2OXHB

The soxyz complex of paracoccus pantotrophus
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
115
structure length
114
Chain Sequence
HGSSTVDELTAAFTGGAATGEGGLTLTAPEIAENGNTVPIEVKAPGAVAIMLLAAGNPEPAVATFNFGPAAADQRAATRIRLAQTQDVIALAKMADGSVVKAQTTVKVTIGGGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SoxZ protein
publication title The SoxYZ Complex Carries Sulfur Cycle Intermediates on a Peptide Swinging Arm.
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Transport protein
total genus 25
structure length 114
sequence length 115
chains with identical sequence D, F, Y
ec nomenclature
pdb deposition date 2007-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13501 SoxY Sulfur oxidation protein SoxY
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2470 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2oxhB00
2OXHB 2OXGB 2NNFA 2OX5B 4UWQB 2NNCA
chains in the Genus database with same CATH superfamily
5DD3L 5F3HB 5JYLA 5GRWA 4JO1L 1XDTT 2NLJA 3ZO0A 3QDJE 2Q7NA 5E0FA 4UCFA 3KM2A 4JHAL 2K6ZA 1FE8H 4FFWD 4Y19B 1L9TA 1CI3M 5K39B 3U9UA 4WCYL 4ZUUB 5F7LB 3CVDA 2R23A 3FTVA 3V5KA 5F1KC 2DQTL 1NAMB 1SF5A 4Y1SA 5ACMA 2G3NA 4L3ED 2BVOB 4RAUB 3L9YA 3I02B 5F1NB 3RRQA 4N4YB 4JFQB 1KLUA 3T0EE 3C2SA 5E5UB 2QFPA 3BIAX 3NT0A 1SBSH 2P5ED 4KITB 3DUSA 4O51B 2EC9U 4LPTA 5LDUA 2C9AA 3DUHA 3L4WA 2Y06L 3CE1A 4G80B 4MXQC 4XX5A 1CDGA 3T3MF 1Q9OB 2D7PA 1B0RB 2JJVA 2UUDK 4OH2A 3TFBA 1B4RA 1INQA 2VDPH 4LVNB 3E8VA 4D8OA 4XN7A 1KLGB 4TQHA 1QHPA 1KJVB 1E30A 4KXDA 2ZJSH 5D4IA 3UYOD 4YHLL 4LHUG 3SPGA 3UTSB 1IGMH 1C12B 3ZDZE 3FCSA 2Z35A 3P9LB 2CKNA 3S8FB 1BAGA 1TTGA 2CO7B 4GFTB 4U6XB 2ROXA 3UAJD 1R3IH 3OGCA 4HCRL 5HGDB 1XGUB 5JORA 5GISH 1DANT 4ANXA 2F2HA 3UCQA 2Y23A 4B9CA 2B2XH 2IG2L 4JL2A 4Y9FA 4K7PL 5DO2D 1MUJA 3RZCA 4IDJH 1I9EA 3LQZA 1Z66A 5E2VL 4Z7NF 2CLZB 1B4TA 1FYTA 5EU3A 4F9PC 1FVCB 5ICZA 5J13B 5K59E 3VD4A 1R0AH 5E6IC 4TVPE 3D30A 2RMNA 4PV8A 5LB1A 4MVBD 2ZAIA 3K6IA 4WWID 1GGBH 3D87B 4XMPL 3UIZA 4ACTA 2EYSB 2KZBA 1HHIB 4HH9B 1GYVA 2A74B 3QFJB 3UO1H 4GI8A 2AEQL 4WFGD 5F7WC 4LASH 4W81A 3R1GH 1FORL 1SOXA 4P23D 3ZDYF 4DUWA 2ETWA 4LOUC 2G60H 2GTWB 2WGXA 1VACA 1UOLA 3BHBB 4KPHH 4PREA 4WEEA 1F8TL 2FH8A 4GW1A 2IPUG 4Q4IA 4BFFA 3RNKB 3DO4A 5T5NG 1K4DB 5GS2D 4JANB 4F7EA 2DPKA 3DVGA 4FMFA 1KFGA 3HG4A 3DOSA 5FGRA 4RA0C 3V7AE 4LZKA 3VFOB 5FO9B 5CGMA 1WZ1H 5JXAH 4P4KA 1WZKA 1F3JB 5JYMA 2GSGB 1TKWA 3CFJB 4FFWC 3UYRL 3SDDA 3EYUL 5H35B 1S9WB 2VM4A 4Z23A 1F11A 3LPFA 4M3HA 3HOGA 2B4CH 1IVTA 1AQ8A 4DN4L 2ZP8A 2HA1A 3GMNA 2GT9A 2X9XA 2E74C 4F58H 1BD2A 3VM5A 3CLWA 3N2JA 4EIZC 4QEGA 3K8LA 1Q9KB 3K72B 4QOKE 5T3XD 3ZE1B 5ALCH 3HLAA 2F54D 5H4YA 3A22A 3PGDB 4NNPH 4I9WD 5TK4A 2LHAA 3M45A 5T1MB 4QRQA 4XPGL 2F53B 2WWMC 3KYOB 1QR1B 2M83A 1OGAD 3KPMB 5IY5B 3NVQA 3DPBB 1KB5A 1JWSA 4PRHD 3K8KA 4MA3B 4DGIH 1E9PA 3PWVA 1GPOL 4P2CG 4WWKB 4RFOH 2EH8H 1EEZA 1USQA 3OHXC 4MNGB 3UAJC 5DMIH 3Q2VA 4TM9A 1UJ3C 2RCSL 3NFNB 3GRWL 4ODBD 3O4LE 3Q43A 5C0CA 5DO2C 2VZSA 2AV1B 1B2YA 2WSKA 1YY8A 3S3CB 4N1CA 5D2NA 4JFOB 7PCYA 3KMDA 5KJ4A 3KPQB 1U91A 2X1PA 4KKBC 5BPPA 1DUZB 5CP3H 2WXJA 5HHQA 2HG0A 3O2DL 1MI5E 2ZXCA 5CINL 1YJDL 1FUNA 1W0VA 3I74A 2HFTA 3V4VA 4M1GL 4MVBC 4PEEA 2GK2A 3NA9L 2V33A 2UZIH 4TSBH 1G7MA 3S3DB 1A6AB 3D4GA 3L3DA 2QV2A 2W8CA 5I0YA 4ZXBC 2EADA 3FU6A 4QRRD 3PXJA 1OALA 4ZMLA 5B39B 5I28A 5HHOE 4XN5A 3TT3L 1MCWM 2ITCB 1PDKB 1RFDL 2E0PA 1EJFA 4QRFA 1BVOA 4LLYA 5C09D 4AUJA 4N90D 3VFTA 3W5NA 4B9FA 4ZPVA 5DJ0A 3WTYA 4XH2A 3T1WA 2K8MA 1F1GA 4NO3B 2DEYX 4YXKL 1P6FA 1SJXA 1XWVA 1KY6A 2XLLA 3L4UA 3MX0A 4H1LG 3SDXA 4J3OG 1T0MA 1A6UL 2J7LA 4BFJA 1BAFL 4PGDB 5DDHB 5BO1L 1IC1A 5JIMA 1QRKA 4PRDA 4RISH 3JBG7 3P30L 1EZUA 4TVPL 2MFNA 1YEWA 2GG1A 1BFSA 2W07A 1KT2B 3F6LA 3O3BB 1TZ8A 4LLWB 2OTPA 4MCNA 3RL2A 3FHQA 3II2A 5F7AA 1FAIL 3ZL4H 1N5AA 2B14A 4NI6A 3WLBA 4PRIB 2MRYA 3STZB 5JQIB 1RSFA 3V4PB 1D2OA 2FJHB 3Q3GA 5GGRB 4Y16B 5B7FA 4J39A 4H4NA 1LK3H 3BVUA 4XPFL 4ZQKA 5JO5B 1F58H 4LLUB 2JCCE 3EG9B 3P4MB 4XPHL 2UVEA 3OF6D 1VGKB 4OJEH 2VN6A 3V9CA 4F91B 4CAGA 2L8AA 1EXUB 2EDJA 2P45B 1JZIA 4JDVA 4N9OB 1FC1A 4KUZL 1OHQA 2D7TH 5BOJA 1PZBA 2ITEA 3BUTA 4KDWA 5I1JH 2H3NB 4LCCB 3B5TA 4X5WA 2AQTA 3GMMB 4X7SH 5EOTB 1UM6H 1KBVA 3GXPA 1RZKL 1WITA 2QSCH 2WNGA 5HYSB 2O1AA 2O61B 5MP6H 1NIFA 2MOQA 4MS6A 2DQHH 4EQ2A 3IGFA 3T3ME 2ZNWA 3C60B 2VQ1A 4Y9CA 3L8QA 2IALB 5ETUA 3FO2A 5F6HI 2BVYA 4Z7WB 2OW7A 2ENYA 1FV1A 3IJEA 3U4BL 3B1TA 4HJJL 3ZUCA 3ARSA 3GD1C 4MB4A 2Y1VA 4NZUL 3HHSB 1O6SA 1Q94A 4YO0A 1BBDL 4BK5A 5EPMB 3UP1A 4JPKL 3LKOA 2EICA 4MNQD 2BVTA 3LKSA 2GHZA 3BWZA 3QCVH 4AJ0A 3OKKB 4XNDA 1C5CL 2VM9A 4AYDC 4JG5A 5FM5M 4YR6A 1QUNA 4EOWL 2X53A 1HL9A 2BIHA 4ODTH 4PB9H 1WS8A 2XYCA 5KYUB 2D73A 3GHBH 3UGUA 2EEAA 2A5UA 4U1HA 1IZKA 3UTTA 1G7LA 4WY7H 4WHTA 2PWDA 4I48B 4M6OH 4Z7NE 4TNWK 5ENWA 4G6KL 3O3EA 4YX2L 2VXQH 4NQTA 4NGHL 5C8JB 4LMQE 5B3JF 1Z9SB 3O8XD 5KJ7E 5CBAB 4M9PA 3THMH 1HXMA 2A6DB 4K3JH 4K8RL 2NYZA 1EHXA 3DMMD 4M7JL 1FH5L 1ANUA 4PSRA 4LSRH 3FBKA 4U6HB 4C57C 2W91A 3MBXL 1AOHA 1N59B 2ADJB 4KK8C 1FNLA 1SDYA 1QI3A 4NN5C 4OGAD 5EC1B 3EDKA 4NQEA 2QTVA 3CFEA 4HUVB 1XT5A 1AZCA 1BEYL 4I2XA 2WQUA 1UWXH 3IFOB 4UB0L 3VCLB 4R7VA 3ZDYE 4N2KA 4N8CH 1TVBB 1XH1A 2YLHA 4HIHB 1JN6B 3VI4B 4LU5H 4QHKI 1CVRA 3FBQA 2UZPA 3JTBA 1NIBA 1GVIA 4IOIA 4OJFL 1E4WH 3M7FB 1NANH 1FCGA 5T1DL 5EG6C 1YEEL 2ESVB 2J20A 5HHMB 4DPCX 1CFVH 4MLIA 4TYUA 3RJQB 2DMHA 4QRUA 5BRZB 4KRMB 2R69L 4WW2B 5F0JB 4U7MA 3ECWA 4X0NA 4OVVA 1KPUA 5IMLB 4JHVA 1SXNA 3V4VH 1ZJBA 1TQBC 3OKMA 1NCBH 5D96C 2FWSA 4MD5B 2OQJB 4NXKA 3VQMA 4EBQH 1XIWA 3LPOA 3S37H 3D25A 1T66D 3PWPE 4KO7A 1DN2A 2VLLA 1Z3GH 3VXOA 4IJ3C 3JWNH 5IW1B 1YEJH 4PJ9D 2DI7A 1U8KB 4YSQA 3ABLB 4QJ3B 1PS3A 1EZSA 1HVXA 4XO5A 3ZZSA 4KQ3L 4P3WA 4N22A 2YC1A 4J12A 1EUUA 3JWDL 3OAZH 4I89A 4LCYB 3IF1A 3VJ6A 4IU2A 4NZDA 2A83A 3DV6A 3D52A 5FDWB 3P4LA 3KGRA 3IRZA 4OQ1A 5SX5K 1BQKA 4NHUA 4S0SD 1MJ8L 3P9WB 1NDGA 2HYMA 5ICXB 4A2DA 2D0GA 2HLAB 3PL6A 3BVNA 1KV7A 3ZQ9A 1CFMA 2Y7NA 1HHJB 3DA0A 5KBLA 2NY1D 1KTCA 2IH8A 5AL0A 4HDIB 4KKAD 2P8LB 3UL4A 3D07A 3ALXA 3DX8B 3PJSA 2DQUL 3EGDB 3T1FA 3VO0A 1JFQL 3CHRA 4MJ2A 5I74C 2C3VB 2NNRA 5KJRL 3DX9A 4FQIH 2YD6A 1CE1H 4FD0A 1BG1A 3GMQB 1ET7A 3OAYK 3FXIC 5M7QA 4UT9L 3QJSB 5JHDB 2WZAA 2JXMB 1CE6B 3O2VH 3RGBA 2QPDB 3P3UA 3G6DH 3DMMC 3TFKD 1VADB 1PIGA 1U3YA 3HG1A 4K5NA 5AG8A 4LARL 3WNMA 1IL1B 3VRJB 2P46B 4EUPA 5I73B 4JQXA 1TXKA 3SDAB 4PJFB 2DQCH 4CKVX 2QADC 3BAXA 2CR0A 4OGAC 4F2MB 3GLZA 5AVXB 1J9RA 1H3GA 1MHPL 2OR9H 1DN0B 4OD3H 4AQEB 3L48A 1NANI 3X1NA 4IEFA 1SJEB 1AKJD 4AYGA 4XZUA 2OZ4A 3EFDL 5CLTA 4GRLB 4IOSA 3U0WH 3LCYA 1OAYH 3AS1A 4OFVA 1I1AA 1TJIH 1ZHKA 3ZHDA 5FGSA 2HLFC 5LLIC 2QGDA 4HX1B 4MCMA 3QB7C 5D7IF 5A6MA 1W6WA 1WTLA 3LAFA 3DNKA 3NESA 3E8UH 3MROB 3WTWA 3QUMA 5HGBA 4DZBB 1CXHA 3EJSA 5D1QA 4TVUA 4CSZA 3VE0B 4CL7A 1P4IL 3LYRA 3RIFK 1QATA 4Q8BA 3VFRB 4J2XA 2A6KA 1FN4A 2C1OA 5HVHC 2HMID 2XNAA 1ZPLA 1P2CB 4E41D 5GSRA 3OB8A 2E3VA 2E6JA 2G2NA 5CXPA 5L4JA 3US1A 1CDJA 4PJCA 1TCRA 4PJDA 1T66C 2HKFH 2J6EL 4ZMVA 3H2PA 1A4JA 2H9GA 5D70L 4ZUTB 1ZE3C 3DECA 4PJAF 1TENA 1MIMH 2LVCA 2X2JA 4PJ9C 3RIKA 4X4ZA 1NA8A 2CDEA 3CMGA 3E2HC 2H26A 1ECYA 2VN4A 2ZOLA 3E1F1 4PRPE 3OZ9L 1U8JA 5JHLL 4HIJA 4GAJL 1EANA 3COOA 2P49B 3L3KA 4M5TA 4QRPB 5D55A 1OVZA 4I3GA 5IG7B 5J8OA 4LCUB 3MNVB 1YNTF 1DVTA 3WXWL 3LKQB 3CVCA 3VFSB 2NY2D 1ETB1 1M1XB 5CN1A 1SDDB 4N24A 3O6FD 4RMTA 3WO3B 4ANKA 2MKWA 4C83A 5JDSA 1BF5A 4JFYB 1BXXA 43C9B 2L04A 2WO2B 4XHJD 1ZA3A 3O9WC 1U92A 3RTQA 2J88H 3ARBB 2X3CA 2NCMA 2NY1C 1UT9A 4KKAC 4OZIF 2GK0A 5ELIA 1A1MB 1R3LA 2YOCA 4X5QA 1PEZA 5DGQA 5C2UB 3GMOB 4AGLA 2ZKXA 3BZFA 1YY9D 3B2VL 1WH0A 2BRQA 1OD7A 5JIQA 2DQJH 5CZXD 4Z7IA 4XMKL 3BP6A 1B4JL 3LOWA 2X1XR 2JKNA 3HE7A 4MJ5B 1H3WM 2UY6B 4ZFZA 1ONQB 5DD6B 4O2CA 2PPCA 3QS3A 1UM5H 3TFKC 4ZOCA 4MJIB 3TURA 4GMTH 3MV7B 4JN2B 4HOXA 3IGKA 1D5ZA 1OM3L 2YEVB 4WW1A 2XJLA 4OQTL 4JBSA 1T1WA 1FP5A 3QRGL 3DXAD 4WNQB 1WBYB 4M7ZC 3TH4T 1QFUH 1T04A 5E6ZA 4IJTA 5K9JH 2BFGA 3B7SA 1HX0A 3F84A 1A6ZA 3CPLB 1N18A 3GZQA 3PU7A 1N8OE 5HGGS 3ZYJA 3SSGA 3O3DA 1G9NH 1RPKA 1H5BC 4ZJ9A 3KL5A 2ATKA 5B3JE 4P46B 5I6LA 3VYOA 3JTSB 3S2CA 3EFOB 2GPZA 2Z93B 5L4IA 2YWYA 4P9MH 4NCC1 4U6VL 3S7GA 5ALBH 5CZVL 1WD9A 5ADPH 5BZDB 1XX9C 3AG4B 4KKQA 5DHYA 3DHUA 2MHAA 3T65B 2HMIC 4DOHE 1BWMA 3JQOB 2EIDA 2YKLH 2C1PB 3V4PH 2I9LB 4OD1L 1O7DE 3IDJA 2R27A 5L9DL 5EUOE 4YHPA 2VMJA 1OAKH 1NGPL 5DMKA 4YPGB 1N6UA 3ELQA 3FT0A 2KH2B 5AB0A 4YDMA 1BBJA 2P48B 4FQLL 1KEGL 1U93B 1GGIH 6FABH 1W0WA 2Y3NA 4OGYH 4OZFA 4XVTL 3TCTA 5HDOA 4Z95H 3HS0C 1G7PB 5CMAA 5C07E 1AAJA 1WBXB 2Z0BA 5EIIA 3T0DA 1XGTB 4DQOL 4IRZA 4KJQD 3D48R 3MUZ1 3P2DA 2NY2C 1Q9WB 2CM5A 4L4TE 1HI6B 3O6FC 4BE5A 3ARYA 4B53A 1E9OB 1P1ZA 3ECQA 3HEIB 1OT2A 1Z0NA 4XHJC 3U6RA 3HKFA 1FPTH 1F6AA 3TESA 1RD6A 4NM4H 5J1SC 3P0GB 2X4NA 5DZVA 2H0FA 3A23A 1KYOJ 2BH0A 2VB5A 5DJZA 4FXKA 1ACYH 2V7NA 3ZHNA 3NQIA 5DEGA 4HG4J 2DEWX 1JNLH 3CHQA 4Z7VF 3U7AA 1NL0L 4PVBA 4R5TA 4FADA 5FKPB 3SZKC 1MF2L 3OJ2C 4U05A 4ZW8A 3TBCA 1YLBB 4GS7C 3VD2A 4UTBA 4BSWA 1RJZB 3GSOB 3L2MA 1S5HB 5CZXC 1BOYA 3MDJA 1SBBA 4FDWA 5JW4R 2ZUYA 4BFIA 3KYKH 3GJFA 1LE9B 3PAZA 3A6CH 4OLXL 4UQEA 1UOKA 2A9CA 4ZODA 1BXVA 3BSHA 4LVHB 3ZZ1A 1RZGB 3BWUF 4H8WC 1FL6B 3IE4A 5E4EB 1TZIA 4ATTA 3QZNA 1FDLL 1JUFA 3QPQD 3NGBB 2GTZB 2VUOA 3FU5A 4UBDD 4MD4B 5HI4D 1BVZA 1ZA6A 3WDIA 4UM9B 5C71A 3F65A 4RAVB 4ODXB 2HFGH 4G8IA 1AVAA 5IW3A 5T3XL 4AQ1C 3E7JA 1OP5H 4GSUA 2FBJH 2WLNA 1KCSH 1Q9LB 2VIRB 4QRSB 3X12B 3ABZA 3M07A 1ROWA 3BO8B 4W1TA 2V9UA 1IEAB 4M8QA 1FZMA 3DBXB 1F4WH 5ITFB 5LCVA 5FECA 1RMFH 2QELA 1DSFH 1U6AH 4IGBD 3E3QE 5ANHA 2VDNH 3MRCA 3ZR5A 4GKSB 1QYGL 2JSFA 4QF1A 3RG1C 3T8XA 2EDRA 1D2PA 1S2EA 1YEFH 4GUQA 1OCOB 3EO1B 3S4SG 3BXNA 2OM5A 2RFXB 3U79A 2FQDA 1EV2E 1QTSA 2Q8BH 2XG4A 3EW3B 1TO4A 4MAYD 1VKXB 4U1JA 5IW6A 3IVKA 2BWIA 4LBAA 2M2DA 4N2EA 1FZKB 4DFIA 4N2HA 2FO4B 4XXWC 1OWRM 1A6WH 2X2UA 2QEJA 4HLZH 4W9KC 2WWKT 3BPOB 2CO3A 3S35L 1LP9B 1N8ZA 2VERA 1IARB 3LZNA 1Y6KR 3FFDA 3T6XA 5IWLC 3ARDD 4H13C 2VTFA 4ZAKD 1G6RA 1LWJA 3FHEA 3RDTA 1UWEH 1IGJB 2AK4A 4OLYH 1RK1A 2OA9A 3DJSA 3AU1B 5A43C 4ES8A 1IM3D 2XVGA 5KW9L 3QAZB 1T20B 4UZSA 4WHDA 4YHMH 2VXTH 2AVGA 4WLCA 3F7PC 3VD1A 3BP4B 3S36L 5HVWA 3WN5C 4IBUA 4IBLT 4CJ0A 2XWJB 4KROD 1G0XA 3IRCA 1J8HB 3W2DH 5DRWA 2IAND 1BZ7A 1YEHL 4KGLA 3WIIL 1KJMA 3CHPA 4NO5A 3CFCH 4MMXC 4ZSOA 1WBZA 4PJAE 2VYRE 3DV4A 4JGMA 5B1JA 3ULSA 5MERA 1E8XA 1QHQA 4G5AA 4X4XA 4BSJA 3EAKA 4JFPA 1JZEA 4GQQA 1GMIA 3P77B 1CTNA 3GO1L 3KJ4C 4R6UA 1OAQH 4UAOB 5EO9A 3T4AC 4CADA 2IOIA 4HMCA 2JE8A 2C9SA 5D1XB 3LKRA 2B0SL 1MJ7L 3TYGL 2N0KA 2Y2WA 3RUGF 2R4RH 1WPCA 2W0FB 4M5YH 4TMPA 5E5RB 1JD9A 4DKDC 5IZ7A 3UTZA 4CC4A 4DTGH 1MZYA 2WLLB 2PR9A 3UO8B 2EIZB 3GI9H 4I18B 2G4EA 2FX9L 3KXFB 2BX5A 1R19A 1JS4A 2CD0A 2WCSA 4JJHA 1NMBL 2VZ3A 3MVSA 4ODUA 2WTRB 1KPRB 3MJ8A 3G9AB 3WEOA 1ICTA 4JVUA 4K7PX 2XWBA 3MC0A 4M7KH 3QPQC 4NZJA 5E08L 4UBDC 5GS0H 4AQ8C 6PAZA 5HI4C 4YDKH 4HIEB 4UT7L 1J0KA 4WU7A 1JGLL 1TVDA 2DQFB 3JYCA 4OZIE 2OMZB 3RBSA 3AM8C 5HP5A 4GEJA 2DYRB 3BUIA 2WHVA 1NEZA 3CK0H 1DVQA 3CBKB 1A0QL 1RUQH 1THCA 1UD5A 4I85A 3B4NA 5E8OB 4NCC2 3KS0J 4IGBC 4UOW0 3QWOB 2J56A 1OB1A 3KNBA 2XTJC 3QP3A 2QHLA 2XPGA 1EO8H 4A6YB 5KUKA 1DLHA 1PCXA 4YL4A 5CGBA 4ZPTA 4U3SA 2HT3D 3I2CH 3L54A 1AE6H 1JXJA 5DJCB 1F97A 4NWTH 4PP2B 4JPVL 3WUWB 3ULVC 1DE4A 5HHXH 4GT0A 5CJOH 1XCQA 2G2RA 1OARL 3OR7B 2VLRE 3D18A 1PG7L 4BDVB 4DVRL 1TJGH 1I9JL 5HHVL 3ZTCC 3ULVF 1OP3H 5HYJB 1VFAA 4ZAKC 1EFXB 1OZUA 4HJTA 1JHKH 5EU6D 1QD0A 4FYRA 2P80A 1MCNA 1P4BH 2VDML 4UILH 2DF3A 2EJ1A 4Y1AD 3QDMD 2Z4TA 4UTBH 2VLKA 3KPRA 4FXGB 3BUYA 3LMJL 1EEYB 1AC0A 1CLOL 3V52H 4PJXA 1PLGH 2VO5A 1SUHA 2DWDA 4MXVF 3GJFH 4FQ2L 3QDJB 4KROC 1AI1H 3FCGA 3LKNA 2EABA 3HRZB 3I6LD 1C16B 2RD0A 4BZ1A 1D7FA 3P3TA 5K9OA 1K2DB 1MJJA 4K3GA 4KHTL 3HC0B 2NUPA 35C8H 2E9JA 3MRGB 1MFDL 4GXFA 1X5JA 3HMXL 2OKMA 1BMZA 4QTIH 2VXSL 3WL9B 1E6OH 2BVQA 3WBDA 4KRNA 3PGCB 4L1SA 4RSVA 1K6QH 5C0AA 2K7PA 5E9NA 3US9A 1EGJA 1MRCL 4YDJA 3SCMA 5AZEH 4BQ9A 5FGBA 4N5EC 2XWTA 2ZCHL 2XN9E 4YXLL 5A1AA 1EDYA 3MODH 4LSTL 4P2QB 5I75C 5DTFB 1JGEB 3GTNA 2MPAH 4JRFA 2DQGH 4DK5A 4MAZA 4AXWA 1FNHA 5CEZE 1L9PA 3HBQA 5DYOA 3DJZA 5C0EA 1VHPA 1K72A 1OAZL 3FH5A 1BLNA 3O2WL 1T1ZB 5GZNA 3MLVH 3SDCC 5KANG 5TDOA 1ZCRA 4WTQA 2FR4B 3B8SA 2VABB 1KYAA 4JAMB 3KG5A 2I7SA 4QAMB 3UOAB 4XI5D 2CIIA 1E27A 1ZV2A 3IETB 2J57A 4BFBD 4Z7VE 5E8DL 5CCGE 1M53A 3BQVA 1KGYE 4GQ9L 1YEKH 4UMGA 3RPBA 3U7YL 5AW3B 5T1KB 3QJOA 1RULL 3VXMA 1G6RH 5IR1B 3GZOA 4YAQB 1SDAB 4CDGC 1SN0A 1R24A 3BAJA 4HHAB 2PTVA 5IB1B 1CBVL 5K1NA 3LKPA 3FYIB 4R8WH 4AL8C 3TYFA 4A1RA 5HYQA 1OF2A 2ROYA 5EDSA 1DVZA 5DJYA 4NZRH 2HPOA 2RTTA 2HT3C 3BUQA 5KYYA 5E1GA 1JVKA 3ATFA 5GGVH 2MNWA 3H85A 4MA1B 5DJ6B 4AWJC 4AE0A 4FTVD 3UPRB 3KPSA 2HJLA 4P59L 2JI2A 2JI1A 2QSVA 1PEWA 3GXDA 4KMTL 3APFA 2C9UA 4Q6KA 3N1PC 4DP9X 3D3VE 2MQ0A 1ZV9A 3T6WA 4D9RE 2ADGA 3SYQA 2CZNA 2DWYA 5DD1L 2WIIA 4OFQA 4BFOA 2ZICA 1IU1A 3T0VA 4EIUA 1CK0H 3C8DA 3N41B 1YMMA 6TAAA 2UY7B 5IROC 5BMFH 1RSYA 3QZMA 4PJ8B 1FGVL 2BNQB 1TG8A 3BW9A 5IFAL 5KYWB 7PAZA 4KTEL 5HHNA 5TDPA 4PYHA 3QR1A 3V0JA 2OTWB 5E8EB 3LH2H 5DQDH 4PR5A 2IPKA 2BP8A 3MCYA 1WC7A 2RQ8A 4J6RH 2GVYA 5E6UB 3W1ZA 4G9DB 4YBQD 4K73A 3LRMA 4Z7QB 3D85B 1SXSA 2VE6B 4OKVB 4RRPA 2XWZA 3IJSA 4FQHB 2WYZA 1CDUA 3VXTB 3ULUD 3FOLB 3P73A 5BW7C 1YPZA 1JWUA 2VSKB 3WEMA 2NY5H 4AZ8B 3G7TA 5I6XB 3JWOH 2PABA 4PRNB 4Z3JA 3WCYA 3FF8A 2IBGA 3KDMB 4PP1D 1RURL 1QBML 1QBAA 2J73A 1QWHA 3G5VB 3GGWA 4NQCE 1SF3A 4RFNC 4KOBA 5EOCH 4F37K 4N6QA 3OJDB 1IKNC 2F1AA 1DVYA 2XHNA 4JDZA 5DD5H 1YUKB 3VXRE 3TIDA 1NUGA 5KSBF 1RIUL 3VTAA 4QHUA 4YJZL 4HOZA 2KYIA 2B1HH 2VXUH 3LZQA 2FT7A 2DIAA 4KDVA 4NOBA 4XI5C 2C9QA 4GAFB 3U36B 1I1YB 4RGND 4LEOA 2WSDA 4G6AD 3ZZLA 2VQ4A 2UXTA 2EIKB 4OAWB 5I1HL 4YSSA 3BT2L 3DPDA 5BO0D 5K9QG 5E00B 4DAGH 4Q9CA 5IF0A 2DQIL 3BZ5A 4YHOH 1H9VA 1K4CB 5D7SL 2WLZA 5FUCE 3T0EA 3RGVA 4P9HL 3L1GA 3ZDXF 3RWGB 3OXRA 5AUMA 1YQVL 3I9PA 5B1AB 4PM1A 3W9DB 2I9TA 1CGTA 1UM4L 1T6WA 3RWJA 3FTWA 2F19H 3PQYD 3FULA 2Y69B 3PIQA 5DD3H 5HHOB 3FUKA 4TUOA 2EE3A 2EDMA 4JO1H 1J87A 2I07A 1OE1A 1LMKA 1CTMA 1LE5B 4OD2A 2GEEA 1OTSD 4JHAH 3BN3B 2PXYC 3CFIC 4DP8X 1EHKB 1VPOL 5IHLB 5E03A 1O7VA 1E5UI 3AROA 2Z0UA 4WCYH 1T83A 1J0HA 3IEAA 5IHUL 3WIHA 1NCAL 2DQTH 2MQCA 2X89D 3H4HA 2AJYL 4PGBB 1YAZA 5IEKA 3CZFA 4LPXA 4JPIA 3EHBB 1KTRL 4X6CF 5GGSY 3FAWA 4ZOEA 4ZMZA 1XF2B 1KZYA 1WWBX 2RH0A 2WNXA 3ZQXA 4PBXA 4N5UA 2Y06H 2B39A 3STLB 5KG9B 2OP4L 1M2VA 3KVDD 1NC4A 3PWUB 5IK3B 3MJ6A 3MJ9L 2XTJE 3WNLA 5MEQA 3B7YA 4I9XA 2CO4A 3EADA 4KNSA 3H9ZA 4DWHA 2WGNB 3O0LA 4YHLH 5FM5O 5EEWA 4F9LA 5ESVA 3FTYA 3PPEA 4YBQC 4IKLA 1BYPA 3ULVE 4MS8D 3V0HA 1JGVL 1KPVA 4D9LH 5C0BB 4HBQA 3ULUC 5A2LH 3GHEH 4H8WL 2VDKB 3HR5A 4H0LC 3VWJA 3PUCA 4J8RA 4QHLA 5IB2B 4OT1L 3X14A 1RZPA 2IG2H 2MNJB 4PP1C 4K7PH 3HS9A 1HINH 4C56D 3BQUB 2NUTA 1DBKL 1GIGL 4XP4H 4MXVE 5SX4H 3HCVB 4M1DL 4LNRB 4P3DB 3MV8D 1KB3A 5L6YH 2GJZB 3WEBA 5G4MA 1MW1A 2PWFA 3EOBB 4XN9A 4Z77A 4PS7A 2I5YL 4XMPH 1DVFA 3LIZL 1SJHA 3FQUB 2LFGA 1M3IA 5FUOL 3VXSB 2QT6A 3LRGA 4O58L 3IDGA 4NYLA 1QRNE 2E47A 1UG9A 1WYJA 4G6AC 4RGNC 3SPJA 2BOBB 4JRYE 4TNFA 5IMOA 3BT0A 1FORH 4NFDA 5D1ZD 3FN0L 3W3BA 3H3KA 5CZRA 4JE0A 2CH8A 1F8TH 4P2OD 2J1ZA 1A9EB 3PUUA 4E5XG 3WFBL 2O6PA 1GZHC 1VZIA 1IGTB 3SY0B 2OTUA 4TUKH 2FSDA 3EFFA 1OT4A 5I6NA 3EOAA 1BOGA 4QOKA 2JB5L 5AL8A 5IVNA 1Z6JT 4HFUL 3BN9D 1KCWA 5DJAA 3ERXA 1KIPB 1XR8B 5C0IB 2ZUSA 1A2YB 3MOAL 2JKRM 4FLOA 4YLBA 5TGBB 5DJ2A 3RYMA 2HWZL 3BH8B 3K5SA 4OFKA 3UYRH 2PPFA 2G0LA 1Q38A 3ZW3A 4ONFL 5BS0E 1TPXC 4NSKB 3SGKA 5AD0B 4Z7NB 4P99A 1E4KC 2V9QA 1RI8A 1SEBB 3APCA 4HUUB 3SYOA 3HBZA 1WAAE 4HEME 4LDOB 4BD4A 3KYMB 4PB0L 1AQDA 1MDAA 4L4VD 4R0LA 5GS1C 5GRZA 3O4LA 3KYAA 4FEIA 4RWYL 2DAVA 4XRCA 4NRXA 2HG5B 2PCFB 3KWWA 4LK4A 5E6IB 4BCZA 5KOVC 1MI5A 1MCDA 5AW0B 2ICEC 2CRIA 1LO4L 4XPGH 3SD2A 3N3EA 4MNHB 4XP9L 5AOMA 5INDB 2VISA 2IIJA 3C6EA 4CBPA 5AOLA 4XTRC 4MS8C 3MR9A 4E9YA 4DGYL 1DLFL 4GSQA 3GSQB 2WKGA 1GPOH 4CRPA 1MWAL 3QNXA 5SX4I 3I9GL 1EA9C 4PU2A 2VZTA 4RZCB 1A1NB 3QUZA 4YSCA 2RCSH 2QZ5A 3GRWH 1AOZA 3F58L 3IPFA 4Z7OF 1AP2B 5ADOH 4PGEA 2D7QA 3RFRA 1Y1DA 5EF3A 2YPLB 3CDZB 3FT3B 3G6AB 2Z64C 4ZFOL 4PS8A 2WQAA 5IM7A 2JB6A 1ZOXA 1P6WA 3O2DH 2VAAB 1J5OL 3PXLA 5CINH 2PWGA 3FFCB 4W9ZA 4GBXC 3PWPB 4LBEA 1HKFA 4M1GH 1IM9D 3NACL 3VI3F 3NA9H 1TMCB 2DZEA 5IUCA 2HRGA 5KVMC 3GBNH 5E9DE 3BE1H 4CBZA 2QDVA 1P84K 2YOAA 1SMAA 2ARJA 1DQDL 1IO4C 4L3EB 1RFDH 1X5GA 3ZIYA 5D1ZC 1AGFB 3ULVL 2XT1B 3QQ3B 2F6AA 3VFPA 3VU2A 3BWAA 5E1HB 4AKOA 3WIHH 2P5EB 3DIFA 4PN6A 2HJKA 5AW8B 3TPKA 1LEIA 4HKJA 4PPTA 4Z7UA 1RP8A 1IGIH 1KG0B 3HC3L 5AB9A 3OV6A 1JGIA 4UDTA 2OMUA 5JUEL 2XDHA 3VXPB 3U2IA 1EX0A 5AVVB 1EEQA 4XNQB 3LNEA 2LT9A 3QW9A 4YXKH 4KMLB 1BX2A 2JCCA 5CWSA 1AHWC 4F27A 1WGOA 5DUJA 3BN9C 4NQXB 5KSBE 4YMPA 2CUMA 4H0IA 2WVTA 4YHIA 1BQHG 2EUXA 2C5DC 1BAFH 3FCUB 3P9MA 5BO1H 2KLRA 1S7XB 3P30H 4TVPH 5KVGE 3GK8H 1CICA 1NUDA 2XYBA 3L3IA 3OHXB 4YGVB 2D31B 1FAIH 1QSEE 5JNYB 4JM0A 2ZUUA 1RUML 1UJ3B 2EZ0C 4PJ7F 4DKFH 2FD6H 3LDBC 5I82A 4MDIA 5IB4B 4LLQB 3ZDXE 3BFWA 4L1HA 4AENA 4U2YA 4XPFH 3FU8A 1RU9L 1ADQL 1MREH 4HKBB 5CUSH 1KCUL 4JRXA 3DRQB 4J3XA 4XPHH 1GYWA 2PW2A 2BNRA 3JV6A 2UWEA 2F74A 4ZOBA 2OJZL 2CKBL 3UPAA 5BQ7A 1IFHL 3R4DA 1TEGA 1W72A 5T5FH 5I6MA 1CG9B 1FSKC 1U95A 3TBSA 5C0GA 3TBVA 1T1YB 4WFEE 4G42A 3N40F 4ZXBB 5CEYA 1N0XH 3H6AA 1ZTMA 3VXUB 4DN3L 3BCDA 3ZKSD 3LV3A 3UERA 3ZZQA 5IVZA 4GUCA 5FOJA 3DX3A 1RZKH 4JFFD 4X6CE 5FDYA 1H15B 2O93L 4NB7A 3FUNA 3TOPA 3S34L 1PL3A 3VFUB 1WGVA 4AKQA 4N2DA 4RMBA 1FO0B 1AZUA 1G7HB 2EACA 1IC4L 1KEML 4OIIL 4PJIF 1JCKA 5HJ3B 2F8XC 1QW9A 1LO3L 4MLSA 2X0WA 2ZXEB 4HJJH 1MSPA 3ZPDA 2DIEA 3UC0H 5JHMA 5FS5A 2BVOA 3RU8H 3I02A 4I77L 2J1YA 4NZUH 4JFQA 1PY9A 2VXVL 2XZAL 2KI6A 5TQ2H 1BBDH 4AL8L 1FFRA 4JPKH 1MH5A 1YC7A 2ATPA 4PRPB 1S7SB 1MAML 1Q9OA 1EAOA 1EJOL 2Y7SA 4OUUB 5D5MF 3MJWA 5IB3B 1C5CH 4EI5D 4GNKB 5JW4N 1S7UA 3VSQA 4EOWH 3FO0L 3UBXG 4CUCA 2LV4A 1H3XA 1KLGA 3GEWB 3WXVL 4G1EA 4KZDL 1J9CT 4QRTB 1KUMA 1XGRA 2QQKH 2H6UA 3G6JA 3AB0C 4L8DB 5AAPA 4JHWL 3P9LA 4G6KH 2ENQA 4YX2H 5KAQG 5J6GB 3DX4A 2F54B 2WOYA 1JHLL 2CO7A 2L4OA 2YLKA 3IMTA 4FG2A 4N8UA 4U6XA 1WWAX 3T9WA 4ZQTA 2FB4L 5E4AA 4K8RH 4LKCB 2QKIA 5CKAA 5ISZE 1MFEL 4M7JH 1OGAB 4NC2B 5FOBA 3DRTA 4UOQA 3MBXH 3TVMD 4TKWA 4X2UA 3BMWA 4AITA 4GIAA 3MRFA 3MYZA 3ESVF 2QJDA 3C6LD 2JQAA 4UB0H 3UTPD 4ZTPH 3K6SA 3UZVB 3Q05A 2GHWB 3GKZA 1I75A 2K8QA 3HN5A 2BP0B 2X7LB 2CCLA 4TUUA 3SGDH 1L4IA 1MHHA 2D4DA 2GBAA 3HN3A 5F9JB 5CILH 1CQKA 4TNVK 3MI6A 1HHIA 1FCCA 5C08E 4OJFH 3MKKA 2WVUA 4XXDA 3U7WL 2IEPA 4LLDB 5T1DH 4NC0B 4WSJA 4MMYB 4MSWA 4F15C 1VCBC 3J7HA 3KGUA 3MNZA 2VMCA 4HWBL 3GFUA 1HWGB 2XQ0A 2YRLA 3I3BA 1NFDF 3AU0A 4I0PC 3US0A 3VXNA 2BHYA 4QRRB 1T5XA 3CSYA 3RNKA 3BRFA 4Y4KD 2ZCLL 2KQNA 2ZCZA 5CSGA 2BZ7A 3VQ1C 2QV4A 5C09B 4JFEA 1UB5B 4UTAA 5BJTB 5KVGL 4Q0XH 3CD4A 2JJTC 4KQ3H 1IEBA 2UZXA 4N0FA 4JLRB 1F3JA 5I8CB 3JWDH 1UEMA 4HC1A 4KKRA 1UA3A 3R19A 4M29A 3SB3A 3J07A 3NYKA 5I1KH 5F7BA 4XMWA 5FHAL 3SKNA 1NBYB 4M00A 3DX6B 1I7TA 3NJMA 3PYCA 4NZ8A 5E5MA 5AVRB 5LWYL 1CLZL 3L6FA 5IEHB 2CUHA 4Y5XA 3T2PA 2JKJA 1MJ8H 4MRBA 1YN7B 2PYEE 2Y6TE 4O00A 3CMOL 3NIFE 3D69A 1X5ZA 1F5WA 4Z7AA 3U0PA 4NN5B 3CUPB 2BOCB 2WXPA 2FO1A 5EU5A 1AXSA 1UXWB 2EDLA 1M6OB 2CALA 3GMLB 5C07B 4EI5C 1MN4A 3PG2A 3A6OA 3PNRB 5FO7B 3LS5L 1OLLA 3L45A 5T1MA 4BH7A 3SGJC 2CJUH 2DQUH 3KYOA 4HIPA 4BXSV 1KTJA 3GQFA 4B7LA 1JFQH 2Z91A 5F3BB 2NSMA 4HGWA 4L4TB 1S46A 1UUSA 5K93A 5KOMC 1N19A 1HHKB 4XMLH 4MA3A 3NK3A 3VFVA 4XCCH 2MH4A 1YN6B 4H0HB 2ORBL 4UT9H 1FJ1A 5JQ6L 3NEEA 5SWSA 1ZWIB 2WV3A 1TZHA 3CN1A 1RJYB 3HB3D 2NY3C 4M1CD 4LARH 4NBXB 3TVMC 4NKQB 1TQBB 1FNSH 5D96B 2AV1A 3ILPA 4L1DA 3SGDI 5EULV 4FJYA 5MENE 3QORC 4FFYA 3I6GA 5DC2A 3KPQA 3AMLA 3OGOE 3NCXA 1HHGB 1E65A 1HCVA 3C6LC 1JK9B 2F7IA 4MXWH 3ZIMA 5CNHA 4QJ5B 3QUKB 5E8PA 4M62L 3DTXB 3EFDH 3ROOA 1O6TA 1RUAH 1YEGL 3SJVD 2ADYA 1A6AA 3OQ3B 4ZX6A 2GAZB 4AGNA 1AZZC 1LD9A 3GBEA 2AV7B 4QI3A 4A55A 4EN3A 4WTZG 2BP3A 2X4PA 3VMOA 4N3UA 5B39A 4R4BB 2DIBA 2GITB 2AJVL 2ITCA 5G5DA 1P4IH 1ZGLA 1BYNA 1JNHB 1MHCB 2WWOA 1KGCE 3GSNL 3L1OL 3TBYB 3LEYL 1ORQB 4B3EA 2B3RA 3MV9D 4L9LC 5EBWA 3FQRB 2VDMB 4MNQB 4OLWL 4DETA 5E6SB 2MCPH 3FSAA 4Y4KC 4NO0A 5J0BA 2J6EH 3FO9A 4IRSD 4ZUSB 3GLDA 3GRBA 3H42L 5D70H 5C6WH 1OF0A 3MBED 1PZDA 3C09C 4GSXA 5DXWA 2NSQA 2DL2A 1I8KB 4P04A 5I74B 3CX2A 1F86A 2BSED 2DLTA 5DDHA 1PZ5A 4LIQE 3KPPB 1JZ4A 3OZKA 5JW3L 1NGXB 3KLAB 2W1NA 3NTCH 3DC0A 5AW6B 3WS3A 5IHZB 2LU3A 4MB1A 2XUWA 1WUNT 3H0TB 1U2HA 1QKZL 2XXGA 3OX8B 1QVOB 3DMMB 2PCYA 3STZA 3VG9C 3H9HB 3CH8A 1VENA 4W9CC 2WLMA 2YFOA 1EMTL 2V7HB 4FNUA 2QADB 5B21A 3B9VA 5D7HA 4M4RB 5JO5A 4HPOH 4LLUA 1ZS2A 2M26A 3P4MA 5IVXF 5D7IB 1E5ZA 1VGKA 4BFEA 1PW3A 1U8OB 1UACL 2BC4B 2XX0A 3BDXA 5HPMA 2FUTA 4V1DE 5E7FA 1XF3B 5KEZA 1R17A 2VW4A 3KW8A 5HJBA 4AYFB 4YQXL 1U8PB 5EEVA 1JTOA 3M88A 2X4UB 43CAA 4G2AA 4Q9BA 1OCRB 4PJIE 5CR8A 2H3NA 5KBPA 1B4JH 4WV1A 3QZWG 1V7NL 3T0XA 3ZTNL 4G1MB 5F8QC 4O5LH 1WEJH 2LLNA 2WN2A 3QJQB 4JFTA 2B4CC 3HB3C 4DF9A 2QZQA 4M1CC 5DJXB 5GGUA 2KDGA 5FB8A 4OQTH 2CCWA 3N5AA 1AJ7L 3MUY1 5D5ME 2OL3L 2IALA 5EUOA 3QRGH 2RA1A 3RZCD 2WCPA 4Z7WA 2HB0A 3IFPA 4B95C 4PJ9B 2A3TA 4ODWB 1UXSA 3E2HB 4JO5A 4NZTL 3QH3B 1XR9B 1ES0A 1J1PL 1DJHA 3HHSA 3K6FA 1YC8A 1T7YA 1MKFA 5FIEA 2OCJA 4WFGE 4GKNB 3UG5A 5FYKD 4JM2D 1X9UA 2VZVA 4FXTA 5IOKA 4MRCA 3TCLB 2OSYA 4HCIA 3ZLQC 4HS3A 3KLHC 4BQBA 2WO4A 4YOKA 2H1PL 1U0QA 4O4YL 4X6DE 4OZIB 3F5WB 5FYJE 1MFNA 3O9WB 2D9QB 4ODHH 4HETA 2OK0L 1PJ9A 2W94A 4QY8A 2QGCA 5L9DH 4JMXA 3W0WE 4XXCC 2NY1B 1NGPH 4G8GE 3HI6L 3ZTEA 4FA8A 4ILDA 1YYML 3GI8L 1KEGH 1PJWA 4JCMA 4X5XA 3MXVL 1SY6A 4GKZB 3QIBD 4N2MA 4GG6F 1XH2A 3HI5L 3K7UA 1A4BA 4OZGF 5BQDA 4XVTH 1N59A 1S9YA 3BVTA 4X9BA 1KTDA 1BIIA 1XF1A 3CDGB 3MLPA 2MEJB 1L5GB 4UV7L 5EC1A 5TFSH 3DIDA 4HUVA 3VFMB 4P4KD 3KL0A 2DWXA 1B2WH 5DHVA 4DQOH 3IFOA 5GGTL 5DS8B 3X1BA 4NO2A 4F57H 3RWHA 1TVBA 4XBPB 3F7RA 4HUXA 1B4LA 3FSZA 4G9FD 4UQ3A 3DJ9A 4OCMC 2EDFA 4YEFA 3CN4A 4XVOA 4OV5B 3APDA 3QJFA 4LL1A 4JQIL 1MNUL 4Y2LA 5CO1A 3MLYL 2H32A 4XMVA 5DWUL 5AQ0A 5DK3A 2I27N 2R56L 5LAXA 4QPEA 2CO2A 2JNZA 2CUIA 4APXB 3QCTH 4JFDD 4M7ZB 1AKJB 2Q0ZX 1MWOA 4WFFD 2CHWA 1NDMB 1XFPA 2UX6A 3R8QA 4B9PA 3OAZK 3HNSH 3KHQA 2FEEL 4Z78B 5CR1A 1YUHB 4WW2A 2EE6A 3QO1A 4GW5A 4NNXB 4QXTA 1MF2H 5B38B 5IMLA 4AIOA 4I4WA 1EWHA 3BFOA 4OR1A 2OQJA 3BP7B 1H5BB 2BOLA 4MHHG 4P5SA 3ZT5A 4APQA 1BQ5A 5I1IH 3LH9A 3LS4L 2OX5B 3RURA 5JLZA 3KEHA 4YBHA 2OR7A 5IW1A 1KC5L 4LIQL 2DD8L 3TA3A 3TASA 2VM3A 5F7EL 4E41B 3WN6A 3EF7A 4IKIA 1FDLH 4XODA 2APWA 1SOKA 2WXLA 3A47A 3L08A 1G6VK 2IH3B 5EC2A 2EVJA 4LCYA 3RI5K 4Q58C 2F08A 3AAZB 4K71C 1BFTA 3RZCC 4P2RE 2XX1A 5EZLB 1XXFC 3L7EB 4HJGA 3WS6A 2FO8A 5FDWA 3B5GA 2A9NH 3UJIL 2GTQA 3A24A 3W82A 4UUJA 1GJIA 2L7UA 4N3TA 2E27L 4G3YL 4YSTA 3CQQA 3HS0B 2Q7YB 1IC7L 3HVNA 5I71C 4WI0B 2DICA 1VGEH 4J23A 4JM2C 2CDFA 4LKXA 1HHJA 4G59C 5H37H 3ZTJH 2GUOA 3KCPB 4UQ9A 1QYGH 5TH2B 3ZE0E 4B41A 1KSRA 4K2UH 2NY2B 2LW3A 4HDIA 3WOVA 3O6FB 4HCFA 3BD3A 3W9EA 4DNLA 1HHHB 1U3HA 3MRNA 4FQXA 5T8IA 5EDXA 5T33L 2WTOA 3OWEA 1YCSA 4Z7VB 3L4VA 2C3VA 3SBRA 5EA0L 2BZDA 3UTSD 3O11A 1IKFL 3NAAL 1RIHL 2J4WL 1CFQB 3GMQA 3SO3C 4RIRA 3PWJA 1B0IA 2XIBA 3AMKA 3DGGB 5JHDA 4OCSH 5FK9A 5HYFA 3QIBC 1NKOA 2XSKA 1VADA 2BWQA 5EU4B 3MBWB 4Z5RA 3CH1B 4GS7B 4S0HA 1O5PA 3SDAA 4JO2L 4PJFA 4CU6A 4GSDL 1GSKA 3OKDB 5KW9H 4P4KC 4JUTA 1QW8A 3P0VL 4Z0XA 4AQEA 1QFWM 4FEMA 2XV2A 5JOFA 1HSBB 4MX7A 1SJEA 3BH9B 4PW3A 3RL1A 3S36H 3SDDC 4FFZA 2Q76A 3UYPB 3BJ91 3K5RA 3TM6A 4EZMA 2ZXWB 3GBML 3Q2WA 3AWFA 5TF1L 4E9QA 3MFFB 4YS4A 1LGVA 3QE5A 2WPGA 3D3VB 3WMPA 2AI0L 4NQSA 4P49A 3HAEG 1ITBB 3BP5B 4XNYL 5FYJL 5B1KA 4AQ1B 4DZBA 1A22B 1UQSB 3VE0A 4U1GC 3WJLA 3P2BA 3GO1H 4X7TB 3VFRA 3GPSA 5D8JL 1D6EB 1NPUA 1REIA 1D5MB 3BVVA 4BKSC 3Q8AA 5I17B 1P2CA 2CK2A 2XIDA 2B0SH 5ESAB 4F33B 2EVIA 1EAPA 1JPTL 4HU2A 3K2UL 3DGDA 4HULB 4JNXA 3EJYD 3MRMA 1I7ZB 3GSRA 1E5AA 4DKEL 5DC0A 4ZUTA 3WE6B 2WIMA 5L4MA 1DL7L 2FX9H 5FM8A 1UD2A 3NJLA 3KGTA 4DERA 1NMBH 3KPOB 5I8KL 4M8VA 2YUXA 5E08H 4K3DL 2GSIA 5ESQB 2QQLL 2VQUA 4D0CB 4P57B 4PG2A 1E9QA 3CWGA 1ERNA 5I1LB 3NJFA 4UT7H 5IVXE 4LCUA 2YA0A 4YEEA 5C7XL 1FA4A 3UAEA 2B08A 3LKQA 3N42B 3VFSA 2VLRA 3WELA 4Y4HA 1NWOA 2G3XA 3B7TA 1SDDA 4I5BA 2WZPD 3ZMEA 2Z8RA 3MRRB 4HV8A 4WKZA 1A0QH 4ORZC 1BM3L 43C9A 5EOQL 4XO8A 1RK7A 5F71A 1DZBA 2OCCB 3V0DA 5CD3B 2B77A 4PJEB 5E7BA 3B3IB 1IAOB 5DUML 4L8CB 1TJMA 1AGCA 4QXUL 4KY2A 3WHE1 4PMEA 3WN5B 1D6VH 1NUFA 4XE5B 3QEHA 1A1MA 5D7LE 3POHA 1GKEA 3TZVA 1TQSA 3F7YB 3KWTA 5DK0A 1U42A 4JPVH 5IIEB 2MMXA 2X4TB 2DMGA 5BRPA 4IQHA 5ACLA 4MMXB 1OARH 4R7XA 1KBKA 3SOTA 3EYFB 4PJBE 3RUGB 1E5CA 4MJ5A 4YHZH 3CFKB 3GJEB 1ONQA 3T4AB 4DVRH 3KJ4B 4FABL 5DCCA 5E6RB 4WWKD 5KSAA 5J7CC 4XP1L 2VLJE 3MV7A 1GZQB 1OK0A 5F7KC 1PKQA 3VMPA 4D7PA 4L0PB 4CKQA 4DGVL 1LMIA 3RWFB 1UH3A 3T5WA 5B1CA 3Q9PA 1U8LA 3LMJH 4WNQA 1DHKA 2W80C 2ATAA 1CLOH 1NBCA 3F3HA 3FCTB 3MOBL 4M6ML 4NQED 1MWAB 1EDHA 4FQ2H 3SDXF 3DVIA 3N50A 4HQQL 3L1FA 1QPXA 3QA3A 4PY8J 3QXWA 4E5XB 3NN8B 1DEEB 2HJFB 4KHTH 2H0EA 4G8FB 3LPGA 1QSFE 1NOLA 4P46A 5JR1L 3EFOA 3GSVA 2VXSH 2FT6A 4B9JA 1Q0YH 1UTDA 3O45A 2D0FA 1A4KB 4GG6E 3POCA 4OZGE 2WP3O 2CLVB 3T65A 2X4OB 4D0DA 2WBWB 4F5CA 1MRCH 1A21A 2XG5A 2I9LA 1SBSL 4IGBB 3HJ0A 3U9PL 2BJML 2ZCHH 4YXLH 4LSTH 1W8NA 3EJYC 4OZHA 4JFZL 2XTJB 3KBEA 4A7GA 1J7VR 5KWYC 4GYBA 1U93A 5LBSA 1A1OA 4X83A 4F80A 3B2UD 3CZGA 3AXIA 2DYSB 1S7QB 1X3DA 1QP1A 3O2WH 5E94B 3CN2A 1COBA 2Y5EA 4KVCH 5IFJB 3EGSA 1IGML 1BVLB 3VD5A 1WBXA 3MGTA 1BIHA 3X1FA 4HA1A 5H94A 1DJYA 1FL3A 2D7NA 4GH7B 4WI4A 4PHXA 1JV2A 3VDBA 4ZAKB 3HKZA 1R3IL 2OSWA 1AQKL 1HI6A 1DEDA 2A6JB 2WC7A 2WLIA 1ZLEA 3CXDL 1QPKA 4GQ9H 4PRID 3U7YH 1NDTA 4ZTEA 2MCMA 5LNDA 2B2XL 1RULH 2ED6A 4ALAL 4K07A 4BM7A 1IM3B 4ZNCD 4IDJL 4PGCB 1CMOA 5FA3A 3WDHA 3WKQA 5ABZA 1CBVH 1HWWA 2HFEB 3DYPA 3B1UA 1PF3A 5F7FA 4KUCF 1ZTXE 3JVGA 4HU8A 4S10A 4KROB 3OMNB 3EH3B 2NR6A 4Z9KB 1J1XL 3FB8B 4TNGA 5FKPA 4ANUA 2FLMA 1Z1WA 1OP5K 4XGZB 3IDMB 3UCRA 3WD5H 1S5HA 3TS8A 1ZANL 5I8EB 3LN4B 3G04A 3ZTDC 4NQDD 1TJXA 3ARFD 4LESA 4P59H 4QYAA 1LE9A 5HD8C 1C08A 3RKPA 1MIEH 4L1TA 3JUYA 1NWPA 4KMTH 1BLIA 1PGRB 4LASL 3R7RA 3RHWK 3QQ9D 2PYFA 4FFVD 4K3EL 5EWIL 2EEXA 2G60L 5HDWA 2CKBB 3VTTA 2N1KA 4RGMC 3QUHA 4M9OA 3NRPA 4HISA 5DD1H 2CO6B 4ZDHA 1B0WA 2ZXQA 4O02B 3VFNB 5I75B 1FYTE 5DS1A 5BV7L 2W0LA 4UM9A 3C60D 3AADB 3N6YA 3BH4A 2CCVA 4ODXA 4TTGA 5IMMA 2QLVB 4QLRA 3VGDA 2PLTA 4AYSA 3LD8C 1R5IB 1WIUA 1FGVH 2VIRA 3NA4A 1XCTA 5CJXA 1MCQA 5IFAH 3TF4A 2TSBA 4NQCA 4KTEH 4LO9A 1CS6A 3BX7C 3SDCB 3DBXA 3IMBA 1A66A 4UIKL 5JXAL 4XCYB 3PNWA 1OLZA 5BS0B 2WKOA 1F3RB 3BEVA 3CVHA 3G08B 3M8OL 3TJEH 3VXRA 4IBVA 4R4NC 3NPSC 1MG3C 4ZMPA 1A8JH 5JHBA 3L95B 3EO1A 4ABWA 2VH5L 1JWMB 3VXQA 3L16A 5D1QD 4CVXB 4RFEB 4G7QB 4F58L 3GHPA 1SM3L 1XBDA 1FZKA 1TU2B 2XACC 4NRZB 4D0BB 4X6FA 4GRMB 2V5YA 2P5WA 1H3VA 2A73A 1XIWC 1RURH 1QBMH 3Q5YA 1KGXA 1W8OA 4F1ZA 1C9SA 4X4ME 3B2UC 2ZF8A 3V5DA 3FOMB 3L3HB 5JXEA 4JJ5A 2VR8A 4OJCA 1ET5A 1VFMA 1Z0MA 3G5XB 3TBTB 4DPAX 2NY6D 2APVA 1NMCC 1T20A 5DRZB 2H2PC 4RFOL 1ZK9A 2EH8L 4M02A 3LSOB 1D5BA 4MJ4A 2YXVA 3LZLA 5EU6B 5I19L 5DA0B 4ZUVA 3WTVA 4HUWA 2FIRT 1BD2E 3VH8A 1LO2L 2NY4D 3QIUD 5FYJU 5GXBB 3BT2H 4BBWA 3NEOA 4Y1AB 3VSVA 3QDMB 4ELMB 2GJ6E 2E4TA 3EJZD 3E6HB 3L3OA 4HWEL 4LHJB 4WI5A 2IPTL 5D7SH 3S5YA 1M9WA 4P9HH 1IQDA 2DIJA 1CF8L 3QUYD 3RTQD 3ZBMA 1YQVH 4XAWL 2ESVD 1UUNA 5HHMD 3U83A 3QEQD 1D5RA 1IV8A 1UM4H 4NERA 1QFWL 1VIWA 3NSJA 3ETTA 4KZEL 9CGTA 5FFOA 1ZT7B 4DT2A 5CEZH 4YNYA 3ZGHA 3WHE0 5JW4M 3ARFC 3X11A 2R2BA 3L5JA 2K78A 4I18A 5EORL 2AFNA 1CYXA 4JKLA 1VPOH 3QQ9C 4FFVC 5C0CE 5D4QA 5AW4B 3FSWA 1KPRA 5IHUH 4GG8B 1NCAH 5D2NE 3HUJB 4XNMB 2AJYH 1ZKAA 4S11A 4LCWD 3SEPA 1J10A 2R0ZL 3CZLA 3H55A 4DO4A 5FCSH 1R5VB 4IK7A 3V8CA 5KSBB 5CEXB 2OMZA 2ZT9C 3AREA 4N6RB 4RFNB 1R47A 1D7CA 1TMQA 2QHRH 1J0IA 4QHNA 3ARZA 3K4DA 4RDQG 1K8DB 4LHUA 5LBSH 4ORGB 1Y0LB 1OW0A 2A9MH 3BLPX 2P5PA 1PZSA 1E2VA 2CIKB 4UF7C 2CJTA 4ISVB 4RISL 1I3GL 3H9SD 1U8HB 2R51A 4R96B 4A6YA 5CGTA 4GUPB 1XTMA 3O41B 4XOBA 4WEUD 1JGVH 4AVHA 3VYPA 2OMTA 3ZDXB 2GEQA 1MAKA 5D1QC 3NRFA 2OXHB 1QRNA 2QVKA 2BIOA 4W6WB 2Z4QB 4HIQA 5CHNB 1F00I 3K1KC 4PP2A 4NKOB 3RPIA 5GS0D 1JZHA 1PZCA 4JRYA 4OT1H 4OCYH 1BA9A 1IBFA 1RJLB 3OR7A 5E2TL 4PY7B 1RZIB 4UM8B 3VGFA 3VRIB 1CFBA 1DBKH 1GIGH 4YDLC 3ARRA 4KY1L 5HYJA 4M1DH 3SDXE 4CGUB 2IADA 4Y2DA 4A38A 4A7VA 4HF5H 3JV0A 4FTVB 2QPEB 4XVSH 4PJCF 4PJDF 5FYKL 3ZQWA 1FNAA 1VFUA 2NY6C 3OLIA 5I1JL 3U4EA 3WY1A 1UEYA 1EEYA 3LIZH 2PXYB 5FUOH 1CD1A 1WA1X 1ZLVK 3OTTA 4O58H 1XB6A 2X41A 4WUUA 1PQZB 4YDZA 1HXYB 2NY4C 3QIUC 5C0RL 4MKMA 4F7PB 1E2WA 4GRLD 4M56A 3ZX1A 1K2DA 2WQRA 3HC0A 4ICWA 4MBOA 2WXHA 4ETQA 3EJTA 1WAAA 1HH9A 5D4HA 3QUYC 3RTQC 5CGYD 4AIXA 2X70B 3EDJA 3RA7H 3TWYA 1GOHA 1Y6NR 5DWPA 5I30L 2FQEA 5JIDA 1IMHC 3DO7B 3QCUL 5TQ0H 4PH8A 4R5XA 4HFUH 4W9JC 2XN0A 1HE8A 4P2QA 1XV8A 3QO0B 3KPNB 2VR5A 1K3IA 1MXGA 3Q06A 3DARA 1BGXL 2VN5A 3CVHH 4XCNA 5TK2A 3V9EA 2HWZH 2XWRA 4EPSA 2ZSVA 5LDSA 3FO1B 4LQ1A 4ONFH 2V0AA 3JWNG 2Q6WA 1HJBC 4UT6A 1HCYA 5TE6H 2EE2A 2VABA 3NFSL 3AWEA 4MDJB 4JAMA 4QRPD 1M57B 3H7BA 4KJWD 4FYTA 1L6XA 3D4CA 5F88B 3BD5A 4NM8L 1MCSA 2DJSA 3IETA 1XSKA 4JPWH 4PRAB 3AACA 5HHPA 2C3HA 4WI9A 3VDAA 5E70A 2B3IA 4QXVA 4WFHD 1AY1H 4YXHH 1I7UA 4LSRL 4FNLL 5T1KA 4P2YA 4X8CA 4XBEH 5IR1A 5DUBB 4M7LH 1FFNB 3LN9A 5JTWA 3ARBD 3ESNA 4KH2A 1KB5L 4Q89A 3KCWA 1AACA 1DLFH 3CFMA 4RGNB 3HMWL 1ORSB 1U9KA 4DGYH 4ERSH 3UZQA 4N8CL 1MHEB 1MWAH 3I9GH 4JZJC 4MBRA 3UTTE 4LU5L 2Q3ZA 1H8SA 2J72A 2C3GA 1BYOA 4N25A 4OF5A 4POUB 5DMYA 5I8OL 5GS0C 1VEOA 1R33A 3RNQA 3C8HA 3IDYC 1Y6MR 3UPRA 3A4FA 1WWWX 3IDNB 1WV7T 1CFVL 3WKNA 2X6VA 2X42A 2XOTA 1JNJA 1FF5A 1BZ9B 2N59A 4JQVA 4MJID 1TF4A 2DDQL 5IBUB 3PQYB 5AZ2L 5J11C 2F7PA 3V4VL 2VT0A 4EBQL 3ML9A 1OANA 3DI3B 3NACH 1BG9A 1JV5B 2AK4D 1NCHA 3NEXA 4OF0A 1SJVA 2VWEC 5LN4A 3IFNL 3EH4B 3LVEA 4P2AA 4QLWA 1YO4A 1MNNA 2J1WA 1G9HA 5FV2A 4PJ8A 1TPXB 1ZLSH 1DQDH 5SWQB 1HZLA 5KYWA 2NX5A 1MVYA 2BS9A 4AGPA 4FN0A 4JKPL 2EDHA 2CR3A 3ULVH 3WTSA 1QSEA 2OTWA 1AO7A 3QJHB 3OSVA 5GS1B 3ECBB 4TV3A 2CHNA 4ZMXA 4D8PB 2CRZA 4R83A 2FSEB 3HC3H 2OI9C 2OL3B 5JUEH 1BFOA 4FXLA 3MOQA 5C0FA 1XGZA 2PYEB 2XY2A 4OKVA 1A6TA 5FGCB 3SE4A 4H1LA 4ZG1A 3VXTA 1X6NA 4OM0L 5DRXB 4AZ8A 1NC2B 2IAMD 2AZUA 5H2BA 4F3FA 1E6JH 3L7FA 4PRNA 2EP6A 3JSSA 3D34A 4NAMA 3R8BB 5I9QC 3NCWA 1FH2A 3KDMA 5FFLA 1U36A 5FA4B 4Z7OB 5KSUB 3G5VA 1JF1B 3FRUB 3HPJA 4ACPA 1XGQA 5MI0C 5EN3A 1QO3A 1QSVA 4H26B 4R2GD 3BAWA 4RNRB 4U1NA 1U8NA 4HJEA 1RZJH 4ZFGL 1UZ8B 15C8L 2DV6A 1IBHA 4LDCA 3FUEA 1E7VA 4KJWC 1CE1L 1CGSH 4BQCA 3VI3B 5EN2B 3JV4A 4C56B 5AVQB 4IBZA 3U36A 3WLWC 4MD0B 3CU1A 1I1YA 1ADQH 4FF9A 1KCUH 4QAWA 3G6DL 3MV8B 3W57A 2XXCB 2YD9A 4QD2E 3ARGA 4GBXB 3G5YB 4EN2A 2F58L 2OJZH 2X44D 4H7VA 4UNVA 1N6QL 1G5GA 3IDXH 1J9SA 3H1ZA 4AM0A 2WSPA 3QZWB 4LE8A 4L1BA 1UENA 3O4OC 5A7BA 1JK8A 4GSRA 5EUKB 1OOWA 1KN4H 4DN3H 1HZKA 4HBCL 3MYJA 1DFBH 1F18A 5D1ZB 2WXRA 1N64L 1DDHA 5DQ9B 5B4MD 4XC1L 1N2RB 4WJKB 4XO9A 5IV2B 1ASPA 2BK8A 2PP8A 3OKLA 4UI2A 5LBGA 3QNZB 4L3CB 2BMKA 3ARTA 2Q3XA 1IC4H 1KEMH 2H6PB 4OIIH 1Z9LA 2J6WA 3FQWA 2NQDA 5SWZE 2AJSL 3NZHL 5CSZB 1AHWB 1KLFB 1LO3H 1OCCB 4ZW3A 2JI3A 1CFNB 1G7IB 4I77H 2VXVH 2XZAH 4LB8A 4PJ7B 4GOSA 1TOXA 5ISZA 2Y2YA 4XHQA 2P80D 4AL8H 1BWWA 4DKAA 1A7OL 4M03A 3I6LE 3STLA 2JKLA 2WBJD 4N0UB 2NXYD 3QIWA 3PWLB 4NQVB 4JFHD 3LDBB 3FO0H 2D9CA 1RZ8B 5GIRB 3REWB 3A21A 1T0NB 4F24A 5DQJB 4L4VB 6PCYA 4KZDH 3JUZA 2V2WB 4WK0B 5F70A 1M7IA 1XO8A 1ND0B 3QUXA 5FCUL 1L0QA 4JHWH 4ZS6D 3TV3H 2VDQL 3PAVA 5B1JC 5HY9B 1JHLH 3CXFA 4L8SA 2FB4H 4DPBX 1Z5LB 5LUMA 4PJDE 1FSKB 1MFEH 2IAMC 5GRUL 4XNZC 5IB2A 3R7QA 1OGTA 1E2ZA 1HQ4A 2EDTA 3ESPA 2CBOA 2QMJA 3OJVC 4IBSA 2X09A 5DC9B 3L4CA 1I4FA 5F1OB 4TUJB 5JA9A 1MXDA 1CURA 4M6NL 1GTFA 4R2GC 5GS3A 4PJIB 4GY4A 5E0QA 1F45A 4QR7A 3B5HA 5JQHC 1F13A 4S1RH 3WJMA 4G83A 2F5BH 4S1QH 12E8L 1HEZA 4U1LB 3IS1X 2F5AL 2BXYA 3VXSA 1TITA 3U7WH 2VSMB 2Z7ZA 4Z3TA 2XXFA 2YXMA 1P53A 1A9BB 1IM9B 4YHKH 1OSPL 2NY5C 4NAJA 3BI9X 1J8HD 5HYSG 2IDCA 4KX7A 2EDKA 2Q86A 3ROLB 4OFYD 4FLSA 4UQBA 2E6PA 3AQDA 2J5WA 1EHAA 1QR4A 4L29B 4NPYB 2BY3A 2KPNA 4FC3E 4NX0A 2DBJA 5EBLB 2ZCLH 1RVFL 2KLTA 3IU3B 3PABB 4JW3A 4LHQB 3BKCH 3OG4B 4HXAL 1S8DA 4AH2B 5IOPB 3MNWB 5L2KE 4E9TA 1R5WA 2X6UA 5JMOC 5KVGH 4I3RL 1KIPA 3FB5A 4NUGL 5C0IA 4GP4B 5CD5C 1DVUA 2O6FA 3AB0B 2NW3B 4OCRH 1XEDA 2FZ3A 1KIQB 4ONGL 1ODAA 1JDDA 4AIZB 4P9ML 5ADPL 2ENSA 1SJMA 4WTXA 4KC3B 5ALBL 2Z31A 3WI9A 2QLYA 4NSKA 5AD0A 5LWYH 3FQNA 4ZUWA 3D8MA 4G8GB 2YKLL 2W88A 3GS0A 2HVKB 4J3OH 4NNYB 4WK4B 2R0WL 5DD0L 1OAKL 3D9AL 2PW1A 3CMOH 2FUQA 3FSVA 4GQRA 3ALWA 2BP5M 3L9RB 2VN7A 1RZFL 2IPUK 4KXCA 4HPHA 2WBJC 5MENA 2ZYRA 3GNML 2NXYC 1JPGB 5HVGB 2DL9A 2PCFA 3V6FA 2AMUA 3LS5H 4Z95L 4L37B 1X44A 3OWRA 3MUGA 4BV1A 3LRLA 2IWGA 3AG2B 5ANME 5INDA 1JXDA 1XF4A 1G4MA 5ICYB 3OVUB 1UZ6F 3GXMA 1OO2A 1X4YA 1NFDB 4LCIL 2AJ3B 2MJWA 2MQ3A 4NIKB 3CV5A 5CBEB 3GSQA 5TE7L 1MELA 1X6LA 4FZ8L 5DZAA 2WXOA 4F15B 2ORBH 1A1NA 3K91A 4IU3A 4I88A 3MRIA 1TFHA 1PU0A 1FPTL 1S9XA 4I0PB 4PJ5E 4PTTB 3U1SH 4B5ZA 3MREB 5JOPE 3SCMC 1AP2A 1QUPA 2YK1L 3C8KB 5FGBC 3ZT6A 5F1IA 2BNUA 3CNKA 3G6AA 5AOJA 1ACYL 2BXZA 3P3YA 2K45A 2N7AA 4JDEB 4HLZG 4JFFB 3U1QA 2BIIA 4KK6C 4KQ4L 1H0DB 3FFCA 1EFXD 4R7LA 5INCB 4LL4A 3MMEA 4UTCA 2EUWA 2OZ4L 3N43B 3D39E 1YEGH 2Q2EB 4H8HA 1HH6B 4FLQA 4X4YA 3L4XA 4KI5D 3KPLB 3ZRFC 4AQAB 3V0EA 1GW6A 1OGPA 2WZ5A 4KK5D 3QUML 3B9AA 4ZD3L 2OYLA 3SGEH 4P5TD 2E9WA 4L9DA 3HG5A 5E1AB 3WEXB 2AJVH 3QBTB 4L3EA 3QDJD 3R4RA 1AGFA 3BZDA 5EZJA 3QQ3A 3CTTA 4P2RB 3GSNH 3MA7A 2P5EA 3RX7A 4MQ7B 4FCHA 2WLYA 2KBGA 2Y7QB 4OLWH 4KNQA 5D7JD 2A99A 3EYSL 4EI5B 4WI6A 5LO7A 4AUUA 4HJIA 3H42H 3T0ED 2IGFL 2OV0A 1X7QB 2HVJB 4AT6B 2ARWA 2EKJA 5FX3A 4JKWA 1F4WL 2EUZA 1DSFL 4FG0A 1U6AL 3I84A 4BQ6A 1YSOA 2UXVA 4JKKA 2YXWA 3VGAC 5IHWA 3U4KA 1S7XA 1P7QD 3C5JA 2ZF9A 1UB6B 1X4XA 1YEFL 4PV9A 5AWNL 3ZRCC 1YEIL 5F3FA 1QKZH 1MLBB 5JNYA 2I60L 1EFQA 3RIAK 4DUXA 3SE9H 3HNVH 2NY3B 1WAEA 3LXAA 3BMVA 3TVMB 2J2ZB 2Y7OA 4GMSL 1EMTH 3QORB 4UZGA 3P11L 4HKBA 5HDLA 1FZOA 1XVSA 1AZRA 2VDPB 3C6LB 3RY5A 4WQOA 3QJXA 3IM1A 1UWEL 1UACH 3HS8A 1T03L 1I53A 3CLEH 4XVUD 1GTNA 1CG9A 4C47A 1NC4D 1TVHB 4YQXH 4NRYB 3S8GB 4DP4X 5SV3A 3UJJL 3NH7L 2JTYA 2VRKA 1YECH 4W9FC 3HPLA 4YHML 4XN8A 2YPKA 4TVPD 1KN2H 1JHTB 1V7NH 3H6JA 3S5LG 3ZTNH 3FT2A 2XWXA 2R9HC 4P23A 2YD0A 2CLRA 1D5XB 3W2DL 4YFLF 3B83A 4L9LB 3NFPA 1I3RA 1NFIB 3V0VA 1PSKL 4X6DA 4N0YL 1MQ8A 4Y4KB 5J06A 1FO0A 1G7HA 1AJ7H 2MSPA 2C4XA 1WHPA 3IMVA 4KTDL 2OL3H 3MJGX 4GXVL 5DSCA 2WXIA 2KLSA 2AQ2A 4HXBL 5F7NC 3NCFB 3UPCA 1YPZF 3C09B 4OF8A 3ZUNC 4E2OA 5BXFA 3GUFA 3BGMB 3SGEI 3DDGA 2XBTA 4NZTH 4G8AC 2F7QA 3IB4A 1UD8A 3B3BA 4L05A 2AGJL 3PHOB 3CVIL 4KI5C 5TDNB 3TL5A 3B9KD 2Q2LA 4F7TB 4ZFFB 1S7SA 4KK5C 5CJ8A 1ASQA 4CW1B 4P5TC 3ABKB 2YD3A 4F8OA 5EEUA 2IVFC 1ETJA 4PUBL 3B43A 3VG9B 3LHAA 4KI5F 4O4YH 3FB6A 4YHNA 2OK0H 2X4RB 3IPBA 4O2EB 5D7JC 3CPUA 1S3RA 5C0DA 1R3JB 2BSSA 3HI6H 3N04A 3T0EC 5J6GA 2WINB 2F54A 4ANVA 2ZWNA 1I9IL 3GI8H 3KR3H 4V33A 4LKCA 2BVUA 3MXVH 5D2LA 3NJJA 2OW6A 4NEHB 1P5UC 1OGAA 3V7MA 1A64A 3HI5H 1LWHA 4OF3A 1R34A 5GRVL 3IFLL 1JF6A 3MO1B 2KPWA 4PRHA 2YEQA 3PHQB 3OKOA 2IFGA 3OKNB 4UV7H 2Y0SA 1WZAA 4YDVB 3VMNA 4OCNC 3WAKA 4HT1L 3BEWB 4YFDB 4IRZL 4AV4A 3MLSH 1UVQB 1E67A 3MLXH 4ABQA 2H2SD 3L81A 3HB3B 1KYOK 4KTYA 4NWTL 1N5YL 4G6ML 2GY5A 1FFPB 3J2PA 5MHSE 5CJOL 5FYLE 4L3AA 4HG4K 1CLYL 2VITA 5F9JA 4JQIH 5AW9B 3RKDD 2PTTB 2R29A 4ICXA 4AQZA 1QPPA 3MLYH 1J48A 2OMBA 2R56H 1TJGL 7FABH 1P7KA 1E5YA 3ZDZF 4DCQB 1DUYB 4O2FB 4OBRA 2JJUA 3EBAA 3O4LD 5AB1A 4UOZA 5IGXL 1JHKL 3GM0A 5E23A 5LN8A 1OD9A 4K8RD 4XVUC 4D9QE 1TSHA 3LN5A 1S7WB 4G5ZL 1AZNA 1AFVL 2KZWA 3R06A 4DVBB 3OPZH 1MI5D 4UTBL 5F89B 4QRRA 2V5SA 3EBIA 2WZ0A 3V52L 3K81A 1OOAA 3LS4H 1A6VH 4F9LC 3GIVA 4N1HB 1E0OB 2P8PA 2A7BA 4OY9A 3BIKA 2XQBL 1KC5H 4LIQH 5FPIA 5J1TC 3QFDB 2DKSA 1UB5A 5FR3A 5K59F 5F7EH 5FKAA 3U30C 4MA1C 3PS6A 5HHOD 4JLRA 1RHFA 3FU7B 4L23A 4NP4L 5I8CA 5KTEL 3IAGC 4RBPH 3UBFA 5I2IB 3KWVA 1G1OA 2WQXA 4OZ4B 2KZKA 3UJIH 2JKWA 5IEHA 1MEXL 1TQWA 4LLVB 3QPKA 4S2SB 2E7CA 4HEPG 1J0ZA 5C92A 1NCGA 2E27H 2VLKE 3KPRE 2BCKA 3MODL 4G3YH 4PY8I 1IC7H 5LCVL 1UZ6E 1J86A 5AAMC 5EEXA 1ZVSB 3B9KC 2EXWD 3MLTA 3PP3H 3S4SA 2MPAL 2NLJB 2ZYHA 1ZIAA 1AD9A 2HRPH 3CQPA 3CUPA 4X5PA 2DQGL 1KXTA 3IN2A 1C5BL 3GMLA 3WU1A 4G8EA 4B27A 1RZKC 1KULA 3U9UB 2E9IA 2QBWA 5T33H 3O3UN 2RJMA 2A38A 2J21A 1IEHA 1IKFH 1RIHH 2J4WH 3INUL 5C0AE 3OF6A 5ERWB 1TDQA 5CCHE 1ZT4B 4B0MM 6CGTA 1INQB 1Y18B 3FTSA 5GQBA 3FUMA 2MTAA 1G6RL 1LL1A 5A7EA 3IS0X 4TS6A 1ZSDB 2BIQA 5JZ7C 5ACZA 5IB5A 1BXAA 4JO2H 4JO3L 2YGOA 4GSDH 2AHIA 4PLOB 1AR1D 2Y3AA 4PJGE 3BQUD 4NZRL 3P0VH 1JK9A 4H8PA 4QXGL 5D4JA 3AWGA 5GGVL 2H2SC 4F7MA 4X7FC 5K9KA 3SGKC 3GBMH 4QT5B 5TF1H 2R2HA 3D51A 1EHLH 2A4EA 3RKDC 1E4HA 4F8NA 2P42B 2AV7A 5J9PA 2XZZA 1MUJB 4K71B 3RZCB 5M95B 4Y1TA 4R0LC 3MRHA 2CHZA 4UNTA 3AGWA 5FYJH 1EEUA 1RPUA 3VXME 5I66B 3VYNA 1HDMA 3MPCA 3QDGE 5EU3B 4K8RC 4PJHE 1HTYA 1JNHA 4F7CA 1NCIA 2ZUQB 4E42A 3FTGB 3TH3T 5ICZB 5I71B 1CK0L 2IJ0C 5I1AA 1RK0A 4JM2B 3K2UH 4MXQD 1BEXA 3GBDA 5KVEE 4DKEH 4HJUA 4MQSB 1DL7H 2R1WA 5KZCD 4HKZB 1B3IA 4Q6YA 3C5ZA 2YUWA 3DK2A 5I8KH 3KPSE 1KNOA 1I8KA 5D7LA 2LAAA 2K6YA 4XB8A 5FV1L 4EDXA 3EO9L 1OP9A 1YRKA 2AJUL 2QQLH 1RL1A 1LVEA 1VACB 2X9ZA 1NGXA 3ALPA 2Z9TA 3KLAA 2FYYA 3HZVA 2Y24A 3ME0A 3HMXA 3R0MA 1A4CA 4GW1B 3WFHA 3SO3B 2K3HA 3O8XA 5FYLL 2XKNA 5C7XH 1DFXA 5DJDA 2E46A 4PJBA 1QVOA 2IF7A 3SKUD 2ZAGA 3EBHA 3QIBB 3H9HA 2B1AL 1FLRH 1YMME 3Q13A 1BM3H 3DROB 3DOSB 5EOQH 2V7HA 5DVNA 1ZT1A 1KZQA 2CO1A 4P4KB 5DUMH 3MCG1 4GI9A 3RWCB 1T7XA 4PD4J 2AF2A 4LP8A 2HT2D 2J8UB 3SDDB 4G9FB 5DD5L 5EU7C 1F11B 1SOQA 1MDTA 1YMHA 4XAKE 3V95A 3UC2A 1U8PA 2ZX7A 1BVKA 4IMLA 2B1HL 2VXUL 4XNAA 3QNYA 4JZOB 2O6CA 2F61A 4X0KB 1W0YT 1QSZA 1U8CB 2GT9B 5KUMA 1X7SA 3SQRA 2DQMA 4JFDB 5T1LA 2MOGA 1KGIA 1YPZE 2F1EA 4U1GB 5E56A 4RX4D 3U1PA 3VX1A 4FABH 4ZMTA 4NUJB 5LBVA 4IDLA 3HLAB 5E2WL 1ZXKA 2WNKA 3EO0B 4YHOL 3LH8A 4D94A 4QRQB 4Z7UF 5IHBA 2FE0A 4PLJC 2Y25A 3UTPE 1AR1C 1AGBB 3KD4A 4FA7B 2XA8H 4WJ5B 1HSAA 1KB5B 1BJ1H 1XSOA 1E9PB 1R6VA 2JCCF 4ODWA 1HWHB 3S3SA 4M6MH 3MOBH 1EEZB 3QAQA 5F96L 3QH3A 2F19L 3PWPD 4HQQH 1EAQA 1OTUD 1KTLA 2VMDA 4BZ1L 4G6JH 1A5FL 4GKNA 4EVNA 2TRHA 2DRUA 4CJ1A 2J12B 1M6UA 1U91B 3WHXA 4OLVL 2G5UA 4WRLA 5JR1H 3B2MA 3RVWC 1K3ZA 1GHFL 4HSCX 5HHQB 4F1SA 2WMPB 3APMA 1W0VB 1M42A 3V4VB 1EGJL 3TNMA 3IGAB 2BJMH 1IAKB 1OV8A 2GSMB 3U9PH 1ASOA 3CGTA 3NIGE 1HEJC 4JFZH 2CRMA 3SYAA 4M43H 4RQQB 3ARXA 3LPPA 3T2QA 2UWEF 1R3HB 5J12C 4GKZA 2YSTA 4M3JA 4LLYB 1YZZA 2WWMD 1CR9L 2ADFH 1RERA 4Q97A 4U7KA 3VFTB 5EHFA 5G55A 3U46B 3WIFA 2ZXBA 1L5GA 5E4OA 4ZPVB 5DJ0B 1WCBB 4GO8A 3VNYA 2ICCA 2HPTA 1FNGB 1K5NA 2ADIB 4D9LL 1B6UA 4ZTOL 5DS8A 3GHEL 3S48A 5I0DA 3MHZA 1LYQA 3OZLA 1AQKH 4AGQA 2DM2A 1J11A 2AQNA 3CXDH 1U4FA 2WTPA 4RRPG 2W5PA 4ALAH 3SDXB 1OPOA 1T0MB 5HGHA 1HINL 3WUWG 3C6SA 4XP4L 4NC1E 4PRDB 2V5TA 2KT6A 1SVCP 4KKBD 1CO1A 2W07B 2HT2C 4X50A 3L5HA 1NDMA 2GI7A 3RL2B 1GGTA 3SQBB 5JPNC 4Z78A 1N5AB 1HU8A 2G9HB 1J1XH 2ITDA 1HKLL 1T4KA 4FQPA 4WKXA 3WLBB 5HYIA 5KVEL 5L6YL 4HJSA 3Q5TA 3RX9A 1GY1A 4NENA 1H5BA 1QLEH 1ZANH 3HZKA 5GGRY 3MRPA 4BXVA 4ZXBD 4ZQKB 3VXUD 1TQCC 2AQRA 4JPSA 3VAEA 2Y5TB 4MZ2A 5AYTA 1KIRA 5EWIH 4K3EH 2F1BA 1XAUA 1BZOA 4JKMA 2ZXGA 4MB5A 5TTRA 2QKIC 1NAKH 5FO8B 3G6JF 1OAUL 2ODHA 3IXTA 3T8VA 4TL4A 3K6OA 2IH3A 4BFGA 4N9GB 4PTUB 5BV7H 1U33A 2EC9T 3RVVC 4P3CH 3L7EA 1ZVHA 4TUKL 4Y4FD 3OB0H 3AQZA 1AQHA 1YNKL 4LPVA 1ZDSA 3BKML 4X4MA 2OMVA 1OTUC 5C3IA 4WF7A 1SYVB 3EDDA 1ETZB 3QJUB 4UIKH 2EYRA 3F6JA 3KHOA 1G7QA 4ZBJA 1TUPA 4FJZA 4PWEA 2A1WL 2VL5A 3M8OH 3KCPA 4E0RA 4PRPD 2CXKA 2VC2H 2H3KA 2VQ1B 4U1KB 3ZU8A 3MV9E 5ETUB 4CNIA 1VA9A 1FV1B 4CC0A 2VH5H 4XO4A 1HHHA 3VG0L 5DHMC 1A02N 4PLKC 1BZQK 3B6SA 3FQXB 2PPAA 4KKCC 1O6SB 3DKHA 1JMXA 1Q94B 1T2JA 4HALA 4YO0B 1OSYA 1R3KA 1SM3H 3MZGB 1LO5B 2GJ6A 3LKSB 1GOFA 4G7RB 3ES6A 4H88L 2C7UB 1J05B 5KVFE 4NO0D 3T6VA 3DIVA 3DGGA 1UWYA 3MCLH 1J9QA 4CVWA 1QUNB 3MJ9A 2C9VA 3MBWA 2AXGA 4IHOB 1EO7A 4JY6A 3WGVB 1ZHNB 3ECVA 3PDOA 5BUAA 2DWEA 2V9RA 1G7LB 1ZJAA 3HFFA 3MCKA 3RWDA 2XU9A 2DW5A 5G4OA 5ENWB 4UZUA 1R75A 2VZ1A 2R0KH 2EXSA 3KLKA 3O3EB 4EDWL 4H8QA 1CGXA 3RTLA 4BJLA 4B96A 1OQOA 3UYPA 5I19H 1HXMB 4GAGL 4RGMB 4DO5A 1ILSA 4Z3HA 1LO2H 1CVSC 1XCXA 3MFFA 4LVEA 4ZT1A 4Y5XC 1AHKA 5ADOL 1HL5A 4BK4A 2E75C 3DJTA 3CJJA 2JELL 4FHKA 1XAKA 1AG0A 1P9MC 3DXAA 2IPTH 2Z92A 5EO0B 4HWEH 3W37A 4LP4A 3BP5A 1FFOA 3KLQA 1CF8H 3CFEB 4NQEB 3VW3L 1A4AA 1OAJA 3LD8B 2DEXX 4I2XB 4XAWH 3NSYA 3ZY7A 3WAJA 2YXFA 1QBBA 4JG1L 1EPFA 1F41A 1QFWH 2YAEA 5ESAA 4KZEH 4F33A 3GBNL 1INEL 1I8MA 3HA0A 3BE1L 4XO3A 1I7ZA 3NPSB 1J0YA 2D7MA 3B2DC 4IOIB 3D2UD 4N0RA 1T2XA 3OAWA 5EORH 4HIIB 1UZGA 3OQRA 3PDGA 4GRWF 1T5KA 4RMRA 4AK1A 1QEWA 4QRUB 3WFDL 3WIHL 2EKSA 3SPIA 4KZ0A 4Y88A 3OKEB 1KPUB 5DHEA 3T04D 4D0CA 1IGIL 3MACL 5I1LA 3S3PA 2R0ZH 3OKMB 3RLSA 3TP4A 1XIWB 1IKOP 4Y4FC 1N3NA 3TO4A 2OR8A 2VLLB 5EOCJ 3VXOB 1CU4H 3LNGA 4OI7A 4WGWB 4UQ2A 1XZ0A 1UH2A 5A2JH 4H25A 2BY2A 4KK8D 4OFIA 3FQ4A 4PJEA 3B3IA 1IAOA 1I3GH 4BELD 1NMCB 1QLFA 3GK8L 4Z18A 4L8CA 2H4EA