2OXOA

Crystallization and structure determination of the core-binding domain of bacteriophage lambda integrase
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
93
structure length
93
Chain Sequence
MTLHSWLDRYEKILASRGIKQKTLINYMSKIKAIRRGLPDAPLEDITTKEIAAMLNGYIDEGKAASAKLIRSTLSDAFREAIAEGHITTNHVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallization and structure determination of the core-binding domain of bacteriophage lambda integrase.
pubmed doi rcsb
source organism Unidentified phage
molecule tags Dna binding protein
molecule keywords Integrase
total genus 36
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 2007-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02899 Phage_int_SAM_1 Phage integrase, N-terminal SAM-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.130 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2oxoA00
3LYSA 2KD1A 1Z1BA 2KJ8A 1PVRA 4A8EA 1XO0A 1Z19A 3MGVA 1Q3VA 1DRGA 2KJ5A 4CRXA 2KKVA 1NZBA 2KOBA 1PVPA 1F44A 2A3VA 5CRXA 2KHQA 2KHVA 2OXOA 3NRWA 2KJ9A 1Q3UA 2KIWA 3CRXA 2KEYA 2KKPA 1XNSA 1KBUA 1P7DA 2HOIA 1PVQA 1OUQA 1A0PA 3C28A 2HOFA 1MA7A 4ACOA 2CRXA 1CRXA 3C29A
chains in the Genus database with same CATH superfamily
4RQ2A 2Q0ZX 2XY5A 4CGZA 4NM1A 8ICSA 2FLPA 3PW7A 1WWVA 9ICCA 1Q3UA 2R18A 4O9MA 1N62A 1Z00A 2JEIA 1UT8A 3FM9A 7ICKA 2BCUA 5J2FA 4YCXA 2W9BB 4DLEA 3K75D 4RPYA 4C8NA 4JV2A 5J0PA 3PSFA 1N48A 1ZXIA 2HVIA 3QZ7A 5IIJA 2ZIWB 3QZ8A 3IG5A 3BJYA 3HKZC 2OWOA 4CRXA 3T5HA 4M9JA 5AK5A 1B0XA 1L3SA 4YD1A 3V6HA 4TUPA 8ICKA 3PSIA 5KFEA 2R8HA 4ICAA 4DQIA 5K4LA 3N7SC 4K4HA 4FBUA 4MF2A 4KLOA 2K8AA 1KSPA 1BGXT 2D6FC 4C8OA 1SZHA 4M9GA 1SKSA 5HR7A 7ICMA 5J0SA 3UQ0A 3Q8PB 2WF7A 2EZZA 4B6JA 1S8OA 5J2CA 2W9BA 1ZJNA 7ICPA 2XGQA 2H3FA 3TAPA 1PZNA 2XCAA 4M04A 1TK0A 4J9LA 5ALZA 2KKVA 3UMBA 3UXNA 3PW4A 2AGOA 3RJHA 4YMOA 4FZNA 9ICAA 4CF3A 1DGSA 2H3VA 3PY8A 3ED5A 3TAQA 3RRHA 1NZPA 3ZDCA 4B9NA 5F3XB 4ECSA 4C80A 4DFJA 3RB3A 2F8LA 4UASA 1FIQA 4Q8EA 3PSPA 1KFDA 5ALQA 4OJ6A 5CWRA 4P0QA 4O3SA 1A0PA 3TFRA 3EW9A 3F2DA 2CXYA 4ACOA 1Z3EB 5JTIA 1S0NA 2Y1IA 3R9KA 2OH2A 5KFUA 4PGYA 2KG5A 4I2JA 1ZQ1C 3UMGA 5AIAA 3KHHA 3WK8A 1PUZA 1ZQUA 7ICJA 2KJ9A 1CUKA 2KZ3A 3D2NA 2ZTDA 4E0DA 4O3QA 1NKEA 5ALRA 5DBCA 4F4YA 2V4QA 2PI5A 4P4OA 1BPYA 3RH5A 4MFFA 1ZQYA 5IIMA 3GU3A 1FFUA 1ZQDA 1T3QA 1EXNA 4Y2VA 4RNNA 2DKZA 4YXMA 4HYKA 2F44A 2C22A 4Y2SA 5J2BA 5AKJA 3SD7A 4YVZA 3F5AA 3F5EA 3RJJA 1NKCA 4ECUA 4QZEA 3C28A 3THVA 2ISOA 2A1JA 3GILA 4EBEA 1UHUA 2ASDA 3HP6A 4JV0A 2XO7A 3PX4A 5ALGA 3KKAA 4UAWA 5DGAA 4NLKA 8ICBA 4QZHA 4DS4A 8ICWA 4NXZA 3OJSA 2NRWA 3KZXA 3K4GA 5KNIA 1ZQXA 1U48A 4ELTA 2R8JA 5AKIA 2LI6A 3SAHA 3Q8SB 5D4BA 2H3QA 4OJLA 3UMCA 2AH5A 4CE6A 2ZTEA 2F76X 4F92B 7ICHA 2KIWA 3E0FA 1QQ5A 5KFDA 1WYGA 1NK0A 2ZXHA 3WK4A 1H38A 4BX9C 5KG7A 2MUTA 5DLGA 8ICOA 3WKAA 5EE1A 5J2IA 4YP3A 3J81j 2R8GA 1WWUA 4O5KA 1MQ3A 3MGHA 5KFNA 4RT2A 4ED7A 1SB3C 3NRWA 1D8YA 4M9LA 4R8UA 3GIKA 3UXOA 5AM0A 4JMUA 1JXLA 1J2NA 5KAFU 5AM3A 5KFOA 1HEKA 1HJPA 3ETRA 4EYHB 3KHGA 3T5JA 5ALOA 4DQPA 4F71A 4UATA 4O0IA 1IG6A 3F53A 3QU5A 2DPIA 4J9PA 1CI4A 1N5XA 9ICRA 1SGGA 2I9GA 2C28A 7ICUA 3BQ2A 1QSLA 4JV1A 4P4PA 4A8EA 3M6KA 5EWGA 4KLJA 4Q8FA 2Y1JA 8ICPA 5ALDA 4AP9A 1O08A 1JX4A 1O03A 2QLTA 2E3TA 2JH1A 1L3UA 7ICNA 8ICXA 4RNMA 4Y2YA 5JU5A 9ICLA 3JPSA 1RM6C 2AQ4A 4KLTA 1ZQRA 3LVVA 2OEHA 5KFKA 3C5GA 1ZQEA 4IC9A 4C8MA 2LHTA 3MBYA 3N7RC 1NOMA 3LVWA 4RQ8A 4F4KA 3NGDA 4NLCA 4KX5A 5J8YA 3IN5A 3M9MB 4GC6A 4TQSA 5J0QA 2PMZF 4KLHA 2KZZA 5KTQA 9ICMA 5AI6A 5DBAA 1LVHA 1URJA 1ZQKA 4UB4A 3RJIA 5AICA 1TK8A 3BZCA 5CP2A 2DF4B 3Q8LA 3HJEA 4RUCA 4QZBA 1Z00B 2FMSA 2ASJA 4BJQA 2UVVA 4XRHA 9ICNA 4JK1A 5ALPA 2QARA 3UM9A 1X9MA 4K4IA 2F8KA 2HHXA 4NL9C 1L7NA 4NLBA 4Y2TA 5B66U 3F2BA 3UQ2A 2GH1A 1VJ5A 2W04A 4R8UB 1N60A 3AMZA 4ECXA 3WK6A 5EE9A 1J97A 2ZUDA 1ZQIA 1ZETA 1N2XA 1FO4A 3FAHA 4MFCA 4XUSA 4RQ1A 4QZ8A 5J2GA 3A0BU 3FYHA 4US9A 1X9WA 1Z1BA 4TURA 9ICKA 3NVVA 3SV3A 8ICCA 2NV3A 2F3NA 3H40A 2DQNB 4U7CA 2VA8A 5GTHU 3MR5A 1ZQLA 4YR0A 7ICLA 1XSLA 5KL8B 3HPOA 1MA7A 5E79U 3ZI4A 3AL0B 4KLGA 1MN8A 5DG9A 1D9DA 2O6KA 3E58A 2IHMA 4QWBA 2AHOB 1RQNA 2GWSA 5IIOA 1NZBA 4PHPA 1X42A 3ORYA 4DF4A 4QZGA 2KKPA 3SMVA 3PV8A 2J6TA 1BNOA 2ZJ8A 4OJOA 4GLXA 3KHLA 5J2JA 2E5SA 2HCFA 2DL0A 3IG8A 5CA7A 3T5LA 1RYSA 5HNKA 4YMNA 2E8PA 1HIWA 3E2EA 2P6UA 5J0XA 2A1AA 4P2HA 3QUQA 4PL2A 3BQ0A 4UBCA 1BPXA 5ALXA 3GZFA 3DDHA 5KG6A 2ALZA 3QXGA 3ZD8A 4UW9A 4ECYA 4YQWA 4QIWC 4UB1A 9ICPA 4NLGA 2JEJA 3PX0A 3BQ7A 3NUQA 2C2RA 1S97A 5KFQA 8ICLA 2LYHA 1ED1A 4RPXA 1KDHA 3WKEA 3SV4A 1L7OA 2H3ZA 2HDOA 2ISPA 2A19A 5AM2A 5ALWA 2LYBA 5ALHA 4ED2A 2V4RA 5DDMA 4KMUA 3ZDDA 1QCKA 1VLBA 3B0YA 1NK4A 2YMQA 4F4XA 3HRDD 4DL4A 3MGVA 4DOCA 2P6RA 1B43A 2J6UA 4F4ZA 1XSNA 3T3FA 3WKCA 2KIVA 3NRZA 4UB8U 3MFIA 5KFWA 3OHBA 1WG8A 3QUTA 4IRCA 5ALFA 2WF6A 1SZPA 4J9RA 3QUBA 4GC7A 2KNJA 1U47A 5CJ7A 5KFFA 3GFKB 4KLQA 2A1JB 3H8SA 5ALTA 5CHGA 2BKEA 4IL6U 7ICVA 5KFRA 4C4RA 4UBBA 2NRTA 1X66A 1DK2A 4I2GA 4NWIA 4OCZA 5L1JA 2YQEA 4Z6EA 5ALSA 2G5IB 2MU2A 4QZFA 2FPLA 2XVTA 4ECRA 2AU0A 3SAFA 2NRXA 4KTQA 1LV5A 4Z6FA 1A76A 1S77D 3KD3A 4DFDA 3NS1A 1NK9A 3RRGA 5KT5A 5J0RA 4FS2A 5KFYA 3RJGA 2W9AA 2XCPA 3SI8A 3G6VA 5AK6A 1Z19A 4LZDA 2RP5A 3ISBA 2LYAA 4ECTA 4RQ5A 3ZDEA 3C5FA 3M6ZA 2RQ5A 2HBMA 1ZQJA 4BDPA 1JMSA 4X5VA 4FBTA 1S0OA 3RF9A 4I2HA 2WHEA 4GIBA 3TACB 2PFOA 2BPGA 4EZ6A 3VCBA 4CNQA 4R64A 4EEKA 2KMDA 5EE0A 2XIDA 3EUB2 2P35A 5DG8A 9ICEA 4YFKA 2PXIA 3RBDA 4B9TA 3QEAZ 2KICA 2YB4A 1DOQA 1RG6A 4I2FA 4QWAA 3H0RB 4DFPA 2Y9TA 1QSSA 5KFBA 5B5EU 4KX3A 5G5GA 4JUZA 3LWMA 3MFHA 3GV5B 4NJ8A 4IQUA 3JPPA 4B9UA 3QUCA 4F3OA 4F5PA 2I5HA 2BPCA 5AI4A 2WB1F 8ICEA 5AHXA 2BQUA 3DV9A 2IOHA 3CW2C 3AEVA 2FLNA 1U45A 3PO5A 3D2SA 1TE2A 5ALLA 3HILA 3F2CA 5DG7A 3TARA 4G9BA 4DL3A 1L6NA 2E8MA 1JXEA 2DBYA 4I2BA 3NVYA 3EYZA 4KLSA 2ESEA 4F5NA 5G5HA 2G06A 2BQRA 5BOMA 1ZQBA 4PGXA 1NK7A 3SAGA 5J0YA 2K60A 1X40A 1Q8KA 4M9NA 4BWJA 3RTVA 3ZDBA 3HKZF 5KFJA 2YY6A 4DFMA 2GLEA 4CF5A 8ICYA 2MRLA 5DBBA 4C7ZA 2PFPA 2K4PA 2AXTU 4GXIA 1KLNA 2FE9A 4UB3A 2OHFA 2KZMA 1Q3VA 1LB2B 3EPGA 2KVSA 2Y9UA 8ICNA 1PVPA 4I2AA 5J2AA 4KLIA 2NRZA 4M47A 3EZ5A 1FFVA 1SXEA 4UAUA 1SXDA 1J2MA 2KE7A 2W9CB 4IQWA 3C2KA 3KOOA 1RYUA 4DLGA 4O3MA 1FEZA 4ECZA 4Z6DA 5ALYA 1ZQWA 4QZDA 2YTUA 1OW5A 4MEYA 4KLEA 1IM4A 4UQGA 3N28A 1U49A 1F5SA 9ICSA 2HBJA 9ICUA 4BXOA 1ZQVA 1JN3A 3PZPA 8ICVA 3TFSA 4B9MA 4JWMA 5H2FU 8ICMA 1XO1A 5HR6A 4I28A 4DL5A 3G6XA 4NLNA 2JV3A 2HBLA 5HP4A 4OO1J 5KFCA 5KT7A 5IINA 3ZDAA 1XS9D 1NK8A 1ZQGA 7ICEA 1TK5A 1L7MA 1C7YA 1SKWA 3RJEA 4NL9A 4AYBC 1ZQMA 2HMXA 2JMGA 5KFZA 2BCVA 1XO0A 3SZ2A 5KFTA 4TUSA 3I28A 1DK3A 2VJ4A 4ZH4A 4RQ0A 1IXRA 1RZTA 5JUMA 2FPKA 3PW2A 4ECVA 4F2RA 1X2IA 4EX6A 2DPJA 3C1YA 4OJ5A 3QE9Y 4J03A 4I2IA 5DGBA 5KFAA 5CEHA 4M6WB 4I29A 5T14A 1UPHA 1DRGA 3SENA 4RQ6A 8ICIA 2M0NA 1KW4A 5ALVA 4ECWA 3GDXA 3PMLA 4FE3A 3GIIA 1SIJA 1KQQA 4KLUA 4Z6CA 1TAQA 4RQMA 4FZMA 3PR5B 2JRZA 4J9KA 2H3IA 4DOBA 5AI9A 2KSOB 3G6YA 4UAYA 1ZD4A 2ODGA 5CR0A 8ICQA 5KFXA 1NJYA 2JGAA 2FDRA 3AN1A 3RJFA 3B0XA 1V38A 3JPOA 3ISDA 2FMPA 2IOFA 1XU4A 1X9XA 4FO6A 4KLMA 1KN5A 4WJ3B 2JEFA 2IBKA 2EH9A 4DSFA 3QX7A 3VC8A 7ICTA 3HWTA 7ICQA 3TI0A 2DFLA 5J2KA 4YXJA 1WCNA 4DL6A 1XC9A 4QWDA 4I2EA 5KG5A 2P66A 3DEEA 2Y0SF 2WF8A 3IRUA 1QLNA 3K1RB 4C4SA 2YX8A 2ZJAA 2W43A 3M9OB 1ZQSA 4QNLA 3QYPA 2LM1A 1V9PA 4ED3A 1UA1A 3L5KA 4PHEA 2QB0A 3AQEA 2KOBA 2ZIVA 1ZQNA 3M8SA 4F72A 3GV7B 4LVSA 1K5OA 1UCVA 2JZBB 3RB4A 8ICZA 3OSNA 3C2MA 3ISCA 1N56A 1PK3A 3ETLA 4KMOB 2GOLA 4RZRA 4B9VA 4K4GA 1JI7A 4G3IA 9ICJA 8ICUA 2VJ5A 4Y2RA 1DGJA 4LJXA 5AKXA 4MFAA 5KFPA 1KTQA 2G0AA 1QSYA 3IM1A 2EQYA 2C2DA 3N4MB 3H8MA 3MR6A 2UVRA 2RHFA 4M9HA 4O3RA 5KG1A 1KRPA 4PZOA 1NK6A 3U26A 3FDSA 1KEJA 3RBEA 3V6KA 2KV2A 4C4TA 2EZXA 4JWNA 4NM2A 1SV4A 2HVHA 3RB0A 3V72A 1AROP 2ZXIA 4R65A 4EEYA 2HOIA 2W9MA 4KLFA 1F0MA 2LPEA 5IILA 5C0YA 1PK1A 2BPFA 5J0WA 1JIHA 4DSJA 3KBBA 3GIJA 4F50A 4DSLA 3TADC 5CB1A 1JALA 3M8RA 2R8KA 2W11A 4GFJA 2IOFK 4ECQA 2HHSA 1D9FA 2BDPA 3BQ1A 9ICVA 3KZIU 1S76D 2DWQA 2HOFA 3TKAA 3LWLA 1T3NA 3LYSA 2HW3A 1JRPA 1BPBA 3TANA 3D6JA 2KJ8A 4QZAA 3TQ1A 3BDPA 4KLLA 2JHDA 4US8A 5C5JA 4IRKA 2NO4A 4NLZA 2NRVA 2FPMA 4RU9A 2E1EA 1ZQHA 2BHNA 3GIMA 4XQ8A 4Y2JA 2Y0SC 3PMNA 5L1MA 4Q45A 2D3DA 4O3NA 4ELVA 3RAXA 1L5UA 2ZIXB 5DDYA 4DQRA 2VKQA 2WTFA 2G5HB 4YR2A 5KG2A 3N97B 1B4FA 4MEXA 9ICWA 3RH4A 2IHNA 2F77X 2ATLA 8ICJA 5KG4A 5AIBA 3EWAA 3BS7A 2KK0A 4EELA 5FP0A 2MUTB 5J2HA 2DGZA 1U4BA 5AI8A 3CP8A 1MQ2A 4OD0A 4BXOB 4P0PB 4QZCA 4ELUA 3T79A 3WU2U 8ICFA 1HUOA 2I6XA 3JPRA 5EWFA 3H8WA 1B22A 4KN4A 5D46A 4F8RA 2F1HA 5DLFA 4BUGA 4J9MA 2KN7A 5KFVA 2YMMA 2B0CA 3AUOA 4LZGA 4PH5A 2KEYA 5EWEA 2L5YA 3H0LB 3I76A 3OGUA 1S10A 2HHTA 4NY8A 2XC9A 3I1YA 3RR7A 3BZKA 3KTQA 1PVRA 4AYBF 2UVUA 1KL9A 2FJ6A 2E8NA 2MSNA 5ALJA 4TUQA 2ZIVB 3NTUA 1C20A 5AKLA 2W9CA 2W7PA 4CF4A 1XSPA 4DO9A 4EYIB 4OJPA 5HHHA 5AK4A 3Q8KA 3RB6A 2HI0A 5D49A 1DXSA 5AK3A 2CPRA 3HW8A 1ZD2P 2BQ3A 5J2DA 1PVQA 2K4HA 2ZTCA 2LKYA 1OUQA 3Q8QB 4YR3A 2FLLA 4DQSA 4RNOA 4EX7A 4USAA 1TKDA 3PVXA 1LKYA 5IIKA 4EENA 4UAZA 3QU9A 4YN4A 4PZNA 2PMZC 2E8OA 5KT3A 5ALMA 4F5RA 4DOAA 3QU4A 4NV0A 4O3PA 4M6WA 5ALEA 2H5XA 1S9FA 4FFDA 1NNLA 3WKDA 3OTQA 4C7YA 3QU7A 4DSIA 1MSWD 7ICFA 4ED6A 2DUYA 4ED1A 5J0TA 1LKYB 1NJXA 1V97A 4UB5A 3KFUF 3CNHA 5DQHA 1UT5A 5ALKA 2KHQA 2OXOA 2XICA 5J29A 1XNSA 5KG0A 1U9LA 3M7DA 2BR0A 2HSZA 1JUDA 3MDCA 4MHVA 4QWEA 4RQ7A 4Y2PA 3JPNA 2PFNA 2EANA 2EDUA 1CEZA 4P0QB 3NVZA 5BPCA 1SWVA 4RUAA 4PHAA 3M9NB 1ZOLA 5BOLA 2BDUA 2LMRA 3PW5A 5KL1B 5AKGA 2AGQA 4CDGA 3H4DA 2WB1C 1UA0A 3IV6A 2N1RA 1OXJA 3KKAC 4QW8A 2W8KA 1COKA 5AKHA 5JRTA 2VA3A 1ZQCA 5DB9A 2KFZA 2MAXA 2MA1A 4P0PA 4TQRA 2LM4A 1T4GA 3C29A 1WUDA 4EBDA 1T8EA 3GV8B 7ICIA 2JXJA 3QU2A 1PK1B 3L4PA 3ICXA 4C0ZA 8ICHA 2AJQA 2K8CB 1N61A 2ES6A 5DB7A 1N63A 2NO5A 3WK7A 2YB1A 4PL1A 4FS1A 3NVWA 1ZJMA 2BCQA 1Q46A 5AI5A 3ZD9A 3PR4A 4QZ9A 2KFNA 2RRDA 4Y2QA 2IA6A 8ICRA 1X6IA 1ZQOA 1VDVA 2W3SA 2EAPA 1RQLA 2F1JA 4BWMA 7ICOA 1IIPA 3AM9A 3IP4B 1YZ6A 2W03A 3V7JA 5IIIA 3HT3A 4PPXA 4DF8A 2YMLA 1L8OA 4J9NA 3RAQA 3M1YA 4GXKA 3C2LA 1HUZA 2D8CA 1WCLA 2XY6A 2G08A 3QEBZ 4IR1A 2FMQA 5AKKA 2EAOA 1COOA 3OPXA 4M0AA 5L1KA 5J0UA 1CRXA 1MC8A 5KT4A 2HHVA 5A0LA 3WK5A 2B6GA 5DB8A 1ZQAA 2YN4A 3K1ZA 3MR3A 4IQTA 2JEGA 3WK9A 3AQFA 5L9XA 1BPZA 4B9LA 4IR9A 3CRXA 2ZUCA 3C1ZA 2KSOA 3MR2A 1SL2A 5AI0A 3PSTA 5KFIA 1SV0C 9ICXA 1T94A 1X6JA 2K8BB 3OHAA 1TFRA 2NYVA 4B9SA 1ZD5A 5KFLA 2PFQA 3CYMA 7ICGA 1SV0A 2KP7A 1XWLA 4O3OA 2B21A 4KLDA 1RDFA 2V9WA 5ALIA 1RYRA 3SEIA 2BGWA 4EBCA 3FC4A 2FI1A 1X9SA 5EOZA 1S0MA 5GTIU 1Z4NA 2AQ0A 4DWIA 5DQIA 4U6PA 2RLTA 1TVAA 5ALUA 4QW9A 3ONNA 2JR5A 4QZIA 4MF8A 4EZ9A 1NI3A 3S6JA 2C2EA 2UVWA 1K1SA 4R66A 2W55A 2W54A 5KT2A 1Y88A 3BQTA 3IDWA 3MC1A 1TV9A 2OYYA 2CN1A 2EZYA 4DFKA 2Q4TA 2QB1A 4F5OA 3T5KA 1ZQPA 1SWWA 1AQ6A 1IV8A 4Y2UA 5L1LA 4FZLA 4UAVA 2LBOA 4KN7A 1SL1A 1ECWA 3IHQB 3RJKA 4UB2A 4IS7A 4C8LA 4PJ0U 3KHRA 3C23A 3OSPA 3V7KA 2VANA 1QTMA 2QARB 4ED8A 2Z7JA 2WF5A 1YT3A 4HAIA 4J9SA 2GO7A 2AGPA 4IRDA 5J0OA 4I2CA 1QQ6A 3O0FA 1V85A 3LDAA 1K1QA 2F2AB 3JPTA 5EE3A 4BGDA 3GQCA 4M2YA 5ALNA 5KFMA 4P4MA 1ZQFA 2XGPA 3AU2A 2W7OA 2OCEA 5J8YC 3H4BA 2HHUA 2CRXA 3PNCA 1KFTA 2KD1A 1KFSA 2ZG6A 4Q44A 3BS5A 3SYZA 1L7PA 5KFHA 4RQ4A 5CRXA 4XA5A 3SQIA 4YG2A 2ZIUB 4UB6U 1L3VA 4I27A 3MGIA 1NJZA 2PI4A 1D8BA 2I1QA 5KG3A 4RQNA 3N7PD 2G07A 2G09A 4RT3A 2HHQA 9ICOA 2PKEA 2KJ5A 5TZVA 4DSKA 2KTQA 2W3RA 4F93B 4DL2A 1A6SA 1RXWA 1ZQTA 2KVCA 1UQVA 2OM6A 3JPQA 2W8LA 1QH9A 5DQGA 5F9LA 1TAUA 3V6JA 2F1IA 4QWCA 4F2SA 2DKXA 3ALRA 4ZOHC 8ICGA 7ICRA 3RR8A 3C21A 4Y2XA 3PO4A 1NKBA 4C8KA 2M9NA 5AM1A 2QB0B 1L3TA 2EAMA 4KITB 4J9QA 3NASA 3PW0A 2ZIUA 4DQQA 3UPQA 1T7PA 1NJWA 9ICQA 1RPLA 4DSEA 4QIWF 2K4IA 1SL0A 3PX6A 5HMLA 4DCCA 5J2EA 1KBUA 2BZFA 2YMPA 1BNPA 5AKYA 4GXJA 2RDJA 3H0MB 9ICFA 5DB6A 8ICAA 1ZRMA 3UXPA 4RQ3A 3MDAA 4UARA 1F44A 4O5EA 7ICSA 2KHVA 1GO3F 3LK9A 5KT6A 8ICTA 5DKWA 2WAQC 3HX0A 1Z4OA 1BPDA 2IMWP 3AU6A 2ASLA 1S0VA 4F91B 4ED0A 4O5CA 2WAQF 2VA2A 3EPIA 4PHDA 3BS5B 2JH7A 4RPZA 1SKRA 5AM4A 1ZQZA 4PGQA 1JROA 2R8IA 2QKQA 2RDIA 4JB3A 3OJUA 4YMMA 2WF9A 2BCSA 1N5WA 3A0HU 2JZBA 4DS5A 3Q8MA 1NK5A 3MABA 3TADA 4CCHA 1BVSA 4F4WA 1P7DA 3RH6A 3L3FX 5KFSA 5F9NA 3SR6A 4I2DA 1ZYQA 1RXVA 4QJFB 2HHWA 5TISU 9ICGA 4Q43A 9ICBA 1TAMA 2ZJ5A 2VIXA 2K4EA 9ICIA 4F5QA 2XI9A 2BCRA 2WFAA 4YD2A 3H7IA 1S5LU 4J9OA 2ZIXA 4R63A 1KKXA 9ICTA 3WKBA 1L8LA 2HBKA 5AM5A 1D8LA 2E1FA 3Q8RB 2ZUBA 4DEZA 1M6YA 2HOQA 2ZIWA 2J6SA 1Z1VA 5L1IA 5KFGA 2K89A 1BPEA 5KAIU 1A77A 1QQ7A 5HMMA 1ZQQA 3D2QA 3B9JA 5AKZA 5HHIA 2XY7A 2A3VA 9ICHA 1YZ7A 3H8JA 3V7LA 1ZD3A 4IQVA 5AKEA 4DL7A 3RFAA 3QNMA 1ZRNA
chains in the Genus database with same CATH topology
2DGZA 2H3IA 2KD1A 4O3MA 3SAHA 2ZG6A 4KX3A 3CP8A 2H3QA 4OJLA 4CGZA 2KNJA 4P0PB 2F8LA 2JGAA 3LVVA 3ICXA 2PMZC 1NZBA 4C0ZA 2F76X 2KV2A 3T79A 1F44A 5CRXA 2K8CB 2KHVA 1GO3F 3PSPA 1Q3UA 2R18A 2KIWA 3SQIA 4NV0A 3E0FA 4IC9A 4OJ6A 2KKPA 2WAQC 3SMVA 2YB1A 2LHTA 2ZXIA 2WB1F 2ZXHA 2HOIA 4PL1A 4P0QA 2ZIUB 4WJ3B 1A0PA 4NWIA 4BX9C 4U6PA 3F2DA 4OJOA 3N7RC 5C0YA 2HBJA 4ACOA 2E5SA 2G5IB 3LVWA 3ONNA 2WAQF 4NLCA 4KX5A 3VC8A 4BUGA 2XVTA 3PSFA 3IN5A 3IG8A 2JH7A 1D8BA 2OH2A 3D2SA 3PZPA 3N7PD 1HIWA 2RRDA 2ZIWB 3IG5A 2G07A 2G09A 2PMZF 3SAFA 1ZQ1C 3HKZC 2KJ5A 4CRXA 3F2CA 5HR6A 3KFUF 1L6NA 2HBLA 2KHQA 4GFJA 4OO1J 4PL2A 2OXOA 3NRWA 2KJ9A 3DEEA 2XICA 2Y0SF 1URJA 2KEYA 3GZFA 2OYYA 1A6SA 2CN1A 1XNSA 1P7DA 3D2NA 2Q4TA 3L3FX 3PSIA 4JMUA 3H0LB 2YX8A 2KVCA 2HOFA 2OM6A 3M7DA 4QJFB 4ICAA 2DF4B 4QIWC 3N7SC 1HEKA 1IIPA 4AYBC 4QNLA 3LYSA 2HMXA 2G06A 2JMGA 1TAMA 4BJQA 2VIXA 3IP4B 2KJ8A 2K4EA 2W03A 1PVRA 4AYBF 3NUQA 4FZLA 1XO0A 2JHDA 2LBOA 1Z19A 3F53A 3SAGA 2RP5A 2K8AA 3GU3A 2XI9A 4NLBA 1ECWA 2LYAA 2E1EA 1ED1A 3ALRA 3AQEA 2KOBA 2ZIVA 2VJ4A 3F2BA 3HKZF 4P0QB 2GH1A 2W04A 2ZIXA 2H3ZA 3M6ZA 2D6FC 2HBMA 2Y0SC 3F5AA 3F5EA 1SZHA 2G08A 2ZIVB 2HBKA 2E1FA 3C28A 2LYBA 2ZIXB 3RF9A 5HR7A 2MRLA 3OPXA 2HOQA 2ZIWA 2BDUA 4OJ5A 1CRXA 2Z7JA 2W7PA 4KMOB 2VKQA 5A0LA 1YT3A 2K89A 2ZIUA 2G5HB 1Z1BA 4OJPA 5KL1B 3VCBA 2GOLA 4A8EA 5T14A 3M6KA 3K1ZA 1UPHA 2H3FA 3MGVA 2XIDA 2F77X 2NV3A 1Q3VA 3D2QA 1DRGA 4QIWF 2KKVA 4CDGA 2K4IA 3AQFA 1PVPA 2VJ5A 3O0FA 2CPRA 2A3VA 2WB1C 2M0NA 2F2AB 2KICA 3CRXA 2YB4A 2N1RA 3KZXA 4FZNA 2DQNB 2G0AA 4U7CA 4FE3A 1KBUA 2H3VA 1PVQA 2K4HA 3H0RB 2LKYA 1OUQA 3PSTA 2W7OA 2MA1A 3RFAA 4P0PA 1T94A 2K8BB 3H0MB 5KL8B 4FZMA 1MA7A 2JH1A 2RHFA 2CRXA 3AL0B 3CYMA 3C29A 1WUDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LYS A;  2KD1 A;  1Z1B A;  2KJ8 A;  1PVR A;  4A8E A;  1XO0 A;  1Z19 A;  3MGV A;  1Q3V A;  1DRG A;  2KJ5 A;  4CRX A;  2KKV A;  1NZB A;  2KOB A;  1PVP A;  1F44 A;  2A3V A;  5CRX A;  2KHQ A;  2KHV A;  2OXO A;  3NRW A;  2KJ9 A;  1Q3U A;  2KIW A;  3CRX A;  2KEY A;  2KKP A;  1XNS A;  1KBU A;  1P7D A;  2HOI A;  1PVQ A;  1OUQ A;  1A0P A;  3C28 A;  2HOF A;  1MA7 A;  4ACO A;  2CRX A;  1CRX A;  3C29 A; 
#chains in the Genus database with same CATH topology
 4RQ2 A;  2Q0Z X;  2XY5 A;  4CGZ A;  4NM1 A;  8ICS A;  2FLP A;  3PW7 A;  1WWV A;  9ICC A;  1Q3U A;  2R18 A;  4O9M A;  1N62 A;  1Z00 A;  2JEI A;  1UT8 A;  3FM9 A;  7ICK A;  2BCU A;  5J2F A;  4YCX A;  2W9B B;  4DLE A;  3K75 D;  4RPY A;  4C8N A;  4JV2 A;  5J0P A;  3PSF A;  1N48 A;  1ZXI A;  2HVI A;  3QZ7 A;  5IIJ A;  2ZIW B;  3QZ8 A;  3IG5 A;  3BJY A;  3HKZ C;  2OWO A;  4CRX A;  3T5H A;  4M9J A;  5AK5 A;  1B0X A;  1L3S A;  4YD1 A;  3V6H A;  4TUP A;  8ICK A;  3PSI A;  5KFE A;  2R8H A;  4ICA A;  4DQI A;  5K4L A;  3N7S C;  4K4H A;  4FBU A;  4MF2 A;  4KLO A;  2K8A A;  1KSP A;  1BGX T;  2D6F C;  4C8O A;  1SZH A;  4M9G A;  1SKS A;  5HR7 A;  7ICM A;  5J0S A;  3UQ0 A;  3Q8P B;  2WF7 A;  2EZZ A;  4B6J A;  1S8O A;  5J2C A;  2W9B A;  1ZJN A;  7ICP A;  2XGQ A;  2H3F A;  3TAP A;  1PZN A;  2XCA A;  4M04 A;  1TK0 A;  4J9L A;  5ALZ A;  2KKV A;  3UMB A;  3UXN A;  3PW4 A;  2AGO A;  3RJH A;  4YMO A;  4FZN A;  9ICA A;  4CF3 A;  1DGS A;  2H3V A;  3PY8 A;  3ED5 A;  3TAQ A;  3RRH A;  1NZP A;  3ZDC A;  4B9N A;  5F3X B;  4ECS A;  4C80 A;  4DFJ A;  3RB3 A;  2F8L A;  4UAS A;  1FIQ A;  4Q8E A;  3PSP A;  1KFD A;  5ALQ A;  4OJ6 A;  5CWR A;  4P0Q A;  4O3S A;  1A0P A;  3TFR A;  3EW9 A;  3F2D A;  2CXY A;  4ACO A;  1Z3E B;  5JTI A;  1S0N A;  2Y1I A;  3R9K A;  2OH2 A;  5KFU A;  4PGY A;  2KG5 A;  4I2J A;  1ZQ1 C;  3UMG A;  5AIA A;  3KHH A;  3WK8 A;  1PUZ A;  1ZQU A;  7ICJ A;  2KJ9 A;  1CUK A;  2KZ3 A;  3D2N A;  2ZTD A;  4E0D A;  4O3Q A;  1NKE A;  5ALR A;  5DBC A;  4F4Y A;  2V4Q A;  2PI5 A;  4P4O A;  1BPY A;  3RH5 A;  4MFF A;  1ZQY A;  5IIM A;  3GU3 A;  1FFU A;  1ZQD A;  1T3Q A;  1EXN A;  4Y2V A;  4RNN A;  2DKZ A;  4YXM A;  4HYK A;  2F44 A;  2C22 A;  4Y2S A;  5J2B A;  5AKJ A;  3SD7 A;  4YVZ A;  3F5A A;  3F5E A;  3RJJ A;  1NKC A;  4ECU A;  4QZE A;  3C28 A;  3THV A;  2ISO A;  2A1J A;  3GIL A;  4EBE A;  1UHU A;  2ASD A;  3HP6 A;  4JV0 A;  2XO7 A;  3PX4 A;  5ALG A;  3KKA A;  4UAW A;  5DGA A;  4NLK A;  8ICB A;  4QZH A;  4DS4 A;  8ICW A;  4NXZ A;  3OJS A;  2NRW A;  3KZX A;  3K4G A;  5KNI A;  1ZQX A;  1U48 A;  4ELT A;  2R8J A;  5AKI A;  2LI6 A;  3SAH A;  3Q8S B;  5D4B A;  2H3Q A;  4OJL A;  3UMC A;  2AH5 A;  4CE6 A;  2ZTE A;  2F76 X;  4F92 B;  7ICH A;  2KIW A;  3E0F A;  1QQ5 A;  5KFD A;  1WYG A;  1NK0 A;  2ZXH A;  3WK4 A;  1H38 A;  4BX9 C;  5KG7 A;  2MUT A;  5DLG A;  8ICO A;  3WKA A;  5EE1 A;  5J2I A;  4YP3 A;  3J81 j;  2R8G A;  1WWU A;  4O5K A;  1MQ3 A;  3MGH A;  5KFN A;  4RT2 A;  4ED7 A;  1SB3 C;  3NRW A;  1D8Y A;  4M9L A;  4R8U A;  3GIK A;  3UXO A;  5AM0 A;  4JMU A;  1JXL A;  1J2N A;  5KAF U;  5AM3 A;  5KFO A;  1HEK A;  1HJP A;  3ETR A;  4EYH B;  3KHG A;  3T5J A;  5ALO A;  4DQP A;  4F71 A;  4UAT A;  4O0I A;  1IG6 A;  3F53 A;  3QU5 A;  2DPI A;  4J9P A;  1CI4 A;  1N5X A;  9ICR A;  1SGG A;  2I9G A;  2C28 A;  7ICU A;  3BQ2 A;  1QSL A;  4JV1 A;  4P4P A;  4A8E A;  3M6K A;  5EWG A;  4KLJ A;  4Q8F A;  2Y1J A;  8ICP A;  5ALD A;  4AP9 A;  1O08 A;  1JX4 A;  1O03 A;  2QLT A;  2E3T A;  2JH1 A;  1L3U A;  7ICN A;  8ICX A;  4RNM A;  4Y2Y A;  5JU5 A;  9ICL A;  3JPS A;  1RM6 C;  2AQ4 A;  4KLT A;  1ZQR A;  3LVV A;  2OEH A;  5KFK A;  3C5G A;  1ZQE A;  4IC9 A;  4C8M A;  2LHT A;  3MBY A;  3N7R C;  1NOM A;  3LVW A;  4RQ8 A;  4F4K A;  3NGD A;  4NLC A;  4KX5 A;  5J8Y A;  3IN5 A;  3M9M B;  4GC6 A;  4TQS A;  5J0Q A;  2PMZ F;  4KLH A;  2KZZ A;  5KTQ A;  9ICM A;  5AI6 A;  5DBA A;  1LVH A;  1URJ A;  1ZQK A;  4UB4 A;  3RJI A;  5AIC A;  1TK8 A;  3BZC A;  5CP2 A;  2DF4 B;  3Q8L A;  3HJE A;  4RUC A;  4QZB A;  1Z00 B;  2FMS A;  2ASJ A;  4BJQ A;  2UVV A;  4XRH A;  9ICN A;  4JK1 A;  5ALP A;  2QAR A;  3UM9 A;  1X9M A;  4K4I A;  2F8K A;  2HHX A;  4NL9 C;  1L7N A;  4NLB A;  4Y2T A;  5B66 U;  3F2B A;  3UQ2 A;  2GH1 A;  1VJ5 A;  2W04 A;  4R8U B;  1N60 A;  3AMZ A;  4ECX A;  3WK6 A;  5EE9 A;  1J97 A;  2ZUD A;  1ZQI A;  1ZET A;  1N2X A;  1FO4 A;  3FAH A;  4MFC A;  4XUS A;  4RQ1 A;  4QZ8 A;  5J2G A;  3A0B U;  3FYH A;  4US9 A;  1X9W A;  1Z1B A;  4TUR A;  9ICK A;  3NVV A;  3SV3 A;  8ICC A;  2NV3 A;  2F3N A;  3H40 A;  2DQN B;  4U7C A;  2VA8 A;  5GTH U;  3MR5 A;  1ZQL A;  4YR0 A;  7ICL A;  1XSL A;  5KL8 B;  3HPO A;  1MA7 A;  5E79 U;  3ZI4 A;  3AL0 B;  4KLG A;  1MN8 A;  5DG9 A;  1D9D A;  2O6K A;  3E58 A;  2IHM A;  4QWB A;  2AHO B;  1RQN A;  2GWS A;  5IIO A;  1NZB A;  4PHP A;  1X42 A;  3ORY A;  4DF4 A;  4QZG A;  2KKP A;  3SMV A;  3PV8 A;  2J6T A;  1BNO A;  2ZJ8 A;  4OJO A;  4GLX A;  3KHL A;  5J2J A;  2E5S A;  2HCF A;  2DL0 A;  3IG8 A;  5CA7 A;  3T5L A;  1RYS A;  5HNK A;  4YMN A;  2E8P A;  1HIW A;  3E2E A;  2P6U A;  5J0X A;  2A1A A;  4P2H A;  3QUQ A;  4PL2 A;  3BQ0 A;  4UBC A;  1BPX A;  5ALX A;  3GZF A;  3DDH A;  5KG6 A;  2ALZ A;  3QXG A;  3ZD8 A;  4UW9 A;  4ECY A;  4YQW A;  4QIW C;  4UB1 A;  9ICP A;  4NLG A;  2JEJ A;  3PX0 A;  3BQ7 A;  3NUQ A;  2C2R A;  1S97 A;  5KFQ A;  8ICL A;  2LYH A;  1ED1 A;  4RPX A;  1KDH A;  3WKE A;  3SV4 A;  1L7O A;  2H3Z A;  2HDO A;  2ISP A;  2A19 A;  5AM2 A;  5ALW A;  2LYB A;  5ALH A;  4ED2 A;  2V4R A;  5DDM A;  4KMU A;  3ZDD A;  1QCK A;  1VLB A;  3B0Y A;  1NK4 A;  2YMQ A;  4F4X A;  3HRD D;  4DL4 A;  3MGV A;  4DOC A;  2P6R A;  1B43 A;  2J6U A;  4F4Z A;  1XSN A;  3T3F A;  3WKC A;  2KIV A;  3NRZ A;  4UB8 U;  3MFI A;  5KFW A;  3OHB A;  1WG8 A;  3QUT A;  4IRC A;  5ALF A;  2WF6 A;  1SZP A;  4J9R A;  3QUB A;  4GC7 A;  2KNJ A;  1U47 A;  5CJ7 A;  5KFF A;  3GFK B;  4KLQ A;  2A1J B;  3H8S A;  5ALT A;  5CHG A;  2BKE A;  4IL6 U;  7ICV A;  5KFR A;  4C4R A;  4UBB A;  2NRT A;  1X66 A;  1DK2 A;  4I2G A;  4NWI A;  4OCZ A;  5L1J A;  2YQE A;  4Z6E A;  5ALS A;  2G5I B;  2MU2 A;  4QZF A;  2FPL A;  2XVT A;  4ECR A;  2AU0 A;  3SAF A;  2NRX A;  4KTQ A;  1LV5 A;  4Z6F A;  1A76 A;  1S77 D;  3KD3 A;  4DFD A;  3NS1 A;  1NK9 A;  3RRG A;  5KT5 A;  5J0R A;  4FS2 A;  5KFY A;  3RJG A;  2W9A A;  2XCP A;  3SI8 A;  3G6V A;  5AK6 A;  1Z19 A;  4LZD A;  2RP5 A;  3ISB A;  2LYA A;  4ECT A;  4RQ5 A;  3ZDE A;  3C5F A;  3M6Z A;  2RQ5 A;  2HBM A;  1ZQJ A;  4BDP A;  1JMS A;  4X5V A;  4FBT A;  1S0O A;  3RF9 A;  4I2H A;  2WHE A;  4GIB A;  3TAC B;  2PFO A;  2BPG A;  4EZ6 A;  3VCB A;  4CNQ A;  4R64 A;  4EEK A;  2KMD A;  5EE0 A;  2XID A;  3EUB 2;  2P35 A;  5DG8 A;  9ICE A;  4YFK A;  2PXI A;  3RBD A;  4B9T A;  3QEA Z;  2KIC A;  2YB4 A;  1DOQ A;  1RG6 A;  4I2F A;  4QWA A;  3H0R B;  4DFP A;  2Y9T A;  1QSS A;  5KFB A;  5B5E U;  4KX3 A;  5G5G A;  4JUZ A;  3LWM A;  3MFH A;  3GV5 B;  4NJ8 A;  4IQU A;  3JPP A;  4B9U A;  3QUC A;  4F3O A;  4F5P A;  2I5H A;  2BPC A;  5AI4 A;  2WB1 F;  8ICE A;  5AHX A;  2BQU A;  3DV9 A;  2IOH A;  3CW2 C;  3AEV A;  2FLN A;  1U45 A;  3PO5 A;  3D2S A;  1TE2 A;  5ALL A;  3HIL A;  3F2C A;  5DG7 A;  3TAR A;  4G9B A;  4DL3 A;  1L6N A;  2E8M A;  1JXE A;  2DBY A;  4I2B A;  3NVY A;  3EYZ A;  4KLS A;  2ESE A;  4F5N A;  5G5H A;  2G06 A;  2BQR A;  5BOM A;  1ZQB A;  4PGX A;  1NK7 A;  3SAG A;  5J0Y A;  2K60 A;  1X40 A;  1Q8K A;  4M9N A;  4BWJ A;  3RTV A;  3ZDB A;  3HKZ F;  5KFJ A;  2YY6 A;  4DFM A;  2GLE A;  4CF5 A;  8ICY A;  2MRL A;  5DBB A;  4C7Z A;  2PFP A;  2K4P A;  2AXT U;  4GXI A;  1KLN A;  2FE9 A;  4UB3 A;  2OHF A;  2KZM A;  1Q3V A;  1LB2 B;  3EPG A;  2KVS A;  2Y9U A;  8ICN A;  1PVP A;  4I2A A;  5J2A A;  4KLI A;  2NRZ A;  4M47 A;  3EZ5 A;  1FFV A;  1SXE A;  4UAU A;  1SXD A;  1J2M A;  2KE7 A;  2W9C B;  4IQW A;  3C2K A;  3KOO A;  1RYU A;  4DLG A;  4O3M A;  1FEZ A;  4ECZ A;  4Z6D A;  5ALY A;  1ZQW A;  4QZD A;  2YTU A;  1OW5 A;  4MEY A;  4KLE A;  1IM4 A;  4UQG A;  3N28 A;  1U49 A;  1F5S A;  9ICS A;  2HBJ A;  9ICU A;  4BXO A;  1ZQV A;  1JN3 A;  3PZP A;  8ICV A;  3TFS A;  4B9M A;  4JWM A;  5H2F U;  8ICM A;  1XO1 A;  5HR6 A;  4I28 A;  4DL5 A;  3G6X A;  4NLN A;  2JV3 A;  2HBL A;  5HP4 A;  4OO1 J;  5KFC A;  5KT7 A;  5IIN A;  3ZDA A;  1XS9 D;  1NK8 A;  1ZQG A;  7ICE A;  1TK5 A;  1L7M A;  1C7Y A;  1SKW A;  3RJE A;  4NL9 A;  4AYB C;  1ZQM A;  2HMX A;  2JMG A;  5KFZ A;  2BCV A;  1XO0 A;  3SZ2 A;  5KFT A;  4TUS A;  3I28 A;  1DK3 A;  2VJ4 A;  4ZH4 A;  4RQ0 A;  1IXR A;  1RZT A;  5JUM A;  2FPK A;  3PW2 A;  4ECV A;  4F2R A;  1X2I A;  4EX6 A;  2DPJ A;  3C1Y A;  4OJ5 A;  3QE9 Y;  4J03 A;  4I2I A;  5DGB A;  5KFA A;  5CEH A;  4M6W B;  4I29 A;  5T14 A;  1UPH A;  1DRG A;  3SEN A;  4RQ6 A;  8ICI A;  2M0N A;  1KW4 A;  5ALV A;  4ECW A;  3GDX A;  3PML A;  4FE3 A;  3GII A;  1SIJ A;  1KQQ A;  4KLU A;  4Z6C A;  1TAQ A;  4RQM A;  4FZM A;  3PR5 B;  2JRZ A;  4J9K A;  2H3I A;  4DOB A;  5AI9 A;  2KSO B;  3G6Y A;  4UAY A;  1ZD4 A;  2ODG A;  5CR0 A;  8ICQ A;  5KFX A;  1NJY A;  2JGA A;  2FDR A;  3AN1 A;  3RJF A;  3B0X A;  1V38 A;  3JPO A;  3ISD A;  2FMP A;  2IOF A;  1XU4 A;  1X9X A;  4FO6 A;  4KLM A;  1KN5 A;  4WJ3 B;  2JEF A;  2IBK A;  2EH9 A;  4DSF A;  3QX7 A;  3VC8 A;  7ICT A;  3HWT A;  7ICQ A;  3TI0 A;  2DFL A;  5J2K A;  4YXJ A;  1WCN A;  4DL6 A;  1XC9 A;  4QWD A;  4I2E A;  5KG5 A;  2P66 A;  3DEE A;  2Y0S F;  2WF8 A;  3IRU A;  1QLN A;  3K1R B;  4C4S A;  2YX8 A;  2ZJA A;  2W43 A;  3M9O B;  1ZQS A;  4QNL A;  3QYP A;  2LM1 A;  1V9P A;  4ED3 A;  1UA1 A;  3L5K A;  4PHE A;  2QB0 A;  3AQE A;  2KOB A;  2ZIV A;  1ZQN A;  3M8S A;  4F72 A;  3GV7 B;  4LVS A;  1K5O A;  1UCV A;  2JZB B;  3RB4 A;  8ICZ A;  3OSN A;  3C2M A;  3ISC A;  1N56 A;  1PK3 A;  3ETL A;  4KMO B;  2GOL A;  4RZR A;  4B9V A;  4K4G A;  1JI7 A;  4G3I A;  9ICJ A;  8ICU A;  2VJ5 A;  4Y2R A;  1DGJ A;  4LJX A;  5AKX A;  4MFA A;  5KFP A;  1KTQ A;  2G0A A;  1QSY A;  3IM1 A;  2EQY A;  2C2D A;  3N4M B;  3H8M A;  3MR6 A;  2UVR A;  2RHF A;  4M9H A;  4O3R A;  5KG1 A;  1KRP A;  4PZO A;  1NK6 A;  3U26 A;  3FDS A;  1KEJ A;  3RBE A;  3V6K A;  2KV2 A;  4C4T A;  2EZX A;  4JWN A;  4NM2 A;  1SV4 A;  2HVH A;  3RB0 A;  3V72 A;  1ARO P;  2ZXI A;  4R65 A;  4EEY A;  2HOI A;  2W9M A;  4KLF A;  1F0M A;  2LPE A;  5IIL A;  5C0Y A;  1PK1 A;  2BPF A;  5J0W A;  1JIH A;  4DSJ A;  3KBB A;  3GIJ A;  4F50 A;  4DSL A;  3TAD C;  5CB1 A;  1JAL A;  3M8R A;  2R8K A;  2W11 A;  4GFJ A;  2IOF K;  4ECQ A;  2HHS A;  1D9F A;  2BDP A;  3BQ1 A;  9ICV A;  3KZI U;  1S76 D;  2DWQ A;  2HOF A;  3TKA A;  3LWL A;  1T3N A;  3LYS A;  2HW3 A;  1JRP A;  1BPB A;  3TAN A;  3D6J A;  2KJ8 A;  4QZA A;  3TQ1 A;  3BDP A;  4KLL A;  2JHD A;  4US8 A;  5C5J A;  4IRK A;  2NO4 A;  4NLZ A;  2NRV A;  2FPM A;  4RU9 A;  2E1E A;  1ZQH A;  2BHN A;  3GIM A;  4XQ8 A;  4Y2J A;  2Y0S C;  3PMN A;  5L1M A;  4Q45 A;  2D3D A;  4O3N A;  4ELV A;  3RAX A;  1L5U A;  2ZIX B;  5DDY A;  4DQR A;  2VKQ A;  2WTF A;  2G5H B;  4YR2 A;  5KG2 A;  3N97 B;  1B4F A;  4MEX A;  9ICW A;  3RH4 A;  2IHN A;  2F77 X;  2ATL A;  8ICJ A;  5KG4 A;  5AIB A;  3EWA A;  3BS7 A;  2KK0 A;  4EEL A;  5FP0 A;  2MUT B;  5J2H A;  2DGZ A;  1U4B A;  5AI8 A;  3CP8 A;  1MQ2 A;  4OD0 A;  4BXO B;  4P0P B;  4QZC A;  4ELU A;  3T79 A;  3WU2 U;  8ICF A;  1HUO A;  2I6X A;  3JPR A;  5EWF A;  3H8W A;  1B22 A;  4KN4 A;  5D46 A;  4F8R A;  2F1H A;  5DLF A;  4BUG A;  4J9M A;  2KN7 A;  5KFV A;  2YMM A;  2B0C A;  3AUO A;  4LZG A;  4PH5 A;  2KEY A;  5EWE A;  2L5Y A;  3H0L B;  3I76 A;  3OGU A;  1S10 A;  2HHT A;  4NY8 A;  2XC9 A;  3I1Y A;  3RR7 A;  3BZK A;  3KTQ A;  1PVR A;  4AYB F;  2UVU A;  1KL9 A;  2FJ6 A;  2E8N A;  2MSN A;  5ALJ A;  4TUQ A;  2ZIV B;  3NTU A;  1C20 A;  5AKL A;  2W9C A;  2W7P A;  4CF4 A;  1XSP A;  4DO9 A;  4EYI B;  4OJP A;  5HHH A;  5AK4 A;  3Q8K A;  3RB6 A;  2HI0 A;  5D49 A;  1DXS A;  5AK3 A;  2CPR A;  3HW8 A;  1ZD2 P;  2BQ3 A;  5J2D A;  1PVQ A;  2K4H A;  2ZTC A;  2LKY A;  1OUQ A;  3Q8Q B;  4YR3 A;  2FLL A;  4DQS A;  4RNO A;  4EX7 A;  4USA A;  1TKD A;  3PVX A;  1LKY A;  5IIK A;  4EEN A;  4UAZ A;  3QU9 A;  4YN4 A;  4PZN A;  2PMZ C;  2E8O A;  5KT3 A;  5ALM A;  4F5R A;  4DOA A;  3QU4 A;  4NV0 A;  4O3P A;  4M6W A;  5ALE A;  2H5X A;  1S9F A;  4FFD A;  1NNL A;  3WKD A;  3OTQ A;  4C7Y A;  3QU7 A;  4DSI A;  1MSW D;  7ICF A;  4ED6 A;  2DUY A;  4ED1 A;  5J0T A;  1LKY B;  1NJX A;  1V97 A;  4UB5 A;  3KFU F;  3CNH A;  5DQH A;  1UT5 A;  5ALK A;  2KHQ A;  2OXO A;  2XIC A;  5J29 A;  1XNS A;  5KG0 A;  1U9L A;  3M7D A;  2BR0 A;  2HSZ A;  1JUD A;  3MDC A;  4MHV A;  4QWE A;  4RQ7 A;  4Y2P A;  3JPN A;  2PFN A;  2EAN A;  2EDU A;  1CEZ A;  4P0Q B;  3NVZ A;  5BPC A;  1SWV A;  4RUA A;  4PHA A;  3M9N B;  1ZOL A;  5BOL A;  2BDU A;  2LMR A;  3PW5 A;  5KL1 B;  5AKG A;  2AGQ A;  4CDG A;  3H4D A;  2WB1 C;  1UA0 A;  3IV6 A;  2N1R A;  1OXJ A;  3KKA C;  4QW8 A;  2W8K A;  1COK A;  5AKH A;  5JRT A;  2VA3 A;  1ZQC A;  5DB9 A;  2KFZ A;  2MAX A;  2MA1 A;  4P0P A;  4TQR A;  2LM4 A;  1T4G A;  3C29 A;  1WUD A;  4EBD A;  1T8E A;  3GV8 B;  7ICI A;  2JXJ A;  3QU2 A;  1PK1 B;  3L4P A;  3ICX A;  4C0Z A;  8ICH A;  2AJQ A;  2K8C B;  1N61 A;  2ES6 A;  5DB7 A;  1N63 A;  2NO5 A;  3WK7 A;  2YB1 A;  4PL1 A;  4FS1 A;  3NVW A;  1ZJM A;  2BCQ A;  1Q46 A;  5AI5 A;  3ZD9 A;  3PR4 A;  4QZ9 A;  2KFN A;  2RRD A;  4Y2Q A;  2IA6 A;  8ICR A;  1X6I A;  1ZQO A;  1VDV A;  2W3S A;  2EAP A;  1RQL A;  2F1J A;  4BWM A;  7ICO A;  1IIP A;  3AM9 A;  3IP4 B;  1YZ6 A;  2W03 A;  3V7J A;  5III A;  3HT3 A;  4PPX A;  4DF8 A;  2YML A;  1L8O A;  4J9N A;  3RAQ A;  3M1Y A;  4GXK A;  3C2L A;  1HUZ A;  2D8C A;  1WCL A;  2XY6 A;  2G08 A;  3QEB Z;  4IR1 A;  2FMQ A;  5AKK A;  2EAO A;  1COO A;  3OPX A;  4M0A A;  5L1K A;  5J0U A;  1CRX A;  1MC8 A;  5KT4 A;  2HHV A;  5A0L A;  3WK5 A;  2B6G A;  5DB8 A;  1ZQA A;  2YN4 A;  3K1Z A;  3MR3 A;  4IQT A;  2JEG A;  3WK9 A;  3AQF A;  5L9X A;  1BPZ A;  4B9L A;  4IR9 A;  3CRX A;  2ZUC A;  3C1Z A;  2KSO A;  3MR2 A;  1SL2 A;  5AI0 A;  3PST A;  5KFI A;  1SV0 C;  9ICX A;  1T94 A;  1X6J A;  2K8B B;  3OHA A;  1TFR A;  2NYV A;  4B9S A;  1ZD5 A;  5KFL A;  2PFQ A;  3CYM A;  7ICG A;  1SV0 A;  2KP7 A;  1XWL A;  4O3O A;  2B21 A;  4KLD A;  1RDF A;  2V9W A;  5ALI A;  1RYR A;  3SEI A;  2BGW A;  4EBC A;  3FC4 A;  2FI1 A;  1X9S A;  5EOZ A;  1S0M A;  5GTI U;  1Z4N A;  2AQ0 A;  4DWI A;  5DQI A;  4U6P A;  2RLT A;  1TVA A;  5ALU A;  4QW9 A;  3ONN A;  2JR5 A;  4QZI A;  4MF8 A;  4EZ9 A;  1NI3 A;  3S6J A;  2C2E A;  2UVW A;  1K1S A;  4R66 A;  2W55 A;  2W54 A;  5KT2 A;  1Y88 A;  3BQT A;  3IDW A;  3MC1 A;  1TV9 A;  2OYY A;  2CN1 A;  2EZY A;  4DFK A;  2Q4T A;  2QB1 A;  4F5O A;  3T5K A;  1ZQP A;  1SWW A;  1AQ6 A;  1IV8 A;  4Y2U A;  5L1L A;  4FZL A;  4UAV A;  2LBO A;  4KN7 A;  1SL1 A;  1ECW A;  3IHQ B;  3RJK A;  4UB2 A;  4IS7 A;  4C8L A;  4PJ0 U;  3KHR A;  3C23 A;  3OSP A;  3V7K A;  2VAN A;  1QTM A;  2QAR B;  4ED8 A;  2Z7J A;  2WF5 A;  1YT3 A;  4HAI A;  4J9S A;  2GO7 A;  2AGP A;  4IRD A;  5J0O A;  4I2C A;  1QQ6 A;  3O0F A;  1V85 A;  3LDA A;  1K1Q A;  2F2A B;  3JPT A;  5EE3 A;  4BGD A;  3GQC A;  4M2Y A;  5ALN A;  5KFM A;  4P4M A;  1ZQF A;  2XGP A;  3AU2 A;  2W7O A;  2OCE A;  5J8Y C;  3H4B A;  2HHU A;  2CRX A;  3PNC A;  1KFT A;  2KD1 A;  1KFS A;  2ZG6 A;  4Q44 A;  3BS5 A;  3SYZ A;  1L7P A;  5KFH A;  4RQ4 A;  5CRX A;  4XA5 A;  3SQI A;  4YG2 A;  2ZIU B;  4UB6 U;  1L3V A;  4I27 A;  3MGI A;  1NJZ A;  2PI4 A;  1D8B A;  2I1Q A;  5KG3 A;  4RQN A;  3N7P D;  2G07 A;  2G09 A;  4RT3 A;  2HHQ A;  9ICO A;  2PKE A;  2KJ5 A;  5TZV A;  4DSK A;  2KTQ A;  2W3R A;  4F93 B;  4DL2 A;  1A6S A;  1RXW A;  1ZQT A;  2KVC A;  1UQV A;  2OM6 A;  3JPQ A;  2W8L A;  1QH9 A;  5DQG A;  5F9L A;  1TAU A;  3V6J A;  2F1I A;  4QWC A;  4F2S A;  2DKX A;  3ALR A;  4ZOH C;  8ICG A;  7ICR A;  3RR8 A;  3C21 A;  4Y2X A;  3PO4 A;  1NKB A;  4C8K A;  2M9N A;  5AM1 A;  2QB0 B;  1L3T A;  2EAM A;  4KIT B;  4J9Q A;  3NAS A;  3PW0 A;  2ZIU A;  4DQQ A;  3UPQ A;  1T7P A;  1NJW A;  9ICQ A;  1RPL A;  4DSE A;  4QIW F;  2K4I A;  1SL0 A;  3PX6 A;  5HML A;  4DCC A;  5J2E A;  1KBU A;  2BZF A;  2YMP A;  1BNP A;  5AKY A;  4GXJ A;  2RDJ A;  3H0M B;  9ICF A;  5DB6 A;  8ICA A;  1ZRM A;  3UXP A;  4RQ3 A;  3MDA A;  4UAR A;  1F44 A;  4O5E A;  7ICS A;  2KHV A;  1GO3 F;  3LK9 A;  5KT6 A;  8ICT A;  5DKW A;  2WAQ C;  3HX0 A;  1Z4O A;  1BPD A;  2IMW P;  3AU6 A;  2ASL A;  1S0V A;  4F91 B;  4ED0 A;  4O5C A;  2WAQ F;  2VA2 A;  3EPI A;  4PHD A;  3BS5 B;  2JH7 A;  4RPZ A;  1SKR A;  5AM4 A;  1ZQZ A;  4PGQ A;  1JRO A;  2R8I A;  2QKQ A;  2RDI A;  4JB3 A;  3OJU A;  4YMM A;  2WF9 A;  2BCS A;  1N5W A;  3A0H U;  2JZB A;  4DS5 A;  3Q8M A;  1NK5 A;  3MAB A;  3TAD A;  4CCH A;  1BVS A;  4F4W A;  1P7D A;  3RH6 A;  3L3F X;  5KFS A;  5F9N A;  3SR6 A;  4I2D A;  1ZYQ A;  1RXV A;  4QJF B;  2HHW A;  5TIS U;  9ICG A;  4Q43 A;  9ICB A;  1TAM A;  2ZJ5 A;  2VIX A;  2K4E A;  9ICI A;  4F5Q A;  2XI9 A;  2BCR A;  2WFA A;  4YD2 A;  3H7I A;  1S5L U;  4J9O A;  2ZIX A;  4R63 A;  1KKX A;  9ICT A;  3WKB A;  1L8L A;  2HBK A;  5AM5 A;  1D8L A;  2E1F A;  3Q8R B;  2ZUB A;  4DEZ A;  1M6Y A;  2HOQ A;  2ZIW A;  2J6S A;  1Z1V A;  5L1I A;  5KFG A;  2K89 A;  1BPE A;  5KAI U;  1A77 A;  1QQ7 A;  5HMM A;  1ZQQ A;  3D2Q A;  3B9J A;  5AKZ A;  5HHI A;  2XY7 A;  2A3V A;  9ICH A;  1YZ7 A;  3H8J A;  3V7L A;  1ZD3 A;  4IQV A;  5AKE A;  4DL7 A;  3RFA A;  3QNM A;  1ZRN A; 
#chains in the Genus database with same CATH homology
 2DGZ A;  2H3I A;  2KD1 A;  4O3M A;  3SAH A;  2ZG6 A;  4KX3 A;  3CP8 A;  2H3Q A;  4OJL A;  4CGZ A;  2KNJ A;  4P0P B;  2F8L A;  2JGA A;  3LVV A;  3ICX A;  2PMZ C;  1NZB A;  4C0Z A;  2F76 X;  2KV2 A;  3T79 A;  1F44 A;  5CRX A;  2K8C B;  2KHV A;  1GO3 F;  3PSP A;  1Q3U A;  2R18 A;  2KIW A;  3SQI A;  4NV0 A;  3E0F A;  4IC9 A;  4OJ6 A;  2KKP A;  2WAQ C;  3SMV A;  2YB1 A;  2LHT A;  2ZXI A;  2WB1 F;  2ZXH A;  2HOI A;  4PL1 A;  4P0Q A;  2ZIU B;  4WJ3 B;  1A0P A;  4NWI A;  4BX9 C;  4U6P A;  3F2D A;  4OJO A;  3N7R C;  5C0Y A;  2HBJ A;  4ACO A;  2E5S A;  2G5I B;  3LVW A;  3ONN A;  2WAQ F;  4NLC A;  4KX5 A;  3VC8 A;  4BUG A;  2XVT A;  3PSF A;  3IN5 A;  3IG8 A;  2JH7 A;  1D8B A;  2OH2 A;  3D2S A;  3PZP A;  3N7P D;  1HIW A;  2RRD A;  2ZIW B;  3IG5 A;  2G07 A;  2G09 A;  2PMZ F;  3SAF A;  1ZQ1 C;  3HKZ C;  2KJ5 A;  4CRX A;  3F2C A;  5HR6 A;  3KFU F;  1L6N A;  2HBL A;  2KHQ A;  4GFJ A;  4OO1 J;  4PL2 A;  2OXO A;  3NRW A;  2KJ9 A;  3DEE A;  2XIC A;  2Y0S F;  1URJ A;  2KEY A;  3GZF A;  2OYY A;  1A6S A;  2CN1 A;  1XNS A;  1P7D A;  3D2N A;  2Q4T A;  3L3F X;  3PSI A;  4JMU A;  3H0L B;  2YX8 A;  2KVC A;  2HOF A;  2OM6 A;  3M7D A;  4QJF B;  4ICA A;  2DF4 B;  4QIW C;  3N7S C;  1HEK A;  1IIP A;  4AYB C;  4QNL A;  3LYS A;  2HMX A;  2G06 A;  2JMG A;  1TAM A;  4BJQ A;  2VIX A;  3IP4 B;  2KJ8 A;  2K4E A;  2W03 A;  1PVR A;  4AYB F;  3NUQ A;  4FZL A;  1XO0 A;  2JHD A;  2LBO A;  1Z19 A;  3F53 A;  3SAG A;  2RP5 A;  2K8A A;  3GU3 A;  2XI9 A;  4NLB A;  1ECW A;  2LYA A;  2E1E A;  1ED1 A;  3ALR A;  3AQE A;  2KOB A;  2ZIV A;  2VJ4 A;  3F2B A;  3HKZ F;  4P0Q B;  2GH1 A;  2W04 A;  2ZIX A;  2H3Z A;  3M6Z A;  2D6F C;  2HBM A;  2Y0S C;  3F5A A;  3F5E A;  1SZH A;  2G08 A;  2ZIV B;  2HBK A;  2E1F A;  3C28 A;  2LYB A;  2ZIX B;  3RF9 A;  5HR7 A;  2MRL A;  3OPX A;  2HOQ A;  2ZIW A;  2BDU A;  4OJ5 A;  1CRX A;  2Z7J A;  2W7P A;  4KMO B;  2VKQ A;  5A0L A;  1YT3 A;  2K89 A;  2ZIU A;  2G5H B;  1Z1B A;  4OJP A;  5KL1 B;  3VCB A;  2GOL A;  4A8E A;  5T14 A;  3M6K A;  3K1Z A;  1UPH A;  2H3F A;  3MGV A;  2XID A;  2F77 X;  2NV3 A;  1Q3V A;  3D2Q A;  1DRG A;  4QIW F;  2KKV A;  4CDG A;  2K4I A;  3AQF A;  1PVP A;  2VJ5 A;  3O0F A;  2CPR A;  2A3V A;  2WB1 C;  2M0N A;  2F2A B;  2KIC A;  3CRX A;  2YB4 A;  2N1R A;  3KZX A;  4FZN A;  2DQN B;  2G0A A;  4U7C A;  4FE3 A;  1KBU A;  2H3V A;  1PVQ A;  2K4H A;  3H0R B;  2LKY A;  1OUQ A;  3PST A;  2W7O A;  2MA1 A;  3RFA A;  4P0P A;  1T94 A;  2K8B B;  3H0M B;  5KL8 B;  4FZM A;  1MA7 A;  2JH1 A;  2RHF A;  2CRX A;  3AL0 B;  3CYM A;  3C29 A;  1WUD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...