L 3CDGB 1PD1A 2N56A 1PLBA 1UWYA 4FZ8L 4JY5H 3L3DA 5D5MA 4JFFB 4JJOA 2V2WB 3RTQB 5C0IA 2DQJL 1MZYA 3FQXA 5IP4A 4KDWA 4AY0A 1A7QL 2YPVL 1SVCP 1DVFC 1B9KA 2FLMA 4YHZH 1E9PA 2XWRA 1KGXA 1PKOA 2MCAA 4IGBB 3KPOA 2YD6A 3GXDA 2N1TE 4UQBA 4AX3A 4JFDE 3CSYB 4ZPVB 1ZT4B 1FE8L 4TVPH 1G7LB 1GGUA 1JPST 3WY4A 3BUQA 3DPDA 3QEUA 5I0YA 4PD4K 3MV8D 4XP6L 1RFDH 3BFWA 2VLKE 5LUMA 1BQHA 4EI5A 3D87B 1ZV9A 2VMFA 2AJ3B 2RFXB 2OXHA 3NCCB 4HOMA 2Q8BL 4QRPE 2GBAA 3SHSA 4GKLA 1H3TA 1YNKH 3RNQB 4EI6A 5C09A 4ELMA 3VG9C 1CE6B 2ZOKA 4LPCA 3LZPA 4L8BB 5BS0B 1OAUH 2X5PA 4XNYH 2XX0A 4L18A 4LVOC 5FA3A 5F9OH 1PL3A 4LPUA 3HR6A 3RRQA 4ZTOH 5LAXB 2XIBA 1TQVA 5E6ZA 4RMBA 3U2SB 5IWLC 4NCDA 4FG6D 2DL2A 4G8AC 2WXNA 4QTIH 4FLRA 3VO0A 3HZYB 3QHTC 1JWSA 1ORQB 5F7WC 1WFMA 2P7TA 5E2TH 3EYFA 3PWNB 1IKOP 4O5LL 1JN6B 1E9QA 1J1PL 4GXUM 4PY7B 1MFBL 2XZAH 3DJ9A 4DGYL 2XXMB 5GGRB 1I31A 3NZ8B 1BPVA 1G5AA 2HT3C 4MQ7A 1NAMA 4DQOL 4AIXA 3Q2LA 2F15A 5LAPA 2G30A 2PP7A 1YJDL 2Z31D 1BF8A 2J56A 1OK0A 1ZT7A 3GLAA 1GTNA 1U8QB 2FJGB 2VXTL 2ZAHA 32C2B 3G6AB 4ZW8A 3U9UB 5FB8B 5D2NA 4N2IA 1XF2A 2V9QA 2PN5A 4R4BA 5AB9A 1GJWA 3D39D 4GO8A 4ALAL 5DYOA 1FIEA 1TIUA 3MZTA 1A14H 4PGJA 4XO8A 1CFNA 3HMXA 2W94A 4FA6A 1UH3A 1JE6A 3PP4L 1WRFA 3T0BA 2R29L 1M1XA 4ZMVA 3KLLA 4LSSL 4XI5D 1BFVH 1UJ3A 3GSQB 3OAZH 2EACA 2MOGA 2OMTA 4LHUD 3OHMB 3GI8H 3O6LL 5E2WH 1ZLVK 1BAWA 3QAZB 4KUZH 2EH7L 5D7KD 5DQDL 4TNFA 4JHWL 4JRXD 3UG4A 4PRPA 4JQIL 4AYMC 3BGAA 3M1CA 3P3YA 4R2GC 3K74B 4EPSA 4PRHB 2LU4A 4ANKA 1K8IB 1IM9A 3CVHB 2IAMC 3QO1A 4N28A 2H3NB 1BG9A 4QYAA 4ZUUA 4KFMA 1CLOH 5J3HD 4WW1B 1CFQA 2PPCA 5IB4B 5IBUG 3O3BA 3C8DA 3MLUH 1RIUH 3MI6A 1O75A 4DKEH 1DUYA 2DQJH 3PXLA 4B27A 3UEQA 5IMLB 5D70H 2VITA 2KYIA 3LCYA 4IQHA 3V8CA 4FJZA 4FCAA 1NCBH 3KNBB 4K94H 3SQOL 1NEPA 3OV6A 3IBEA 4Q6YA 2G3NA 2JI3A 4G1MA 5T3ZH 3MROA 4HJ0C 5E1AA 4WKZA 2QQQA 4E9YA 4EEEA 3HUJB 5HXMA 4DK5A 1YQVH 4LSVH 1TQBB 3WFCL 1O6TA 2BX5A 4Y9EA 1Y0LB 4V33A 1NL0L 4IMLB 2VMDA 1OTTD 4YE4H 3BQVA 3UC0L 3CPLA 5BUPA 3BIAX 1Y6KR 4WFGD 1U3JA 3KH4A 3CX2A 2OSWA 4A7GA 4WF7A 4OZHF 5I19L 3QXAA 4LSTH 4CVZA 3NZSA 4WUUE 3VI3E 5B7FA 1PW3A 4LP5A 3H3PH 4RFEB 1NFDF 2MTPA 2EYRB 1BQKA 1RJZB 4HIHA 3KXFB 3FC8A 1UXWA 5CP7B 1BBDH 3F7YA 3UAFA 4FLHA 1F3JA 2UZPA 1H9VA 4XNZB 5B1AB 4O02H 5DI8A 3CFTA 3FSVA 3CZNA 3ZUNC 2M26A 3MX0B 4QHNA 3MMEB 5C0ND 2XLLA 3H7LA 5GGSB 2DQIL 5LWYH 3MFGB 3WS3A 2NYYC 4HPYH 1NC4A 3UZQA 5HY9A 3RIKA 5B22A 2GJZB 3FQNA 2WXOA 5CJBA 2OFQA 1KCWA 4Y16A 4FXKA 4YFDB 4DGIL 4HMEA 4Q4EA 4XNUH 1YECH 2WO3B 5A16A 2YBGA 2XDHA 2W81C 4PJAA 1ZVSA 4GO9A 4NZTL 2EABA 1BVLA 5T1KB 5GGQL 5EB9A 5IREA 4HUXA 3EZ8A 1KJMA 1NBVL 1TQUA 4KITB 5H37H 3OGCA 4QYOA 4Q9RL 3V0GA 1LGVA 4JREB 3ES6B 3GSUA 3MV7A 4QHKI 1X5ZA 4M5ZL 3GLDA 2FL5A 5F3BB 4KQ4L 4KFZC 2DI7A 4PJAE 1DN0B 2Q8AH 3J2PA 4J6IA 1M9SA 1E4KA 4JM4L 4H2AA 1MFDL 3I3BA 5L4IA 4YWGH 2D31B 4RAUA 1IBYA 1UXWB 5CP7A 5D96C 8FABB 5IESL 1MI5E 2FX7L 2KC0A 2XYCA 1TTAA 1M05B 1R6VA 3D9AL 2KDGA 3NIDB 4ZSOE 1VFMA 4TOYL 4M3JA 5CFAA 2VUYA 5H4ZA 3JZYA 2HWZL 1JF5A 3KLQA 3ET9F 3O6LH 2QV2A 3OG6B 4NT6B 4QO1B 5CBEA 1XR8A 1X9QA 4I1RA 4JO8A 4PLNC 2C3VB 3AXLB 5DD5H 3EXJA 3VW3L 1IM3D 3O3DA 3GNMH 1EGJL 4Z6AT 2D3NA 5JIIA 3VSTA 3AC0A 3G6JB 3JWNH 2CUAA 1AS6A 2P8PB 1G7LA 1AQDB 3VA6A 3PWPD 3HI1B 4R7LA 4KZEH 2PW1A 4KKQA 1CG9A 4ZW7A 1OWWA 4HUKB 5BV7B 5JPNC 3MGTB 1I3UA 1KFAH 2X9WA 4URTB 4Y2OB 2XFXA 1GOGA 1UZ6E 3DJSA 1A9EB 2BWDA 2YPVA 2UY6A 1KULA 3IDYB 3AG4B 4G8GD 2XWBA 3WIFA 2VERN 4TL4A 5C0CD 5KBKA 1ZTXH 1OTTC 3JWNG 1OAKL 2AXJA 2BFVH 4NQVA 2OL3A 2AV7B 4HWUA 1HESA 3KCPA 3TBSB 1R47A 4J2QA 4JS7A 2ZAGA 4AQ8A 2ERJC 3HE6C 1PAMA 3KGTA 2WB7A 1JXGA 4PRNA 1CXHA 1DJHA 2F58H 5DEFB 1L5GB 5MEPA 4J23A 2A0LC 4JFZH 2CDFA 2JI1A 3DYOA 3PFUA 3U7YL 5DHYB 3DWTA 1BVOA 3DSFH 4BD4A 4JO2L 3IAPA 1QI4A 4JG1L 3K4DA 4NO0B 4GIOA 4XCFL 5CJXC 3BP5B 4C54A 4ZFFB 4NNPL 3ARVA 4N90D 4KKBD 4X8JA 4JRYE 4KK8C 3BZ4A 4G6AD 2H1LM 2P45B 5KSUA 4NKQB 1S5IL 4ZYKB 3ZBMA 3SCMB 1FRGH 4E9LA 2FBJL 5L4FA 5KSVA 5E4EB 1B2WH 5LO7A 5I1HH 1M57B 3Q8FA 3AREC 3MFFA 2VDPL 4JG9A 1ZK9A 1OQXA 1RIVL 4O51A 1A6WH 2R0KL 3GSWA 1TZGH 5D2NB 5CKAA 1J18A 4MD0B 4YXKH 4AE1A 2IDQA 1Z9NA 5C0JB 3NJNA 1LO2H 4S1DC 4X9BA 1OY3B 3MJ8B 4DEUA 5EG6C 3UTSA 4F33B 2X0WA 5DQ9A 4WENB 5DK0B 1T83C 3OKLA 5GZNA 3C6LA 3PWVA 3GRWH 5FYJD 2ZJSL 4Y8DC 2DIJA 3PWVB 1NFDE 2KI6A 1IX2A 4JN2A 1JZ7A 1N64H 4JQVC 1J1XL 1QYGH 3GI9L 1JMXA 1M2VB 2ADGB 3DGDA 3K81A 5C08D 1MKFA 1DBKH 3ZE1F 1SPDA 3QXWA 4Y0GA 4Z7VF 2J5LB 3BZ5A 3HAEB 3WG7B 2OTUA 5I8CA 3K8KA 4LQ1A 3TA4D 1R1CA 4MTMA 4ZT1A 4BHUA 1WE5A 2Z31C 3VD1A 1HZLA 1DJIA 2GC4C 4MB4A 3O81A 1UB5A 3W3BA 1U58B 3QP3A 2FNBA 2HT3D 4JY6B 1TPXC 1BMGA 3HG1D 1U6AL 3QFJA 4KV5E 3PQYD 4MYPA 4RBPH 4AQAA 1JP5A 2IFGA 3QHZH 3GM8A 2JKIS 2CGRH 2X44D 2Y6SD 5LBSH 3WFHB 3QZMA 4X7EC 1YEDB 4ES9A 1EH9A 3CH1A 2BNRB 3E3QE 2IEPA 4LPVA 3T3PB 4U6HA 2XWZA 2CR3A 4OUUB 5D7IE 3T4AB 5C0GB 1PKQA 3ESPA 2LTQB 4ODHH 5BZWB 4KI5E 4DP2X 1R3LB 3CQFA 3OKKA 3V5KA 3Q5TA 4X6FB 1EJ8A 4Y4KB 3RI5F 2DEYX 2I7SA 4ZPVA 3TT3L 1DANT 2CGRL 4IOIB 4HEPG 4WSGA 3RZCB 5DEFA 4JHVA 2X89A 1VZIA 3W39A 3E8UH 4PJ5A 1G7MB 4OIIH 3GZPA 3FMGL 1MHEA 5JDSB 2QSCL 5KS9A 1JZ2A 3QQ9C 2P42B 2CWRA 2IXQB 2ZSVA 5D5ME 2BZDA 1SF3A 4KRPD 4AIOA 3ZMEA 3QIBB 4XCEB 3IN0A 3QDJB 1IJ9A 2WQSA 4U2YA 3AG1B 5DS8B 4Z7VB 4RA0C 1CC3A 1MHHA 1GYUA 3GS4A 3PWUB 3PWNA 4H4NA 1R3IH 1IO4C 3CVCA 5E99L 2DLFH 1KGWA 2YMTA 2YD4A 1I4FA 1MNUH 1YMHB 2ZXBA 3DETD 3F00A 3MRLA 3VTAA 4FADA 4RWYH 4KRPC 1J9SA 5JOEA 5T1KD 3VXUB 1IZJA 1X9UA 5DMIH 4DCQB 4UYPA 3WXVH 5ENWA 5KEZA 3WNKA 3WN5A 1GGCH 2W9EH 4U1MB 1QACA 1U8QA 2FJGA 4AI7A 4DF9A 2UYLB 4FNLH 2GT9B 3LIZH 4HCGA 4H0HB 2YPLB 2D3JA 2UVFA 4M7ZB 4PG9A 2HMID 1FC2D 4IOFD 4M6OL 3ZSTA 4B9ZA 2BP3A 4G9DB 4YZFF 2OJZL 2X2HA 4ZMOA 5FUZL 4XOBA 4GEIA 5EZOL 5E6IC 5HHOA 1AC6A 2EVIA 1V54B 3CDYA 3C8HA 3D30A 3CN1A 2DKMA 3D12B 1OAQH 2KZKA 2ICWJ 1DO6A 2G5BA 2CPUA 4P2OD 3D33A 4AJ0A 2IAAC 2NY6B 3EYVA 1TQCB 1VFBA 2X0UA 4FRWA 4NNYA 2IAMA 3ETBF 5IMOA 5DUMH 5I30H 1KCRH 1AACA 2PO6C 3L1OH 1L7TL 1GIGL 2WWMC 1NIDA 4XO5A 1M7IA 3K4AA 4JDEA 1YEEH 3VGEA 3AS2A 4OD3L 2JIXD 3GSOA 2VN4A 4HQQH 2X4RA 2A4ZA 7FABH 1TCRA 2MCPH 2YIHA 4JB9L 1FZMA 1ILSA 3MXWH 3V0VA 3MUGB 4ZMWA 2WJ7A 3IDUA 4M48L 1ZLWK 3BVNA 1UT2A 5E2UL 2CO7B 2O5NA 3PE9A 4Y1AA 2MNWA 3APFA 5HHXL 3EGSA 5LQBH 4FNUA 2P5WB 3RFZA 5DJYB 1NDMB 2APVA 4LDCA 4JZJC 2QQKL 2NPLX 3MBEB 1I9JH 3P3TA 4LGPB 1Z66A 1KJVA 4P9ML 4RX4A 5C7ZA 3SGEH 3UZQB 5IB1B 2EEAA 1BF5A 3MKGA 3U2JA 5IB1A 4LKCA 1BXUA 3MOBH 4LMQI 4M7LL 1RSFA 3E9UA 3ZOAA 2N7AA 1XIWA 5FDWA 5T1DH 1MCSA 1ZMYA 5IV2A 1NIFA 4AOFA 3QUYC 4FF9A 3U36A 3QC5X 4MFHA 3WY2A 3BEWB 4ALAH 4DZBA 1IVTA 1KFAL 1L9QA 3QORD 1IAIM 4I8DA 4AG4H 4CN4A 5DDHB 3GBEA 4EDXA 1JXJA 3QJTB 4BUHA 1M2OA 4PJ7E 1E40A 2FX7H 4POZD 5ID1B 1T7VA 3TBCA 3FQ2A 3V0VB 3EYOA 1R3KA 5HGDB 4Y1AE 2WBJA 1QD0A 5LGKA 3G5WA 3QUMH 4ZX4A 3E38A 4J28A 4G6AC 4K94L 2B0SL 4MNQD 3AITA 4ZO8A 5LLIC 4IBWA 2BRQA 3B34A 1CLYH 4JVUA 2WLLA 5C0EB 3GGWB 1G9EA 4DVBA 1G1OA 4OTXL 3IKKA 4O9HL 1TSRA 2WINB 5BV7H 3WJMA 1YYML 2OKMA 1OAZL 1QEWB 4U6HB 5C0GA 1NMCB 3UBGA 3CH1B 4AYBA 1AANA 4U1GC 2BOBB 3MOQA 4FKHA 4U6XA 2H2SC 4MZRA 1IC7H 4JPVL 3FTZA 2WAQA 1D2OA 1U8IB 3MLTB 1VGEH 3OKOB 1S9XB 5CD5D 2VE6B 1MWAB 1VGKB 4HHAA 3DSNB 1JK8A 4OIAA 2VNCA 1S78D 3BVWA 3H85A 4UINL 4IGBD 3U7YH 4AGLA 5BVPH 1CZ8L 1F97A 4LLQB 2ZUUA 5IK3B 3SDXE 2VTFA 4B0MB 3FAWA 3L3JB 3HJ0A 2OTUB 4XWGL 1K5NA 1UXSB 3D4ZA 4N3TA 4WO4A 4B60A 1INQA 2QHLA 3FT1A 3ARFD 4UTCA 1I4FB 1YMHA 4J3XA 2YWZA 4HK0A 3DHMA 1NBYB 2VLRA 4N25A 3TCTA 3HC4H 5F7EL 3GSUB 2XZQL 3MV7B 4K7PX 4OH2A 5J89A 4RDQG 2NY3C 4GBXD 2VXQL 4YE4L 3UP6A 4P5RA 4U6XB 3UTOA 4MMXA 2HKFH 4FJYA 3LN5B 3WJMB 4MBRA 4K8RD 4XBGA 4L0PB 1FSKB 1WVZA 2XZQH 1J05A 1AMYA 3DDFA 4C57C 4WU7B 3UTTD 2VXTH 4LEBA 3ZKXC 3V0AC 3R06A 3ECUA 4GMSH 3SPCA 1SJHB 2E27H 5KAQF 3VFWB 2FX9H 5L2JB 4Q9QL 2GEEA 1SLXA 1J9CT 1P53A 4NSKA 2CLVB 5IB2A 2XG5A 1QLEL 2X4UA 12E8H 5KYUB 1G9MC 2X7LB 3GZOA 3QIBC 4QD2E 4X8JB 2O1AA 3K1KC 1MCOH 3MODH 1RZ8B 5LXGH 2BVOA 3B7YA 3MYJA 5L6YH 1SVZA 4GEJA 3BSGA 5J6GB 5GGVL 2ICEA 3CFBB 3ULVC 4KGLA 3MJ9L 3H6AA 5MI0B 3TYFB 2AFNA 1FIGL 2WMPB 4EN3B 1UB5B 4KV5F 4F80A 3CHOA 4APQC 4X80H 4KUZL 5DQDH 1RPKA 1AD9A 1TXKA 4XWOD 2K8QA 4I0KA 5CKGA 1IBDA 2DJ4A 2F54A 3GMMA 1BOGB 2WD0A 1F56A 3OLIA 4H26A 4X0KB 5DHXB 1FFOB 3RFZB 1ZS8A 1SJXA 3JT0A 4WFHE 1A7RL 3ML9A 3QNZA 5AW5B 3NJKA 2DBLH 3LNHA 4KHTL 4K5MA 4NQVB 1IEAA 3KBFA 5DS1A 4AVKA 2B5IC 4MAUH 3ULUC 5I1LA 3GHBH 4A68A 4J1UA 3WIHH 4FXTA 4N8CL 3DX6A 3K2IA 2JI2A 4Z7NE 5HYJB 2C9UA 2F53E 3PHOA 4FZEL 5C09B 3VFTB 2PWEA 3EJRA 2G60L 3O9WB 5MERA 4ZAKA 3A67L 4YXHL 3DTXA 4D9QD 4GI6A 3CZUB 4J6RL 4U05A 5EFIB 4F9LA 5EIIA 2APSA 2Z8RA 1CBVL 1OLLA 3EKCA 3A3YB 3QQ3A 3ES6A 1UQSB 2P43B 4DAGL 1JWUB 3CV5A 3TEZA 1KTDA 4LARL 4O00A 1KGJA 1EBAA 5FO2A 5INDA 2WWKT 3ZKND 4S2SA 4ZYKA 3SJVA 5DRWB 2AJSH 3B5GA 5DK2B 4P4KA 4ADGA 2B59A 4YEFA 3ZKQD 3UAJC 4R0LA 3MAWA 2JJUA 4HCRH 4L48A 3IAGC 2B7DT 3QQ4B 5GRVK 3UH8A 5L4JA 3VM5A 5LXVA 1XGTA 2NMSA 4XRCB 3X12A 5FW7A 2IADA 2YD5A 3V6ZA 3KYOB 4GRMA 3SPVA 1YEFH 4PWGA 4GNKB 3OAYH 5GZOD 1K6QH 4IHOB 1HILB 4S11A 3FTXA 3LIZL 1CDJA 4KKNA 5AWNH 3LKNB 2O5YL 5C7XH 3B7RL 5MEPB 4HD5A 1OE1A 5HYJA 1BHGA 5CR1A 4OLZH 4GRLB 4MAYD 4IK6A 4JFWA 4OLVL 4MA7L 2M8XA 4ZXBC 1BZ9B 4L1TA 2LABA 4PJAB 4R7NB 3RUGF 2G4GA 2IFFL 4LEOA 3K1DA 4OCYL 1B4JH 5KYYB 1DSYA 2PXYB 4LKXA 1KCRL 4OV6F 1TZOA 2YAMA 5E99H 2DD8H 1T6BX 3INUH 1KXVC 4A2MA 4MNGB 3B2UD 3GKWH 5LQBL 4LESA 4DNLA 5FR3A 2Z1PA 3D5OF 4XNDA 4JHUA 3ZT7A 5FS5A 4EBQH 3KLHC 1G84A 2MCPL 3VCLB 1CLZL 2HCZX 3ARZA 3B3IB 3Q3GB 4WI2A 5CUSH 1YVLA 5D1ZB 3HS9A 4X6CB 1BZDA 1B0IA 2NY7L 4NUJB 3E6HB 4F7TA 2VM3A 2AJVL 2ZPKL 1HHHA 3U7WH 3MCKB 3VTTA 3ECVA 1J1XH 1UD2A 1R5WA 5LDSA 2D4FA 4G83A 1JXFA 2AXHA 1O7SA 2X42A 4PJXA 3VXSE 4E9QA 5L2JA 3UPRB 1X7TA 2WNKA 1OZUA 3ZE2F 1QFWI 1OHQA 1CICA 2CK0H 2B0SH 2H5UA 2Y5TB 3U6XS 5BJTB 1F90L 3D07A 5A3IC 3BMVA 5H4YA 4P05A 5DJXA 1CLVA 2EIEA 2VQUA 4Y4FC 3GMOB 5ES4B 2FECI 5IROD 2H1PH 2ZZUT 3GK8L 3KYMA 4D9RD 1NOFA 1AGBB 2HJKB 3UBXB 2IVFC 2H0PA 5E6SB 1JGUH 4QIRA 3UPCA 2PYEB 3QCTL 3IF1B 4KNTA 4WW2B 2HRPL 5AEAA 3AM8C 3VRIB 4HAGA 1IU1A 4ZD3H 1ANUA 3RWCA 3FQTB 3RAJL 2EE3A 5K33A 3V4VB 4FZ8H 2BP0B 4QTHA 4S10A 1KB5A 5TGBA 3RWDB 4QJ3B 3GJFH 2GCYA 4FXKB 4ELMF 1QSFB 4F7MA 1J5OH 3K8MA 2VM4A 4AQOA 5E9DA 4ODVL 5D9SB 4AMWA 1BM3H 4PBXA 4ZMYA 5DVNA 4JCMA 5D4IA 3SYAA 4GQPH 2W95A 5A2IH 5CEZH 3FMGH 3R06B 4NLAA 5EUKB 1C12B 1MFUA 4I18A 2P9RA 1QAWA 5K69A 1WICA 3MRNB 1XGQB 1A22B 3TS8A 4NQCB 1MF2H 2R29A 4PJDE 4S1QL 4KPHH 4NHCL 4UV7L 3ARRA 3NDYE 2DLFL 1PU0A 5IZ7A 4YXLL 2IH1A 1II4E 3CFDA 3VXNB 2B1HH 4JPWH 1I7ZB 4E36A 4L9LC 3F05A 5DJZB 2YAFA 1OAJA 5DHVH 4Y2DD 3WLBA 4BFEA 4PVLA 2XN2A 4N8VB 2VXSH 4H20L 4XP6H 4R97C 3TOPA 4XAKD 5EZIH 1GPOL 1FH5H 5KVEL 2YEZA 3BO8B 3L3GB 3K71A 4HS8L 1J5CA 3ZO9A 4PV8A 4MJIA 4X9IA 3F12A 1B6DA 4H25B 4PVNA 1JCVA 3VXUD 3K2UL 1M42A 2AS5M 3CU1A 4MZIA 4YDKL 4M8QB 4RETB 2UY7B 1PY4A 2XN9D 4K07A 5E7FA 1EFXA 1JFQH 3V10A 4J5VA 3QJUB 4BFKA 3GXPA 1ZS2A 3T77B 4BQCA 5BZZA 2AK1H 4U1HA 3NTCL 4HUCA 2DMGA 4WUKL 2R0WL 1FZOB 5DURD 2H45A 3T8XA 3QG6A 1NOLA 1T6WA 4LQFL 4RBPK 4XMKH 4HHWA 3HUJE 3A5VA 4QXVA 3VFSA 4Z3IA 2YPKA 1BQUA 4TVUA 2AVFA 1DSFL 1T89A 2R56H 1QNZH 4LMQE 4X6CF 3O6FB 2AP2A 3MBWB 5KVDE 5F97E 2O6EA 2C1PA 3EHBB 2AK1L 4B53A 2X4RB 1C5CH 4PRHE 1EUUA 4DKFH 3ISYA 3HI6L 1T4KB 1M1SA 6PAZA 1GVIA 4L8BA 4BDVA 1QWHA 1OM9A 3B7TA 2EQDA 2Q87A 1M7DA 2D03L 4PIRF 3HMXL 1JRHI 2RFXA 4P2CG 1P1ZA 1IJNA 4JFFA 3IFPB 3MJ7A 5BZDA 3HPLB 3NFPB 3QS3A 3S48A 3FHAA 4S1SH 1PDKA 3RJDA 1QBML 4ECNA 3D25A 1YQ2A 5E8OB 4K3DH 4HUVA 3L4TA 1A7BA 4MQXD 4JFHD 1TVBB 4ODXA 4F2MA 2PUQT 4I0PD 2H6OA 3KE0A 5AL0A 4YDJA 4F3FB 1OANA 4AM0A 4HJJL 5A16B 1VPOL 3RGVB 3BCFA 3QULB 2FBOJ 2KZBA 4HFWA 3W57A 4IMKA 2DQUL 1DCLA 1YEKL 1ZE3H 5E9NA 3EOTH 1SOXA 1KNOA 1SYVA 4LCYB 4BWTA 4ESKA 3TURA 1RULL 3VH8B 1O5DT 3I3DA 4LVEA 4PY7A 4X6BA 1B0RA 5DUPH 5CJ8A 5L7XL 1ZXKA 3MRLB 2EO1A 1S9VB 2YD0A 1QNIA 4L1HA 2YARA 3H42L 2HXAA 5L4MA 3HPLA 2ENYA 4BIKA 3V4UH 3P73B 1LQSR 1IBGL 2JB6B 3VGHA 4ZBJA 3BUTA 4RH4A 1KIQA 2E0PA 2DY2A 4RGNC 4KZEL 5B1BB 1DANU 2AEWA 1K2DA 3GDCA 2K1MA 4HETA 5EU4A 1WGOA 3P9MA 2X1XR 4QUOA 3L7EA 3E8VA 4FQ1H 4UZSA 1LWRA 4XODA 2A9NL 5AAMC 4WDIA 1PLCA 5TE4L 1GZQB 4ORGA 3SDXF 3ALXA 3Q7JA 2D7NA 4APXB 4L4TD 1NLDL 3N1MC 1NBZA 1MXDA 4Y7MA 2JE8A 1PAZA 3UTZB 2Z34A 1DJSA 2YAOA 2E9JA 2ILLA 4KQ0A 3GUFA 1Z9PA 3JVFC 3H2WA 3HVNA 3BW9A 2JKRM 2VJXA 2YD2A 3GMNA 3K2MC 5IIEA 2WO4A 4XPBH 1LLAA 3L5XL 3U0TA 4AT6A 4YHML 4RDQF 3L4VA 1F11B 3QNXA 4IJ3C 2WXMA 1HJCA 1AYOA 3AAZB 3T8MA 2WNXA 4NP9A 3JTSA 3NFNB 2GAZA 1CURA 3BUIA 3VRIA 3MRIB 4FQXD 1BJ8A 4X42A 2OULB 3GJFB 4QRRD 1SMOA 4Y19D 3TO4A 4CRPA 5C0BA 3C5XA 3BRFA 3K71B 3ZZSA 5HYSG 2NX5E 2XTJD 4N2KA 5FECB 1JZIA 2V7NB 2J8OA 2A6JA 3B2DC 2HUEA 2ZPKH 3U7WL 4LSTL 4DESA 3NTCH 4OF7A 5ECGA 2ADGA 3U4BH 3LD8B 3ARTA 1QVOB 1Z9SA 1N3NA 1ITBB 3T77A 2WGNB 1NCWH 3R4RA 4K4KA 1JPSL 1JTTA 2G4EA 3IDIB 2OYMA 4Y1SA 1A6ZB 1NFDB 3OKKB 3V0FA 3AG2B 4L5FL 4TULL 3W82A 2IOMA 2YKLH 5FYLH 4A2DA 5AVXB 4E2OA 1SXBA 2FATL 4LNRA 1JL8A 3FU7A 4GW5B 4JFSA 5EN3A 5AYTA 2GJ6A 3RDTC 5ICZB 3C2SA 2IV9A 4RA3A 1CIUA 4LDEB 4IU3A 3VVVA 1TJHL 3M8OL 4QRPB 3TZVB 4J3OC 1PSKL 4PJCB 4N8CH 5C6WH 4R6UA 4JQIH 1J0YA 3CBKB 2F53B 5F1NB 4FQJH 3FYEB 3V6OA 2DMBA 4ODBD 1UXLA 4HIEA 3VX1A 4YHYC 4R97B 3C6SB 5AW9B 1RUQH 4F8OA 2P1YA 3O4LE 3BIKA 4GFTB 5HI3C 4JGJA 3RY5A 4F7MB 3L16A 4P46D 3B5TA 3VX0A 4JGNA 4L2LA 1KXVA 3NFSH 1A7PH 1QUNB 2GQHA 1UZ8B 3HC0B 3U9WA 4P2YA 2XZZA 1Z9MA 4LLYB 3T2NH 1ZHKA 1A25A 1H3VA 4J3VA 3MLVH 4PJIA 5D7EA 2Y24A 1QASA 3PF2A 4HKXA 2ZYRA 3E0GA 4EVNB 4BFJA 4F1ZA 1TVBA 2G60H 3AGVA 1X4XA 4X6DE 3GBNL 1M6OA 2X4TA 4FA8A 1BQRA 4N0FA 4WFFD 1R19A 1QR4A 4PJFA 5E2VH 5JIMA 1L9SA 4L1SA 5ERWA 3QO0B 5I5MA 3AB0B 4BXVA 1C12A 2NY3D 4GBXC 1C5DA 2YGPA 5CLZA 3SPHA 2JMRA 3QIWA 1PG7L 3FQRB 4X2UA 3BLKA 1SNRA 3QIUB 5DD3H 3MSPA 1EUTA 1N0LA 3RKPA 3V52H 5H37A 3NIDF 2XG4B 5CU9A 3VQ1C 1ZJAA 4X7TA 4S1RL 3VGBA 2F18A 2QL1A 5D93C 3WNOA 3WUWB 5T8IA 2HT2D 5CD3B 5CBAB 1KG0B 2NY2D 4PP2A 2EE0A 3PCYA 4PCKA 2CM5A 3O0RH 2G9HA 4PRAB 1T04B 3TV3L 3K2UH 5CD5C 4K7PL 1DHKA 3MLYH 3U4EA 4PSRA 3HE7C 5CR8A 5HJGA 5T5FL 4WJKB 5DJCB 1JFHA 4OI7A 1ED3A 4KZCA 1X3DA 5TK4A 1CT8B 3QQDB 2C34A 1MIEL 1RCYA 1YAZA 5T33L 1GGBL 5TD4A 3P2DA 3CZJA 1MW1A 3NCJL 1EJFA 2Q8BH 1UH4A 2IQ9L 3CSYA 4NT6A 1VRSA 3ESUF 1SN0A 4BZ1L 5C08E 4WDIB 4NQDD 4WK2B 1C08A 1WITA 1QR1A 4GY4A 1L6ZA 2OZNA 4H8QA 4WO0A 3PWLA 2ZOLB 1OAXH 2F19L 4MD4B 4PGBA 4YXLH 4JG5A 3VXRD 3CIQA 2ZX5A 3LZOA 1LD9B 4GP5B 4TQPA 4V1DE 3PJSA 2XWBB 2W65B 5IHUH 1NFKA 5F6HI 5GS0D 5D7LA 2EEDA 2C3WA 3C60B 3MNWA 3TZVD 4IKJA 1BIIB 1K8DA 2TSBA 1GHFH 5LXGL 5I82A 2E6JA 4PUBH 2R27A 1T0OA 3HN8A 4MS8D 3RP1A 2G3MA 2ITCB 3DBXB 3C5JA 5HHQB 3QUYD 2I32A 1CGYA 3C5JB 3HCVA 1Q8MA 4CDGC 4GUCA 1LO3H 4ZTPH 1SXCA 1IC0A 1CFBA 5DRXA 4YSRA 2IC2A 5JHDB 2ADFL 3S2AA 1X7SA 5TQ0H 2EVJA 1KIRB 5PCYA 5D8JH 4LRIA 4J8RA 2C3VA 3Q6FB 2PCXA 4Y16B 3AQZA 5BUGA 5B39A 4XTRD 1BZOA 3H0TB 4PRHD 3WSQH 5DO8A 1EXHA 3ESMA 5HHXH 3KLSA 1JDAA 3TEWA 1EZSA 2JV6A 4HUVB 3CSGA 4APQB 1G0XA 5JPMA 1T03L 3QWOB 5K9OA 4XCYB 2K9FB 2WJ5A 2AJXH 1NC2B 4ACTA 5I76B 5FUCC 5AOJA 3RWDA 3KL0A 2BY2A 1JHTB 4XN1A 1S7QA 5IG7A 4LLDA 4QHMB 2NQCA 1P2CA 1BECA 1DQDL 4Z3JA 5K9QG 3RY4A 3V5DB 1WA2X 5BQDA 3FT4B 3EJUA 3DMMB 2Y7OA 5DJ2A 1ADQL 4A2HA 3CXHJ 1NWOA 1NCNA 4MMXB 3MC0A 3O6FC 4XP4H 2ICCA 3QQ4A 2PYEA 4G8GE 3V9EA 1GR7A 1A2YB 1IGIL 2FQFA 3OKNA 1C7TA 4X5LA 2B9AA 4LVNC 3UBXI 3ATBA 3NQKA 3PLYA 4J3BA 1IEHA 3L1FA 4L3EA 3UZEA 3LZFH 3MPCA 2KZ1B 3JV6A 3KYAA 2X4QA 4JBSA 5IBUB 5JW4R 2NOYA 5I28A 4W9GC 1LO4L 2BDNH 1JGVH 3WNNA 4X99A 5T1JA 1NC4B 4LO9A 3G08B 3OC8A 1BQSA 5AOIA 2MCMA 2X4PA 3FCUB 2F8XC 1FDLH 1AP2A 1NCCL 2CJUL 4GKZB 2EDJA 1N67A 1C5DB 4LU5L 1ZWIB 3OAWA 1EAQA 1ZWIA 2PABA 2NY1C 3MYJB 1M7XA 3FCSA 2BVTA 1F3JB 3G04A 3AQXA 3WENA 4EOWL 4GSXA 2CDEB 4AJWA 2GW5A 4JE0A 5JIQA 1U3YA 4NZUL 5IB4A 3HB3D 3AACA 4O51B 1ACYL 1JTOA 4A7VA 4N2GA 5DJXB 2MFNA 2VR6A 4R96B 2E3VA 2OQJB 3QCUL 2A7BA 4RAVA 4NQCD 1U3NA 1P7QB 3N41F 3FULA 5BRZB 3FOLA 2XA8L 2ENPA 4JPVH 5C9JB 4W9FC 3SE3A 1N10A 3BD4A 1HS6A 1JMZA 4KXZI 4LT7A 4WU5A 3EHBC 3GWJA 1CDYA 3U9PL 5KVGL 1KDIA 3ARWA 4F58L 3IPFA 1ZHNA 4QXGL 4ABWA 1H8SA 4L5FH 5F0LB 4XN8A 2GITA 1C1EL 4NIKB 4EXKA 2CA4A 1I1RA 4QLWA 2FR4A 3HMWH 4MZ3A 2PKDA 2OSYA 3SKJH 2EAEA 4NSKB 3ALPA 4ORZC 3EJSA 3B9VA 1YO4A 2CLRA 2UWEF 5DJAA 2F74B 4WEMB 1T0MA 1AR1D 4JB9H 1L7IL 1D7DA 4D9RE 1I3VA 2NXYD 3FTVA 5CJ5A 5AW6B 5EPMB 1E2WA 4LL1A 4OB5L 2CRYA 1HX0A 3CGTA 1MH5A 5FKPA 3DVNA 1JGLH 3DX8B 3WKQA 4F2EA 1WZ1H 1RUKL 2XFXB 2X2UA 4LOVA 3T65B 1MCWW 1ZSHA 4PJ8A 1BD2D 2ZUYA 3RA7H 2Y07H 2ENJA 3OZ9L 4NC1E 1IC5H 2AXWA 4AZ8B 3QEQD 1DDHB 3I85A 4QHKJ 5E5UB 4FXGB 4FMFA 2B9BA 5AD0A 2AQ2A 3DJTA 4AMKH 1XXFC 3LIZA 5DRZB 4JLRA 1MFBH 2DQUH 2XZAL 2M2DA 4NQUA 3SDCB 1KY6A 3GRWL 4OR1A 4Z95L 1T1WA 3GB7A 2HFFB 1P5UC 1I8KB 1FL6B 3QUXD 3VYOA 1R3JA 5E8NB 4R3SB 4WNSA 2GG1A 2EE2A 1MFVA 2GSGB 5JHBA 2UVEA 3UMNA 3MLVL 5LG6A 4PJ5E 4I88A 3CC1A 4HU8A 1CFVH 2DI9A 5I1DB 1D5XB 4MCMA 4UT9H 5FCUL 5MP6H 3MJ9H 3EYOB 1DTUA 1ROWA 1IAMA 1HWWA 4L37A 4HC1A 4WHYG 3WOVA 3PS6A 2QPEB 3QQXA 3HNSH 1PKQE 1HI6A 5IJVA 1OM3H 1FVDB 1S9YB 4JM0A 1G7PA 2J6EL 1Q9OA 4HKZB 1CXKA 3QAQA 4KKBC 5AVVB 2E7LA 5IOPA 5DT1H 1BBJB 5DHVB 1YPZB 1LE9A 3NA9L 2VMCA 2A5UA 1DJWA 4Y19E 1G7HA 2XHNA 3JWDH 3ZZQA 4DVBB 1SFDA 4S0TD 5DJDA 2A6IB 4XPAH 4LCIL 1KUMA 4OCWH 2Q5BA 1TTBA 4KO7A 4U1JA 5IEKB 2VR5A 1QBLL 1N7MH 3EGSB 5F9WC 1NCIA 2XZCH 3BPLC 2V7HB 4XNQA 4JRXE 4GAAA 1NMAH 2B2XH 4LSRL 5I1LB 4LLUA 5TE7L 2GJZA 4HWEL 3KJ6L 4FG2A 3IFOB 1SOSA 1E3XA 2X3BA 5EOQH 2V2WA 1H0DB 3BN9D 3RIFK 3RTQA 1SJHA 4ODSH 4F3FA 3OR7A 2YBRB 4ILDA 4NNPH 1QSEA 1KTJA 1UKTA 4KAQL 1HNGA 5T1LA 4YHNA 2NY1D 3RWGB 3MRQA 3IU3A 3Q1SH 4CC4C 5GISL 3GF8A 2DMCA 1INEH 4OFDA 5EU5B 1JNHA 2ZCHH 4JZNA 4PBDA 2BCMA 5LGJA 1X6NA 4ZAKC 5TE4H 1E3FA 4AEIH 3ARDA 4M5YH 1UA3A 4M02A 1FVDA 3W11C 3WIIH 5HGBA 5JW5B 4ZZKA 3AWFA 5E24E 1I9RH 4PJEA 4AQAB 1NGPL 2B59B 3BKYL 1BWMA 1I7RA 1BLNB 4K9JA 2R59A 1RK1B 4PTTB 1T4KA 5ISZE 4WJ5A 1HIMH 5DJ6A 3CVHL 3ESNA 1NFAA 1P4BH 4Y4HA 4IBTA 3UGUA 4P9HL 2TSAA 1RZGB 4NWUL 5ENWB 2X4OA 3WYRA 3KMDA 1YEIL 4NQXA 2N7BA 5I1KL 3ZVVA 1OTUD 1FG2B 3GMQB 4FFYH 3BZFA 4GYBA 3TC9A 4MJ6B 4OF8A 5MENA 3PWJB 2Q2LA 1A6UH 2Q6WA 4ZXBB 4N0FB 3II2A 1NGXB 1J9TA 2DEWX 1TITA 1Z5LB 4LOUD 1EDYA 2VR4A 1YEGL 1OAYH 2QQLH 3IDIA 3S96A 2GPZA 3E2HC 3D4YA 1J9QA 3QIBA 3QR1A 4XCEA 3UGXA 4X4XB 2EKJA 1X9LA 4ZX5A 2F7IA 2DM2A 4LFHD 2WNGA 1ML0A 2XVGA 3DVNB 1MRDH 5FOJA 1E5BA 3QJRB 5LDUA 3OPZH 3GINA 3TL5A 4OLWL 3GMMB 1QRNB 2BY1A 2ZUQC 3OR6A 4PS7A 1UH2A 4MJHA 4N2BA 3IETA 1AD9B 3VD7A 1PJWA 5L88H 1NMBH 4M4PA 4PJXF 1GOFA 4Z7QF 1FFRA 3T0AA 3ZHKA 3DSNA 4YHLH 1NEZB 3UYRH 3SE4A 5ICYA 1EHLL 5KSVB 1L9PA 1FFQA 5EC1B 3TFBA 1KCUH 1JPGA 1RK1A 4PTTA 4F9PC 1OTUC 1AKJA 1XBRA 1CTMA 2W9DH 1FN4B 1YSOA 4Q6IC 1M1XB 3AS0A 5BRZE 4XVJL 1O6SB 1FN4A 1NBQA 4BSVB 1DJYA 1WA0X 2Q2EB 1JPFB 5J12C 1UZ6F 3U0WH 2HTKC 2WQRA 3VFWA 4JHAL 4Q7DA 3CFJB 3HG4A 3KL3A 3ABZA 3MRNA 2O5ZL 4P23B 2N4IA 2YSSA 4DPCX 2BSSA 4LU5H 1QSEB 1QRNA 1WFTA 5D71H 2AEOA 4HLZH 4PMEA 4D0BB 2MIZA 1AHWC 3FB8A 4GI9A 3ZMNA 4JJHA 4EMZA 5GS1A 4XMVA 2WOYA 1QPPA 1CXFA 1KBGL 1ONQA 2ZKHL 3VRJB 2YRBA 1LQBC 2FB4H 1RHHB 4Q14A 5GS0L 5B1KA 5D1QA 1EEZB 4Z23A 3DRQB 4U1JB 4OZHE 4XOAA 1Z9LA 3N04A 2W88A 4AVHA 2NZ9D 2A6IA 3HMWL 1NIEA 1ICTA 2MMXA 5GS1C 4YHIA 1F13A 2AJZA 5FYLE 2JFCA 5LNGA 5KSBE 4OGYH 3QK0A 3K3QA 2VQ1B 1OARH 3LS5L 1OHZA 4LARH 2EC9U 4FYSA 1SHWA 4NM4H 4GG8B 4YE0A 4AIZA 3UC0H 1EHKB 3BE1H 4AVJA 4YDJB 3MUGA 3VXTA 1PZSA 4A7SA 5EWIH 4Z7UB 3T0EB 4OM0L 2VQ4A 5F3HB 4QXTB 3INOA 1AIZA 5C86A 2DJSA 3RYMA 4XVSL 1P84K 1BQHB 2P44B 2CIKA 4JGMA 4AQ1C 1XIWC 3NIFE 4KK5C 1KIQB 4HAFA 3K5RA 4FERA 1S2EA 5CZXC 2BY3A 5DJ0B 1WA1X 4PGEA 3P2TA 5EOTB 4UM9D 3CCHA 1S9VA 4A2GA 4Y4HB 1EEZA 4P46C 1A4AA 2D73A 2EDMA 2OMVB 3R8QA 4FLOA 4UV4H 3R7QA 2ZKYA 1A64A 2H1XA 4PJAF 5B3SB 4G8IB 1WZAA 5FCUH 3GSXA 4NRXA 1HZKA 5B39B 3RX8A 2YO3A 3R4DA 4IMKC 2BVEA 3VI4B 2V7HA 4DFIA 4QR7A 4XZ4A 1KIRA 2CM6A 2JSFA 2HFGH 4J3OD 5AB1A 2GVYA 1D2PA 4XNXL 1OPGL 4PW4A 1TQWA 2IH8A 3AS1A 5IQLA 1TZHB 2Y1ZA 4FLQA 2ADJB 2FVNA 2X3CA 1G6RA 1U8KB 3I9GL 2YUVA 4TN9A 1XCTB 1T5WB 4HIPA 2XQBH 3PDGA 4PREB 2XKUA 3AY2A 4M5TA 3T3MF 3QS2A 4GBXB 1FVEA 2WNWA 4QPEA 4HDIA 3MX0A 4BUGA 2HN7A 3P4LA 3X13B 5FYKL 3G5XB 1BZ8A 3W0WA 3WMQA 4ZQKB 2JKTM 1O6VA 1IC5L 4ELDA 4M93C 3X12B 1QA9A 2JCWA 2B1AL 2C1PB 4N8PA 4ODTL 3A6CL 2WQVA 4XPTL 3GSOB 2MSPA 1QWUA 5C9JA 2VJ0A 3QEGH 2AEIT 1MI5D 2GIXA 4Z8FL 1NFIB 3WHE1 1XH3A 4KROD 4G6FB 4JM4H 5DJDB 2ZX6A 1A4KB 5GHWH 4JHWH 4DZ8A 4Z7AA 3GNML 4LIQH 2BFGA 2XVKA 1KJ2L 3LXCA 4R84A 2E8ZA 3TO4C 3CHRA 4NPYB 4BE5A 3TNNA 2OA9A 2WIMA 2VISA 3DVFA 1SBSH 5ALBH 3C6LB 2ARJA 1CLOL 1EFXB 4RFOH 4FQIL 1NUNB 2FEJA 1T0NB 3S35X 2D7TH 3RIAF 3TU6A 4ZXBA 1RIUL 1DQKA 4O4YL 3WJJC 5C0RH 5CCKL 5L0QB 2A73A 3FONA 3LH8A 1IMHC 2AQSA 5GSRB 4AM0Q 4K9EC 1TETL 1H6UA 2F2HA 3IJ7A 5CGMA 2ZAIA 4QHLA 3WD5L 4F37F 2EDOA 1MY7A 5FGCE 2C9SA 4POUB 4KRPB 3MFFB 2Y25A 4N8VA 1MCLA 4FQIH 1F6AB 3KLDA 4Z0BH 3VFNA 3CHPA 3AVEA 4M7JH 3SOBH 4HWBH 3RWCB 1TJGL 1CXEA 3O6ML 1J5IA 4PV1C 1ZTMA 4FXGA 4EIZC 2X4TB 4WHTA 1OLZA 4JQXA 4Q6IB 4GMSL 5AYUL 3O2WH 1YECL 3F7YB 3HC3L 1KYOK 4NO0A 1D5RA 1IEBA 1A65A 3ZYJA 2EC9T 4F9PA 1FGVH 2XTJB 5FKPB 2XCMC 3HR5B 2ZP0T 2HPOA 3RA7L 1QUNA 2I5YL 2P5WD 4WWNA 4YHNB 3FUHA 5I66B 4JFDB 4I18B 3O8XC 4JM2A 1D7FA 1TQCC 5T5NF 1HOEA 3QB7C 2MCG1 4EZMA 4W93A 3ZSSA 3ISWA 1FNGA 1JHLH 4KTEL 1DEEA 3ELAT 4R4ND 4LSQH 1MJJA 3H7BA 4A38A 4Z7VE 4O58H 4PJCA 2CBTA 5G5DB 4KUCD 1EGJA 5L2KA 3BAJA 3MNZA 2V2TA 3FL7A 3JYBA 3NCEB 4PY8J 1OSZB 1OZTG 1GMEA 1S7UA 1UWXH 4YN3A 5IQ9A 3P4NB 3QXDA 3AQYA 3ZTEA 2DBLL 1HSBA 3PXHA 4QOKD 3VE0A 2JKJA 4YBQD 4I77H 4U1NA 4GXUN 1X7QB 4CN1A 1JGLL 1HCZA 4KWUA 3O3AB 1SEQH 3ZT6A 5DQJB 2K8MA 4B0MM 5BRZA 1RZIA 3WN6A 4MVBC 4HMDA 4AKQA 2A4CA 4HS3A 4OZFB 1MCWM 4DVRL 4E9WA 3F7VB 4FZEH 5CMAB 3NAAH 4PW9A 1MJUL 4PB9L 5D7IB 3A47A 3NPSB 4N0CC 1FNAA 3Q1EA 3O6KH 1MIML 4JJ5A 4PJDF 5GRUH 4BEIA 5AB2A 3ILPA 4MS8C 4XPAL 5E2WL 5IF0B 2YS4A 2R0LL 4PRPB 5D7KE 5A2CA 3P4MB 3REVB 1J8HD 3LOWA 2VZ3A 5LN8A 4UTAL 2KMWA 3MJ8A 1X6LA 2ZG3A 1G6RL 4JO4L 5CWSB 1HWHB 1RJLA 2HN7B 3G6JA 4YSOA 3ZTNH 4PR5A 1FFNA 1WH0A 3MQIA 2UWEB 4KXAA 1Z5YD 4UQ2A 3R1GL 2XX1A 4AQ8C 2ZCKL 3ULVE 3U4EB 3IFLL 3DC0A 3D3VA 2FO8A 1A4KA 4L8SC 4NM4L 4P57A 4X4MA 4QWWD 3EOAB 3E9TA 3OWRA 3QEHA 4JPIB 3MTXA 4KK6D 2PCPA 2PXYA 5IQMA 3FBKA 2VO8A 5EU4B 2D7TL 1HZHH 2CO2A 1GKOA 4ONHB 2BSEA 1BAFL 3LHPL 2RH0A 2BVPB 3KWUA 4LLDB 4QHMA 2BW4A 4Z7OE 5IMMB 3DO3A 1R0AH 4MRCA 4Y19B 3ORJA 2PPAA 3U36B 1J48A 4JZOA 2P7TB 2CO6A 2Y72A 2RB8A 3E8UL 3ML8A 4KKAC 1T66D 3PHOB 5JPMB 3U7AA 3NIFF 2QSQA 1JNJA 3TA3D 3AMLA 4IM8A 2A6DA 3N43F 1RJZA 4M93B 4N0RA 2QKIB 1CDBA 3DIDA 3JWOC 2AXFB 1V3JA 2JLLA 2Y1YA 2ZONA 5DUML 2J1KA 4HCRA 1BXAA 3BAEH 3V79C 1GIGH 1H3XA 1A7OH 1Q0YH 4G8IA 3V0DA 3FQNB 3HI6H 1G7QA 4QTFA 3SJVB 5L0QC 4KVPA 4JRWA