2OXHB

The soxyz complex of paracoccus pantotrophus
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
115
structure length
114
Chain Sequence
HGSSTVDELTAAFTGGAATGEGGLTLTAPEIAENGNTVPIEVKAPGAVAIMLLAAGNPEPAVATFNFGPAAADQRAATRIRLAQTQDVIALAKMADGSVVKAQTTVKVTIGGGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SoxZ protein
publication title The SoxYZ Complex Carries Sulfur Cycle Intermediates on a Peptide Swinging Arm.
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Transport protein
total genus 25
structure length 114
sequence length 115
chains with identical sequence D, F, Y
ec nomenclature
pdb deposition date 2007-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13501 SoxY Sulfur oxidation protein SoxY
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2470 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2oxhB00
2OXHB 2NNCA 4UWQB 2OXGB 2NNFA 2OX5B
chains in the Genus database with same CATH superfamily
5GJTH 1PY4A 1ZWIA 3FQ1A 1UHVA 3TWCL 2XQBL 4W1TA 1TTGA 2G3MA 3AREC 3CLFL 3FN9A 4P05A 5DQ9A 2X1XR 2BOBB 4K4KA 3INOA 2Y7QB 5DQJB 3I9GH 2Z1PA 3PDOA 3MNWB 2E5EA 1SUJA 3C87A 4HWZA 1N59A 3EJSA 2L7QA 3OR6A 5FFLA 2J8UE 3OAZK 5H35A 4HS6B 3HG1A 4XXCA 3M46A 1T7VA 4OAWB 1NCOA 4BH8A 2LVCA 2VC2B 5IB3A 4JK0D 4GEIA 1H8OA 1LHZA 1OB1B 1QBLL 1AIZA 1PLCA 1FVDA 2LW3A 3KPSB 1SVZA 2HRPL 4Y1SA 2F53B 1L9PA 2R8SH 1F11A 4PJIE 4XPAL 3NFSH 1UURA 2FSEA 3SE8L 2Y1YA 2JXMA 4YIQB 2Y7MA 4BV1A 1E9QA 1JZHA 1HDMB 3OHMB 1UD5A 3KVPA 2BVOA 1KFGA 5ADOH 3KPSD 4A6YA 4KXCA 2F53D 4HX1A 1YC8A 3AFLA 5DHMC 4G8FA 2A4EA 3D2UB 4BFNA 4PTTB 3K7UA 1KLGB 4NQCB 3OF6D 5CSZA 2XTJE 5I1GL 3CVHB 3KPMA 3QUKA 4MQXD 4NNYA 3GBNH 4BD4A 2HXAA 2F6AA 35C8L 4FQLH 1JYXA 4QXTA 2YWZA 5B1JC 1GC1L 1OCRB 3PV6B 2GAZB 3CFMA 3D2UD 3MQIA 2ORBL 1SHMA 1Z9LA 1ADQH 4FZEH 3UBXG 4KOBA 4NQCD 4TRPL 3VG0L 5BUGA 3GI8L 1HH9A 5AW1B 5DEZA 2X7LA 2WXLA 3QCVH 1U8IA 1AOHA 4DP0X 3L4YA 4OCRH 2YAQA 4M4RA 5FK9B 1IM9B 3S4SG 4B9JA 5BS0A 2DQHL 2HT4D 3T3PF 3TNMA 3CN3A 2IXQB 3A4FA 2UWEA 4G7RB 4JANB 4W81A 1XIWB 2KDGA 4MYWB 3NACL 3OLDA 5HHOD 5C08E 3KGTA 4K8RH 4RIRA 4LASL 1S5IL 3WLWC 4ERSH 1PJWA 3KWWB 1OAQH 3BGAA 1E4HA 4FTVD 1RP8A 3DV4B 2LAGB 3HPJA 3QXVA 5IK3A 3VXUE 5HGHA 4EOWL 4ES9A 4R7DA 3T2OA 2AJ3A 2YK1H 2MCMA 1H6FA 4AYFA 5D7LA 2AXGA 2QQLH 3MACL 1N67A 3WYRA 3F58L 3LMJH 4MRCA 1OSYA 2NUTA 2R69H 2ATKB 1ZIBA 1NAML 1SEBB 1K6QH 1ZRUA 4KNSA 1YUHB 2QVIA 1WZ1L 3ZMRA 3BD4A 3C6SA 1FL3B 3F62A 1MEXH 2UXVA 4IBQA 3FDWA 3LKQA 2QMKA 3GMLB 3PWUA 1U41A 1PX8A 3FQYA 4Z77A 3MXVH 4X9FA 2C9XA 1J8HB 3RE0A 1U6AH 2K6ZA 2Z35B 4KQ4L 4PJ5E 3MNVA 2G3XA 5FA4A 4POYA 5C6TL 3B37A 4F2ME 3QR0A 2C34A 3GI9H 1B4RA 5LCVA 4MKTA 3CFCL 4PVLA 5L4FA 1MRFH 1UEMA 3PGCB 2HPTA 1J8HD 4GS7C 4TUOA 4F7TB 1UD8A 3EG9B 4HUUB 1TOXA 1MCEA 1OW0A 1KC5H 4XVSL 1ERNA 5GGQL 3WFCL 5DUPL 5J8OA 5DK3A 3DBSA 5H94A 4GI6A 3LRSA 1AE6L 3X1BA 1RPUA 1Y6MR 2ZOOA 4NO0A 5E8OA 4U3SB 3AGVA 1BG1A 1G7PB 1ZA6B 4P0DA 2NNAA 3V7AG 2CBTA 5I1DA 4WWKC 1ODAA 5JHLH 3KVQA 2BRRH 1EQWA 1IB5A 3HC3L 1AI1L 3N9GL 3O4OB 1JXKA 4NM4L 6PCYA 1UD6A 4QXUL 2J4WH 4MJIE 5HI4D 3VSVA 2HPOA 3QZBA 2WXKA 3P0VL 4X5LA 1AZRA 2F8VA 1ACZA 4RRPG 1YUKB 2VLLA 3BZFB 2IDTA 4QLRA 3H9SE 4JL1A 5E03A 2WJ5A 4MJ4A 2H3KA 2WLNA 3DSFH 3DIFA 3R8QA 4MMZA 3SJVA 3QWRD 1YHPA 4NIYE 4TXVB 2CR6A 1LK3H 2QPSA 5E4IA 3QQDA 2J55A 4JO2L 1JF1B 1ZEAH 3SPJA 1SEQH 4PIBA 2VABA 4BHUA 3FOMA 3LQZA 3RWGB 4P2QE 2DTMH 4DFHA 3IFNH 5AOZA 4LARH 1AHWC 1KBVA 1NCNA 4PBWD 1EUTA 4G9FA 4A6YH 3NEXA 4IM8A 1RK0B 3KL3A 1AXIB 3ML9A 3JWNC 3O2VH 3TIEB 4TM9A 3IMTA 5A7BA 3OGCA 4GSDL 1TQBB 1ZHKB 1NICA 2TRHA 4XPGH 1G7LB 1XGTB 4C55A 2HLFC 3UH8A 4DP7X 1GXEA 2O93L 5TDPB 3C8HA 4BDVB 1VCBC 3RTLA 1JYNA 4JE4B 4LQFL 2ALAA 4MJJA 1KTBA 4CVWA 3L3OC 2AJXL 3V52L 4IOSA 4M62L 2VDML 1P69B 3R0NA 4HUKB 5I19L 5B8CB 2QFRA 1KIQB 4JFTA 3SZKC 2E27H 4PJAA 3CZKA 3KYMB 1UQSA 4FXKA 2RAMA 3MLTB 3K74B 4IU3B 3I2CL 1S7QA 4XNUH 3V0IA 4DO5A 1CFBA 1I3VA 3E38A 4Y19D 1QR1B 1ZTXH 4JFFA 1T04A 4ZS7L 3WFZA 4OU3A 3BAXA 5B39G 4X8GA 4XRCA 2D03H 1KOAA 4KDWA 1ZLWK 2NY1D 1AP2B 5I23A 4H88H 1IBYA 2E7BA 3Q6GH 4OLUL 1CMOA 2XA8H 2XPZA 3MLXH 1MHEA 3NESA 3WS6C 4PJFB 4XOCA 5DQ9B 1ZCRA 1DBAH 1KYOK 4Y5XC 3H4FA 2PLTA 3AT9A 1VKXB 2YBRB 5I1KH 3DPBA 3OR6B 4Z7QB 5H35B 4K7PY 3WKYA 1YNTB 5D5MA 3M7OA 4ODSL 1AO7A 1TEGA 1M57B 3W9EB 4XNXH 2X4NA 2Z93A 3G04A 1WS7A 2VXVL 3B7SA 3L48A 5HDRA 3HG1D 4QKTA 5EUOF 2JXMB 3T0EE 2IANE 4F93B 2AF2A 3U4AA 3MOAH 2IH1B 1E9QB 2VLJA 3RL1B 5KYXA 1HEJC 3VGGA 3N3EA 1OANA 3RHWK 5LCVH 3BKYL 2EE6A 1G9NL 2UZYA 4O58L 5GGUB 3ZYIA 2X2IA 4OZGE 4QJ4B 5T5NF 1O6SB 1U8JB 2J44A 4GKZB 1IE4A 1NEZB 4R90L 3WIIL 3C5XA 1FF5A 3MLVH 1TQWA 2WB7A 1NIAA 3IGFA 2NYKA 3QEQA 1ZLDA 4ZSOA 4LBAA 4Z7WB 3MVSA 4OFIA 2C4FT 2I5YL 2JJSA 4PH8A 3D30A 3BKJL 1G9NC 2WVUA 3IRZA 3RUGB 5JIMA 4UT7L 2YMXL 5GS0L 2X7LB 3ZDYE 3MZTA 4Z5RA 2BW5A 2VL4A 4HJ1A 1XF1A 1ORSB 3TCLA 4M5TA 2OR9L 5T3ZE 2UWEB 5L6YH 5LHDA 2O26U 4I0CC 4JVWA 2GJ6B 4RIRB 4U49A 3R8BB 1RURL 3P4NA 2D31A 3F00A 5CZVH 5IREA 3BVNB 4NUGL 1HXYB 5GS0C 1P0SE 4ZOAA 5JW3L 1VFBB 2AJ3B 1OWRM 2QQKL 5GISL 2QGCA 3BDYL 3GMPB 1RKRA 2O5NA 2YUZA 25C8H 2OCCB 3DMMC 2GJ6D 3GEFA 4PN6A 5E2UL 2YEVB 4Y5YC 5CGYC 2EE2A 4PJ8A 4ELKA 4HOXA 4JKPL 3PGDB 1SDDB 1BA9A 1A22B 2QPUA 4MS8C 4APQA 5FOJA 4J12A 4AXWB 4W6YB 5JLZA 3QPXH 4OZFB 3VXME 4L37B 3HG5A 4JFSA 4Y4KC 1BM3H 1DEEB 1OAZL 3QJFA 4TVPE 2AI0L 1SF3A 2D3JA 2A9MH 4Z77B 5CEZL 3N1MC 1QQDB 4KHTH 4WHYH 4L4VE 1RZGA 4HXAL 5D7IE 1OQOA 5I2IA 2D0HA 2CBPA 3RIFK 1J5DA 2ZCHH 1IMHC 3QHFL 4ZUUB 1HSBB 1CLCA 2VITA 5I1JH 1CFSB 1J05B 1FFRA 4IGBC 4NAMA 2DQTL 3AQDA 4KROB 2R59A 2AGJH 5L88L 2AEQH 3LRSB 3ROLB 1JZFA 2BSSB 2HFFA 4NO0B 2WBWB 4G1EA 1KB9K 2DWSA 3BFOA 4M5SA 2GK2A 3EGXA 3GZPA 4XAKE 4BFKA 4KUCD 2Y2TA 3BWUC 1Z3GH 2J5WA 1EMTH 1D5IL 4NN5C 5I1DB 3EYVA 2OMWA 1ZHNB 3KNBB 4NO0D 3KLSA 5F6HI 3U25A 4IOIB 5ESQB 2XUWA 2IQ9L 4Y89A 5IMKA 1Z5YD 2P8PA 3C6LA 4PIRF 2NY0B 4EI6B 3U36A 5BQDA 3PWVA 3HRPA 3DV6B 3I9PA 2DS4A 1YEIH 4Q8BA 2DEXX 4PGEB 5EU6B 2XN9E 3NIDB 1LTXA 1RUKH 3T0DA 3DIFB 4MJ5B 1H15A 3EJCA 1ZS8A 1BDYA 3F7LA 1VENA 2NY0D 2XWZA 3LN9A 2PETA 2ZXQA 3BZ4B 1S7RA 5EWIL 1NEZG 2VN3A 4PTUA 3K80A 3OZ9L 5EU6D 3QA3B 1QI3A 4N0YL 1S46A 1QUNB 4QRTA 1B9ZA 3FRPA 5IW6B 4XBGB 1NKRA 1UYWH 1MLCB 4R8WL 3V5KB 2QTEA 3V0FA 3FKUS 3ZMNA 4OFPA 2F54B 4XMVA 1IV8A 5IB5B 5E70A 2P7TA 2V8MA 1ZANH 1JNLH 4Q97A 4XGZB 3NCMA 3H42L 4Z3TA 4WLCA 4G9FD 1WT5C 1EXUA 5KYUA 4TNEA 2F54D 3DBXA 2X4PA 5MP6H 4YC2C 2EO7A 2D0FA 3ROOB 4ZNEE 1EHXA 5EZOH 3SE3A 3TZVC 1YY9C 2WZAA 2XV3A 2A4ZA 5DHDA 3KJ6L 4L9LC 2CHWA 2CJUH 1CLYH 2DICA 4PJAB 5F0LB 3UG3A 4AZUA 3U0WH 1D7BA 1N8OE 1I1YA 1NC2A 4GP5B 2F15A 4LRIA 4ZFQA 4EUPB 4IOSD 4XP5H 4F9PC 5ALCH 5C0AB 5H4YA 1HHGA 2L8AA 4MCZA 3W81A 5EEXA 4YOKA 1ED3B 3EDFA 5ACZA 1ADWA 2V2WB 1P53A 2QKIC 5DD1H 3B1UA 2ZYSA 2GUOA 3H85A 5C0AD 4N6RA 4OFYD 3T3MB 3TJEL 3K5SA 2OSWA 2BSTA 4U1KA 4N25A 5C97A 1Q90A 2ZICA 3EJQA 4WWPA 3RZCB 1HX0A 3ABKB 4JM4H 5JIKA 4KAQH 4UOW0 3X11A 4ADJA 3BT2H 4M8RA 1MFBL 3MODL 4BUHA 4ZFOB 2ZG2A 4XNQB 5DA4A 3O6ML 5D5MB 5JHBA 4E9SA 2FR4A 3BEWA 1SMAA 4AEEA 3RZCD 2J71A 4UI2A 3IETA 4HHAA 2GK0A 3BAIA 1XT5A 2ZUSA 3EH5B 5D70H 3FO2A 1PLAA 3NN8B 1KTDB 5KYYB 2VLJB 3KJ4B 3TBTB 4GAJH 4XN7A 5CGTA 3VI3E 1CLZH 5FYLE 3WJMA 1G6RB 3QQNA 4NXSA 1T22B 4KI5E 1J0HA 2OMZA 4JCWA 4RGOL 4W9ZA 4XNYH 3IXTA 2XTLA 2FDBP 4DVBA 2VLJD 1IGYA 3ULVD 2DDQH 1JZ5A 2IADA 1OM3L 4AMKL 1T4WA 2UYLA 2Z34A 3A67H 4NN6B 4Z7VB 3CC1A 3IFOA 3MLZH 4JDEB 4ZSOB 4AG4L 4LGSB 1G7QB 4KX9A 3FUNA 3JWDH 4PR5B 2IPUK 2MTAA 4GAGH 5CAYB 3CQPA 3RFZB 1V55B 2IALA 1VADA 4WQOA 3QFJA 5EZIH 1Y1DA 3KGRA 5INCA 3A6CH 2X4OB 1JI2A 1MNUH 4IIZA 3G9AB 1D3CA 2Z92A 5IBUG 1BFSA 4UTCA 4LSDA 5CP3A 5EU7E 3QQ3A 4W9EC 3TA3C 4RGNC 4QHNA 3QNZB 4H8WH 4U6VH 4Z0BH 2X6VA 3EYFA 2ZUVA 4MQ7A 1OHQA 3WNIA 2OJEB 2J8UA 1PCXA 2JH2A 4P46B 1OTUC 5FUZH 1KCUL 1RIHH 1UH3A 2YXWA 4P57A 4UAOB 2VWEC 3E0GA 5DJ8B 2FZ3A 4X0KB 4G8GB 1N3NA 4RA0C 4PJIA 4FF9A 2ZCKL 4Q89A 4WFEE 1A4JA 2HFTA 4UZUA 4DQAA 1MFMA 4RWHA 2BNUB 4PJ8D 4LRNH 3RG1C 4BWUA 1J0IA 2GSGA 4GPVA 1N8ZA 4G8GD 1QFWH 3KPQB 4APQD 5TQ2L 4EUPG 1F4WH 4WI4A 4HVBA 4JY6A 4NB7A 5I2IB 5DS8A 2DJSA 2KS0A 3EOYG 2AHIA 2YD4A 1MAML 3ZN6A 2CPUA 4N2BA 3SE9H 2K45A 1YN6B 4EI5B 3U1QA 3NGBB 3GJEB 4LLYA 2A9DA 3BRDA 2LE9A 3UP6A 2CKNA 3VXPB 2CXGA 2ED6A 1A1MA 3BIAX 4ZOEA 3QUHA 3ARGA 3R06B 4U6TA 1TKWA 4ZTOH 1YA5A 5HD8C 1P7QA 3R1GH 3QNXB 4WNQA 1URZA 2VW4A 1E8XA 3H53A 2E7LC 1YEGH 3P0YH 1NH6A 3DWTA 3Q9QA 1M7DA 1AQMA 4OB5H 2K1MA 4FDWA 3EJYD 4PVBA 5C08A 4N5EC 3WTWA 1QBML 1NGWB 3LNFA 3F7YB 4KKAD 3S5LB 4WKZA 4OLYL 3VXUA 2XWXA 1UXSA 2XY1A 3OKEA 4X7DC 2ITDB 4NRZA 2K9FB 3W82A 4NBZB 2MFNA 4NSKA 4G43B 2HX8A 3S3BB 4ABWA 4LEOB 1BLNB 2P8LA 1ET5A 3D3VB 3HHSA 2OXGB 4KTYA 1GRWA 2IJ0C 3C6LD 4HPOL 3UAJD 3VB8A 1OAXL 3H7BA 2V0AA 3VQLA 2VR8A 3VRIB 1FDLH 1UT2A 5CEXA 3L95A 1VEPA 2R7EA 3D3VD 4X4ME 3UC2A 2GJZA 1ETZA 1GSKA 4IQHA 1WE5A 3ASWA 4HHGA 1BQUA 1MQKH 2XFXA 4N9OB 4PJ5A 4NKDB 3OHXB 5ABDE 4C47A 2Z0BA 1T2QL 5IF0A 4TLTA 5F96L 4F2MA 2DWDB 1AS6A 1XGQA 5G2NA 2YARA 5H37A 3RWDB 4BEIA 5BOJA 1PBYA 5ID0B 4HPYH 4YAQA 2VJ0A 5L8JB 1Q9KA 5FAAA 3VAEA 2X2UA 3MJ8A 5TF1H 2E8YA 5KYUB 4QTFA 4YHIA 3IE9A 5FHAL 4NO5B 3REVA 1FLTX 2NNCA 5HHNB 5DZOA 1OT4A 1YSOA 3WI9A 3JTSA 4YX2L 2FGWL 3MFGB 1SVBA 1RJZB 1TXKA 1U95A 5KTEL 1KGYE 2DWEA 1LO5A 4X9IA 4DKEH 4OLZL 4M02A 4F7PA 4LBEB 3UJTL 4ABQA 3GF8A 4GQRA 1SLWA 1RJYA 3L4TA 4NP4H 3MLYH 1GGTA 2ARJB 1WFJA 4PJCE 3FCGA 3DIDA 4PB0H 5HGGS 2WZ6A 2WXHA 5CSGA 5EC1A 4MJIA 1E5AA 3CPLA 2UY7A 1NC2D 1UJTA 3NTCH 1JPGA 3N0AA 4H2AA 2Y07L 5TE4H 3SDXE 2YA2A 4MXQD 2WXGA 4N6RB 2XIDA 4YHZH 1XF2A 3H3KA 1E4WL 1FGVH 3H9SA 2N1KA 1NLBL 2HRLA 3HMXA 3APDA 5C07E 4CKVX 5E00A 1TT6A 2NTFA 5GRJL 3KL0A 3MBXL 3WGUB 5JUEH 3BKML 2A83A 2V2XB 4KKPA 4XHJD 5KANG 3OG4B 1PL3A 5JMRA 3BMVA 3I75B 1KWKA 3ETBF 3F84A 3MC0A 1IFHH 1JVKA 1WP6A 2FECL 1NFDE 4OFVA 1IC4L 3GSUA 4XNBA 4OGYL 4YDKL 3LH9A 4HHAB 3ZRCC 5IZ7A 4HIJB 1MLBB 4PV9A 4JM2C 2CSPA 5JPNC 5GS1A 2OSYA 2VLKB 1RPQA 4LCWB 1M6OA 3P73A 5DRZB 2OMUB 3VFUA 5IQ7L 5KJ4A 3FJTA 2XWBA 1OQXA 2ZOLB 2OMZB 4LCCA 4QF1A 4EIGB 4MASA 2ED9A 4MFHA 4PRPB 5H4ZA 4DVBB 2VLKD 1CXEA 1DBKL 4LCWD 3G5ZB 2YD9A 3S5LG 3J2PA 2R29A 4KNTA 2N7AA 3CNKA 4BQ6A 5I8KH 2ZJSH 2B15A 3OLIA 3H1ZA 2NXYC 1AGFA 2GABA 5KWYC 5DWUH 1BZ7A 5ENWB 5IV2B 1T0MA 1A4AA 1UM5L 2EDTA 4L9DA 1VADB 4ZPVB 5D1ZA 1DUYA 3GRWL 3QFJB 5DR5H 1QEWA 3CDZA 3DTXA 3M8OL 1A66A 4AEHL 1SM3L 1DVUA 3BGMA 1CL7I 3B2UC 2F0CA 2C3HA 2FIKB 4RQQA 2QVMA 5KS9B 3OAWA 1R4XA 3BDBA 4ZUTB 4ZUVA 1USQA 3QFJD 4PP1C 2FL5A 3VGAC 1NCUA 4C4UA 3AXLB 4QHNB 3CHPA 5IMOA 4KRPB 2P48B 2CGZA 1CF8H 4LCYA 3MOQA 5G4NA 2P42B 3JWOL 5HSFA 4F8NA 1M7IA 4QGYA 4X8JA 1A25A 4ENEC 4AIZA 3K3QA 5H2BA 2YAMA 3QORA 3GNMH 3QIUC 4X6CF 3MUUA 4Y2OA 1GOFA 3FPXA 2YAFA 4KRPD 3PWNA 3VG9B 4EI0A 5EOTA 1WD8A 3WHXA 5CJOL 1R6VA 2B1OA 1B0WA 2XXFA 4KV5F 3T0EA 4JB9H 4LHJB 4IW4C 2IANA 3AXIA 4OV6F 3RGBA 4YSQA 1NFAA 4FQ1L 1JD9A 5FGRA 3JWOC 3UROR 3QUYC 3GZQA 4BGDA 5H37H 3VM7A 4OZGA 4Y7MA 3WELA 4XWOC 1SXCA 5DJXA 3MRBB 4G83A 2AQSA 3VFGH 3T6VA 5F6IB 5EO1B 1S9XA 1XZWA 3SPIA 4CVZB 2CLVA 1EBAA 3CHQA 3U1SH 5DU7A 5I0WA 1DVQA 1I7UB 3SDCC 3MV11 4DGVH 1L7IH 2V9TA 3V4VL 2GITB 3N5AA 4TQ8A 4ACTA 1ICTA 1MKFA 1RUMH 1NTDA 3BPCA 4JY4A 4XN4A 3TCTA 1GY2A 3ILEA 4NM8H 4F27A 4WV1A 4Z76B 2CK0L 1MCSA 3ES6A 2ZKHL 2IH3A 2PYFB 3ME0B 2WOYA 1TJXA 2W59A 3VSQA 2JI1A 4EIUA 4KBPA 1QSZA 1LEGA 3V6ZB 2X0WA 3QR2A 5C08B 3MRHA 3ARGD 1FH5H 2A5UA 4RNRB 4PLJC 2ICES 2P5EB 1BVNT 3G6JF 3I9AA 1II4E 4N86A 4D0DB 3HMXH 5KSAA 1FIGL 1DCLA 4JE0A 5C08D 1MFAH 1KNOA 3FBKA 3ET9F 3FUDA 1MIMH 3QZMA 5HVGB 3RGVC 1GYWA 4ISVB 4UYQA 5IKCA 1I9IH 2P8LB 3O6FA 4M1CD 3SPGA 3VD1A 1MH5A 2A9NH 2NY4C 5DEGA 4M3KB 1NCCL 1YDPA 4R5TA 3SYAA 2DJUA 2H26B 2VZVA 3VXMA 1E6JH 2E46A 1FNLA 2R7EB 3HVNA 4Y5VC 2G0LA 1OAKH 2OV0A 5HHVH 4OD3L 5L4IA 2BNQE 4L4VA 5CNHA 5GIRA 5D7IA 5EZJA 5L9DH 5IJVB 5IF0B 1R5VB 4MAUH 4ZFZB 4QRRB 4QCIB 4N2MA 3WSQH 3VFRB 2H0JA 1ES0A 1PD6A 3BPNC 5EOCL 3GSNA 3MX0A 7FABL 1DBML 1WISA 2R29H 1JAEA 1S7SB 1BQLH 2EUWA 3ZL2A 4NI3A 4XN8A 4PLNC 3TBSA 2Z3FA 4PRHB 4BFGA 4DZBB 5AKVA 5J4MA 4HDIB 1RHHA 4K5PA 2XG5A 4PW3A 1IQWL 1G7MB 2R9HC 4Y2NA 3RDTC 3SN6N 2DWEB 3L3HB 1SN5A 3MBWA 2AJYH 5EDXA 2NMSA 1A6VL 3L4WA 3L3JA 3UGEA 3T04D 1D9KC 3CMGA 2DF3A 5LGKA 5EN3A 2VISA 3ATEA 4ECNA 2PWDA 3IGLA 5GGTA 1OAYL 1JWMB 1WEJL 3WS3B 3JT2A 3IU4L 4R7LA 1JPGB 2OYMA 1I31A 1U8OB 4P99A 2VJ8A 1EJOL 3DC0A 12E8H 5B7MA 1FFTB 1Z3RA 4XI5C 5K39B 2P80D 2OMYA 4GBXC 3HS0C 4TSCL 3NCFB 3UTZB 3IEAA 4AWJC 2F19H 2XN9A 4DPCX 4MJID 3MREA 2HRGA 3UYRH 1I7RB 5E00B 2YD0A 1OP5K 4P5RA 2HG5B 2Y1VA 2ZX5A 4YXLH 2OMVB 4XBMA 3T5WA 5KJ7E 2XT1B 2A83B 3HG4A 4I0KA 5IGXL 1X6LA 4P2QB 5AZ2H 3VE0B 4E0RA 3LKPA 4WTZA 1KENL 5MHSE 4YR6A 1TZGH 4JFPB 3FRUA 4LP8A 3GPSA 2D7TL 4JHZA 1KFAL 1FJ1A 2FX9H 5GS1B 3NIGE 3UAEA 4PRIE 4P2QD 3U46A 5IIEA 4L5FL 2XZAL 4YWGH 4JX0A 3RVVC 4WUUB 4F58L 4HZAA 5DEFA 5GS2D 1INEH 3C5SA 2XWBB 6FABH 3AABA 4NLAA 1J1XL 4ZNEA 5IVXF 3UFIA 2IQAA 4Q6IC 4YBQD 1ZSDA 2H3NB 4DJMA 5A40E 1PLBA 5A3IC 2VL5B 4WUUD 1RK1B 2FK9A 4K9EL 1HHKB 4L8BB 3QCUL 2DOCA 4LSSL 2JNZA 3UXFA 3KBEA 1F86A 1ZS2A 4K3DH 4ATTA 5DMIH 4O51B 4IK6A 4R83A 2AABL 4R26L 5MEQA 4R0LA 1B4JH 1ZXKA 1MQ8A 4K9EC 1XGRA 4B9PA 5FECB 3HMWH 3D08A 3DK2A 2BXZA 4YHPB 3UPCA 1QX1A 2QLYA 4MXWH 1KEGL 1VGEL 4HKZB 1RD6A 1I8LC 1P4BH 2CR3A 2FGZA 1WJ3A 2RCSL 5IHUL 3MBEB 5IB4A 4XPTH 4HH9A 3HE6A 4G7QB 2W0PA 2XETA 4G80A 4JN2A 1RUAL 1L7TL 4PJDB 4HS8L 3T0AA 4AIZB 3MBED 1AOZA 5H2BB 3SDYL 3DHPA 4KKQA 3D39E 2IEPA 5DURB 2OYPA 2Q76A 3CN4A 3MTRA 2GQHA 3TEXA 4TVPH 1UM4H 5F1IA 1KBPA 3ETSA 4B9IA 5ITBH 3ZHNA 3WN6A 3P54A 2IANB 1M05A 1X5HA 3ARBC 4M93B 1IZJA 4L23A 2LFEA 5DFWH 5DURD 1JGDA 1LP9B 3VI3A 2ICCA 4WAFA 3VFTB 3FH8A 2VDLB 1NOLA 5DC9B 4P23A 4AJVA 1EUUA 3CVBA 3GSNH 1QLEL 1DL7L 2IAND 3A4EA 4LDEB 4PS8A 4YPGB 3W11D 1IC5L 4BH7B 2YUVA 4MMXC 5LAXA 2C7UB 3DYMA 3F5WA 3FZUC 5E5MA 1L9TA 2EQDA 5B1BB 3UYPA 4I0PC 1BPLB 1MHCB 4WI9A 5DVLA 5L4JA 3BPCB 3WY3A 5F89A 3ZDYB 4ZG1A 5JW4N 5EOQH 3ULAB 4Q9BA 4WV1B 3MFFA 4ZO9A 2EIKB 3CQFA 3VW3L 3ES6B 1B2WL 2IH3B 1P1ZB 5IFJB 1LEGB 4U1JA 1H0DB 1S7XA 2KERA 2R0LH 3MRHB 3VDCA 5BV7L 5FIEA 2V3DA 4K15A 3KWVA 3Q3GA 4Y9BA 4NT6A 4LHUB 1KJMB 4KRLB 3OPZH 2CALA 3GLEA 2R4SH 4NQXB 5KYWB 1KNOB 4YE4H 4JLRB 4PMEA 5BZDB 4HFWA 4DPAX 1P4LB 2E86A 4LHUD 4MCNA 1IGFH 3FT9A 5CEYB 1S5HA 1JZDC 4ODHL 1HKFA 4HWBL 5B1CA 1MH5B 2IAMB 2WKLA 4M6OH 1XCXA 2HKFH 2JB5H 3GSQA 1MUJB 3BIBX 5CM1A 2H2SC 4I7ZC 5EHFA 2W38A 5CEZE 2J56A 3T8MA 3WD5H 3WXWH 2BS8A 4D3CL 5E99H 3FB7B 5C0ND 1CYXA 1THCA 5ECJE 3OXRA 3QUZA 5J13C 1JPFA 5D7IB 2QLVB 4OFQA 1LE9B 3SY6A 5DVMA 5DSCA 5TK2A 5IMLA 1CD8A 1WC7A 3FULA 1HSAA 3ZDZE 2BFVH 2Y9RT 4ZO6A 2WANA 4K94H 4TVPD 2P5PA 4FI8A 4PY7A 1MCOL 4LQ1A 1I3GH 3NSJA 5CILH 3KL5A 3CSFA 4NHCH 2G4EA 4JGUA 4BRJA 3VYPA 1E3ZA 5ACLA 4XCFL 4ATWA 5KAQG 2ZSWA 1RHHB 4HEPA 4AYMC 5HYQB 3MYZA 4B27A 3NDYE 5L0QC 4GW4B 1E50A 4J6RL 5LGHH 4FNSA 1WFIA 2EDWA 2W07A 3MLWH 4N90E 2MRYA 3TS8A 1YEKL 2O5XH 3AGWA 5FYKL 1WH0A 5JHLA 3NBNA 1OP4A 5EA0L 3OVUB 4PJXF 5E4EC 4UILL 3GXMA 2KHAA 5I5MA 2EDBA 2GBTA 2R1WB 2OMYB 2X5PA 3I6GA 2Q0ZX 4IRSB 1NGXB 3WEOA 5IEKA 3HE7C 4HJEA 5LNGA 3DUSB 4HGKC 1KV7A 3LXUX 2EH8L 3O45B 3TEWA 4WEBH 3LIZA 3OKNB 1BVKB 4X4MA 3TBYA 3LIUA 3B6SB 1N64H 5D72H 3S36X 15C8H 4E0RB 1VSCA 2BIQA 4BFBD 5BNXD 4XN5A 4YR6B 2ZYRA 1AGCB 3A21A 5FYLH 1ZHBB 3EYOA 3X3FH 4MBOA 4W9CC 1E9OB 1H6UA 4B0MB 2KT6A 3DYPA 1ZT7A 5DVNA 3UZVA 1G9MH 4KJQC 5IIEB 3U46B 2Z31C 1J11A 4P3WA 2IGFH 1KDJA 1A7QH 4K2UH 3K6SA 4U0QB 2EEFA 1T3FA 1N5YH 1WVZA 2KZWA 2XNAB 2QR0A 4U7KA 1A0QL 2AVGA 4U6HB 5DFVC 3G5VB 5D2LB 4NNXA 2IQAB 3BUPA 4BCZA 1F3DH 1A6UL 2DYRB 3NCYP 4I2XA 4WO4A 3AG2B 4LHUG 4OBRA 3RWEA 4B9GA 1AKJA 4KDTC 3OC8A 4HLZG 3B7RL 3ZT7A 4TKWA 1MW3A 1I4FA 4ZMXA 5E9AA 4FQXA 4NI6A 4RFNB 1VFAB 1EO8L 3M1OA 2K0RA 5A2JH 4ILDA 5C0EB 1KXTB 4PJCA 3TU6A 2WCGA 3QUMA 3VFOB 4O2FB 4FA6A 4FEIA 1M4KA 4GO6B 4LLVB 4AMWA 4HKXA 3VWKC 1ONQB 3SDXA 3CFNA 5EN2A 4RBPH 3FTWA 3VRLF 5EU3A 1MJJA 3MCKB 1N7ML 2DH2A 1G43A 4EPSA 2W60A 3DARA 3K0YA 3ARDC 4LSQH 4XR8C 3V6OC 1NMCC 5C07A 3V6BR 7PAZA 3ASOB 5IQ9B 2NY3C 3HE6B 2XPGB 4JO3L 3CK0L 4O9HL 1XCQA 4HBCL 5DI8A 5EU4A 3UADA 4NZJA 1A7OH 3CU7A 1OF2A 3FU8A 1NFDA 4TNGA 1RFDH 4IEFA 2Y36H 3HE6D 1HI6A 2XN0A 3RBGA 1T1WA 4JFYB 2VDOB 3DGGB 3LN5A 2VMCA 4KK5D 1SFHA 4QTIL 3SCMC 4NJAH 4DAGL 3LDBB 5F7EH 1WBYB 2A0LC 1KN4L 5DMKA 3E1F1 4DGIL 3SGKC 4MDIA 2EVHA 4Z95L 3O9WC 3SOBH 3Q6FA 4TL4A 4A2FA 1CL7L 2AV1B 4E5XB 3IJYA 3ZKXB 5FYLD 3NFPA 1DANU 4UTBL 4MCYB 3SQOH 3NJHA 4P23D 5HPMB 4G7SB 3HZVA 2ZX6A 2ADIB 1D5XB 2GIXA 5J56B 3QC5X 4FD0A 4RGMB 2XYBA 2WZPD 3CFDA 1ZMYA 2VQTA 4LNVA 1FAIL 4R3SA 5F89B 2X89D 2X2HA 2BVPB 4R97B 3WDIA 1AGEA 2FJHB 1GPOL 3QDHA 1C7SA 2VWEE 4TOYH 3Q44A 3TEUA 3L45A 2APBA 1EWHA 1JG9A 4JFHE 1OEZW 3FAWA 4X9YA 4FZ8H 4XO3A 1TJIH 5TH2A 4OIIL 1VPOL 4NWUL 3S9DB 4FX5A 2FT6A 1CN4A 1TSRA 3HJEA 1G0XA 4I89A 3U7YL 1QRNE 1YPZF 2ZOKA 3GTNA 4PS4H 4U0RC 2VRQA 2GC4C 3MJGX 4QRAA 4GT7A 5LG6A 1BG9A 4OUOA 4V1DE 2B3IA 3LIZH 1FRGL 1MZYA 2VDRH 4HFWB 5AW3B 5I1LB 1YYML 2DL9A 1S5HB 3L3DB 4LKCB 5B1JA 2WBXA 2FYYB 3QNYA 3DO3A 2DAVA 1LO4L 4IIQC 3L1OH 3GMMA 4GKNA 3NA9H 1P7KA 3QDGE 3JSSA 4YHML 2I60H 1Z9MA 1A3ZA 5AWNH 4DETA 3STZA 2ZKWA 5E6SB 4AKQA 1VHPA 2JK5B 5ESVB 2EIZA 1HSAB 4NO2B 1TJHH 4B60A 2Y4SA 4LVNB 1JZEA 4JEGB 5CS7A 5KSVA 1YEDA 1KCWA 4NXKA 4JDZA 3S36L 3X12A 3UMNA 4HJ0C 3T2PA 1IARB 5D6CA 1RUPL 3C60B 2EC8A 3MLRH 4R5VA 5HHMB 3BZEA 1SHXA 2BJML 1F18A 1NANI 5D7JA 1HTYA 1AQDB 3ILPB 4ZMWA 4AY0A 1HXMB 2CUHA 2GJRA 1OLLA 1ZHLA 2JKLA 1H8SA 3WKML 2Z91B 4PJEE 4X5WB 2B9BA 3C60D 3BAEL 2N7SA 1ORQB 3CFBA 3IPEA 1G94A 1C08A 4ZMAT 1SJEB 2BK8A 3T4AB 3AAZB 4Z0XA 1XTMA 2VZ3A 3UO1L 2HMID 3FO0H 5FHBH 2DKUA 4FNQA 4CSZA 1NAMA 2CQVA 5HDBE 1E42A 1HIML 2AJZA 3ZGIA 1FLRL 4O2CA 5MERA 4OZHF 5D71L 2RA1A 5IHBA 1USZA 4F57L 1XEDA 3RYMA 3VU2A 2EDFA 3KW7A 4YEEA 1S2EA 5D1QC 4J7RA 5HI5C 5IEKB 3QPQC 4O02B 3MKKA 1HJCA 3QIWB 5D7SL 1TZIB 3X3GL 3BUYA 2DBLL 1UWXH 4LNRA 4E5XG 4K0OA 3BVVA 1LK2A 4YXHL 4XO4A 2JB6A 3GFUA 5MEOA 4OBSA 4QTHA 2WBJC 3FT4A 2H4EA 3AMKA 2BNQA 3BSZA 4MWFA 4W93A 5F7FA 4ZMLA 2Y3NA 3FQTA 2G5BA 1CLOH 2BWDA 3MV7E 4YHKH 3EYOB 1BEYH 4Q6KA 1V8HA 4D8PB 3II2A 3V4UH 1T4KA 1ZLUK 2DYSB 1FNSH 4P49A 3RKPA 3KDMB 1JWUA 1NMBH 3MCLL 2R23A 3M1BA 3WLBB 4WNJA 3MRJA 1QP1A 5DWPA 3DDGA 5GGSB 1KLUA 3HRZB 3QZWA 3ZR5A 2ICEC 2ZNXA 4WO4B 2NYYD 4HWNA 5AOLA 5JPMB 1CK0H 3CFQA 2RH0A 2XQBH 3TWCH 3I74A 4QO1B 5F21B 3CLFH 1T20A 4PRBB 1I4FB 4LESA 2EDEA 1HNYA 1IGJA 1MHPL 2J73A 1NCGA 4WO4D 5BXFA 1JYVA 4EN3C 1AMYA 1SYVB 2HH0L 3OJDA 6PAZA 1J8RA 1SY6L 4HALA 1RMFL 4X7CC 2GSIA 3AWEA 3ZE2B 4FG6C 2EIEA 3VX1A 3MUGB 3P3UA 1PZ5B 1JS4A 4FGMA 2HRPH 3ZTNL 3BAKA 4M7LT 1M3IA 5C07B 3LKRA 4XE5B 4XPAH 5EFIB 1TTUA 2X28A 3JUYA 4NLHA 1AMXA 1JFQL 2JCWA 4KK9C 4PWFA 2CGRL 4J23A 7CGTA 5EU4B 3IF1B 3K1KC 4TPRH 1JNNL 4F92B 1ZE3C 5D55A 4GUOA 1CG9A 5C07D 4QYOA 5BRPA 3WO4C 1NFDB 4M48H 1CGWA 2DMBA 4OQTL 1PD0A 2VT0A 4QIRA 5DC2A 4AL8L 5I6PA 1OV8A 4P5TC 5I1GH 1Z9OA 2I9TB 2JCCB 1GZPA 1C16A 3CH1B 3FF7A 4PRIA 4HEPG 4UM9A 1IEAB 1IBGL 1Z5HA 2ORBH 3K0WA 5D1XC 4AMXA 3VG0H 3GI8H 2WLJA 3CCHA 4A38A 4D8OA 5IR1A 1NFKA 4YK4B 3L3IA 3WS6A 2VUKA 2FBJH 3SE6A 4AL8C 5AVSB 3D06A 3AREB 2QGEA 3BUIA 1D5ZA 2HUHA 4EAEA 2DQHH 5EZLB 3Q8CA 2X4TA 3NACH 2R39A 4HISA 4HIPA 1S5IH 1E7VA 1T1ZB 3ARED 2BVYA 4CMHC 3BP6B 5CMAA 4BSWA 2DYPB 3FU3A 4YSPA 1D5MA 2KYIA 3MACH 3P3YA 5AOJA 1ID2A 3ZYJA 3F58H 4UDUA 1AKPA 4J28A 2W5PA 4X5XA 1NGZB 3SGDI 2CKBL 1NBZB 1XBRA 1PFCA 1JE6A 3HZKB 1KB5L 1HQ4B 1I9RH 1M1XB 3OB8A 4HJJL 1XSJA 4YVNA 2IOIA 5K9KB 3PUUA 2WW8A 3DUUA 4IRJC 3WY4A 1I75A 2B2XL 3D6GA 3GMOA 2N0KA 1U8HA 3BFQG 5LG1A 4BCYA 2HYMA 2QV2A 3P2DA 3VXNA 3D39A 5I6OA 1Z1WA 5E08L 5A6MA 4MNQE 1IGTB 1J9CT 5FM4A 5C6TH 2XXMB 1SBSL 4N3TA 4J3UA 3MMEA 3BSZH 4EN2A 4MDRA 3CFCH 1BMGA 3LNGA 5IM7B 1MJUH 1YC7A 1P7KB 2X70A 5E2WL 2RTTA 5T1KB 2J72A 4JMXA 3KM2A 4AQZA 4BQ8A 1ACCA 4LPYA 5DC4B 2BSBA 4HGWA 1KTJA 5C0JA 3QJRB 1S7VA 4PY8J 4XVSH 5GGQH 4EKXA 1JZ2A 4RAUA 4N2CA 3V79C 1AE6H 4KKNA 3U83A 5T1KD 1TVBA 4FQJH 5KSVB 1YEDB 4AENB 3HFMH 3X12B 1JZJA 3VH8B 3CDFA 5IUCA 4UV4H 4QRPB 2ID5A 2ZUWA 1ZJAA 3Q43A 4XC3L 3HC3H 5AVQB 2IAAC 2H8PB 3WLWD 1AI1H 4IBWA 3SKNB 4NM4H 4Q2ZA 5JQIB 1ZHLB 4PYGA 5HDQL 2FEDC 3P0VH 4OJYA 4QRPD 3QQXA 4XVUC 2VDKH 1NLDL 3CFBB 4F8OA 3B43A 2JIXA 1W6LA 4NKMA 4UBDD 3CLEL 5EMYA 4BSVB 1K2DA 2J1ZA 4Y4KA 4Z0XB 3JWNH 4Y88A 2Z8VC 4IU2A 1MG2C 4X99A 1LO0L 2V17L 5BRZE 5I73C 1KSRA 1T6BX 2FWUA 4JO2H 1KBGL 2Q3XA 4BUQA 3KYKH 3PQYE 4GXUM 3PL6C 1MI5E 2WXRA 5IUSA 2BVEA 4O2CB 1N26A 1T5KA 1HINH 4P2YA 1AS8A 2OSLB 2PTTA 1SYSA 3I6SA 4U1MA 5I66B 4PLKC 3EW3B 4S1RL 4GS7B 1QMUA 4QXWA 4G8EB 1CFVH 1COBA 1GJWA 2DMKA 4GSDH 2FBOJ 3ATDA 3CFEB 3WFHA 4DOHB 4JHWL 1UA3A 1I3RA 4JHAH 1TQSA 1RJLB 3KM1A 4HMCA 5MEOB 4A7GF 5IHWA 1HQRB 3N41B 1DLFL 3WMPA 1EEYB 5CJBA 1DJWA 2VDMH 1JF6A 3GSOB 4B7IA 1P6FA 3AB0B 5AKRA 3FCTB 2QQNL 4WWKB 3RWFA 5I19H 5AB1A 5TE7L 1FVCA 1TTAA 4LDOB 1T4KB 5C7XL 5IROA 2WD0A 1FO0B 2DKMA 5HYJB 3I2CH 1KPUB 1JWUB 1G7JB 1OTSC 2H6PB 2X10A 5E1AA 4A37A 2BOLA 4WWKD 4ZS7H 4ZS6C 4DSYA 1KLUB 2ZKYA 4KVNL 1DSFL 5HYJD 5TDNB 2HVJB 4XAWH 2V5TA 2OJZL 4I3RL 2OL3A 1DYZA 2HLAA 5I1CL 2PPEA 2BVQA 3US9A 3BP7A 3A0OA 4AV4A 4UT6L 1DO6A 2FQEA 4WGVB 2D7MA 4L3EB 3BYYA 1BQKA 3N91A 4I88A 5L7XL 1ZPLA 4LLQA 2VDKB 4DEUA 1YVLA 1DVFA 1MFCL 2B20A 3FO1A 3OJDB 4BKLA 1AHWB 4XMXA 2AERT 1BYPA 4JGJA 2AKRA 4ODSH 3V0HA 1OHZA 4HZ1A 4L3ED 2P3YA 5FCUL 4DGUA 4PM1A 1H3VA 2XKNA 1A7NL 2C3VB 1HCYA 4OLXL 3RB7A 4QAMB 4WI0A 3LKRB 3M07A 3MV8B 4ENZA 2AMGA 4J3BA 2WQXA 1HH6A 3HAEB 4HYTB 3SYQA 3NCXA 4LL9A 4G6JL 3L3OB 4HWUA 3FQUA 4EIBA 1TLMA 3MV9B 3BKYH 2HLFD 1G9NH 1JN6A 4FLHA 3TZVA 4QYOB 2WQRA 3MV8D 3VH8G 4OD2A 4L9LA 1FFQA 3FQWA 2VDNL 3MGAA 4L5FE 1R19A 4U1HA 3TO2B 3UTTB 3WNPA 4R90H 1FL6A 4F33A 1NGQL 3STLB 5D93C 3MV9D 1Q1JL 2NX5B 2F5AL 3NIGB 4JRXB 3S8WA 5FO7A 2X4SA 3UC0L 2PYEE 4WEEA 4E9TA 4ES8A 5MHSD 2DW5A 2I5YH 2VLRB 5KN5A 4NCDA 3UTTD 1GJIA 4DVRH 2DQJL 1I1AB 4UT7H 4NQSA 1CU4H 5GS0H 5HHPB 2NX5D 3QG6B 4UM9D 3WNKA 3KLHC 4JBSA 4BZ2L 3KHQA 2XV0A 5EBWA 2HX7A 2VLRD 3GIZL 4TUUA 4UDTB 3RWIA 2F9BT 3ZT5A 4Y5XB 5JDSA 3C5ZC 3PIQB 3EO0B 1JERA 4XTRD 2YAEA 4K8RC 3EBIA 3IJHB 3QFDA 4NUGH 5F2FA 2AW2A 2PR4H 4OIBA 5CMAB 4GG6B 2QQKH 5GISH 3BDYH 3GJFK 4OJAA 4XCEA 5EO0A 5E2UH 4YPJA 1JTTA 5GRVL 5SWQA 4X5XB 1TCRB 3W5MA 2FJFA 3KYAA 3IWVA 4JKPH 5HY9A 3TBVA 4IKJA 5CLXA 4D0BB 3OQ3B 1NCJA 1U3HA 3TO4C 4DNLA 5ELIA 2ZWSA 1F45A 4CJ0A 2MWCA 3OX8A 4HD5A 2Z8SA 3FPYA 5GGSY 2YA0A 3PXLA 3PABA 3KAAA 2QKSA 3HI6L 1KJ3L 1DQKA 1ZKAA 5CLZA 32C2A 4OSUL 4POZC 4HXAH 1WCBB 2CO6A 4DHLA 1UUSA 1AD0A 2D7NA 2AEPH 2YIHA 3FTVA 3U30C 1FNHA 5TQ0L 3PJNA 3HFFA 3QHFH 4LSUH 1I3UA 3UIYA 2L7EA 3VXSB 5CLYA 4R4NC 2XSKA 1KIUA 4G9DB 1HNFA 5EIQA 2DQTH 1AQKL 1S7VB 3N06B 5BZWA 1QWHA 2WOBA 1JHLL 1F1DA 1M7XA 2RB8A 4HGMA 1QSEE 3PG2A 1DQQA 2NZ9C 2BLFA 3VXSD 3S97C 5A6LA 4TSAH 1CWVA 3VCLB 2EAEA 1JK8A 3E6HA 4NC1E 1D5IH 3MJ9L 2AZAA 3HN5A 5I1HH 4W9KC 5EEUA 2ISDA 2OL3H 3JWNG 5CCJA 5AVYB 3DMMB 2WO4A 3KGUA 4H0GA 4UIKL 2EDRA 4GQ9L 3KVDD 4MD5A 1BBJB 1IAIH 2IQ9H 4Y5YB 5DEJA 3VVWA 3RI5F 1A1OA 2Y22A 4Q2ZB 4PJFF 5GS0D 5DD6A 1NINA 3FH7A 2AMUA 1ZJBA 3EO1A 3G5XA 5FFGA 2ZAIA 3HAEG 3OKMB 3BUBA 1OE3A 2EIBA 1IBZA 3DMMD 4JFXB 1XGYL 4HIEB 4XXCC 1N5AA 5CGYD 4XX5A 3DX1A 4JRYE 4QHPA 4Z7QF 4QHLB 1YNTF 2OX5B 3IWUA 1S3KL 4PS7A 5E94B 4X99B 2BC4B 4MS8D 5BO1L 5B38A 2CHZA 3OAUH 5EWIH 3SQBA 4A1RA 1UOWA 1QRNA 1CR9H 3OZ9H 3HS8A 3EYQC 4ZOCA 3AJ7A 4J8RA 3ESOA 2WQ8A 4Y4KD 3QXDA 4V1DA 1OTTD 1CFNB 2FWOB 5I1AA 3QQ9C 4R8WH 4WJKB 1KCSH 1S7UB 1EDQA 4YGAB 3EOAB 1FBIL 1U30A 3X13B 4IGBB 5MI0B 3HJ0A 2XJLA 4J4PA 1G5AA 3QDGA 4Z7UE 5LXGL 3WTTA 1CO1A 4N2IA 4YSSA 3H56A 1KJ2H 4NDMB 2ESVE 4RMUA 4XNZB 4XN9A 1P5VB 1KYFA 3F64A 5FFOA 1NGPH 5T1MB 4F8LA 3MUZ1 3QEHB 4OJFH 2E7LA 4IGBD 4Z7WF 5I17A 1OSZA 4FL4C 2QTVA 4NN5B 2W80C 1VF5C 1UJ3A 2OP4L 3RWFB 4CU7A 3KJ6H 2AV7A 4QRUA 2ZUQC 1D6VL 2E7HA 2PW1B 5INDA 4GRMB 4ZDHB 1KT2B 2F7RA 5HGDA 1E5YA 3KXFB 4G8AC 1DCEA 1YY8A 5J1AB 2BP0A 5F71A 3RNKA 4LOEA 3L81A 2P49B 4FFZL 4PJEA 5IJDC 1PDKA 2G60H 2OL3B 1T21B 2HLAB 2ADJA 3TJEH 2BVQB 5AB2A 1GS7A 1JPST 1X44A 5TDOA 4WW2B 5CZXC 3ZE0B 5FYKE 1SDYA 4PCKA 3AT0A 4WU5B 3VUAA 3NDZE 4ANKA 1ANUA 4YQXL 5DJ6B 3MRFA 5CBEB 1XH2A 1AR2A 2BY1A 4FMKA 1J48A 1T2XA 1OD7A 4HD9A 4N8CH 1T5XA 3PHOB 2DQFB 3IKKA 3O6MH 5CINL 3P4MB 4AQ1C 1A3LL 1GGYA 3HNSL 5GRXG 1HXKA 2EO1A 2YPLE 3ZGHA 1JK9A 4BK5A 2NW3A 2A6DB 4NFCA 3QH3B 5B3JF 1TSHA 1Z7JA 1HILA 1FPTL 2XQYK 3C6EA 4YC2B 1RK7A 4J1UA 2CA4A 5DJZA 5KUKA 2NT1A 3SD2A 5LN8A 1CVSC 3ESNA 3TZVB 4RGOH 3U0PA 4MQTB 1NFIB 1RULL 2UZIL 3B3IA 3DO4A 3NIFE 3TPUB 3CZSA 4HWEL 1A6PA 5GJSH 3FQWB 1BHGA 1JFHA 4LPUA 4ZFGL 3O6KH 4GB9A 1OW0C 1KJ2B 3ZHLA 4XCNB 3L6FA 4I48A 4AMKH 4F8QA 3TZVD 1MHHB 1YY9D 2VMDA 1OO2A 3AITA 3CSGA 3D07A 5FO7B 3D69B 1AY1H 3GBML 5SWZE 2J5LC 3SB3A 2Q8BL 4PGBB 2CO7A 5E9DE 5FYKU 1JRHI 2QKIB 3EFDH 2FRGP 2P24A 4HOWA 3ESMA 2UXFA 5IOKA 3D7PA 1I1RA 2ZWNA 3UYOD 3P2TA 1WBZA 4JFDE 1K3ZA 1A6WL 1M71B 2ATAA 4CC4A 2J3SA 2GCYA 3B9KA 1XR8A 1F8TH 2OZ4A 1RSYA 3TYFA 3V6OE 4XNMA 3WEXA 4K5MA 1DZ0A 2BHYA 1Q0XL 4JKKA 1JPEA 1OSPL 3LQAL 3QFDB 4TSBL 1DFBL 3V0VA 2FO4A 3B7YA 2BSED 2HFGL 3OXSB 4NCC2 2V3FA 2BDNL 3D0VA 2Y72A 4FNPA 4HIIB 2WO2B 3NIDF 3VGFA 3FHEA 4H2CA 4X6FB 1KCUH 4JM2A 5I8CA 1OE2A 2G9KA 3FTZA 4MGXA 5JPNA 5CJ8A 1QAWA 1U8NA 4GEJA 3RWJB 5TTRA 2EKSA 3LQAC 1ULVA 3QIBB 5IBTH 2P45B 4MNHB 2O1AA 3BAYA 5LN4A 4AYGA 5T1DL 1JPSL 1EZVX 1XCWA 4HUWA 3LXAA 1A9VA 2WMPA 1A9BB 3QIBD 3VGHA 2P8MB 4QRSA 5TQ2H 32C2B 1DDTA 3E9UA 3FW6A 5E7FA 1HZHL 2CO6B 3WBDA 3OSKA 4IBTA 4UV7L 4ZW7A 3FOLA 4HK0A 3T3PE 1QKZL 1KEML 2XVLA 5AAPA 5KUMA 4NPJA 3CE1A 3AU1B 2IBBA 1XCTA 1IO4C 2WXNA 1N18A 1Y0LA 4GLRI 4FQCL 2YUXA 3DHJA 2X05A 2PABA 3CG8A 3SBWC 4FXKC 1P4UA 1YQVH 3FT2B 1A9EB 3BOVA 3C2AL 1ITCA 1SJHA 1KTLB 2Q7NA 3ZJAA 3TA3B 1GMIA 4RGNB 2UZPA 4LDLB 3TJHC 4MA7H 4AW7A 4RMTA 1JK8B 2LLNA 3BH9A 4M6NL 3RY4A 1QBMH 3NJKA 3GRWA 1JD7A 1UUNA 3KCPB 3LH8A 2JI2A 4JDVA 3CSTA 3D5OF 2YKKA 3TA3D 1F1AA 4RGND 5T1LB 3QIUA 4ALAL 4AQAA 4BFIB 2CUIA 2K3TA 4BKTC 3SGEI 3T6QC 1BXAA 1I53A 4JJHA 1FZMB 1OTUD 2WP3O 3O8XC 4NQEB 2CDFA 2Y24A 4B9YA 3Q2WA 5T1LD 4FKKA 3EOBB 2C9AA 3DROB 1MCBA 1WICA 4HJIA 3FQRA 4NWTL 3WNMA 5B38B 4AGNA 4YVUA 3SQBB 4ALAC 1L5GB 4NGHL 3RAJL 1N0XL 3ZZSA 1U8KB 5M94B 4LLUA 4X6EB 1NCIA 2ZP9A 2OMTA 2GI7A 4L2LA 1WBXB 4MNQA 5I1AB 3QI9B 4KPHH 4Y8AA 1T2QH 3ULVF 5F96H 1WA2X 3QC6X 4JPIA 1UB5A 3SO3C 3QULB 1CUOA 4N28A 4V1DD 5J5EA 3KGSA 1Z0NA 2E3VA 4G11A 1VLXA 5MEPA 4KGLA 3CC5B 3QI9D 4PJHB 2EE9A 3WFDL 4WU7B 3MYJB 2ETWA 1CD1B 3GT6A 5FHAH 3QJOA 4Z7VF 4XVJL 2ROYA 4WK2B 4JZOA 3MROB 2CBMA 2YC1A 1Z5LA 3QDGD 1I7ZA 3VI4B 4YX2H 5C9JA 1BECA 4JO1H 4RSVA 2I25N 2Q3AA 3EGSB 2X42A 5DJ0A 3V4VA 5KTEH 2BCKA 1WIOA 5HD8D 5GZNA 4OLZH 4UU9A 3O41B 2VR7A 2N01B 3UJTH 2OZ4H 5HTSA 4RA3A 1E27B 5HGDB 5GRUH 2NQ3A 2D2CC 4N5ED 4CILA 3RLSA 2I85A 3BEVB 4NYLA 1INQA 1YY8B 4X6DB 1P4IL 2BP0B 4DZ8B 3V95A 2Y07H 5BQ7B 3T77A 4L29A 2FCBA 4LSTH 1CBVL 2GY7B 3CZLA 1HL4A 1XGPB 4EVNA 3U9UA 1NLBH 4AM0A 3GHBL 1UXWA 4IHBA 4MNGB 4Y5VA 4A2DA 5DJCA 4QUOA 4HLEA 3MGOA 4PVNA 5CCKH 1JWSA 4ETYA 5BRZA 5GRJH 3EH4B 1QVOA 3MBXH 2OBGA 3VFWB 4KI1A 1AGBA 3BKMH 2R15A 3PQYA 1J1OH 5HDBB 1MI5A 5IEHB 2J2ZB 5EF2A 3QO0A 1Y6NR 1IC4H 1K4CB 2DZEA 2V7NA 3GYRA 4G7VL 4OGYH 1XVSA 1W91A 3E8UL 1XDTT 1NBVL 3F01A 4Q74A 1JK9B 2WK2A 1X5FA 2WUCH 3BN9D 2QDWA 5FB8A 3TH3T 2AJVL 2JMRA 1YQ2A 5IVZA 4B53A 4UQ3A 2CBQA 2HJFB 3T71A 3U0PB 3RDTA 3EFFA 5KVGH 3ULUC 2VDPH 5BVPL 1DBKH 3MV7B 1D9KA 1NM9A 1Q9WB 2R4RL 5HJGA 4DK3A 2QSQA 4OLVL 1NL0L 2YSSB 3AC0A 3JVGC 1BP3B 1FZJB 2CO7B 4AM0Q 4FABL 3MV7D 4FYRA 5I0XA 1UM5H 4N9GA 4FXGA 4LPXA 3VD9A 1R3IH 3HS0A 4U1NB 3IMUA 2GCYB 4AEHH 3BN3B 3VD3A 5A2KH 1OOWA 3UBXI 5TGBB 5B38G 4KO9A 3VWJC 4UM8B 4GSUA 4WTXA 1GYAA 4FLSA 4Y9GA 3CPUA 2XWTA 5EUOE 4XN2A 4B6ZA 3LRLA 3L3GB 4AGOA 5CKAA 3V0VB 5J9PB 5AOMA 4PD4J 3JWOH 3RVXC 1LQSR 4NUJB 3G6DL 2UZXA 1A4CA 3MU3A 3QG7L 2P4AB 3QWOA 3DTDA 3K72A 4M6MH 1C5BL 3SDAB 5M95B 2QBWA 4WGKA 4OVVA 2YXFA 4WVRA 1BFOA 5EBLB 2EKSB 4F8TA 4TNWK 5SX5K 4MA8L 5D1XE 2O30A 4CA4A 4XH2A 5E8EA 1ZOXA 4JM2D 3SDAD 1MRCL 1TU2B 2OS7A 4YBLB 5HJDA 2EVFA 4FQ1H 5CJQL 3EBGA 4HUWB 1AJ7L 1GTNA 3P30L 3Q7JA 3BGFC 4YHYC 4X4KA 5E9NA 2WIIA 3WL9B 1ZA3A 1FAKT 2QHRL 2CJSA 1XAKA 4D0CA 4YHNB 3WO3B 5JXAH 4XCYA 2BFGA 3LZRA 4A67A 3IMVA 3KPOA 3SE3C 1V3KA 2VRAA 5I5RA 2FX8L 2VDPB 2WXPA 4ZAKC 3V4VH 2C3WA 4DW2L 5DYFA 2NXYD 4NQVB 3P9LB 2G5UA 5I71B 2HT2C 3DX8A 3IXAA 4F15C 5IFAL 4UUJB 2C3XA 2CK0H 3U4KA 4Z9KB 3BH8A 1UD4A 3V9EA 3FS9A 4B3VA 2VXUL 1F6AA 3VGAB 2LLLA 4ZMYA 3B2UD 4NZ8A 1ROCA 4TLUA 3B2VL 3ZO0A 1VFUA 1AHMA 4XP1L 4OCWH 2ED8A 3MRPA 4PP1D 3UTSE 4AQAB 3S0PA 3NZSA 1FIGH 3U0TA 1SXNA 4NO3A 5FF6B 4EE2A 2GJPA 5E2JA 3L9RA 4LSRH 1TZAA 3ARBA 2KLRA 2WLLA 4MBRA 4XMPH 3QUYB 3EHBC 3WUWA 3B5HA 4F37F 1NCCH 2MIZA 3QWNA 5AG8A 1WK0A 4N0UE 4P4RA 5A2AA 4GQZA 3VD5A 4WJ5A 1OZUA 4MMXA 2FD6L 3W0WE 2Y7NA 3QUYD 2NNFA 4OD3H 2V5YA 1JNHA 3O11A 3FFCB 5EBMB 2R0KL 3M88A 5H8DA 1K5NB 3G7TA 3HI1A 2IDFA 3N04A 1KGIA 4QRQA 4XWOD 5FLVA 3SDCB 2CIIB 3FXIC 2RQEA 3JBG7 5EOCH 2E9GA 1NCHA 3OKYA 1T7WA 3GBLA 1X4YA 5MEPB 1DBMH 3RVWC 2FLMA 4GP4B 1BAFL 2PW2A 4D9QE 3SDCD 1NJ9B 3FSZA 2O61B 1QSEA 3DXAB 5I0VA 5E6RB 1XBDA 4WW1B 3FSVA 3FU0A 3V4VB 3QGVA 4NHUB 4PBXA 4U1SA 1A6VH 1IM3B 4TTDC 4GO9A 4KWUA 5ANME 5F1NA 3TYGH 5JOPE 3IGAA 1ZDQA 3OKKA 3RWCB 3DXAD 4BE5A 3JZYA 4NZUL 4MLSA 2YBGA 3NMEA 2WXQA 5AQ0A 3RGVB 4PLJD 1IM3D 3IU4H 4PV1C 4NC2B 5KS9F 4AQEA 2EDNA 4XWGL 3TFKD 3WKQA 1A3RH 1EJOH 3ZXAC 4JFVA 2NY4B 3LH2L 3PJLA 3FHQA 3FN3A 1BXVA 4TSCH 1UACL 1ZD6A 2DBJA 3RGVD 4JRYA 1OALA 3U9UB 2Y1ZA 1E90A 1UXWB 4IRZL 4Y5VB 3TXAA 5DJCB 2WSPA 3UCRA 4GQPH 2NY4D 1IEHA 3D33A 3Q2NA 5AZEL 1Y6KR 5E23A 3FYEB 3PS6A 4HWBA 3MA9H 4WZ9A 4AKPA 5IGXH 2GW5A 1M53A 5J6GA 5IB2A 1OPGL 1JNJA 5BVJB 3GB7A 1Y1UA 2PP8A 2Z4QA 1ILUA 5C0IA 3IMRA 4R7NB 1Z9SA 2D7TH 3P0GB 4ODXB 3SDDC 1KFAH 3KEHA 4U6YA 5AVXB 4XPFH 1FWXA 4Z7UA 4AEIL 2UXGA 2XTJC 3CZGA 4AX3A 3HG2A 4F58H 3NK4A 5I6KA 2ESVA 4TUJA 2CA3A 5A2FA 1KF9B 1OCZB 3BVTA 1YYCA 3QEGL 5BRQA 1QHQA 4WSGA 5F7DB 1MWOA 1TETH 1UZ6F 3DA0A 4FQQA 1MDAA 1YNLH 4K9EH 5LJYH 4QRBA 2C4FU 3WMQA 3KPPB 2R9HD 4H4NA 4NZRL 5FYJL 3D25A 3OKLA 1L6XA 2DQUH 2CCLA 2DM7A 1D9KD 3EO9L 1IZKA 3IN2A 4K73A 4LVOC 5HYFA 3CZNA 1PZSA 2OM5A 2W81C 3NZ8B 4GSQA 4R26H 2IDSA 4XBEL 4ZQTA 5MENB 4HUXB 2O6EA 4P2RB 3GDBA 4AC2A 4DP1X 2XA3A 5AFAA 1I7TA 2WVVA 2X9WA 4GBXB 5JW4Q 1JDCA 2YWYA 3HE7A 4LLDA 3GSWB 5HVFB 3BVWA 3G5WA 4I87A 3QXAB 1VGEH 5MEND 1KEGH 1XXDC 3D05A 5IHUH 4XI5D 4GBXD 2MCG1 4Z8FL 5FO8A 1R3JA 2H6OA 4ZXBB 3BPLC 4BCXA 3HBQA 1UB6B 4LEEA 3TBWA 5DD0L 2QJDA 4LP4A 2ODIA 2WINB 1RUAH 1ZVYA 1F2XK 1JVLA 2XKUA 1L7TH 4HS8H 1BW8A 1R46A 2OJ1A 1OCWL 3SDYH 1ND0B 3VJ6A 4ZXBD 3RI5K 1B6UA 2YPLA 4NFDA 3V6FA 1GIGL 4NIKB 2FJSA 1DQJA 1N4XL 1NMAL 1JRHL 4W9LC 3SO5A 3UJIL 1TPXC 3UTOA 5I5IA 1ZXQA 1L9QA 4Q6IB 1RLWA 5E6IB 4E41E 4LAQL 3RVVD 5A2CA 1QLEH 4KDTA 1T0PB 2Y7SA 3DX0A 1BF8A 1MCFA 1IC5H 3FU7B 1K8DB 3E80A 1TO5A 3L7EA 2MCAA 5A3ID 2I32A 3UABA 3VXTA 2G2RA 2DM3A 4ELMB 1HHHA 2PYEB 3L5WB 5SWZA 2FH6A 3IJSA 3PNWA 5E9DA 4F8PA 3BQUC 1ACXA 1KXHA 3EDEA 4MMYA 2CH8A 4LLWB 1JZ3A 1X5GA 2EACA 3IXAB 2VR6A 4JFDA 2E47A 1OT2A 3CUPB 2Z4TA 2ITCB 1NGYA 2PYED 4IMKC 5AOKA 3RVUC 4WO0A 4AUJA 5I8OL 3BH8B 3ARDA 3RBSA 3V6OA 1D2OA 4GW1A 4UOZA 4JGMA 4UQIM 4G7YL 4CU8A 3VXRA 3QRLA 1RL1A 3ELAT 1B3IA 3V5HA 3GMRA 1E30A 1M42A 4E9WA 4ZZFA 2JKTM 4G1MA 3TV8A 1HK6A 1FSKC 3U0TB 5C09E 5DDHB 1VCAA 4FJYA 2M26A 2C1OA 4HT1L 4TNVF 3FB8A 2FAUA 1Q9LA 3GM8A 4FP8L 4LCUB 2OI9C 3U4BL 4ODHH 3ARBB 4HWBH 2X4UB 2YKLL 4XXDB 2DI7A 5I75B 1LEIA 4XPHL 4NS0A 4P4KC 3SGKA 3EOTL 2G3ZA 1U8LB 3ARVA 1AFVL 2WIMA 4N0FB 3O9WA 5J7CC 2ZAHA 2LR4A 3ARBD 4F80A 1E4XL 1YEHL 3HHRB 1FCGA 1V3JA 3NZUA 2HJKB 1HHJB 5E8DL 2VO5A 5ETUA 5FR3A 2EILB 1IGIL 3MJ7A 3TESA 1O6TA 1FI8C 2ENSA 5FUOL 4LCCC 2VDQL 4CW1B 3O2WL 2W1NA 3K8LA 3BLPX 4I0PB 3TIDA 1OGTB 1ETJA 1FNFA 1VACA 4PY8I 3QRFM 2RGSA 2B08A 4LVHC 5L2JB 1WAEA 1W72L 4UTBA 4XCFH 4CN4A 2VKWA 1I85C 2JKJA 3GO1L 4I0PD 4KY1H 1D5RA 2G75A 5ERWB 1F3DJ 1MXGA 3H3PH 1RVFL 1WAAF 1XF3A 1KGXA 2WLMA 3UERA 3GRBA 5JNYB 1BQHA 3U48A 5D1ZC 1A6AA 2MJWA 3IGAB 1YMHB 4G6AC 3RTQA 5I30L 1EFXA 4M5YH 2HFEA 1U58A 43CAA 3B2DC 4P9MH 2QPFA 2I9LB 5IWLA 1OT1A 4NN7C 4FFWC 5D2NC 4I1PA 3F7VB 3DECA 4ZQKB 3I3EA 5KAQF 2WLIA 3CZUB 3BW9B 1TCMA 1SN0A 1TIUA 1FIEA 3OJ2C 4HHWA 2BZ7A 1DFXA 4ZO7A 4IIQA 2AQRA 3SPCA 1C5DA 1XL6A 3FTUA 4PJDF 1IX2A 2EH8H 1PX3A 2YRLA 3B9EA 4UOJA 3GSRA 5J13B 1DQLH 3GSVB 2HUEA 5C0DA 3GBDA 4ICXA 3ABMB 2H2SD 7TAAA 1JZIA 5D8JL 3TP4A 5FGSA 5AB0A 2UX7A 4IHOB 3IDNA 1DO5A 4GRWB 2AAAA 4RAVA 1IL1B 1LP9F 2B7DT 3V0GA 1PQZB 1E2WA 1HAUA 2D0GA 2Q8AL 3CXFA 4IK7A 1HYSC 4F3FA 3FSWA 1UFUA 3T6ZA 1A0QH 2ZNWA 4OQ1A 3PAUA 1O5DT 3HC4H 4ZX3A 2P5WB 4OI8A 4TULH 1AZUA 2NY7L 5L0QB 3FN0H 1A6UH 4M43L 1CE6A 2ESVD 4G6FB 5DZNA 3ZOAA 3CU1A 3QZPA 5EORH 4AUYA 5LDUA 3NSXA 1QABA 4GI9A 4HFUH 4JFOA 4YSDA 2NY6C 2P5WD 3UMTA 2XZZA 4HS3B 1EO8H 2VAAB 4UIMB 3RX5A 4CBPA 2O6DA 2G2PA 5E4EB 1ET7A 3OTTA 4G6FD 1YAZA 2GIMA 4ZUWA 3V0WH 1ZK9A 4FCHA 1UXLA 1KWGA 4Z7NB 3ZO9A 1Y18A 4KJPC 2DB8A 4LLDB 5FOBA 2WXFA 5KSAC 1N7MH 4P5SA 2Q10A 2X3AA 2Y1AA 4BSJA 5DK2A 5DUML 4R96A 3S35L 3T4YA 4H8UA 3KBHE 3T65A 5CUSL 1SF5A 1Q4NX 3HE7D 1DR9A 4UQ2B 4JO3H 3CK0H 4O9HH 4WK0B 1IFRA 4G42A 4HBCH 4R2GC 2LTQC 3PWJA 1X3DA 4K7PL 4BHUI 4LU5L 3ZY7A 1KG0A 3VJ6B 2DD8L 1XF5A 1LGVA 1SLVA 2Z31B 5T1JA 3ARZA 3I6LE 4JAMA 4QTIH 3ECVA 2K8QA 4F2EA 4UQEA 5B4MC 2W0KA 2YPLD 3D4GA 1A14L 4KJQD 3JUZA 3BO8A 2LU5A 2Z31D 2ICEA 4OCYL 2ODHA 5CBAB 3JV4A 4YE0A 3ECWA 3WJJC 1FFPA 1CL7H 4Z78A 5DFVD 3PGFL 1L3NA 4B95C 4PBDA 3DVGB 1G7IA 4UTBH 3L7EB 3VFSA 4L1HA 2X9YA 5FGCB 5AAMA 1HHHB 5DUBB 4AIOA 4EN3A 5IHLB 5I6XC 3OKDA 2A73A 5E9DB 3DO7B 1DVTA 2CLZB 2HSIA 3KE0A 3MNZA 3RHWF 3VWKB 1YZZA 1QLRA 1FAIH 2YD2A 4FG2A 3WTYA 1NUFA 2NY2C 2FBRA 3UJJL 2Z65C 3MRQA 5F88A 2K4AA 4I3GA 1A4BA 3DX9B 4NAJA 5E9DD 4LLAA 2A74C 1NMCB 2CIKA 4X6CE 3GHEL 3VWKD 2XIIA 4FFVC 4UZSA 2CD0A 4KV5E 5JIHA 1MRDL 4JFDD 5EUOA 3ELQA 4OIIH 3CMOL 1E3FA 1SY6A 1VPOH 2CDGB 3NK3A 4N5UA 4FG4A 4NWUH 1TO4A 3ARDD 1UOKA 2QL1A 3UIZA 2EADA 2NY3D 3VD4A 4HIHB 4P5TA 4LSPL 4P9HL 4M1GL 1F0LA 3PCYA 3MRIA 3SCMB 4X9HA 1YYMH 2D7OA 2ZP0T 5BUAA 2IVFC 4X42A 1XR9B 1LEIB 3RJOA 5F7LB 4I13B 1UM6L 5D1XA 3WTSA 1BX2B 4YDVA 1U8MB 1JHKL 1LO4H 1EANA 1M7UA 2EO9A 3DVNB 4W9GC 4X4XB 2DPKA 2NY5C 3SCMD 4L0YA 4YHMH 4OQTA 5GSRB 2FHBA 2VUYA 1SQMA 4LCIL 3KPLB 3NABL 1ZLSH 1ZV9A 5ICYB 5ETUB 2XWJB 5KVFE 3U79A 3GPEA 4M61B 1BOGB 4HJTA 2A6IA 4NKIL 3T3PB 4E42A 5I26A 4Q9QL 3NJIA 3APNA 5BMFL 1RUQL 3B7TA 3RL2A 5ITFA 1FNGB 2AK4E 3S36H 4A2LA 4AVIA 2NUPA 4XMKL 5GGRB 5D2LF 4I4WB 5ID1A 3G6JE 1RUPH 3L5XL 1GYUA 3AG3B 4H5SB 2BJMH 1B0RB 2I7SA 1MVUB 1IVTA 3TBBA 2ADYA 1UTDA 3I3DA 2G75B 1U8PA 3WKMH 2P28B 2VC2L 1MWAB 1R3LA 4R0LC 4UF7C 1X5MA 4URTB 3RIFF 1A6AB 4S1QL 4IRJA 3B9AA 1H6EA 4WI5A 3UO1H 3DHUA 4QT5B 2R1YB 1Q0YH 2GVYA 1MJ8L 3QCTL 3UO8B 3UTSA 1UASA 4YDJA 3SKOB 1BFVH 2CKBA 3EGDA 2YHGA 3PDGA 5IQOA 3LKNA 2E7CA 1KB5A 2P52A 1EFXD 3AM8C 4LEXL 4XOEA 3QUXB 1QA9A 4GAYB 2JLLA 1QO3A 4JN1L 4NRXB 5D71H 1JHTA 3CVHL 2DEWX 4IIQB 4D2NA 4F57H 3LAFA 5DQDL 4RWYL 3CFJA 3HB3C 1CF1A 3FL7A 4PV8B 4XP9H 1NOFA 1KLFA 1SMDA 4N26A 5EPMA 4JQIL 4N0UA 1AR1C 5K9QG 5CIPH 3ZSTA 2DBLH 3H55A 4FKHA 1CFTA 1T7ZA 2HJLB 4G6ML 5FUCC 4ZYKA 3N0PB 5IY5B 1AGDB 1VFOA 3ARRA 1GYVA 1FZKB 1A7RL 1I1FA 4LHQB 1NUNB 2AJSL 4KI5C 2YPKB 4PWHA 3L5JA 4LOUC 5IQLA 2DJ4A 1EAPA 4BFJA 5KANI 5K9JH 1CE1L 3WE1A 1IAOA 5TD4A 3TX4A 2O6FA 4XB3A 1I8IA 1KTCA 5K59F 4FXLA 4HJ0D 1ZLVH 3MCLH 4X7SH 1A6TB 3CIAA 1SHWA 1KCRL 4FS0A 2Y06L 1U9KA 4M7ZC 2BOCA 3I9GL 1RLBA 5G5DA 1XIWC 3AWFA 1U36A 3DJRA 4V33A 4HIXL 5F9OH 5ANMA 5HGBA 4JFOB 3B2MA 4F91B 3LS4L 1J0JA 2ZKXA 1EXHA 4UYPA 2KMWA 3W39B 5HHQB 5DK0A 4NZFA 3L4CA 1JDDA 4DQOL 3HC0B 1H3XA 2QGDA 3AUWB 3CX2A 3DOSA 4JREC 3ERXA 5EU7C 4ZTPH 5ICXB 1SY6H 3FB6B 1RZKL 2IPKA 4OCXL 2GT9B 3C5JB 1ZE3H 3QHZH 3J07A 1ZV2A 3Q0HA 5D1QB 4AGQA 5FDWA 2DLFH 3DYOA 5EEVA 1CD0A 4RX4A 3ZDWA 2QVTA 5ILTL 2CRMA 3T4YB 2V8LA 1MCHA 3PJSB 2APFA 2AK1L 5D1QD 4OH2A 3IAGC 2WBJB 3QPQD 4YJZL 2RFXA 4OVUA 2CGRH 1MREL 1RZKC 1JNNH 2YEQA 5IVXE 3PWJB 4QY8B 3PF2A 3UTQA 3TWYA 1DQTA 4S0TD 1BAWA 3P4OB 4PRAA 5CD5D 1EK3A 2WBJD 4WWOA 1XH3A 4AL8H 3T8VA 5CIPB 4PGDB 1J9RA 3QUZC 2OCJA 3LV3B 1LMIA 1RZ7H 1MJ7L 1N70A 4XC1H 3MRKB 1K4DB 4OCRL 4Y16A 5DRNA 3V4PB 1H9DA 1QFWI 3MGTB 4EZKA 4A55A 4EXPX 2L4OA 3W2DH 4BXVA 3JV4B 3UZEC 4AUUA 5IT2L 3FTGA 1IBDA 3MLSL 1JYWA 1FFPB 3CZFA 1C12A 2M8XA 3LXBA 3C09B 3DVIA 4O5LH 1G7IB 1EV2E 5HI4C 5AVZB 1F4YL 2BSCA 4RZCA 5KSBB 2YK1L 5HJ3B 1IQDA 3EH3B 2WUBH 2QQLL 2A73B 3LMJL 3RA7H 3O4OC 2EE0A 2AVFA 1K6QL 5I6NA 4ZUSA 2C9VA 3SQRA 5F8RC 4EN3D 4UT6A 5I1EH 2H6UA 1MEXL 3RX9A 4X7TA 2H1PL 2PPDA 3MN8A 5IJKC 3T2NH 2CKBH 2X1WL 5E2VL 1XGUA 1KB5H 4NQDB 1K9TA 4FQHA 2FNBA 4O2EA 3GK8H 4PJGF 4CSSA 3IDJB 2B2XH 4E9QA 5JW4R 2Q86B 4KQ3L 3RWHA 4KK9D 1E5ZA 2OMXA 2C9SA 4MJ6B 4NQDD 2DQEL 1SJMA 2OR7A 1MRFL 2X41A 4IDLA 4KKLC 4UT9L 3C8KB 4ZMVA 5E08H 1KCBA 4H26A 4MA3A 4JKWA 3G08A 1TQBC 1SBSH 1QFOA 1LEKA 2PXYB 1SFDA 2WLKA 1KC5L 1LWHA 2KZ1B 4PMFA 4P5TD 4PREA 4E9XA 3S88L 3UEZA 1GTFA 3OPUA 4U1IA 5E2WH 4HJUA 4F1SA 2W88A 3ZT6A 2OR8A 3KS0H 1CYWA 5FKAA 4E41A 3NFNB 4QPEA 1XGZA 1N12A 3C5ZA 4XP4L 1FV1B 2J7LA 4PG9A 5IB1B 4PAZA 3IKCB 5AAWC 4ZW6A 1Z9NA 3QUGA 5AVVB 1LXMA 2NUPB 4N8PA 1CICA 3S4SB 4BZ2A 4OF7A 3RFRA 1PJ9A 3HW7A 4FJ6A 3HI5L 4XC3H 1H6TA 1EERB 4ODVL 4P3DA 2NNRA 1SJVA 1BBDH 1V27A 4FQXC 2BSRB 4JJ5B 3DSFL 5SWSE 5GPRA 5IHZA 4LIQE 4YSRA 1MPAL 1NLDH 3TNNA 3H2PA 3TO4A 4KXDA 4IRJB 3CLEH 4DCQA 1Q9OA 3AU0A 3KYOB 3WEAA 4LARL 3ZE2F 5FS5A 3KH4A 1LO0H 2V17H 1EZSA 5JR1H 1KIRB 3KDPB 3ALWA 2D73A 1PZBA 5C09A 3O2VL 3MRDB 4IRJD 1GZHC 1KB5B 4GKSB 4J2QA 4ONHA 1MFVA 2DLHA 1GOGA 3US0A 1HWGB 4E9RA 2Q3ZA 4Q56A 4LPWA 1DN0A 1JHTB 4HBQA 1DJIA 2L7UA 2PCYA 3IDMB 3Q8FA 3UTSD 4Y1AE 2F7OA 3CFKB 3EFOA 4S1RH 2EDLA 3GIVA 2V7HB 3RX8A 3RZWA 5F1OB 1KLFB 2BY0A 4CVXB 5CLTA 4UQ9A 2MMXA 4N0UB 3L1EA 4GUPA 4JHWH 4N8UA 4X83A 4P5KB 5K93A 2P43B 2UUDK 4P06A 3T2LA 3V0JA 4GSRA 2XBZA 3W0WB 2EDHA 4AZ8A 4ZYKB 3HC2A 3UP1A 5IMMA 2Y6SC 2JCCF 1DLFH 2CBOA 4ZPTB 4GAFB 1DVXA 1I1FB 4ZZKA 1MFUA 1JGIA 4MA1B 3BUTA 1ZTXL 2QQNH 3FMGH 3GMNA 5TE7H 3W0WD 5AKTA 1EAPB 1A2YA 2FX7L 1CDJA 3HZMA 3PHSA 1U8CA 3Q6GL 2CDEA 2BVTA 5AUMA 3WE6B 2XA8L 1S9YA 2DH3A 3LEXB 4HCGA 2V2TB 3GXFA 1LO3L 2YAOA 3HA0A 4M8UA 2DL2A 3EF4A 4PJXE 4KVNH 2YGPA 1NKOA 2A9BA 2SEBB 3FTYA 3MJ9A 3CN1A 1JGLH 1U92A 2OJZH 3F6JA 1D5BA 5I1KL 5I1CH 3GKZA 3HZYB 2FEDD 5E8NA 5HGBB 4Z7OF 5KBKA 3WN5A 8FABB 1CGSL 1CXFA 4IS6A 4UT6H 4XVUD 5T5NG 4KMQA 2LV4A 4X9GA 4FERA 4H0LC 3PL6B 5L7XH 1B0GA 4K7FB 5AVTB 4XNXL 4PRDA 4CC1A 1MFCH 2F8IA 1P9MA 3BISA 2BERA 4MZ3A 1ITBB 3M17B 2EYTB 4D9RE 2E6JA 3MRCA 5FCUH 3PL6D 2PCPA 2VR5A 2ERJB 1A7NH 3BXNA 4Z18A 1AR1B 1JCKA 5AW2B 4JKLA 4AE0A 1U0QA 1T0NA 5GGRY 1JJUA 1R24A 4L4TA 4PJ7B 4PLKD 5FX3A 3UPAA 2ZOTA 4HCRH 4F7CB 3LZQA 4G6JH 1IC0A 1FN4B 4I1RA 3MLVL 2K9UA 1WUZA 2DKSA 2GFBB 4OT1H 3ZQXA 3SBQA 5HHOB 1M2VA 2PO6B 1WUNT 4FTVB 2EDDA 2HLEB 4PD4K 4CDGC 1NGQH 4TNVK 3RPIA 2NRDA 4PP2A 5CD5C 2F5AH 3DX6A 5G55A 4MYPA 1GC1C 5DRNB 3UTPE 1BJ1H 2YLHA 5DLML 3DURA 2ICWA 2PO6D 3NJJA 5F3HA 2VO8A 4KROC 2I26N 5F9JB 5J11B 5GGVL 5JORB 5L6YL 1GZQB 3APMA 1OTSD 3VXQA 3W1ZA 1BGXH 2JQAA 4ZS6D 5E8PB 3BQVA 4LE8A 3V7MA 3VRLE 2CO1A 4M5ZH 3GIZH 1LE5A 5D7JC 1QZ1A 5A43C 4RZCB 1KCLA 5B39B 3LOWA 4C56E 5E0QA 4MRBA 3G5YA 3IFPA 1YN7A 5E1HB 4CDHA 2WKOF 3L2MA 1MIEL 2ZXBA 1IT9L 4FFZA 3GUTB 1CT8A 1U93B 5AW6B 2Q20A 3LY6A 4AQ1A 4ODWB 1KIPA 2DTSA 4XZUA 4WUKH 2A99A 4KTDL 2EUXA 2IWFA 5GS3A 1HVXA 4CMMB 1BM3L 5BOZG 2CUMA 2GTZB 1MFDH 1SRDA 2FO8A 5EC2A 5I16A 3NEOA 4BE6A 1K8IA 1HOCA 4ZFFB 3DJSA 3P3SA 1KJ3H 3ZKMC 5D93B 2GTQA 2WVSA 3P3RA 4OSUH 4BM7A 3WU1A 4X7EC 5I1JL 1TEYA 1AD9B 5FYJU 5AEAA 5TQ0H 5IHHA 4YDZA 1KGCE 4IMLA 2A3TA 5I74C 4U1IB 3WAJA 3N41F 3NP4A 4HJGB 4OZ4B 3H2WA 5FKAB 1JV5A 1FNEA 2MOVA 1AQKH 4RZKA 1NDMB 4JHUA 3SPVA 1JHLH 1F58L 3MRLB 1E4KC 3SHSA 1EMTL 3C5ZB 2VE6A 2GYSA 3HHMA 2QFPA 3D0LA 3ZTJH 3BRFA 3QDME 4N1CA 4UQBA 5AD0A 2LAAA 1UG9A 2NR6C 2NDFA 1X7QB 3ILQD 1HFUA 4B9KC 3C5ZD 1J0ZA 3I85A 4OM0H 3GXIA 1KJVB 4ZJ9A 1RZ8A 2XG4A 1WRFA 4K8RD 1EDHA 3P9WB 2P46B 1YEIL 1YPZE 4GQ9H 4ZFOL 3QYNA 5I1IH 4UINL 1DQMH 2CWRA 3ABLB 2R83A 3FC8A 3AACA 5IHZB 4X6CA 5LBGA 1IEBA 1PG7W 3TNNB 2KLTA 2MPAL 1BIHA 4L3CB 1XGYH 4MD0A 5HXMA 3LN4A 5C0CE 3RZCC 4PJBB 3L54A 4X6BA 5JYMA 1EAOA 2W9DH 5C8JB 5E5LA 3ULVL 3BE1L 4OF0A 5BO1H 1UYWL 5LUMA 3GLAA 5IJCC 3GXTA 1NCAL 3X1GA 5DLLA 1G6RL 1PG7H 4ESKA 4RDBA 5CJ5A 1JNLL 2OTWA 3U30B 1S8DA 2H2PC 3ZRFC 4B5EA 1HESA 1PYWA 4JPKL 5ISZE 5JOEA 4WSKA 1C8QA 4Y19B 5EU5A 2R2HB 1FBIH 3ULSB 3ULVC 3TN0C 4PGJA 1FG9C 3SBWA 2NY1B 5TE6L 3UACA 4DN3L 2Y69B 2E59A 5B3NA 4HUVA 4Y7OC 4R4ND 3QS2A 4YGVB 3UZQB 2R0WL 4XP5L 3O3EB 4N1HB 2I07A 3ARQA 2Q9OA 5C0BE 3GMNB 3QO1B 2ZUTA 1ZWIB 3IDGA 2AK4A 1NOAA 1D6VH 3ARSA 2SODB 1R33A 5D2NE 3G6JA 1KPRA 3PDOB 4KZCA 3MRMA 1QWUA 3MJWA 4HWZB 1N59B 4U3CA 1FL5A 3O8XA 2CCVA 2VXQL 1QLFA 3HG1B 4KNQA 1U92B 4HXBL 4OZHE 2GTWA 4BH8B 4KAQL 2LVEA 4KZEH 5IB3B 1FVDB 4GG6F 1W15A 1KN2L 1F11B 1PFOA 3QARA 4H40A 4XMWA 4P2CG 4N3UA 2FSEB 5CSBA 4YQXH 4P46C 1AZNA 4W4OC 1AZZC 4IYKA 5E95B 2BVOB 4A6YB 1HEHC 3CQQA 3C08L 4UAOC 5D70L 1R3HA 2ZG3A 4HX1B 3BWSA