2OXOA

Crystallization and structure determination of the core-binding domain of bacteriophage lambda integrase
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
93
structure length
93
Chain Sequence
b'MTLHSWLDRYEKILASRGIKQKTLINYMSKIKAIRRGLPDAPLEDITTKEIAAMLNGYIDEGKAASAKLIRSTLSDAFREAIAEGHITTNHVA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrase
publication title Crystallization and structure determination of the core-binding domain of bacteriophage lambda integrase.
pubmed doi rcsb
source organism Unidentified phage
molecule tags Dna binding protein
total genus 36
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 2007-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02899 Phage_int_SAM_1 Phage integrase, N-terminal SAM-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.130 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2oxoA00
2A3VA 4CRXA 1PVQA 2KJ9A 3NRWA 2HOIA 2KOBA 1Q3UA 2HOFA 1P7DA 2KKPA 3LYSA 3C28A 3MGVA 3C29A 1XNSA 2KEYA 2OXOA 1XO0A 1PVRA 1KBUA 1CRXA 1NZBA 2KD1A 4A8EA 1A0PA 2KJ5A 1PVPA 2KJ8A 2KHVA 2KIWA 1Z19A 1DRGA 1Q3VA 1OUQA 1F44A 5CRXA 2KKVA 1MA7A 1Z1BA 2CRXA 3CRXA 4ACOA 2KHQA
chains in the Genus database with same CATH superfamily
2KN7A 4KLDA 1X6JA 1UA1A 2GOLA 5AM1A 8ICIA 3Q8QB 3BQ7A 3C28A 4OJOA 4CE6A 1A6SA 1SXDA 2YMQA 1M6YA 1SZPA 2MRLA 3C2MA 4KMUA 5KFBA 4NM2A 4UAYA 3TI0A 2DBYA 2D3DA 2IOFA 3T5JA 2NRXA 2FLNA 2PMZC 8ICPA 3QU7A 2IBKA 1NJZA 1ZQOA 4CDGA 1ZQIA 3MR5A 1TAQA 2R8IA 2GH1A 3FAHA 7ICGA 3AQFA 2HBMA 1NZBA 2DKZA 2DQNB 2D8CA 2HHVA 1BGXT 1N63A 4I29A 3ZDCA 1JUDA 1SV0C 5ALYA 5FP0A 3C23A 2BQUA 1URJA 4ZH4A 3VCBA 3V7JA 3OJUA 2ASJA 5DBBA 4F2SA 4FZLA 2XCPA 1TKDA 1N62A 3Q8SB 3RJKA 5CHGA 3RB6A 4J03A 1ZQWA 1SV0A 5L1IA 4DLEA 3NRZA 5HP4A 2K4PA 2PFNA 2BCSA 2NRTA 3DV9A 7ICRA 2Z7JA 4UBCA 2LYHA 5KT5A 4Z6DA 1C20A 4I2JA 3V6KA 2W8LA 5ALZA 4OD0A 2H3FA 5AK6A 5AM2A 3C29A 3RR8A 2F1JA 1TK0A 1AQ6A 5AKLA 2P6RA 4KLQA 4PL2A 4HAIA 1L3VA 4O3RA 1KRPA 2IMWP 2NRWA 1L3TA 3JPNA 5L1MA 1Q3VA 1WCNA 4IQVA 5KFSA 4QNLA 5AKEA 2AQ0A 4DSJA 3RTVA 3KZXA 5AKXA 3C2LA 4RZRA 4QW9A 1EXNA 4KX3A 5AK4A 1QH9A 2JMGA 4QZEA 4ECWA 4EX6A 4UQGA 4YFKA 5ALSA 2ZJ5A 1ZOLA 4FZNA 1QSSA 3ZD8A 3PR4A 1SXEA 1NKCA 2YMMA 5KG3A 1ZRMA 4YCXA 1ZJMA 2WFAA 2EDUA 1ZQTA 4MEYA 2HI0A 4UB1A 3RJHA 3RB3A 1KQQA 3QU5A 4QZCA 4C7YA 1S0VA 5E79U 5J2KA 2NO4A 5KT6A 5AK3A 9ICEA 2K4IA 1SIJA 5ALTA 2VIXA 5ALIA 3MR3A 3WKCA 3QNMA 3MDAA 3J81j 3RBEA 3NVYA 7ICIA 2OHFA 9ICHA 5AKKA 3T79A 4YQWA 4M6WB 1ZQ1C 2YMPA 4Y2VA 8ICFA 4PH5A 2PI5A 3QZ8A 1K5OA 3LK9A 2ZG6A 4F5RA 3UMCA 4JWNA 4IRCA 4PZOA 3TADA 4UAZA 2EQYA 4UASA 1S97A 5CWRA 5J2FA 7ICSA 1ZQJA 4Y2SA 5D4BA 2ZIVA 3ED5A 1TV9A 4TUSA 2HBJA 3AMZA 2QLTA 4MEXA 3K75D 5BOMA 3WK4A 1SGGA 1K1QA 1BVSA 4KMOB 2P6UA 5DDYA 1N60A 3I76A 3KTQA 4F3OA 5KFDA 3ZI4A 2OEHA 2WF7A 4AYBF 2E3TA 3RJIA 4EZ6A 3SQIA 3C21A 4ECSA 5KFTA 3RR7A 5TZVA 1T3NA 1TVAA 3UMBA 4F4ZA 7ICHA 2W3SA 1JMSA 8ICXA 1VDVA 3KBBA 2PXIA 1RQNA 4RQ7A 3BQ2A 5AKGA 1YT3A 3BS7A 3PV8A 4OJPA 4F72A 4O3NA 8ICGA 4K4GA 2P35A 3PNCA 2MUTB 4PGQA 4KTQA 2I6XA 1ZXIA 5DKWA 4OJLA 2QB1A 1L7OA 1COOA 2WF9A 1KFTA 4PHAA 4MFAA 2XI9A 7ICPA 1L7NA 2P66A 1FEZA 2BDUA 1LKYB 5CA7A 7ICJA 2W04A 2ALZA 4YR3A 3JPPA 3EZ5A 4C8OA 5HNKA 1QQ6A 4GXKA 2NV3A 3KHHA 4QZDA 4Y2UA 4Y2YA 4RQ4A 3GZFA 1SWWA 4YXMA 3MC1A 5ALJA 4GXIA 2GO7A 5JU5A 1L8LA 2QKQA 1PZNA 2W54A 3D2NA 4YR2A 2XY5A 5EWEA 1LV5A 2AXTU 2JEJA 4ZOHC 4C4RA 2D6FC 2FJ6A 2K8CB 1HEKA 4EYHB 1JN3A 3H40A 1QQ7A 5AHXA 2M0NA 2WB1F 2KZ3A 1RXWA 3IHQB 4UW9A 2N1RA 2ZUBA 4F4KA 1S76D 1WWVA 5CR0A 1JXLA 3F5EA 2YB4A 4QWEA 3DDHA 5J2BA 1LVHA 3SZ2A 4DL5A 2BQ3A 8ICMA 4DSLA 3QEBZ 3PY8A 2JZBB 2XY7A 2PFPA 3PSPA 1DOQA 2XY6A 3VC8A 5CP2A 4DQSA 4DL4A 3PX6A 8ICUA 5JUMA 4ECRA 4I27A 4DL2A 4XUSA 4JV1A 2G07A 3WK5A 9ICRA 2KK0A 1Q3UA 3B0YA 3IG8A 4F5QA 1KDHA 4DLGA 4EEYA 2OH2A 3M6KA 4O3OA 4YD1A 1N56A 1U45A 1ZQGA 2EZZA 3BQ0A 3SI8A 5F9NA 4ED8A 4GIBA 4U6PA 4YP3A 4I2FA 2G0AA 7ICEA 5HHHA 4ECZA 3RFAA 4KITB 3GIJA 1S0MA 9ICXA 1RZTA 1O08A 1FFUA 3PW4A 8ICYA 3PMLA 4PHPA 5HHIA 3ICXA 1CEZA 2PFQA 2C2EA 9ICNA 1ZJNA 1D8LA 4NV0A 3ZDEA 4IRDA 4U7CA 1J97A 2RDJA 3HJEA 4PL1A 5AM5A 1B22A 4I2BA 2AGPA 1L5UA 4RQ3A 4RQMA 4KLHA 4IL6U 2GLEA 3H0LB 2YMLA 1T3QA 2KJ8A 4EX7A 2KP7A 1N5WA 2C2RA 4MFCA 4F91B 4M2YA 3GIMA 1S5LU 2RP5A 2XGPA 2FMSA 4GC6A 2OCEA 3MGVA 3GV7B 1ZQMA 4KN7A 2CXYA 4YR0A 1ZQPA 4RPXA 3ETRA 3H4DA 3GU3A 3IN5A 7ICNA 3M1YA 3BS5A 3NTUA 9ICKA 2FMPA 3NS1A 4IC9A 5KFCA 3EW9A 4UB6U 2KJ9A 8ICTA 4FO6A 4IR9A 4R64A 3BDPA 1BPZA 2W8KA 3HX0A 2IA6A 3T5LA 1PVRA 5D49A 5KFIA 2O6KA 3KFUF 2ZXHA 4J9NA 1XSNA 5D46A 4UB3A 7ICKA 1L7PA 1SL1A 2KNJA 4RQ1A 1DGSA 3V6JA 2VA3A 3RB4A 3G6YA 1NK4A 5J0SA 3L5KA 1D8BA 4XA5A 3SR6A 4ICAA 3SAHA 7ICVA 1ZQRA 1HUOA 4ECTA 3M7DA 4YXJA 5KFMA 1IXRA 1IM4A 2VA2A 4F5OA 3WK8A 3IRUA 2DF4B 8ICCA 1SL2A 2R8JA 2DKXA 5KNIA 5EWGA 1ZQYA 2WF8A 4K4HA 3PZPA 2YX8A 5KFUA 4M04A 2BHNA 3OJSA 1X66A 5ALUA 5G5GA 3HKZC 2F1IA 4KLUA 4KLSA 2VANA 3OPXA 2JEFA 4LZDA 3LDAA 3FC4A 3SENA 2HBLA 3NASA 3H0RB 3V72A 1TAUA 3HT3A 3M9OB 3UXOA 2XICA 3PW7A 4ECQA 5C5JA 5IIIA 2ZTEA 1BNPA 3JPRA 1KBUA 2FMQA 1RDFA 2YTUA 2KFNA 1KSPA 1SZHA 4NLBA 1JROA 4R65A 2JH1A 3RH4A 5J2HA 3RB0A 1HIWA 2HVIA 1S10A 2F2AB 3M9NB 1ZQBA 4C0ZA 4QZIA 4RNNA 3LWLA 4QIWF 4TURA 3V7LA 3Q8KA 4KLIA 1O03A 4RNOA 4QZHA 1SL0A 3MR2A 3N7RC 3SD7A 2NO5A 3PSIA 4DL7A 2QB0A 2UVRA 4TUQA 4M0AA 4KLOA 4Z6CA 4Y2TA 2HHQA 5IIOA 3F5AA 5ALKA 5JRTA 3UMGA 5ALGA 4PJ0U 5DB7A 3T5KA 3V6HA 4KLEA 1ZQVA 4J9QA 1FFVA 4I2HA 2K4EA 3WKDA 3MDCA 4FE3A 2KOBA 2Y0SF 4NJ8A 1DGJA 9ICOA 5J2AA 4ELUA 4DOBA 2KEYA 3M9MB 3D2QA 4DL6A 2ASLA 4ED2A 3L4PA 4F5PA 1N2XA 1OUQA 1ZQCA 4HYKA 2EZYA 4M9NA 4O3SA 2ZXIA 4NL9C 4OJ6A 1PK3A 4IQWA 4US8A 1DXSA 3NRWA 1A76A 5AIAA 1X42A 2DUYA 2BR0A 4ED0A 3BZKA 2OWOA 4PHEA 4NL9A 1BNOA 9ICWA 3CP8A 4J9RA 2ISOA 2ZJ8A 5DLGA 8ICNA 2EAMA 1VJ5A 5AKZA 3JPSA 3TANA 1NNLA 3KZIU 5CRXA 1T4GA 1XO1A 1TAMA 2BPGA 2V4QA 5DG8A 2ATLA 3IDWA 2JV3A 4JV0A 3H0MB 3B0XA 2JH7A 3PSFA 5AICA 2ZTDA 2LYBA 4UB2A 4XRHA 4NLZA 4DF4A 1MQ3A 1X9WA 5KFVA 2ZUDA 2I5HA 2BCRA 3QZ7A 2MA1A 5EE0A 1SB3C 5GTIU 5KL1B 4B9VA 5J0TA 4RT2A 2KKPA 5AK5A 1ZQKA 4F92B 5J0PA 2ZIWA 2KFZA 4NY8A 5KFHA 1MC8A 1IG6A 4MF2A 1NJWA 4OJ5A 5DLFA 2R8HA 1UT8A 1SKRA 1MQ2A 3CNHA 2W9AA 3ETLA 2G5HB 1ZQXA 5HR7A 2G08A 5ALFA 1UT5A 3AQEA 4DFJA 4Q8EA 3WU2U 1QSYA 1T8EA 5AKJA 9ICCA 4G3IA 4QZAA 2NRVA 3AU6A 1NK8A 4YMMA 3HRDD 1N5XA 4NWIA 3N7SC 4ED1A 1JX4A 2IOHA 2LPEA 1S77D 2KVCA 2MU2A 5F3XB 1NKEA 3BS5B 5KFWA 5DGBA 5BOLA 2V4RA 4P4PA 5KFYA 4C80A 4B9MA 1ZQZA 5ALHA 3OTQA 2JXJA 3TAQA 4Q44A 4O0IA 3OHAA 4RPZA 4J9OA 1OXJA 9ICFA 4J9LA 3RRHA 5ALOA 1LB2B 3UXNA 5KFFA 2C2DA 1ZQFA 5ALDA 3RAXA 2VJ5A 1XSPA 4LVSA 3UXPA 3NUQA 4FFDA 3WKAA 1RG6A 4CRXA 2BDPA 2CN1A 5L1KA 4KLFA 4KX5A 2OM6A 1JI7A 4O3QA 5CEHA 1X40A 2XGQA 2HCFA 3H8JA 4R66A 4C4SA 2HHUA 1S0OA 2GWSA 3B9JA 4CNQA 1XWLA 2UVUA 2HHWA 2ISPA 4B9LA 5AIBA 1ZQQA 9ICIA 3QUTA 5J2IA 1Z1BA 3WKEA 9ICVA 3F2DA 5J2CA 2BPCA 3N7PD 5ALWA 4PZNA 3UQ2A 9ICSA 1AROP 5JTIA 5IIKA 3KKAC 2RHFA 2J6SA 3E0FA 4DEZA 1ZQLA 4B9SA 1CRXA 3PX0A 1A0PA 4TUPA 4FZMA 1D9FA 3KKAA 4BWMA 2QARA 4ED6A 1WUDA 2F3NA 3QU9A 1T94A 3HW8A 5AI0A 2VJ4A 5BPCA 4RQNA 3HWTA 3AM9A 5KG6A 4F93B 5KFJA 2IHMA 4GFJA 4NM1A 1NI3A 8ICEA 5DB9A 3QU2A 2EH9A 3LVVA 5KFZA 4G9BA 5EWFA 2BZFA 3UPQA 3GV8B 4CCHA 2ZUCA 3WK9A 2C28A 2R8GA 2PKEA 2W7OA 4C8LA 5J2JA 2DL0A 4DSEA 1XNSA 2OXOA 1HJPA 5AM4A 2A1JA 4EZ9A 4QZBA 2HW3A 4Z6FA 4OO1J 2HHTA 5KT7A 1NK6A 4Y2JA 4QWCA 4ELVA 1YZ7A 1QQ5A 3RH5A 5ALQA 3OSNA 4F71A 1X9SA 2H3QA 3K1RB 3RJEA 8ICOA 3FDSA 3EYZA 4F8RA 2WAQF 1JXEA 1ZQAA 4YMNA 3D6JA 2KZMA 3QE9Y 4QW8A 8ICRA 5DB6A 2XIDA 3TARA 2HHSA 3DEEA 1KEJA 4QZ8A 3UQ0A 5AKYA 1V9PA 4AYBC 4EYIB 4F5NA 4ED3A 1IV8A 1BPXA 9ICMA 4J9PA 4O3MA 4DQRA 3THVA 1RQLA 2K89A 2HOIA 3Q8LA 4DWIA 5L9XA 3BZCA 3PW2A 2ZJAA 1V85A 4TQSA 3EPIA 1Q8KA 4DFMA 2FLPA 5KFGA 9ICBA 2Q4TA 1TE2A 2UVWA 4O5CA 5AI6A 4FS2A 7ICOA 1KW4A 4RQ2A 4KLTA 3M8RA 4X5VA 2LHTA 5DG9A 2G09A 5IIMA 5DDMA 2K8BB 5KFOA 3ZDBA 1NJXA 5KFPA 8ICZA 5J0OA 1ZD2P 4QJFB 2AGOA 2PMZF 4Q43A 1A77A 3QUQA 2W43A 3TFRA 1MSWD 1OW5A 2DWQA 5G5HA 1BPDA 2KTQA 1QTMA 3G6VA 3T3FA 3SV4A 1RM6C 5HMMA 1U47A 4ECYA 2KHQA 4Y2PA 5AI9A 2DPJA 2E1FA 3ISCA 5IILA 2ZIWB 4RPYA 5DG7A 2JEIA 5AM3A 2LYAA 5F9LA 4UB4A 4NLNA 2WB1C 4QWBA 2FI1A 2J6TA 3KHLA 3ONNA 3C1YA 2NYVA 2K4HA 2WTFA 2KIVA 1JALA 3CYMA 3SEIA 3PO5A 3F53A 7ICLA 3EUB2 2MSNA 4JMUA 2FPLA 9ICTA 3D2SA 2A1AA 3ORYA 3PW0A 2YB1A 3GQCA 4NXZA 1KTQA 5KT4A 3H8SA 3RRGA 3T5HA 2ZIVB 3O0FA 4J9MA 4DSKA 2W7PA 1COKA 7ICQA 5ALMA 1CUKA 1HUZA 2I9GA 1N48A 2E5SA 1XO0A 1ED1A 2MUTA 3MGHA 2AU0A 1WCLA 1ZQDA 5KT2A 2KG5A 2LMRA 3SV3A 4FS1A 4ECUA 8ICBA 2Y9TA 1F44A 4UARA 3L3FX 1FIQA 4M9JA 4CF3A 3QUBA 4KLGA 5J0YA 5KL8B 4JWMA 2ES6A 2HHXA 3JPOA 1BPYA 2R8KA 1GO3F 1SWVA 2DGZA 2HVHA 5EOZA 4QZFA 3WK7A 2FPKA 3ISBA 2ESEA 4DSFA 1Z4OA 4DFPA 4J9SA 2FE9A 5ALPA 3AN1A 4YN4A 3WK6A 1DK2A 3H7IA 1PK1A 1PVQA 4P0PA 2F44A 4EBDA 3KOOA 4UAUA 4DCCA 1UCVA 4YVZA 4ED7A 2AH5A 4DOCA 1ECWA 3RF9A 2B6GA 4KLLA 1RYUA 4IR1A 3NGDA 2YQEA 4EELA 2BGWA 1JRPA 5KFEA 4C7ZA 5KTQA 3MBYA 4I2EA 4R63A 3GIIA 1ZQNA 4GC7A 2K60A 2OYYA 2MAXA 3MGIA 5AKIA 5IINA 1L3SA 3MFIA 4O5KA 3SMVA 5J8YC 4BXOA 3C5GA 5H2FU 2QARB 4DQQA 2WF5A 5J2GA 3G6XA 4B9UA 2JZBA 4MF8A 4P0QA 4ECXA 1H38A 5J8YA 1S9FA 1XC9A 2E1EA 3RAQA 5AI8A 9ICQA 3PO4A 4DFDA 3MFHA 1ZD5A 5C0YA 4M9LA 4I2AA 2W03A 4MFFA 5ALVA 3TAPA 4QWAA 3R9KA 1ZQEA 5KG2A 4RQ6A 1X9XA 2W9CA 2RLTA 3JPQA 4O5EA 2ZIUA 2WF6A 4B6JA 3IM1A 1B0XA 1QSLA 4NLGA 1SKWA 4QZ9A 4DF8A 2I1QA 4I2DA 1UQVA 4I28A 4F4YA 2K8AA 2A1JB 4DL3A 4C8NA 5J0RA 3AU2A 3H8MA 3PX4A 8ICSA 3K1ZA 3I1YA 5KG5A 4DFKA 2L5YA 5ALXA 1UPHA 1Z4NA 2H3ZA 3QU4A 1VLBA 3MR6A 9ICPA 4USAA 1Z00A 4Q45A 4UATA 4IRKA 4PHDA 2W9BA 4JV2A 2F8LA 1PUZA 4IS7A 3ISDA 2RDIA 3C1ZA 2VKQA 4KLJA 3AL0B 4TQRA 1Z19A 1NZPA 5DBAA 5J2EA 4EBCA 2CPRA 1L6NA 2RQ5A 2FDRA 2KSOA 2KVSA 4ACOA 1Q46A 5ALRA 1NK0A 2BPFA 3ZDDA 1BPEA 8ICWA 3LYSA 2HBKA 3ZDAA 3KD3A 3H8WA 2B21A 5J0XA 4IQTA 2JHDA 4DOAA 4QIWC 2AQ4A 9ICUA 4RQ5A 1JIHA 5DGAA 2LM1A 8ICQA 1KLNA 5KFRA 3F2CA 2FLLA 1QLNA 1RXVA 4EENA 1WWUA 4CGZA 4BUGA 2JR5A 3IG5A 2KV2A 5EE9A 5J2DA 3IP4B 3FM9A 5AI5A 8ICLA 5KFXA 5KAFU 3TQ1A 4IQUA 2HOQA 4PGYA 4P4OA 3GILA 1NOMA 3ZD9A 4DO9A 4ECVA 7ICUA 3TADC 4RQ8A 5KG1A 1BPBA 4UB5A 2BCUA 2Y1JA 1ZQUA 5ALLA 3RJJA 5GTHU 2IOFK 2M9NA 1V38A 3QXGA 4YMOA 1CI4A 2Y0SC 2BQRA 3ALRA 4Y2RA 1V97A 1F0MA 5ALNA 4FBTA 7ICFA 4QZGA 4RQ0A 3AEVA 2EAPA 3BQ1A 2NRZA 3N97B 5KFAA 4KN4A 2ZIXA 3JPTA 2JGAA 1F5SA 3HPOA 3M8SA 2E8OA 4E0DA 1NK9A 2C22A 4R8UA 5KFNA 3LVWA 1D9DA 3SYZA 2WHEA 3RJFA 1ZD4A 1ZQSA 2XCAA 2XVTA 4RU9A 4C4TA 7ICTA 1XS9D 3HP6A 4PPXA 2Q0ZX 9ICLA 2E8PA 5DQIA 4CF4A 4F2RA 5KFLA 4CF5A 2BCVA 2JEGA 1U49A 4P4MA 1L8OA 1XU4A 1B4FA 2G5IB 2AJQA 3FYHA 4NLCA 3UM9A 9ICAA 1ZRNA 4UAWA 3QEAZ 2KKVA 2CRXA 2YY6A 3H4BA 5IIJA 3PSTA 4I2IA 3QUCA 8ICAA 1FO4A 4DSIA 2IHNA 1DK3A 2G06A 4WJ3B 3KHGA 5KG7A 4Z6EA 1QCKA 2VA8A 4RT3A 5J0UA 4GLXA 3BJYA 3SAGA 1PK1B 4UAVA 4P0PB 2ODGA 2XC9A 2UVVA 2AGQA 5AKHA 2R18A 5AI4A 3C2KA 8ICVA 1SKSA 8ICKA 1MN8A 4BGDA 5TISU 4JK1A 5KG4A 2YN4A 3Q8MA 2AHOB 1PVPA 1YZ6A 2QB0B 4O9MA 2JRZA 3BQTA 5J0QA 5L1JA 2W11A 3GFKB 3K4GA 1NK5A 1U48A 3PR5B 2H3IA 3NVVA 5B5EU 1J2MA 1N61A 4BXOB 1RYSA 3V7KA 1NJYA 4JB3A 3QYPA 4P0QB 4AP9A 4BJQA 3GV5B 5DQHA 3A0HU 5HMLA 5HR6A 2ZTCA 2W3RA 2KE7A 3KHRA 2F76X 2W55A 8ICHA 1WG8A 2E8MA 3E2EA 3TACB 2A19A 3E58A 5KT3A 5KG0A 2W9MA 3M6ZA 1KFDA 2W9CB 2HSZA 1J2NA 2KJ5A 2ZIUB 5AM0A 3N4MB 2KIWA 2ASDA 4NLKA 4UB8U 3GIKA 1L7MA 4K4IA 3HKZF 3CRXA 2EAOA 2A3VA 2J6UA 4YD2A 4Y2QA 4GXJA 2Y9UA 4C8MA 2LKYA 5J29A 9ICGA 3N28A 5KFQA 5DB8A 4KLMA 4C8KA 1X9MA 1KFSA 1NK7A 4BDPA 1U4BA 3OSPA 4J9KA 4B9NA 4US9A 3GDXA 4DS5A 1Z00B 3C5FA 8ICJA 4ELTA 2H3VA 4BX9C 1NKBA 3RH6A 1Z3EB 2W9BB 4EEKA 2KZZA 2BKEA 1RYRA 4M6WA 4YG2A 1SV4A 4F50A 1TK8A 4QWDA 1X2IA 4Y2XA 5L1LA 1TFRA 3F2BA 2Y1IA 3NVWA 3Q8PB 5EE1A 2BCQA 2KSOB 4LZGA 1U9LA 2V9WA 5EE3A 5K4LA 4UBBA 2B0CA 5ALEA 2PFOA 4I2CA 2F1HA 5KAIU 1P7DA 5DQGA 1RPLA 5DBCA 1TK5A 3NVZA 4Q8FA 4RNMA 2DPIA 1Z1VA 1ZYQA 4MHVA 5J0WA 4M9GA 2KD1A 4A8EA 3S6JA 4I2GA 3TKAA 3U26A 3RJGA 1MA7A 3SAFA 4F4XA 3A0BU 5T14A 1B43A 4EBEA 2LI6A 5CB1A 4O3PA 2HOFA 4PGXA 4LJXA 2F77X 4DS4A 1KN5A 1K1SA 2EZXA 5KFKA 3IV6A 4RUCA 2DFLA 2LM4A 2E8NA 3PMNA 1S8OA 3EPGA 4B9TA 2WAQC 3HILA 3PVXA 2LBOA 2EANA 3LWMA 2HDOA 2PI4A 3WKBA 3OHBA 4JUZA 4P2HA 2HMXA 5CJ7A 1KKXA 9ICJA 2KMDA 5B66U 4FBUA 1C7YA 4XQ8A 1WYGA 4DQIA 2FPMA 2F8KA 1X6IA 2RRDA 1Y88A 1L3UA 1ZD3A 4RUAA 4M47A 4OCZA 1ZETA 3RBDA 3OGUA 1UA0A 3MABA 4BWJA 1UHUA 4F4WA 2H5XA 3TFSA 4M9HA 1S0NA 3PW5A 1D8YA 1KL9A 1LKYA 1ZQHA 1T7PA 3I28A 7ICMA 1IIPA 2ZIXB 2KICA 2KHVA 3Q8RB 1DRGA 5A0LA 3CW2C 4DQPA 3AUOA 4R8UB 3QX7A 2XO7A 1XSLA 3EWAA
chains in the Genus database with same CATH topology
2K4HA 3N7PD 2OYYA 4FE3A 4U7CA 2K89A 2GOLA 2HOIA 2KOBA 2Y0SF 1P7DA 3CYMA 2ZIVA 4KX3A 2RHFA 3LYSA 3C28A 2JMGA 4PL1A 2G5HB 2HBJA 3D2NA 3LVWA 2KEYA 3E0FA 4OJOA 3SMVA 1A6SA 3PZPA 2HBKA 3F53A 3D2QA 5HR7A 2G08A 3H0LB 2MRLA 2YX8A 1CRXA 2D6FC 2KD1A 4JMUA 4A8EA 1A0PA 3AQEA 2K8CB 2KJ8A 1HEKA 4FZMA 4KMOB 2XVTA 4P0QB 3HKZC 3D2SA 4BJQA 1OUQA 2PMZC 2Q4TA 4FZNA 2YB1A 4P0QA 2M0NA 1MA7A 2WB1F 5HR6A 3OPXA 2JHDA 2ZXIA 3SAFA 4AYBF 1WUDA 2N1RA 4QIWC 4OJ6A 5T14A 2RP5A 2E1EA 2HBLA 2F76X 4CDGA 1T94A 2ZIVB 3SQIA 3O0FA 3NRWA 3H0RB 2W7PA 2HOFA 2VJ4A 2F77X 3F2CA 2XICA 3F5EA 2GH1A 4ACOA 3MGVA 2YB4A 3AQFA 2HBMA 2LHTA 4NWIA 5C0YA 2E5SA 2G09A 4CGZA 3N7SC 4GFJA 1XO0A 1ED1A 3M6ZA 4BUGA 1KBUA 2K8BB 2W03A 1NZBA 2DQNB 2G5IB 2KVCA 2KJ5A 2ZIUB 3IG5A 3GU3A 3CP8A 2KIWA 2KV2A 3IN5A 3IP4B 3LVVA 4NLCA 3PSPA 1F44A 3VC8A 2ZIUA 1SZHA 4NLBA 2KKVA 2HOQA 1YT3A 4OJPA 2CRXA 4IC9A 3L3FX 3HKZF 1URJA 4QJFB 2JH1A 3CRXA 2WAQC 2PMZF 3VCBA 5CRXA 2A3VA 2G07A 1HIWA 2LBOA 2F2AB 2KJ9A 5KL8B 4C0ZA 1TAMA 1Q3UA 2K4IA 4QIWF 4FZLA 3PSTA 2W7OA 2LKYA 2HMXA 2K8AA 1GO3F 2DGZA 1XNSA 2OXOA 3IG8A 2VJ5A 2VIXA 1PVRA 2G06A 3NUQA 4WJ3B 3H0MB 3N7RC 2OH2A 3K1ZA 2JH7A 3M6KA 3PSFA 3PSIA 4OJLA 3KFUF 2LYBA 2ZXHA 4OO1J 2RRDA 3SAGA 2Z7JA 1UPHA 2H3VA 2H3ZA 4P0PB 4BX9C 2Y0SC 2H3QA 3ALRA 2KNJA 2KHQA 3T79A 4U6PA 4CRXA 2MA1A 2XI9A 2G0AA 1PVQA 4P0PA 2CN1A 2E1FA 2R18A 5KL1B 2BDUA 1ZQ1C 2WAQF 3F5AA 4KX5A 3RFAA 2H3FA 2KKPA 2OM6A 2ZIWB 3C29A 2F8LA 2W04A 1D8BA 4PL2A 2XIDA 4ICAA 3ICXA 2ZIWA 2LYAA 3DEEA 1ECWA 3RF9A 3SAHA 2VKQA 1IIPA 2ZIXB 1PVPA 2KICA 3AL0B 2WB1C 2KHVA 3M7DA 2ZG6A 1Z19A 1DRGA 4AYBC 3F2BA 1Q3VA 5A0LA 2CPRA 4OJ5A 1L6NA 2ZIXA 2NV3A 2JGAA 4QNLA 1Z1BA 4O3MA 3ONNA 4NV0A 2DF4B 3KZXA 3F2DA 3GZFA 2H3IA 2K4EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A3V A;  4CRX A;  1PVQ A;  2KJ9 A;  3NRW A;  2HOI A;  2KOB A;  1Q3U A;  2HOF A;  1P7D A;  2KKP A;  3LYS A;  3C28 A;  3MGV A;  3C29 A;  1XNS A;  2KEY A;  2OXO A;  1XO0 A;  1PVR A;  1KBU A;  1CRX A;  1NZB A;  2KD1 A;  4A8E A;  1A0P A;  2KJ5 A;  1PVP A;  2KJ8 A;  2KHV A;  2KIW A;  1Z19 A;  1DRG A;  1Q3V A;  1OUQ A;  1F44 A;  5CRX A;  2KKV A;  1MA7 A;  1Z1B A;  2CRX A;  3CRX A;  4ACO A;  2KHQ A; 
#chains in the Genus database with same CATH topology
 2KN7 A;  4KLD A;  1X6J A;  1UA1 A;  2GOL A;  5AM1 A;  8ICI A;  3Q8Q B;  3BQ7 A;  3C28 A;  4OJO A;  4CE6 A;  1A6S A;  1SXD A;  2YMQ A;  1M6Y A;  1SZP A;  2MRL A;  3C2M A;  4KMU A;  5KFB A;  4NM2 A;  4UAY A;  3TI0 A;  2DBY A;  2D3D A;  2IOF A;  3T5J A;  2NRX A;  2FLN A;  2PMZ C;  8ICP A;  3QU7 A;  2IBK A;  1NJZ A;  1ZQO A;  4CDG A;  1ZQI A;  3MR5 A;  1TAQ A;  2R8I A;  2GH1 A;  3FAH A;  7ICG A;  3AQF A;  2HBM A;  1NZB A;  2DKZ A;  2DQN B;  2D8C A;  2HHV A;  1BGX T;  1N63 A;  4I29 A;  3ZDC A;  1JUD A;  1SV0 C;  5ALY A;  5FP0 A;  3C23 A;  2BQU A;  1URJ A;  4ZH4 A;  3VCB A;  3V7J A;  3OJU A;  2ASJ A;  5DBB A;  4F2S A;  4FZL A;  2XCP A;  1TKD A;  1N62 A;  3Q8S B;  3RJK A;  5CHG A;  3RB6 A;  4J03 A;  1ZQW A;  1SV0 A;  5L1I A;  4DLE A;  3NRZ A;  5HP4 A;  2K4P A;  2PFN A;  2BCS A;  2NRT A;  3DV9 A;  7ICR A;  2Z7J A;  4UBC A;  2LYH A;  5KT5 A;  4Z6D A;  1C20 A;  4I2J A;  3V6K A;  2W8L A;  5ALZ A;  4OD0 A;  2H3F A;  5AK6 A;  5AM2 A;  3C29 A;  3RR8 A;  2F1J A;  1TK0 A;  1AQ6 A;  5AKL A;  2P6R A;  4KLQ A;  4PL2 A;  4HAI A;  1L3V A;  4O3R A;  1KRP A;  2IMW P;  2NRW A;  1L3T A;  3JPN A;  5L1M A;  1Q3V A;  1WCN A;  4IQV A;  5KFS A;  4QNL A;  5AKE A;  2AQ0 A;  4DSJ A;  3RTV A;  3KZX A;  5AKX A;  3C2L A;  4RZR A;  4QW9 A;  1EXN A;  4KX3 A;  5AK4 A;  1QH9 A;  2JMG A;  4QZE A;  4ECW A;  4EX6 A;  4UQG A;  4YFK A;  5ALS A;  2ZJ5 A;  1ZOL A;  4FZN A;  1QSS A;  3ZD8 A;  3PR4 A;  1SXE A;  1NKC A;  2YMM A;  5KG3 A;  1ZRM A;  4YCX A;  1ZJM A;  2WFA A;  2EDU A;  1ZQT A;  4MEY A;  2HI0 A;  4UB1 A;  3RJH A;  3RB3 A;  1KQQ A;  3QU5 A;  4QZC A;  4C7Y A;  1S0V A;  5E79 U;  5J2K A;  2NO4 A;  5KT6 A;  5AK3 A;  9ICE A;  2K4I A;  1SIJ A;  5ALT A;  2VIX A;  5ALI A;  3MR3 A;  3WKC A;  3QNM A;  3MDA A;  3J81 j;  3RBE A;  3NVY A;  7ICI A;  2OHF A;  9ICH A;  5AKK A;  3T79 A;  4YQW A;  4M6W B;  1ZQ1 C;  2YMP A;  4Y2V A;  8ICF A;  4PH5 A;  2PI5 A;  3QZ8 A;  1K5O A;  3LK9 A;  2ZG6 A;  4F5R A;  3UMC A;  4JWN A;  4IRC A;  4PZO A;  3TAD A;  4UAZ A;  2EQY A;  4UAS A;  1S97 A;  5CWR A;  5J2F A;  7ICS A;  1ZQJ A;  4Y2S A;  5D4B A;  2ZIV A;  3ED5 A;  1TV9 A;  4TUS A;  2HBJ A;  3AMZ A;  2QLT A;  4MEX A;  3K75 D;  5BOM A;  3WK4 A;  1SGG A;  1K1Q A;  1BVS A;  4KMO B;  2P6U A;  5DDY A;  1N60 A;  3I76 A;  3KTQ A;  4F3O A;  5KFD A;  3ZI4 A;  2OEH A;  2WF7 A;  4AYB F;  2E3T A;  3RJI A;  4EZ6 A;  3SQI A;  3C21 A;  4ECS A;  5KFT A;  3RR7 A;  5TZV A;  1T3N A;  1TVA A;  3UMB A;  4F4Z A;  7ICH A;  2W3S A;  1JMS A;  8ICX A;  1VDV A;  3KBB A;  2PXI A;  1RQN A;  4RQ7 A;  3BQ2 A;  5AKG A;  1YT3 A;  3BS7 A;  3PV8 A;  4OJP A;  4F72 A;  4O3N A;  8ICG A;  4K4G A;  2P35 A;  3PNC A;  2MUT B;  4PGQ A;  4KTQ A;  2I6X A;  1ZXI A;  5DKW A;  4OJL A;  2QB1 A;  1L7O A;  1COO A;  2WF9 A;  1KFT A;  4PHA A;  4MFA A;  2XI9 A;  7ICP A;  1L7N A;  2P66 A;  1FEZ A;  2BDU A;  1LKY B;  5CA7 A;  7ICJ A;  2W04 A;  2ALZ A;  4YR3 A;  3JPP A;  3EZ5 A;  4C8O A;  5HNK A;  1QQ6 A;  4GXK A;  2NV3 A;  3KHH A;  4QZD A;  4Y2U A;  4Y2Y A;  4RQ4 A;  3GZF A;  1SWW A;  4YXM A;  3MC1 A;  5ALJ A;  4GXI A;  2GO7 A;  5JU5 A;  1L8L A;  2QKQ A;  1PZN A;  2W54 A;  3D2N A;  4YR2 A;  2XY5 A;  5EWE A;  1LV5 A;  2AXT U;  2JEJ A;  4ZOH C;  4C4R A;  2D6F C;  2FJ6 A;  2K8C B;  1HEK A;  4EYH B;  1JN3 A;  3H40 A;  1QQ7 A;  5AHX A;  2M0N A;  2WB1 F;  2KZ3 A;  1RXW A;  3IHQ B;  4UW9 A;  2N1R A;  2ZUB A;  4F4K A;  1S76 D;  1WWV A;  5CR0 A;  1JXL A;  3F5E A;  2YB4 A;  4QWE A;  3DDH A;  5J2B A;  1LVH A;  3SZ2 A;  4DL5 A;  2BQ3 A;  8ICM A;  4DSL A;  3QEB Z;  3PY8 A;  2JZB B;  2XY7 A;  2PFP A;  3PSP A;  1DOQ A;  2XY6 A;  3VC8 A;  5CP2 A;  4DQS A;  4DL4 A;  3PX6 A;  8ICU A;  5JUM A;  4ECR A;  4I27 A;  4DL2 A;  4XUS A;  4JV1 A;  2G07 A;  3WK5 A;  9ICR A;  2KK0 A;  1Q3U A;  3B0Y A;  3IG8 A;  4F5Q A;  1KDH A;  4DLG A;  4EEY A;  2OH2 A;  3M6K A;  4O3O A;  4YD1 A;  1N56 A;  1U45 A;  1ZQG A;  2EZZ A;  3BQ0 A;  3SI8 A;  5F9N A;  4ED8 A;  4GIB A;  4U6P A;  4YP3 A;  4I2F A;  2G0A A;  7ICE A;  5HHH A;  4ECZ A;  3RFA A;  4KIT B;  3GIJ A;  1S0M A;  9ICX A;  1RZT A;  1O08 A;  1FFU A;  3PW4 A;  8ICY A;  3PML A;  4PHP A;  5HHI A;  3ICX A;  1CEZ A;  2PFQ A;  2C2E A;  9ICN A;  1ZJN A;  1D8L A;  4NV0 A;  3ZDE A;  4IRD A;  4U7C A;  1J97 A;  2RDJ A;  3HJE A;  4PL1 A;  5AM5 A;  1B22 A;  4I2B A;  2AGP A;  1L5U A;  4RQ3 A;  4RQM A;  4KLH A;  4IL6 U;  2GLE A;  3H0L B;  2YML A;  1T3Q A;  2KJ8 A;  4EX7 A;  2KP7 A;  1N5W A;  2C2R A;  4MFC A;  4F91 B;  4M2Y A;  3GIM A;  1S5L U;  2RP5 A;  2XGP A;  2FMS A;  4GC6 A;  2OCE A;  3MGV A;  3GV7 B;  1ZQM A;  4KN7 A;  2CXY A;  4YR0 A;  1ZQP A;  4RPX A;  3ETR A;  3H4D A;  3GU3 A;  3IN5 A;  7ICN A;  3M1Y A;  3BS5 A;  3NTU A;  9ICK A;  2FMP A;  3NS1 A;  4IC9 A;  5KFC A;  3EW9 A;  4UB6 U;  2KJ9 A;  8ICT A;  4FO6 A;  4IR9 A;  4R64 A;  3BDP A;  1BPZ A;  2W8K A;  3HX0 A;  2IA6 A;  3T5L A;  1PVR A;  5D49 A;  5KFI A;  2O6K A;  3KFU F;  2ZXH A;  4J9N A;  1XSN A;  5D46 A;  4UB3 A;  7ICK A;  1L7P A;  1SL1 A;  2KNJ A;  4RQ1 A;  1DGS A;  3V6J A;  2VA3 A;  3RB4 A;  3G6Y A;  1NK4 A;  5J0S A;  3L5K A;  1D8B A;  4XA5 A;  3SR6 A;  4ICA A;  3SAH A;  7ICV A;  1ZQR A;  1HUO A;  4ECT A;  3M7D A;  4YXJ A;  5KFM A;  1IXR A;  1IM4 A;  2VA2 A;  4F5O A;  3WK8 A;  3IRU A;  2DF4 B;  8ICC A;  1SL2 A;  2R8J A;  2DKX A;  5KNI A;  5EWG A;  1ZQY A;  2WF8 A;  4K4H A;  3PZP A;  2YX8 A;  5KFU A;  4M04 A;  2BHN A;  3OJS A;  1X66 A;  5ALU A;  5G5G A;  3HKZ C;  2F1I A;  4KLU A;  4KLS A;  2VAN A;  3OPX A;  2JEF A;  4LZD A;  3LDA A;  3FC4 A;  3SEN A;  2HBL A;  3NAS A;  3H0R B;  3V72 A;  1TAU A;  3HT3 A;  3M9O B;  3UXO A;  2XIC A;  3PW7 A;  4ECQ A;  5C5J A;  5III A;  2ZTE A;  1BNP A;  3JPR A;  1KBU A;  2FMQ A;  1RDF A;  2YTU A;  2KFN A;  1KSP A;  1SZH A;  4NLB A;  1JRO A;  4R65 A;  2JH1 A;  3RH4 A;  5J2H A;  3RB0 A;  1HIW A;  2HVI A;  1S10 A;  2F2A B;  3M9N B;  1ZQB A;  4C0Z A;  4QZI A;  4RNN A;  3LWL A;  4QIW F;  4TUR A;  3V7L A;  3Q8K A;  4KLI A;  1O03 A;  4RNO A;  4QZH A;  1SL0 A;  3MR2 A;  3N7R C;  3SD7 A;  2NO5 A;  3PSI A;  4DL7 A;  2QB0 A;  2UVR A;  4TUQ A;  4M0A A;  4KLO A;  4Z6C A;  4Y2T A;  2HHQ A;  5IIO A;  3F5A A;  5ALK A;  5JRT A;  3UMG A;  5ALG A;  4PJ0 U;  5DB7 A;  3T5K A;  3V6H A;  4KLE A;  1ZQV A;  4J9Q A;  1FFV A;  4I2H A;  2K4E A;  3WKD A;  3MDC A;  4FE3 A;  2KOB A;  2Y0S F;  4NJ8 A;  1DGJ A;  9ICO A;  5J2A A;  4ELU A;  4DOB A;  2KEY A;  3M9M B;  3D2Q A;  4DL6 A;  2ASL A;  4ED2 A;  3L4P A;  4F5P A;  1N2X A;  1OUQ A;  1ZQC A;  4HYK A;  2EZY A;  4M9N A;  4O3S A;  2ZXI A;  4NL9 C;  4OJ6 A;  1PK3 A;  4IQW A;  4US8 A;  1DXS A;  3NRW A;  1A76 A;  5AIA A;  1X42 A;  2DUY A;  2BR0 A;  4ED0 A;  3BZK A;  2OWO A;  4PHE A;  4NL9 A;  1BNO A;  9ICW A;  3CP8 A;  4J9R A;  2ISO A;  2ZJ8 A;  5DLG A;  8ICN A;  2EAM A;  1VJ5 A;  5AKZ A;  3JPS A;  3TAN A;  1NNL A;  3KZI U;  5CRX A;  1T4G A;  1XO1 A;  1TAM A;  2BPG A;  2V4Q A;  5DG8 A;  2ATL A;  3IDW A;  2JV3 A;  4JV0 A;  3H0M B;  3B0X A;  2JH7 A;  3PSF A;  5AIC A;  2ZTD A;  2LYB A;  4UB2 A;  4XRH A;  4NLZ A;  4DF4 A;  1MQ3 A;  1X9W A;  5KFV A;  2ZUD A;  2I5H A;  2BCR A;  3QZ7 A;  2MA1 A;  5EE0 A;  1SB3 C;  5GTI U;  5KL1 B;  4B9V A;  5J0T A;  4RT2 A;  2KKP A;  5AK5 A;  1ZQK A;  4F92 B;  5J0P A;  2ZIW A;  2KFZ A;  4NY8 A;  5KFH A;  1MC8 A;  1IG6 A;  4MF2 A;  1NJW A;  4OJ5 A;  5DLF A;  2R8H A;  1UT8 A;  1SKR A;  1MQ2 A;  3CNH A;  2W9A A;  3ETL A;  2G5H B;  1ZQX A;  5HR7 A;  2G08 A;  5ALF A;  1UT5 A;  3AQE A;  4DFJ A;  4Q8E A;  3WU2 U;  1QSY A;  1T8E A;  5AKJ A;  9ICC A;  4G3I A;  4QZA A;  2NRV A;  3AU6 A;  1NK8 A;  4YMM A;  3HRD D;  1N5X A;  4NWI A;  3N7S C;  4ED1 A;  1JX4 A;  2IOH A;  2LPE A;  1S77 D;  2KVC A;  2MU2 A;  5F3X B;  1NKE A;  3BS5 B;  5KFW A;  5DGB A;  5BOL A;  2V4R A;  4P4P A;  5KFY A;  4C80 A;  4B9M A;  1ZQZ A;  5ALH A;  3OTQ A;  2JXJ A;  3TAQ A;  4Q44 A;  4O0I A;  3OHA A;  4RPZ A;  4J9O A;  1OXJ A;  9ICF A;  4J9L A;  3RRH A;  5ALO A;  1LB2 B;  3UXN A;  5KFF A;  2C2D A;  1ZQF A;  5ALD A;  3RAX A;  2VJ5 A;  1XSP A;  4LVS A;  3UXP A;  3NUQ A;  4FFD A;  3WKA A;  1RG6 A;  4CRX A;  2BDP A;  2CN1 A;  5L1K A;  4KLF A;  4KX5 A;  2OM6 A;  1JI7 A;  4O3Q A;  5CEH A;  1X40 A;  2XGQ A;  2HCF A;  3H8J A;  4R66 A;  4C4S A;  2HHU A;  1S0O A;  2GWS A;  3B9J A;  4CNQ A;  1XWL A;  2UVU A;  2HHW A;  2ISP A;  4B9L A;  5AIB A;  1ZQQ A;  9ICI A;  3QUT A;  5J2I A;  1Z1B A;  3WKE A;  9ICV A;  3F2D A;  5J2C A;  2BPC A;  3N7P D;  5ALW A;  4PZN A;  3UQ2 A;  9ICS A;  1ARO P;  5JTI A;  5IIK A;  3KKA C;  2RHF A;  2J6S A;  3E0F A;  4DEZ A;  1ZQL A;  4B9S A;  1CRX A;  3PX0 A;  1A0P A;  4TUP A;  4FZM A;  1D9F A;  3KKA A;  4BWM A;  2QAR A;  4ED6 A;  1WUD A;  2F3N A;  3QU9 A;  1T94 A;  3HW8 A;  5AI0 A;  2VJ4 A;  5BPC A;  4RQN A;  3HWT A;  3AM9 A;  5KG6 A;  4F93 B;  5KFJ A;  2IHM A;  4GFJ A;  4NM1 A;  1NI3 A;  8ICE A;  5DB9 A;  3QU2 A;  2EH9 A;  3LVV A;  5KFZ A;  4G9B A;  5EWF A;  2BZF A;  3UPQ A;  3GV8 B;  4CCH A;  2ZUC A;  3WK9 A;  2C28 A;  2R8G A;  2PKE A;  2W7O A;  4C8L A;  5J2J A;  2DL0 A;  4DSE A;  1XNS A;  2OXO A;  1HJP A;  5AM4 A;  2A1J A;  4EZ9 A;  4QZB A;  2HW3 A;  4Z6F A;  4OO1 J;  2HHT A;  5KT7 A;  1NK6 A;  4Y2J A;  4QWC A;  4ELV A;  1YZ7 A;  1QQ5 A;  3RH5 A;  5ALQ A;  3OSN A;  4F71 A;  1X9S A;  2H3Q A;  3K1R B;  3RJE A;  8ICO A;  3FDS A;  3EYZ A;  4F8R A;  2WAQ F;  1JXE A;  1ZQA A;  4YMN A;  3D6J A;  2KZM A;  3QE9 Y;  4QW8 A;  8ICR A;  5DB6 A;  2XID A;  3TAR A;  2HHS A;  3DEE A;  1KEJ A;  4QZ8 A;  3UQ0 A;  5AKY A;  1V9P A;  4AYB C;  4EYI B;  4F5N A;  4ED3 A;  1IV8 A;  1BPX A;  9ICM A;  4J9P A;  4O3M A;  4DQR A;  3THV A;  1RQL A;  2K89 A;  2HOI A;  3Q8L A;  4DWI A;  5L9X A;  3BZC A;  3PW2 A;  2ZJA A;  1V85 A;  4TQS A;  3EPI A;  1Q8K A;  4DFM A;  2FLP A;  5KFG A;  9ICB A;  2Q4T A;  1TE2 A;  2UVW A;  4O5C A;  5AI6 A;  4FS2 A;  7ICO A;  1KW4 A;  4RQ2 A;  4KLT A;  3M8R A;  4X5V A;  2LHT A;  5DG9 A;  2G09 A;  5IIM A;  5DDM A;  2K8B B;  5KFO A;  3ZDB A;  1NJX A;  5KFP A;  8ICZ A;  5J0O A;  1ZD2 P;  4QJF B;  2AGO A;  2PMZ F;  4Q43 A;  1A77 A;  3QUQ A;  2W43 A;  3TFR A;  1MSW D;  1OW5 A;  2DWQ A;  5G5H A;  1BPD A;  2KTQ A;  1QTM A;  3G6V A;  3T3F A;  3SV4 A;  1RM6 C;  5HMM A;  1U47 A;  4ECY A;  2KHQ A;  4Y2P A;  5AI9 A;  2DPJ A;  2E1F A;  3ISC A;  5IIL A;  2ZIW B;  4RPY A;  5DG7 A;  2JEI A;  5AM3 A;  2LYA A;  5F9L A;  4UB4 A;  4NLN A;  2WB1 C;  4QWB A;  2FI1 A;  2J6T A;  3KHL A;  3ONN A;  3C1Y A;  2NYV A;  2K4H A;  2WTF A;  2KIV A;  1JAL A;  3CYM A;  3SEI A;  3PO5 A;  3F53 A;  7ICL A;  3EUB 2;  2MSN A;  4JMU A;  2FPL A;  9ICT A;  3D2S A;  2A1A A;  3ORY A;  3PW0 A;  2YB1 A;  3GQC A;  4NXZ A;  1KTQ A;  5KT4 A;  3H8S A;  3RRG A;  3T5H A;  2ZIV B;  3O0F A;  4J9M A;  4DSK A;  2W7P A;  1COK A;  7ICQ A;  5ALM A;  1CUK A;  1HUZ A;  2I9G A;  1N48 A;  2E5S A;  1XO0 A;  1ED1 A;  2MUT A;  3MGH A;  2AU0 A;  1WCL A;  1ZQD A;  5KT2 A;  2KG5 A;  2LMR A;  3SV3 A;  4FS1 A;  4ECU A;  8ICB A;  2Y9T A;  1F44 A;  4UAR A;  3L3F X;  1FIQ A;  4M9J A;  4CF3 A;  3QUB A;  4KLG A;  5J0Y A;  5KL8 B;  4JWM A;  2ES6 A;  2HHX A;  3JPO A;  1BPY A;  2R8K A;  1GO3 F;  1SWV A;  2DGZ A;  2HVH A;  5EOZ A;  4QZF A;  3WK7 A;  2FPK A;  3ISB A;  2ESE A;  4DSF A;  1Z4O A;  4DFP A;  4J9S A;  2FE9 A;  5ALP A;  3AN1 A;  4YN4 A;  3WK6 A;  1DK2 A;  3H7I A;  1PK1 A;  1PVQ A;  4P0P A;  2F44 A;  4EBD A;  3KOO A;  4UAU A;  4DCC A;  1UCV A;  4YVZ A;  4ED7 A;  2AH5 A;  4DOC A;  1ECW A;  3RF9 A;  2B6G A;  4KLL A;  1RYU A;  4IR1 A;  3NGD A;  2YQE A;  4EEL A;  2BGW A;  1JRP A;  5KFE A;  4C7Z A;  5KTQ A;  3MBY A;  4I2E A;  4R63 A;  3GII A;  1ZQN A;  4GC7 A;  2K60 A;  2OYY A;  2MAX A;  3MGI A;  5AKI A;  5IIN A;  1L3S A;  3MFI A;  4O5K A;  3SMV A;  5J8Y C;  4BXO A;  3C5G A;  5H2F U;  2QAR B;  4DQQ A;  2WF5 A;  5J2G A;  3G6X A;  4B9U A;  2JZB A;  4MF8 A;  4P0Q A;  4ECX A;  1H38 A;  5J8Y A;  1S9F A;  1XC9 A;  2E1E A;  3RAQ A;  5AI8 A;  9ICQ A;  3PO4 A;  4DFD A;  3MFH A;  1ZD5 A;  5C0Y A;  4M9L A;  4I2A A;  2W03 A;  4MFF A;  5ALV A;  3TAP A;  4QWA A;  3R9K A;  1ZQE A;  5KG2 A;  4RQ6 A;  1X9X A;  2W9C A;  2RLT A;  3JPQ A;  4O5E A;  2ZIU A;  2WF6 A;  4B6J A;  3IM1 A;  1B0X A;  1QSL A;  4NLG A;  1SKW A;  4QZ9 A;  4DF8 A;  2I1Q A;  4I2D A;  1UQV A;  4I28 A;  4F4Y A;  2K8A A;  2A1J B;  4DL3 A;  4C8N A;  5J0R A;  3AU2 A;  3H8M A;  3PX4 A;  8ICS A;  3K1Z A;  3I1Y A;  5KG5 A;  4DFK A;  2L5Y A;  5ALX A;  1UPH A;  1Z4N A;  2H3Z A;  3QU4 A;  1VLB A;  3MR6 A;  9ICP A;  4USA A;  1Z00 A;  4Q45 A;  4UAT A;  4IRK A;  4PHD A;  2W9B A;  4JV2 A;  2F8L A;  1PUZ A;  4IS7 A;  3ISD A;  2RDI A;  3C1Z A;  2VKQ A;  4KLJ A;  3AL0 B;  4TQR A;  1Z19 A;  1NZP A;  5DBA A;  5J2E A;  4EBC A;  2CPR A;  1L6N A;  2RQ5 A;  2FDR A;  2KSO A;  2KVS A;  4ACO A;  1Q46 A;  5ALR A;  1NK0 A;  2BPF A;  3ZDD A;  1BPE A;  8ICW A;  3LYS A;  2HBK A;  3ZDA A;  3KD3 A;  3H8W A;  2B21 A;  5J0X A;  4IQT A;  2JHD A;  4DOA A;  4QIW C;  2AQ4 A;  9ICU A;  4RQ5 A;  1JIH A;  5DGA A;  2LM1 A;  8ICQ A;  1KLN A;  5KFR A;  3F2C A;  2FLL A;  1QLN A;  1RXV A;  4EEN A;  1WWU A;  4CGZ A;  4BUG A;  2JR5 A;  3IG5 A;  2KV2 A;  5EE9 A;  5J2D A;  3IP4 B;  3FM9 A;  5AI5 A;  8ICL A;  5KFX A;  5KAF U;  3TQ1 A;  4IQU A;  2HOQ A;  4PGY A;  4P4O A;  3GIL A;  1NOM A;  3ZD9 A;  4DO9 A;  4ECV A;  7ICU A;  3TAD C;  4RQ8 A;  5KG1 A;  1BPB A;  4UB5 A;  2BCU A;  2Y1J A;  1ZQU A;  5ALL A;  3RJJ A;  5GTH U;  2IOF K;  2M9N A;  1V38 A;  3QXG A;  4YMO A;  1CI4 A;  2Y0S C;  2BQR A;  3ALR A;  4Y2R A;  1V97 A;  1F0M A;  5ALN A;  4FBT A;  7ICF A;  4QZG A;  4RQ0 A;  3AEV A;  2EAP A;  3BQ1 A;  2NRZ A;  3N97 B;  5KFA A;  4KN4 A;  2ZIX A;  3JPT A;  2JGA A;  1F5S A;  3HPO A;  3M8S A;  2E8O A;  4E0D A;  1NK9 A;  2C22 A;  4R8U A;  5KFN A;  3LVW A;  1D9D A;  3SYZ A;  2WHE A;  3RJF A;  1ZD4 A;  1ZQS A;  2XCA A;  2XVT A;  4RU9 A;  4C4T A;  7ICT A;  1XS9 D;  3HP6 A;  4PPX A;  2Q0Z X;  9ICL A;  2E8P A;  5DQI A;  4CF4 A;  4F2R A;  5KFL A;  4CF5 A;  2BCV A;  2JEG A;  1U49 A;  4P4M A;  1L8O A;  1XU4 A;  1B4F A;  2G5I B;  2AJQ A;  3FYH A;  4NLC A;  3UM9 A;  9ICA A;  1ZRN A;  4UAW A;  3QEA Z;  2KKV A;  2CRX A;  2YY6 A;  3H4B A;  5IIJ A;  3PST A;  4I2I A;  3QUC A;  8ICA A;  1FO4 A;  4DSI A;  2IHN A;  1DK3 A;  2G06 A;  4WJ3 B;  3KHG A;  5KG7 A;  4Z6E A;  1QCK A;  2VA8 A;  4RT3 A;  5J0U A;  4GLX A;  3BJY A;  3SAG A;  1PK1 B;  4UAV A;  4P0P B;  2ODG A;  2XC9 A;  2UVV A;  2AGQ A;  5AKH A;  2R18 A;  5AI4 A;  3C2K A;  8ICV A;  1SKS A;  8ICK A;  1MN8 A;  4BGD A;  5TIS U;  4JK1 A;  5KG4 A;  2YN4 A;  3Q8M A;  2AHO B;  1PVP A;  1YZ6 A;  2QB0 B;  4O9M A;  2JRZ A;  3BQT A;  5J0Q A;  5L1J A;  2W11 A;  3GFK B;  3K4G A;  1NK5 A;  1U48 A;  3PR5 B;  2H3I A;  3NVV A;  5B5E U;  1J2M A;  1N61 A;  4BXO B;  1RYS A;  3V7K A;  1NJY A;  4JB3 A;  3QYP A;  4P0Q B;  4AP9 A;  4BJQ A;  3GV5 B;  5DQH A;  3A0H U;  5HML A;  5HR6 A;  2ZTC A;  2W3R A;  2KE7 A;  3KHR A;  2F76 X;  2W55 A;  8ICH A;  1WG8 A;  2E8M A;  3E2E A;  3TAC B;  2A19 A;  3E58 A;  5KT3 A;  5KG0 A;  2W9M A;  3M6Z A;  1KFD A;  2W9C B;  2HSZ A;  1J2N A;  2KJ5 A;  2ZIU B;  5AM0 A;  3N4M B;  2KIW A;  2ASD A;  4NLK A;  4UB8 U;  3GIK A;  1L7M A;  4K4I A;  3HKZ F;  3CRX A;  2EAO A;  2A3V A;  2J6U A;  4YD2 A;  4Y2Q A;  4GXJ A;  2Y9U A;  4C8M A;  2LKY A;  5J29 A;  9ICG A;  3N28 A;  5KFQ A;  5DB8 A;  4KLM A;  4C8K A;  1X9M A;  1KFS A;  1NK7 A;  4BDP A;  1U4B A;  3OSP A;  4J9K A;  4B9N A;  4US9 A;  3GDX A;  4DS5 A;  1Z00 B;  3C5F A;  8ICJ A;  4ELT A;  2H3V A;  4BX9 C;  1NKB A;  3RH6 A;  1Z3E B;  2W9B B;  4EEK A;  2KZZ A;  2BKE A;  1RYR A;  4M6W A;  4YG2 A;  1SV4 A;  4F50 A;  1TK8 A;  4QWD A;  1X2I A;  4Y2X A;  5L1L A;  1TFR A;  3F2B A;  2Y1I A;  3NVW A;  3Q8P B;  5EE1 A;  2BCQ A;  2KSO B;  4LZG A;  1U9L A;  2V9W A;  5EE3 A;  5K4L A;  4UBB A;  2B0C A;  5ALE A;  2PFO A;  4I2C A;  2F1H A;  5KAI U;  1P7D A;  5DQG A;  1RPL A;  5DBC A;  1TK5 A;  3NVZ A;  4Q8F A;  4RNM A;  2DPI A;  1Z1V A;  1ZYQ A;  4MHV A;  5J0W A;  4M9G A;  2KD1 A;  4A8E A;  3S6J A;  4I2G A;  3TKA A;  3U26 A;  3RJG A;  1MA7 A;  3SAF A;  4F4X A;  3A0B U;  5T14 A;  1B43 A;  4EBE A;  2LI6 A;  5CB1 A;  4O3P A;  2HOF A;  4PGX A;  4LJX A;  2F77 X;  4DS4 A;  1KN5 A;  1K1S A;  2EZX A;  5KFK A;  3IV6 A;  4RUC A;  2DFL A;  2LM4 A;  2E8N A;  3PMN A;  1S8O A;  3EPG A;  4B9T A;  2WAQ C;  3HIL A;  3PVX A;  2LBO A;  2EAN A;  3LWM A;  2HDO A;  2PI4 A;  3WKB A;  3OHB A;  4JUZ A;  4P2H A;  2HMX A;  5CJ7 A;  1KKX A;  9ICJ A;  2KMD A;  5B66 U;  4FBU A;  1C7Y A;  4XQ8 A;  1WYG A;  4DQI A;  2FPM A;  2F8K A;  1X6I A;  2RRD A;  1Y88 A;  1L3U A;  1ZD3 A;  4RUA A;  4M47 A;  4OCZ A;  1ZET A;  3RBD A;  3OGU A;  1UA0 A;  3MAB A;  4BWJ A;  1UHU A;  4F4W A;  2H5X A;  3TFS A;  4M9H A;  1S0N A;  3PW5 A;  1D8Y A;  1KL9 A;  1LKY A;  1ZQH A;  1T7P A;  3I28 A;  7ICM A;  1IIP A;  2ZIX B;  2KIC A;  2KHV A;  3Q8R B;  1DRG A;  5A0L A;  3CW2 C;  4DQP A;  3AUO A;  4R8U B;  3QX7 A;  2XO7 A;  1XSL A;  3EWA A; 
#chains in the Genus database with same CATH homology
 2K4H A;  3N7P D;  2OYY A;  4FE3 A;  4U7C A;  2K89 A;  2GOL A;  2HOI A;  2KOB A;  2Y0S F;  1P7D A;  3CYM A;  2ZIV A;  4KX3 A;  2RHF A;  3LYS A;  3C28 A;  2JMG A;  4PL1 A;  2G5H B;  2HBJ A;  3D2N A;  3LVW A;  2KEY A;  3E0F A;  4OJO A;  3SMV A;  1A6S A;  3PZP A;  2HBK A;  3F53 A;  3D2Q A;  5HR7 A;  2G08 A;  3H0L B;  2MRL A;  2YX8 A;  1CRX A;  2D6F C;  2KD1 A;  4JMU A;  4A8E A;  1A0P A;  3AQE A;  2K8C B;  2KJ8 A;  1HEK A;  4FZM A;  4KMO B;  2XVT A;  4P0Q B;  3HKZ C;  3D2S A;  4BJQ A;  1OUQ A;  2PMZ C;  2Q4T A;  4FZN A;  2YB1 A;  4P0Q A;  2M0N A;  1MA7 A;  2WB1 F;  5HR6 A;  3OPX A;  2JHD A;  2ZXI A;  3SAF A;  4AYB F;  1WUD A;  2N1R A;  4QIW C;  4OJ6 A;  5T14 A;  2RP5 A;  2E1E A;  2HBL A;  2F76 X;  4CDG A;  1T94 A;  2ZIV B;  3SQI A;  3O0F A;  3NRW A;  3H0R B;  2W7P A;  2HOF A;  2VJ4 A;  2F77 X;  3F2C A;  2XIC A;  3F5E A;  2GH1 A;  4ACO A;  3MGV A;  2YB4 A;  3AQF A;  2HBM A;  2LHT A;  4NWI A;  5C0Y A;  2E5S A;  2G09 A;  4CGZ A;  3N7S C;  4GFJ A;  1XO0 A;  1ED1 A;  3M6Z A;  4BUG A;  1KBU A;  2K8B B;  2W03 A;  1NZB A;  2DQN B;  2G5I B;  2KVC A;  2KJ5 A;  2ZIU B;  3IG5 A;  3GU3 A;  3CP8 A;  2KIW A;  2KV2 A;  3IN5 A;  3IP4 B;  3LVV A;  4NLC A;  3PSP A;  1F44 A;  3VC8 A;  2ZIU A;  1SZH A;  4NLB A;  2KKV A;  2HOQ A;  1YT3 A;  4OJP A;  2CRX A;  4IC9 A;  3L3F X;  3HKZ F;  1URJ A;  4QJF B;  2JH1 A;  3CRX A;  2WAQ C;  2PMZ F;  3VCB A;  5CRX A;  2A3V A;  2G07 A;  1HIW A;  2LBO A;  2F2A B;  2KJ9 A;  5KL8 B;  4C0Z A;  1TAM A;  1Q3U A;  2K4I A;  4QIW F;  4FZL A;  3PST A;  2W7O A;  2LKY A;  2HMX A;  2K8A A;  1GO3 F;  2DGZ A;  1XNS A;  2OXO A;  3IG8 A;  2VJ5 A;  2VIX A;  1PVR A;  2G06 A;  3NUQ A;  4WJ3 B;  3H0M B;  3N7R C;  2OH2 A;  3K1Z A;  2JH7 A;  3M6K A;  3PSF A;  3PSI A;  4OJL A;  3KFU F;  2LYB A;  2ZXH A;  4OO1 J;  2RRD A;  3SAG A;  2Z7J A;  1UPH A;  2H3V A;  2H3Z A;  4P0P B;  4BX9 C;  2Y0S C;  2H3Q A;  3ALR A;  2KNJ A;  2KHQ A;  3T79 A;  4U6P A;  4CRX A;  2MA1 A;  2XI9 A;  2G0A A;  1PVQ A;  4P0P A;  2CN1 A;  2E1F A;  2R18 A;  5KL1 B;  2BDU A;  1ZQ1 C;  2WAQ F;  3F5A A;  4KX5 A;  3RFA A;  2H3F A;  2KKP A;  2OM6 A;  2ZIW B;  3C29 A;  2F8L A;  2W04 A;  1D8B A;  4PL2 A;  2XID A;  4ICA A;  3ICX A;  2ZIW A;  2LYA A;  3DEE A;  1ECW A;  3RF9 A;  3SAH A;  2VKQ A;  1IIP A;  2ZIX B;  1PVP A;  2KIC A;  3AL0 B;  2WB1 C;  2KHV A;  3M7D A;  2ZG6 A;  1Z19 A;  1DRG A;  4AYB C;  3F2B A;  1Q3V A;  5A0L A;  2CPR A;  4OJ5 A;  1L6N A;  2ZIX A;  2NV3 A;  2JGA A;  4QNL A;  1Z1B A;  4O3M A;  3ONN A;  4NV0 A;  2DF4 B;  3KZX A;  3F2D A;  3GZF A;  2H3I A;  2K4E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...