2OXOA

Crystallization and structure determination of the core-binding domain of bacteriophage lambda integrase
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
93
structure length
93
Chain Sequence
MTLHSWLDRYEKILASRGIKQKTLINYMSKIKAIRRGLPDAPLEDITTKEIAAMLNGYIDEGKAASAKLIRSTLSDAFREAIAEGHITTNHVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrase
publication title Crystallization and structure determination of the core-binding domain of bacteriophage lambda integrase.
pubmed doi rcsb
source organism Unidentified phage
molecule tags Dna binding protein
total genus 36
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 2007-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02899 Phage_int_SAM_1 Phage integrase, N-terminal SAM-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.130 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2oxoA00
4A8EA 2CRXA 1NZBA 3C29A 4CRXA 1CRXA 5CRXA 2KHQA 1DRGA 1XO0A 1F44A 2HOIA 2KD1A 2KJ5A 2KKVA 1Z19A 2OXOA 2KJ9A 2KEYA 1Z1BA 1Q3VA 2A3VA 2KIWA 1PVPA 1PVQA 1OUQA 1PVRA 4ACOA 2KHVA 1Q3UA 1P7DA 3LYSA 2KOBA 2HOFA 3C28A 3CRXA 1XNSA 1KBUA 1A0PA 2KJ8A 1MA7A 3MGVA 2KKPA 3NRWA
chains in the Genus database with same CATH superfamily
3JPSA 1L3SA 1ZQKA 1WG8A 2F8KA 2W3SA 2BCQA 3GU3A 3E2EA 4PL1A 3N28A 2MA1A 2W9CB 3JPQA 1JRPA 5HNKA 2WTFA 4NXZA 1MA7A 5KFZA 3TI0A 3Q8MA 2CN1A 1U47A 4PH5A 1ZYQA 2ASLA 7ICMA 4O3QA 4M9NA 2DL0A 1Q46A 2NO5A 4UAYA 4QZAA 1ZQXA 3MABA 2JMGA 4NWIA 4Q45A 3SAGA 1KN5A 2ZJ5A 3WKAA 2UVUA 2H3ZA 5HHHA 2KFNA 2K89A 3QU2A 3RR7A 2M9NA 5ALRA 2JRZA 3OTQA 3HKZF 4I2EA 2XVTA 4MFCA 8ICNA 3DEEA 2KOBA 2YN4A 3HT3A 4ECSA 3PMLA 2PMZC 3T5KA 4KX3A 4GC6A 4MFFA 5DG9A 2RLTA 9ICHA 4IQVA 4M9GA 1LKYB 1KEJA 2ISPA 4RT3A 5AM2A 2A3VA 1PVPA 1K5OA 2VANA 4E0DA 4ELVA 1L7OA 1DGSA 1ZJMA 7ICPA 2YMMA 2BR0A 5GTIU 5EWEA 3H0RB 5B66U 5DDYA 5J0SA 4GXKA 3RB4A 3CW2C 1QSSA 4PHPA 4KLHA 5DGAA 1QQ5A 3E0FA 5ALSA 2BPCA 3ONNA 2Q4TA 1SV0C 4QZCA 3GIMA 5AKGA 2PFQA 2K4EA 2WF5A 3KHHA 4FZLA 2E8OA 2WB1C 2FPKA 4C8MA 5ALTA 4MF8A 2XY6A 3PSTA 3GV8B 3WK4A 4KLSA 2HDOA 3RH4A 2HHXA 2OXOA 8ICCA 4RNOA 9ICPA 4J9QA 1B4FA 4ZH4A 4F5OA 1ZXIA 3H8JA 1L3VA 4AYBC 4RUCA 2FMSA 2OCEA 3C29A 4M0AA 1NI3A 1N56A 3EYZA 1NK7A 4UB5A 2ZIXA 4ED6A 4F92B 2MUTB 1UT5A 1TAUA 4C80A 3NUQA 1RM6C 2R8IA 1URJA 3V6KA 1U9LA 5KG5A 9ICLA 2HOQA 2BGWA 1L6NA 2G5IB 4F4ZA 3UM9A 4PZNA 3MR2A 2W9AA 3RR8A 1JN3A 5TZVA 3WK7A 2AH5A 4JK1A 4CNQA 5J2DA 3WK8A 2DKXA 5J0XA 1BPEA 4ED2A 1ZQWA 2W8LA 4BX9C 5KFFA 5JRTA 4R66A 4DL6A 4QW8A 4RQ6A 9ICUA 2KKPA 1QQ6A 2OH2A 4NLKA 3QYPA 1X40A 1CRXA 8ICOA 1UA1A 4UAVA 1QLNA 3WKEA 5KFYA 4DL3A 3BQ1A 3V7KA 5AHXA 4I2GA 7ICIA 3LWMA 4KN4A 1S5LU 1SGGA 1MQ3A 2V9WA 4B9TA 1VDVA 5CEHA 4UBBA 3MR3A 5J0YA 4O3RA 1NJZA 1TVAA 1D9FA 1Y88A 5CJ7A 1PK3A 4QZBA 1ZQTA 2EZYA 3M9OB 5DBCA 2HBLA 2KV2A 2RHFA 5DQHA 2HMXA 5KNIA 5HHIA 1N5WA 4Z6CA 5BOLA 2NV3A 1JXLA 3U26A 2PFPA 2K8BB 9ICJA 2EAPA 3SENA 4ECTA 3V72A 2YMPA 2ZIVA 4BWMA 8ICSA 1YT3A 9ICAA 1SKSA 3BDPA 1O08A 2A1AA 2ZUBA 1UQVA 3ISBA 3CP8A 2LYBA 1ZQVA 3CYMA 3TANA 4JWMA 3RAQA 3RJJA 2BCSA 4ECRA 2H5XA 5AM1A 3UMCA 3VCBA 7ICEA 4LVSA 3RFAA 2KD1A 5BPCA 2ZIUA 5AKLA 3BQ2A 7ICFA 4DF4A 4PGXA 1COKA 2PXIA 4KLLA 4F2RA 8ICHA 1KW4A 2Y0SC 3PX0A 2BPFA 4NLGA 1ZRMA 2B0CA 4YD2A 4PHDA 2J6SA 3RH6A 1PK1B 1JMSA 1HIWA 4UATA 4C8OA 4YG2A 2CXYA 3NGDA 3Q8KA 4O0IA 2PKEA 4ACOA 3C2LA 4GXIA 2L5YA 2MSNA 4ZOHC 3JPRA 2FDRA 3L3FX 4DL7A 4R63A 1KTQA 4UB8U 3WKDA 2LYHA 2HVHA 5KT2A 4YP3A 3FC4A 3KZXA 3UXNA 5AKKA 4UAZA 4FZMA 5AICA 4Y2PA 9ICRA 2W9BB 2E1FA 4PHAA 4C7YA 2W7PA 1V9PA 1UA0A 1A77A 3PW2A 4LJXA 4USAA 5KFMA 4EEKA 4QZHA 3AN1A 3D6JA 4P4PA 8ICWA 2AU0A 1JUDA 5J0TA 7ICKA 2P6UA 2IA6A 3LVVA 1J2NA 4P4OA 1NNLA 4EBCA 1KLNA 4EBDA 4YR3A 8ICKA 1GO3F 4F71A 2WFAA 3T79A 2LBOA 3CRXA 3SV4A 2C28A 4B9VA 1LVHA 5KFIA 2QB0A 1SL2A 1WWVA 4QNLA 4FO6A 5TISU 3QZ8A 1ED1A 5ALFA 4G9BA 1KL9A 4Y2SA 2OYYA 9ICFA 1MQ2A 1T3QA 4DSKA 1F0MA 4O3NA 3KKAC 1V38A 5KT7A 4EX7A 5KFAA 5KAFU 1VJ5A 2EANA 1QH9A 2A1JA 1Z00A 1RPLA 4CDGA 3MGIA 3OSNA 5CR0A 2E3TA 5G5GA 4MHVA 1UPHA 5HR7A 4TUSA 1AQ6A 4F72A 2VIXA 1S9FA 3C28A 2HI0A 2F1JA 4UB1A 5KFTA 1YZ6A 5KG2A 1X66A 8ICZA 5AM0A 2ZJ8A 4DO9A 3OSPA 5KG7A 3UQ0A 4CRXA 4RUAA 5EE3A 1ZQDA 3LK9A 2KEYA 2G06A 3ZDEA 4OJPA 3KZIU 1JXEA 3QU9A 1DOQA 2GOLA 4O9MA 3FAHA 2F1IA 3V6JA 2HCFA 2WHEA 1BVSA 2LPEA 5DB8A 1TK8A 1ZOLA 1ZQAA 4DFPA 2IOHA 1U48A 4EENA 2HHTA 5CA7A 3V7LA 1XU4A 4R8UB 1Z4OA 2NRWA 5IIIA 3TFSA 1BPZA 4O5EA 4ECWA 4MFAA 4G3IA 5DBBA 3HJEA 3N7RC 3CNHA 3RAXA 4F93B 2NRZA 3TQ1A 2W3RA 1KKXA 5ALYA 4EEYA 9ICBA 3ALRA 3L4PA 4DOBA 7ICHA 2LMRA 4C8LA 5AK5A 2P6RA 1NKEA 4ED1A 5KFKA 1Z19A 3PZPA 1Q3VA 1ZQFA 4M47A 3NVVA 1RXVA 4TUPA 1T94A 8ICPA 4RQ5A 4NM1A 3WKCA 2KSOA 5KFQA 4DS5A 5AKIA 4FZNA 5DG7A 5F3XB 1ZQOA 2VA3A 5DBAA 4CF5A 3TFRA 5FP0A 1A76A 1TK0A 3H4BA 2YB4A 5ALUA 3RJKA 5HR6A 3NS1A 4PGYA 3M9NB 3F2DA 2D6FC 3FDSA 4ECYA 2ZIWB 4RU9A 1N60A 4I29A 5KG1A 4EYIB 2W43A 5DGBA 1WUDA 1C7YA 1BPDA 4ICAA 3RRHA 3NVYA 4QZIA 2EQYA 3AQFA 4Y2VA 3TARA 3N7SC 3ZDAA 5HMLA 4O3SA 4B9UA 1CI4A 4FBTA 3KKAA 2HOFA 4QWBA 3ZDCA 2JXJA 1PUZA 2H3QA 1N61A 3RTVA 3LDAA 3G6VA 5J8YA 5J29A 4JV0A 4F91B 2ZIXB 5L1LA 3SQIA 3NASA 1XSNA 5KT4A 3H40A 1X9MA 4Q43A 3UQ2A 4O3OA 2FMPA 1RYRA 3RRGA 4YN4A 4UASA 5ALLA 1T8EA 1X2IA 3GIKA 4YCXA 3SAHA 3C21A 4RQ2A 2IHNA 5AKXA 4A8EA 4QIWC 2KVCA 4Y2UA 5L1MA 5KT3A 1T3NA 8ICBA 1MN8A 1V85A 4DSFA 3KTQA 2JH1A 3H8WA 2W54A 5G5HA 4GLXA 5AK4A 1Q3UA 2M0NA 1NK4A 4Z6DA 4X5VA 3TKAA 1IM4A 2LM4A 1NK8A 1ZQ1C 4DOAA 4P0QA 2K4IA 5KFWA 2CRXA 2EAOA 3AU6A 4Y2RA 2JH7A 2WB1F 3TAPA 3KHLA 4GXJA 2F44A 4JB3A 4NV0A 5EWGA 5J2HA 2AGOA 2EZXA 3J81j 4C8KA 1XO1A 5AI9A 1TV9A 2Y9UA 9ICVA 1Z4NA 3F5EA 1L3TA 1NK0A 1ZQHA 2K8AA 5HMMA 3HP6A 3RB0A 3DDHA 1FO4A 2BQ3A 3B0YA 5C0YA 1NZPA 8ICGA 3QUBA 5DQIA 3I76A 1K1SA 5ALXA 4AYBF 2NRTA 5ALMA 2KHVA 5KFJA 2YY6A 4IQTA 4DQPA 7ICSA 3SR6A 1IXRA 5IIMA 5A0LA 1DK3A 4QWEA 4FS2A 2RDIA 4JMUA 4O3MA 5IIOA 2PFOA 3HKZC 4GIBA 4I2JA 2DUYA 5AKJA 1SKRA 8ICQA 1N62A 5F9NA 4WJ3B 2JZBA 5KFGA 2DKZA 5AM3A 2NRVA 4BXOB 2K60A 5C5JA 5DG8A 4M6WB 2F3NA 3HILA 4IC9A 1LB2B 2GWSA 2ZIUB 2ZJAA 3M9MB 1A6SA 2KKVA 1ZD4A 4Y2XA 4JWNA 2WF7A 2HBMA 3JPNA 2DQNB 4YXJA 1J97A 5DB9A 3MR6A 2FLNA 2W9CA 3THVA 1ZETA 5ALWA 4DS4A 3BQ7A 1TKDA 2KP7A 1ZQSA 4QWCA 2QARA 1K1QA 4OJ6A 2VJ4A 4EZ6A 3LYSA 1ZQRA 4CF4A 2MAXA 4F5QA 3PO5A 5KT6A 3B0XA 5ALIA 3PO4A 1QCKA 4DOCA 2V4RA 4RQNA 5AI5A 3MFHA 4NLNA 4K4IA 4PHEA 3JPPA 4EBEA 5J2CA 3JPTA 2OWOA 1NJWA 3IDWA 1RYUA 4PZOA 2JHDA 2RDJA 2EAMA 1X9WA 4DSLA 4Q8EA 4OD0A 1WWUA 3QE9Y 4B6JA 2JEIA 3M6KA 2XIDA 4XRHA 5KFEA 1MC8A 4F5PA 4KLMA 2FI1A 5KFCA 4EX6A 1HUZA 4KLOA 3H0LB 4C7ZA 4OJ5A 3NVWA 3BQ0A 1Q8KA 3RB3A 4O5KA 1JIHA 3N4MB 2HVIA 2WAQF 2A19A 1L8LA 1NKBA 3RJEA 4ECVA 3IN5A 5BOMA 3HPOA 3C1ZA 4UQGA 5KFUA 1RG6A 5AM5A 2DPIA 5EWFA 4QZEA 1UHUA 4P0PB 1Z00B 4KLIA 2XY5A 2DPJA 4OCZA 1NZBA 4RPXA 1KSPA 5AM4A 2ASJA 2AQ4A 4TURA 4YD1A 2ISOA 4F5RA 4YMNA 2FE9A 4JV2A 4ECUA 2EH9A 4AP9A 1P7DA 3L5KA 2WF6A 4DF8A 8ICVA 1FEZA 3R9KA 4FE3A 1FFUA 1NK5A 2OEHA 3QEAZ 5E79U 4Y2JA 2ESEA 3PSPA 3EWAA 1ZQNA 4K4HA 2DF4B 1ZQEA 3B9JA 2MUTA 4I2HA 2DWQA 1ZQGA 2FPMA 1L7PA 5KAIU 1SZPA 4KLJA 4BWJA 1S8OA 3WK5A 3WK9A 2UVVA 5L1KA 4J9PA 3QUCA 5KFDA 5AI4A 2XGQA 2E5SA 1S10A 3BZCA 1XWLA 5KG3A 4I2DA 4BDPA 3LVWA 2FPLA 4U7CA 4QZ9A 1X9SA 4DFMA 2F2AB 2NYVA 5D46A 5AI8A 2ALZA 1BNOA 2KVSA 3H7IA 4DFDA 2Y1JA 7ICTA 3ZI4A 1SKWA 2Y1IA 4KLGA 4DFKA 4UW9A 3TACB 4ED3A 4B9NA 4DEZA 1RYSA 4QW9A 2LM1A 4BJQA 2KSOB 1D8YA 1DXSA 7ICRA 2ZG6A 4IS7A 2XCPA 2KG5A 3M8RA 9ICMA 2VA8A 2K4PA 1Z1VA 3OPXA 3IHQB 1CUKA 3RH5A 3D2QA 1D9DA 3IG8A 4F50A 4FS1A 1S77D 2XI9A 2IBKA 1PVRA 4DLGA 5IILA 2K4HA 1SL0A 5DQGA 3TAQA 8ICLA 5J8YC 1ZRNA 2P35A 4QJFB 4F5NA 3C2MA 4JUZA 1ZQUA 3ETRA 1S0NA 1QTMA 2R8JA 1HJPA 4Q8FA 7ICNA 1IG6A 4CGZA 3O0FA 2CPRA 4EZ9A 5KFPA 7ICLA 4IL6U 4Z6FA 2Q0ZX 2KE7A 2Y9TA 4JV1A 4F2SA 4MF2A 3RJGA 9ICSA 2KJ8A 3MDCA 3EPGA 1KFDA 4I2AA 1J2MA 3PSFA 1ZQMA 5ALZA 1OW5A 2W55A 4QWAA 4O3PA 1F44A 2BPGA 2ZUCA 3PX4A 1SL1A 2JEGA 9ICXA 3RBDA 4RNMA 5J2GA 3UMBA 3Q8LA 4XUSA 4TQRA 2YMQA 1L3UA 1BNPA 2I1QA 3BS5A 5DB7A 2W7OA 3PW5A 1KBUA 2R18A 4BUGA 4PGQA 3KD3A 3AUOA 2ZXIA 1S0VA 2IHMA 3OJSA 1XS9D 5ALNA 2LI6A 3AU2A 2KIVA 4BGDA 2E8MA 2R8KA 5IIJA 5KG4A 1ZD5A 1N48A 1JROA 4RPZA 2ZXHA 5JUMA 3RJFA 4US9A 2AXTU 3NVZA 2ZTDA 1N5XA 3EUB2 7ICQA 3PV8A 5KFHA 2ZTCA 5KG6A 2G07A 5AI0A 2AJQA 4DL2A 4DQQA 2YMLA 4RT2A 2FLPA 1SXEA 1T7PA 3GQCA 5AK6A 4NLCA 1OUQA 4KTQA 5J2BA 4UB4A 3MBYA 3ISDA 2RQ5A 4OO1J 1OXJA 2PI4A 5KFOA 5GTHU 1L8OA 2EDUA 1XNSA 4DQIA 2EZZA 3BQTA 2KICA 3GFKB 1UT8A 9ICWA 2I9GA 8ICAA 1RXWA 5CRXA 2YQEA 1SXDA 2V4QA 5F9LA 3A0BU 5KFRA 5CWRA 2E8NA 1BPYA 1L5UA 4P2HA 2G5HB 4J9SA 4HAIA 3T5HA 2BCUA 5KL1B 4P4MA 4LZGA 3M6ZA 5ALPA 5L1JA 4IQWA 5J0UA 2GLEA 4CCHA 5AI6A 2BQRA 2W9MA 2R8GA 3GZFA 1Z1BA 4NM2A 1F5SA 1KQQA 1U4BA 2YX8A 3C1YA 2RRDA 4LZDA 8ICRA 2UVRA 3AL0B 4KLEA 1CEZA 4F4WA 3AEVA 3SYZA 2WF9A 2HHVA 4IRDA 5JTIA 4K4GA 4M2YA 2JEJA 2KFZA 3ZDBA 2PMZF 2XGPA 4F4KA 2F77X 2KJ9A 5KG0A 2W11A 3F2BA 1ZQQA 5AIAA 5H2FU 3RJHA 4C4SA 3OHAA 5AIBA 3KHRA 4UAWA 1X9XA 1YZ7A 2LHTA 2JV3A 4YMMA 2FJ6A 3MR5A 4MEXA 2KN7A 4I2BA 4Z6EA 3F2CA 2QARB 7ICOA 3SAFA 3D2SA 4RQMA 4KMOB 4DSJA 4UARA 2BKEA 4M9LA 4QZFA 4KMUA 2XY7A 4KLDA 4F4XA 2W8KA 3I1YA 1NKCA 1ZQYA 4RQ4A 1HEKA 4YR2A 5ALOA 4Y2QA 2XO7A 3RBEA 3PSIA 4OJOA 2K8CB 4C0ZA 2J6UA 4XQ8A 3PR4A 4KLTA 5ALKA 1BPXA 4I27A 3G6XA 2E1EA 5J2JA 5KTQA 4R8UA 3HW8A 2D3DA 4UB3A 7ICVA 4YFKA 1NJXA 3QX7A 1QQ7A 4QWDA 2I5HA 5DLFA 3PR5B 5J2FA 1D8LA 3UMGA 2C2EA 4DLEA 4ELTA 2HBJA 4I28A 4UAUA 4YR0A 4DWIA 2H3VA 2C22A 5L9XA 8ICXA 1LV5A 1ZD3A 1WCNA 1S97A 4I2CA 4I2FA 2KZZA 5ALQA 2E8PA 4YXMA 3PMNA 4XA5A 2ZIVB 4B9SA 4ED0A 2G09A 3EZ5A 5J0OA 3PW0A 1HUOA 5D4BA 1QSLA 3PX6A 3K1ZA 5EE9A 1TAQA 1KFSA 2GH1A 3GDXA 1ZQCA 2ZIWA 3SV3A 1N63A 2MU2A 2QKQA 5J2EA 8ICJA 2HHWA 1TE2A 2NO4A 3NTUA 2DBYA 2KHQA 5KL8B 1XC9A 3OGUA 3Q8QB 2HBKA 2P66A 1KFTA 2GO7A 5EE0A 1WYGA 8ICEA 4IR9A 2HSZA 9ICCA 4KLQA 3WK6A 1A0PA 3NRWA 9ICQA 1TFRA 3MC1A 4KLUA 3ED5A 1IV8A 3KFUF 1NK9A 2AQ0A 4C4TA 4J9OA 2WF8A 4ED7A 3ORYA 5B5EU 2ATLA 1PZNA 1SIJA 2JEFA 3C5FA 1PVQA 5ALDA 3HRDD 2KNJA 2KZMA 4YQWA 1D8BA 2IMWP 5J0WA 2JR5A 2YTUA 3D2NA 5ALJA 3QZ7A 4J03A 1SV4A 9ICIA 3DV9A 3V7JA 9ICOA 2LKYA 1KRPA 4GC7A 4O5CA 3BZKA 2HHUA 1DRGA 4QZDA 2PI5A 3AQEA 1RQLA 3ZD8A 3IRUA 1L7MA 3H0MB 2HHQA 3Q8SB 3I28A 1BGXT 2HW3A 1X6JA 2LYAA 3F5AA 2BDUA 3ZDDA 3UPQA 5AKEA 5AKHA 1NK6A 1ZJNA 3HX0A 3TADC 4DL4A 1LKYA 5D49A 4DL5A 1QSYA 3SEIA 4M9HA 5CB1A 2B21A 2MRLA 2C2RA 4NY8A 3EPIA 2W03A 4DSIA 3PVXA 2QB0B 4RQ8A 2VJ5A 3MGVA 4YMOA 2XCAA 2Y0SF 5DB6A 5ALGA 2BCVA 1MSWD 3SZ2A 4PPXA 2KJ5A 4C4RA 9ICKA 2KK0A 2N1RA 4U6PA 3FM9A 3OJUA 4DSEA 1ZQPA 1ZQIA 4FFDA 4YVZA 4DCCA 4DQRA 1U49A 4KN7A 3IM1A 2A1JB 4NL9C 3QEBZ 2NRXA 3T5LA 2DGZA 3KHGA 4KITB 2XC9A 4OJLA 2F76X 5KFBA 3K4GA 4J9MA 3OHBA 1ZQJA 3VC8A 4QZ8A 3H8SA 1SV0A 3NRZA 4BXOA 3A0HU 3ETLA 8ICFA 3IG5A 3GV7B 5KFNA 3PW7A 4M6WA 3C2KA 3SMVA 4EELA 5J0QA 4RQ0A 2BQUA 4ECQA 4ECXA 1DGJA 1ZQLA 8ICYA 2J6TA 1N2XA 4F8RA 5KFXA 3GIIA 3GILA 3H8MA 2JGAA 4UB2A 3BS5B 4MEYA 3Q8PB 4J9RA 3QUTA 5AK3A 2WAQC 1T4GA 4DFJA 3FYHA 4FBUA 3RF9A 3MGHA 1NJYA 1UCVA 1WCLA 9ICTA 2C2DA 1SWWA 3WU2U 3WKBA 2B6GA 2O6KA 2G08A 2AGQA 8ICMA 3SI8A 4IRKA 1SB3C 2OM6A 1COOA 1Z3EB 3KBBA 3N97B 1EXNA 1XSLA 2BZFA 5J2AA 4TUQA 2FMQA 1FIQA 4ELUA 5EOZA 8ICIA 3H4DA 3MDAA 1L7NA 4RZRA 5J0PA 4R65A 2PFNA 3IP4B 8ICUA 1ZQZA 5J2KA 3ISCA 1M6YA 2BCRA 2VA2A 2HHSA 3T3FA 1C20A 4HYKA 5ALVA 4B9MA 4J9LA 1FFVA 1JX4A 5EE1A 4IR1A 1BPBA 3T5JA 3TADA 1RQNA 2ASDA 2IOFK 4NJ8A 3E58A 5ALHA 5IIKA 4Q44A 1KDHA 4J9NA 2VKQA 7ICJA 5KFVA 4F3OA 7ICUA 4QZGA 3KOOA 4PJ0U 4RQ3A 2D8CA 3MFIA 9ICEA 3M8SA 9ICNA 3M1YA 3GV5B 4DQSA 3IV6A 4GFJA 1XO0A 4NLZA 4F4YA 4IRCA 8ICTA 5J0RA 4KX5A 3QU7A 3GIJA 4P0PA 1JALA 5IINA 3SD7A 5KFLA 4NL9A 3AMZA 3N7PD 2Z7JA 4TQSA 2BDPA 3QU5A 1AROP 2I6XA 2ZTEA 2W04A 5AKYA 2UVWA 2YB1A 1VLBA 1O03A 2QB1A 4UB6U 4C8NA 3PY8A 1IIPA 2AHOB 1TK5A 5HP4A 4US8A 2QLTA 1H38A 1ZQBA 1XSPA 4ED8A 4J9KA 1B0XA 4CF3A 3PNCA 1NOMA 1PK1A 3RB6A 5KFSA 2F8LA 4M04A 1SZHA 3JPOA 4UBCA 1X42A 2H3IA 4R64A 1U45A 3C23A 1S0MA 4EYHB 4P0QB 1DK2A 2KZ3A 1ZD2P 1S0OA 1S76D 3EW9A 3UXOA 3C5GA 2BHNA 2AGPA 5AKZA 2KIWA 2OHFA 1TAMA 1V97A 1RZTA 5KT5A 5DKWA 3ZD9A 4RNNA 2W9BA 5DLGA 5J2IA 3BS7A 4NLBA 4RQ7A 5CHGA 3V6HA 2DFLA 2F1HA 2H3FA 5ALEA 3S6JA 2FLLA 3UXPA 3PW4A 4PL2A 1RDFA 3M7DA 5DDMA 2ODGA 5CP2A 3K1RB 4B9LA 1B22A 4I2IA 2R8HA 2ZUDA 2G0AA 3HWTA 3QXGA 7ICGA 4RPYA 4M9JA 3RJIA 1ECWA 3F53A 9ICGA 4ECZA 3K75D 3QUQA 3LWLA 3AM9A 4RQ1A 2HOIA 4IQUA 3G6YA 2KMDA 2JZBB 1X6IA 3ICXA 4Y2TA 3BJYA 1JI7A 3QU4A 4QIWF 5K4LA 1SWVA 3Q8RB 2IOFA 2KTQA 4CE6A 2ES6A 5JU5A 5T14A 3QNMA 5L1IA 2RP5A 4KLFA 2XICA 1B43A 4Y2YA
chains in the Genus database with same CATH topology
2OH2A 3H0RB 4CDGA 2CRXA 1IIPA 2Y0SF 1NZBA 3F2CA 2JH7A 2WB1F 3SAFA 1CRXA 2G07A 3D2SA 2KHQA 5KL8B 3OPXA 1HIWA 4NV0A 2KJ5A 2HBKA 3GU3A 3D2QA 3IG8A 4KMOB 2N1RA 4U6PA 4PL1A 4OJ6A 3E0FA 1UPHA 5HR7A 3IP4B 3ONNA 4NLCA 2Q4TA 2XI9A 2F8LA 2VIXA 2YB4A 4ACOA 1PVRA 1OUQA 2MA1A 4OO1J 1P7DA 1SZHA 2K4EA 2VJ4A 3F5EA 5HR6A 3LYSA 3F2DA 1HEKA 2D6FC 3C28A 2K8AA 4FZLA 2K4HA 3L3FX 1XNSA 2WB1C 2ZIWB 1A0PA 1MA7A 2H3IA 4P0QB 2KICA 3NRWA 4QJFB 2DGZA 4FE3A 1WUDA 3PSIA 4ICAA 2CN1A 2F76X 2K8CB 4OJLA 4OJOA 4C0ZA 4CRXA 3KFUF 5C0YA 3KZXA 5CRXA 3PSPA 3PSTA 3AQFA 4FZMA 2E1EA 2DF4B 4AYBF 2OXOA 2KEYA 2G06A 2KIWA 4OJPA 1TAMA 3VC8A 2HBLA 4CGZA 1PVQA 2E1FA 2CPRA 3N7SC 3O0FA 2KV2A 2RHFA 2HMXA 2KHVA 2KNJA 2GOLA 2W7PA 2NV3A 1D8BA 2JMGA 4NWIA 2G5HB 2JHDA 2HOFA 5A0LA 4NLBA 3SAGA 2K8BB 3D2NA 2VKQA 2KJ8A 3IG5A 5KL1B 2H3QA 2H3FA 4AYBC 3M6ZA 4JMUA 4O3MA 3M6KA 3PSFA 3SMVA 2LKYA 3HKZC 3C29A 2XIDA 4PL2A 2H3ZA 2ZIXB 2ZIVA 3M7DA 2K89A 1DRGA 1XO0A 1F44A 4GFJA 1YT3A 3LVVA 3SQIA 3AQEA 3GZFA 2HBJA 2ZIXA 2JGAA 1Z1BA 4WJ3B 1GO3F 2YX8A 2E5SA 3NUQA 2H3VA 3H0LB 1URJA 3HKZF 3N7RC 3CP8A 3H0MB 2XVTA 3LVWA 4KX5A 2LYBA 4OJ5A 2HOQA 2RRDA 3DEEA 2KOBA 4U7CA 3T79A 2LBOA 2G0AA 2W7OA 3CRXA 1L6NA 2G5IB 2PMZC 3CYMA 4KX3A 2WAQC 3AL0B 1KBUA 2LYAA 2R18A 4BUGA 2F2AB 3SAHA 3F5AA 4P0PA 4QNLA 1ECWA 2BDUA 3F53A 3RF9A 4IC9A 4A8EA 1ED1A 2ZXIA 4QIWC 2KVCA 2ZIVB 3ALRA 2PMZF 2ZIUB 2OYYA 3N7PD 2WAQF 3VCBA 2G09A 2HOIA 3RFAA 2KD1A 2JH1A 2KKVA 2ZIUA 2Z7JA 1Z19A 2F77X 3ICXA 2KJ9A 1A6SA 2G08A 2HBMA 3PZPA 1Q3VA 2A3VA 3F2BA 2DQNB 4QIWF 1PVPA 3IN5A 1Q3UA 4BX9C 2M0NA 3K1ZA 2OM6A 2Y0SC 2MRLA 5T14A 2W04A 1T94A 4BJQA 2W03A 2ZXHA 2RP5A 2YB1A 1ZQ1C 2GH1A 2XICA 4P0PB 2VJ5A 2ZG6A 3MGVA 2KKPA 2LHTA 2ZIWA 4P0QA 4FZNA 2K4IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A8E A;  2CRX A;  1NZB A;  3C29 A;  4CRX A;  1CRX A;  5CRX A;  2KHQ A;  1DRG A;  1XO0 A;  1F44 A;  2HOI A;  2KD1 A;  2KJ5 A;  2KKV A;  1Z19 A;  2OXO A;  2KJ9 A;  2KEY A;  1Z1B A;  1Q3V A;  2A3V A;  2KIW A;  1PVP A;  1PVQ A;  1OUQ A;  1PVR A;  4ACO A;  2KHV A;  1Q3U A;  1P7D A;  3LYS A;  2KOB A;  2HOF A;  3C28 A;  3CRX A;  1XNS A;  1KBU A;  1A0P A;  2KJ8 A;  1MA7 A;  3MGV A;  2KKP A;  3NRW A; 
#chains in the Genus database with same CATH topology
 3JPS A;  1L3S A;  1ZQK A;  1WG8 A;  2F8K A;  2W3S A;  2BCQ A;  3GU3 A;  3E2E A;  4PL1 A;  3N28 A;  2MA1 A;  2W9C B;  3JPQ A;  1JRP A;  5HNK A;  2WTF A;  4NXZ A;  1MA7 A;  5KFZ A;  3TI0 A;  3Q8M A;  2CN1 A;  1U47 A;  4PH5 A;  1ZYQ A;  2ASL A;  7ICM A;  4O3Q A;  4M9N A;  2DL0 A;  1Q46 A;  2NO5 A;  4UAY A;  4QZA A;  1ZQX A;  3MAB A;  2JMG A;  4NWI A;  4Q45 A;  3SAG A;  1KN5 A;  2ZJ5 A;  3WKA A;  2UVU A;  2H3Z A;  5HHH A;  2KFN A;  2K89 A;  3QU2 A;  3RR7 A;  2M9N A;  5ALR A;  2JRZ A;  3OTQ A;  3HKZ F;  4I2E A;  2XVT A;  4MFC A;  8ICN A;  3DEE A;  2KOB A;  2YN4 A;  3HT3 A;  4ECS A;  3PML A;  2PMZ C;  3T5K A;  4KX3 A;  4GC6 A;  4MFF A;  5DG9 A;  2RLT A;  9ICH A;  4IQV A;  4M9G A;  1LKY B;  1KEJ A;  2ISP A;  4RT3 A;  5AM2 A;  2A3V A;  1PVP A;  1K5O A;  2VAN A;  4E0D A;  4ELV A;  1L7O A;  1DGS A;  1ZJM A;  7ICP A;  2YMM A;  2BR0 A;  5GTI U;  5EWE A;  3H0R B;  5B66 U;  5DDY A;  5J0S A;  4GXK A;  3RB4 A;  3CW2 C;  1QSS A;  4PHP A;  4KLH A;  5DGA A;  1QQ5 A;  3E0F A;  5ALS A;  2BPC A;  3ONN A;  2Q4T A;  1SV0 C;  4QZC A;  3GIM A;  5AKG A;  2PFQ A;  2K4E A;  2WF5 A;  3KHH A;  4FZL A;  2E8O A;  2WB1 C;  2FPK A;  4C8M A;  5ALT A;  4MF8 A;  2XY6 A;  3PST A;  3GV8 B;  3WK4 A;  4KLS A;  2HDO A;  3RH4 A;  2HHX A;  2OXO A;  8ICC A;  4RNO A;  9ICP A;  4J9Q A;  1B4F A;  4ZH4 A;  4F5O A;  1ZXI A;  3H8J A;  1L3V A;  4AYB C;  4RUC A;  2FMS A;  2OCE A;  3C29 A;  4M0A A;  1NI3 A;  1N56 A;  3EYZ A;  1NK7 A;  4UB5 A;  2ZIX A;  4ED6 A;  4F92 B;  2MUT B;  1UT5 A;  1TAU A;  4C80 A;  3NUQ A;  1RM6 C;  2R8I A;  1URJ A;  3V6K A;  1U9L A;  5KG5 A;  9ICL A;  2HOQ A;  2BGW A;  1L6N A;  2G5I B;  4F4Z A;  3UM9 A;  4PZN A;  3MR2 A;  2W9A A;  3RR8 A;  1JN3 A;  5TZV A;  3WK7 A;  2AH5 A;  4JK1 A;  4CNQ A;  5J2D A;  3WK8 A;  2DKX A;  5J0X A;  1BPE A;  4ED2 A;  1ZQW A;  2W8L A;  4BX9 C;  5KFF A;  5JRT A;  4R66 A;  4DL6 A;  4QW8 A;  4RQ6 A;  9ICU A;  2KKP A;  1QQ6 A;  2OH2 A;  4NLK A;  3QYP A;  1X40 A;  1CRX A;  8ICO A;  1UA1 A;  4UAV A;  1QLN A;  3WKE A;  5KFY A;  4DL3 A;  3BQ1 A;  3V7K A;  5AHX A;  4I2G A;  7ICI A;  3LWM A;  4KN4 A;  1S5L U;  1SGG A;  1MQ3 A;  2V9W A;  4B9T A;  1VDV A;  5CEH A;  4UBB A;  3MR3 A;  5J0Y A;  4O3R A;  1NJZ A;  1TVA A;  1D9F A;  1Y88 A;  5CJ7 A;  1PK3 A;  4QZB A;  1ZQT A;  2EZY A;  3M9O B;  5DBC A;  2HBL A;  2KV2 A;  2RHF A;  5DQH A;  2HMX A;  5KNI A;  5HHI A;  1N5W A;  4Z6C A;  5BOL A;  2NV3 A;  1JXL A;  3U26 A;  2PFP A;  2K8B B;  9ICJ A;  2EAP A;  3SEN A;  4ECT A;  3V72 A;  2YMP A;  2ZIV A;  4BWM A;  8ICS A;  1YT3 A;  9ICA A;  1SKS A;  3BDP A;  1O08 A;  2A1A A;  2ZUB A;  1UQV A;  3ISB A;  3CP8 A;  2LYB A;  1ZQV A;  3CYM A;  3TAN A;  4JWM A;  3RAQ A;  3RJJ A;  2BCS A;  4ECR A;  2H5X A;  5AM1 A;  3UMC A;  3VCB A;  7ICE A;  4LVS A;  3RFA A;  2KD1 A;  5BPC A;  2ZIU A;  5AKL A;  3BQ2 A;  7ICF A;  4DF4 A;  4PGX A;  1COK A;  2PXI A;  4KLL A;  4F2R A;  8ICH A;  1KW4 A;  2Y0S C;  3PX0 A;  2BPF A;  4NLG A;  1ZRM A;  2B0C A;  4YD2 A;  4PHD A;  2J6S A;  3RH6 A;  1PK1 B;  1JMS A;  1HIW A;  4UAT A;  4C8O A;  4YG2 A;  2CXY A;  3NGD A;  3Q8K A;  4O0I A;  2PKE A;  4ACO A;  3C2L A;  4GXI A;  2L5Y A;  2MSN A;  4ZOH C;  3JPR A;  2FDR A;  3L3F X;  4DL7 A;  4R63 A;  1KTQ A;  4UB8 U;  3WKD A;  2LYH A;  2HVH A;  5KT2 A;  4YP3 A;  3FC4 A;  3KZX A;  3UXN A;  5AKK A;  4UAZ A;  4FZM A;  5AIC A;  4Y2P A;  9ICR A;  2W9B B;  2E1F A;  4PHA A;  4C7Y A;  2W7P A;  1V9P A;  1UA0 A;  1A77 A;  3PW2 A;  4LJX A;  4USA A;  5KFM A;  4EEK A;  4QZH A;  3AN1 A;  3D6J A;  4P4P A;  8ICW A;  2AU0 A;  1JUD A;  5J0T A;  7ICK A;  2P6U A;  2IA6 A;  3LVV A;  1J2N A;  4P4O A;  1NNL A;  4EBC A;  1KLN A;  4EBD A;  4YR3 A;  8ICK A;  1GO3 F;  4F71 A;  2WFA A;  3T79 A;  2LBO A;  3CRX A;  3SV4 A;  2C28 A;  4B9V A;  1LVH A;  5KFI A;  2QB0 A;  1SL2 A;  1WWV A;  4QNL A;  4FO6 A;  5TIS U;  3QZ8 A;  1ED1 A;  5ALF A;  4G9B A;  1KL9 A;  4Y2S A;  2OYY A;  9ICF A;  1MQ2 A;  1T3Q A;  4DSK A;  1F0M A;  4O3N A;  3KKA C;  1V38 A;  5KT7 A;  4EX7 A;  5KFA A;  5KAF U;  1VJ5 A;  2EAN A;  1QH9 A;  2A1J A;  1Z00 A;  1RPL A;  4CDG A;  3MGI A;  3OSN A;  5CR0 A;  2E3T A;  5G5G A;  4MHV A;  1UPH A;  5HR7 A;  4TUS A;  1AQ6 A;  4F72 A;  2VIX A;  1S9F A;  3C28 A;  2HI0 A;  2F1J A;  4UB1 A;  5KFT A;  1YZ6 A;  5KG2 A;  1X66 A;  8ICZ A;  5AM0 A;  2ZJ8 A;  4DO9 A;  3OSP A;  5KG7 A;  3UQ0 A;  4CRX A;  4RUA A;  5EE3 A;  1ZQD A;  3LK9 A;  2KEY A;  2G06 A;  3ZDE A;  4OJP A;  3KZI U;  1JXE A;  3QU9 A;  1DOQ A;  2GOL A;  4O9M A;  3FAH A;  2F1I A;  3V6J A;  2HCF A;  2WHE A;  1BVS A;  2LPE A;  5DB8 A;  1TK8 A;  1ZOL A;  1ZQA A;  4DFP A;  2IOH A;  1U48 A;  4EEN A;  2HHT A;  5CA7 A;  3V7L A;  1XU4 A;  4R8U B;  1Z4O A;  2NRW A;  5III A;  3TFS A;  1BPZ A;  4O5E A;  4ECW A;  4MFA A;  4G3I A;  5DBB A;  3HJE A;  3N7R C;  3CNH A;  3RAX A;  4F93 B;  2NRZ A;  3TQ1 A;  2W3R A;  1KKX A;  5ALY A;  4EEY A;  9ICB A;  3ALR A;  3L4P A;  4DOB A;  7ICH A;  2LMR A;  4C8L A;  5AK5 A;  2P6R A;  1NKE A;  4ED1 A;  5KFK A;  1Z19 A;  3PZP A;  1Q3V A;  1ZQF A;  4M47 A;  3NVV A;  1RXV A;  4TUP A;  1T94 A;  8ICP A;  4RQ5 A;  4NM1 A;  3WKC A;  2KSO A;  5KFQ A;  4DS5 A;  5AKI A;  4FZN A;  5DG7 A;  5F3X B;  1ZQO A;  2VA3 A;  5DBA A;  4CF5 A;  3TFR A;  5FP0 A;  1A76 A;  1TK0 A;  3H4B A;  2YB4 A;  5ALU A;  3RJK A;  5HR6 A;  3NS1 A;  4PGY A;  3M9N B;  3F2D A;  2D6F C;  3FDS A;  4ECY A;  2ZIW B;  4RU9 A;  1N60 A;  4I29 A;  5KG1 A;  4EYI B;  2W43 A;  5DGB A;  1WUD A;  1C7Y A;  1BPD A;  4ICA A;  3RRH A;  3NVY A;  4QZI A;  2EQY A;  3AQF A;  4Y2V A;  3TAR A;  3N7S C;  3ZDA A;  5HML A;  4O3S A;  4B9U A;  1CI4 A;  4FBT A;  3KKA A;  2HOF A;  4QWB A;  3ZDC A;  2JXJ A;  1PUZ A;  2H3Q A;  1N61 A;  3RTV A;  3LDA A;  3G6V A;  5J8Y A;  5J29 A;  4JV0 A;  4F91 B;  2ZIX B;  5L1L A;  3SQI A;  3NAS A;  1XSN A;  5KT4 A;  3H40 A;  1X9M A;  4Q43 A;  3UQ2 A;  4O3O A;  2FMP A;  1RYR A;  3RRG A;  4YN4 A;  4UAS A;  5ALL A;  1T8E A;  1X2I A;  3GIK A;  4YCX A;  3SAH A;  3C21 A;  4RQ2 A;  2IHN A;  5AKX A;  4A8E A;  4QIW C;  2KVC A;  4Y2U A;  5L1M A;  5KT3 A;  1T3N A;  8ICB A;  1MN8 A;  1V85 A;  4DSF A;  3KTQ A;  2JH1 A;  3H8W A;  2W54 A;  5G5H A;  4GLX A;  5AK4 A;  1Q3U A;  2M0N A;  1NK4 A;  4Z6D A;  4X5V A;  3TKA A;  1IM4 A;  2LM4 A;  1NK8 A;  1ZQ1 C;  4DOA A;  4P0Q A;  2K4I A;  5KFW A;  2CRX A;  2EAO A;  3AU6 A;  4Y2R A;  2JH7 A;  2WB1 F;  3TAP A;  3KHL A;  4GXJ A;  2F44 A;  4JB3 A;  4NV0 A;  5EWG A;  5J2H A;  2AGO A;  2EZX A;  3J81 j;  4C8K A;  1XO1 A;  5AI9 A;  1TV9 A;  2Y9U A;  9ICV A;  1Z4N A;  3F5E A;  1L3T A;  1NK0 A;  1ZQH A;  2K8A A;  5HMM A;  3HP6 A;  3RB0 A;  3DDH A;  1FO4 A;  2BQ3 A;  3B0Y A;  5C0Y A;  1NZP A;  8ICG A;  3QUB A;  5DQI A;  3I76 A;  1K1S A;  5ALX A;  4AYB F;  2NRT A;  5ALM A;  2KHV A;  5KFJ A;  2YY6 A;  4IQT A;  4DQP A;  7ICS A;  3SR6 A;  1IXR A;  5IIM A;  5A0L A;  1DK3 A;  4QWE A;  4FS2 A;  2RDI A;  4JMU A;  4O3M A;  5IIO A;  2PFO A;  3HKZ C;  4GIB A;  4I2J A;  2DUY A;  5AKJ A;  1SKR A;  8ICQ A;  1N62 A;  5F9N A;  4WJ3 B;  2JZB A;  5KFG A;  2DKZ A;  5AM3 A;  2NRV A;  4BXO B;  2K60 A;  5C5J A;  5DG8 A;  4M6W B;  2F3N A;  3HIL A;  4IC9 A;  1LB2 B;  2GWS A;  2ZIU B;  2ZJA A;  3M9M B;  1A6S A;  2KKV A;  1ZD4 A;  4Y2X A;  4JWN A;  2WF7 A;  2HBM A;  3JPN A;  2DQN B;  4YXJ A;  1J97 A;  5DB9 A;  3MR6 A;  2FLN A;  2W9C A;  3THV A;  1ZET A;  5ALW A;  4DS4 A;  3BQ7 A;  1TKD A;  2KP7 A;  1ZQS A;  4QWC A;  2QAR A;  1K1Q A;  4OJ6 A;  2VJ4 A;  4EZ6 A;  3LYS A;  1ZQR A;  4CF4 A;  2MAX A;  4F5Q A;  3PO5 A;  5KT6 A;  3B0X A;  5ALI A;  3PO4 A;  1QCK A;  4DOC A;  2V4R A;  4RQN A;  5AI5 A;  3MFH A;  4NLN A;  4K4I A;  4PHE A;  3JPP A;  4EBE A;  5J2C A;  3JPT A;  2OWO A;  1NJW A;  3IDW A;  1RYU A;  4PZO A;  2JHD A;  2RDJ A;  2EAM A;  1X9W A;  4DSL A;  4Q8E A;  4OD0 A;  1WWU A;  3QE9 Y;  4B6J A;  2JEI A;  3M6K A;  2XID A;  4XRH A;  5KFE A;  1MC8 A;  4F5P A;  4KLM A;  2FI1 A;  5KFC A;  4EX6 A;  1HUZ A;  4KLO A;  3H0L B;  4C7Z A;  4OJ5 A;  3NVW A;  3BQ0 A;  1Q8K A;  3RB3 A;  4O5K A;  1JIH A;  3N4M B;  2HVI A;  2WAQ F;  2A19 A;  1L8L A;  1NKB A;  3RJE A;  4ECV A;  3IN5 A;  5BOM A;  3HPO A;  3C1Z A;  4UQG A;  5KFU A;  1RG6 A;  5AM5 A;  2DPI A;  5EWF A;  4QZE A;  1UHU A;  4P0P B;  1Z00 B;  4KLI A;  2XY5 A;  2DPJ A;  4OCZ A;  1NZB A;  4RPX A;  1KSP A;  5AM4 A;  2ASJ A;  2AQ4 A;  4TUR A;  4YD1 A;  2ISO A;  4F5R A;  4YMN A;  2FE9 A;  4JV2 A;  4ECU A;  2EH9 A;  4AP9 A;  1P7D A;  3L5K A;  2WF6 A;  4DF8 A;  8ICV A;  1FEZ A;  3R9K A;  4FE3 A;  1FFU A;  1NK5 A;  2OEH A;  3QEA Z;  5E79 U;  4Y2J A;  2ESE A;  3PSP A;  3EWA A;  1ZQN A;  4K4H A;  2DF4 B;  1ZQE A;  3B9J A;  2MUT A;  4I2H A;  2DWQ A;  1ZQG A;  2FPM A;  1L7P A;  5KAI U;  1SZP A;  4KLJ A;  4BWJ A;  1S8O A;  3WK5 A;  3WK9 A;  2UVV A;  5L1K A;  4J9P A;  3QUC A;  5KFD A;  5AI4 A;  2XGQ A;  2E5S A;  1S10 A;  3BZC A;  1XWL A;  5KG3 A;  4I2D A;  4BDP A;  3LVW A;  2FPL A;  4U7C A;  4QZ9 A;  1X9S A;  4DFM A;  2F2A B;  2NYV A;  5D46 A;  5AI8 A;  2ALZ A;  1BNO A;  2KVS A;  3H7I A;  4DFD A;  2Y1J A;  7ICT A;  3ZI4 A;  1SKW A;  2Y1I A;  4KLG A;  4DFK A;  4UW9 A;  3TAC B;  4ED3 A;  4B9N A;  4DEZ A;  1RYS A;  4QW9 A;  2LM1 A;  4BJQ A;  2KSO B;  1D8Y A;  1DXS A;  7ICR A;  2ZG6 A;  4IS7 A;  2XCP A;  2KG5 A;  3M8R A;  9ICM A;  2VA8 A;  2K4P A;  1Z1V A;  3OPX A;  3IHQ B;  1CUK A;  3RH5 A;  3D2Q A;  1D9D A;  3IG8 A;  4F50 A;  4FS1 A;  1S77 D;  2XI9 A;  2IBK A;  1PVR A;  4DLG A;  5IIL A;  2K4H A;  1SL0 A;  5DQG A;  3TAQ A;  8ICL A;  5J8Y C;  1ZRN A;  2P35 A;  4QJF B;  4F5N A;  3C2M A;  4JUZ A;  1ZQU A;  3ETR A;  1S0N A;  1QTM A;  2R8J A;  1HJP A;  4Q8F A;  7ICN A;  1IG6 A;  4CGZ A;  3O0F A;  2CPR A;  4EZ9 A;  5KFP A;  7ICL A;  4IL6 U;  4Z6F A;  2Q0Z X;  2KE7 A;  2Y9T A;  4JV1 A;  4F2S A;  4MF2 A;  3RJG A;  9ICS A;  2KJ8 A;  3MDC A;  3EPG A;  1KFD A;  4I2A A;  1J2M A;  3PSF A;  1ZQM A;  5ALZ A;  1OW5 A;  2W55 A;  4QWA A;  4O3P A;  1F44 A;  2BPG A;  2ZUC A;  3PX4 A;  1SL1 A;  2JEG A;  9ICX A;  3RBD A;  4RNM A;  5J2G A;  3UMB A;  3Q8L A;  4XUS A;  4TQR A;  2YMQ A;  1L3U A;  1BNP A;  2I1Q A;  3BS5 A;  5DB7 A;  2W7O A;  3PW5 A;  1KBU A;  2R18 A;  4BUG A;  4PGQ A;  3KD3 A;  3AUO A;  2ZXI A;  1S0V A;  2IHM A;  3OJS A;  1XS9 D;  5ALN A;  2LI6 A;  3AU2 A;  2KIV A;  4BGD A;  2E8M A;  2R8K A;  5IIJ A;  5KG4 A;  1ZD5 A;  1N48 A;  1JRO A;  4RPZ A;  2ZXH A;  5JUM A;  3RJF A;  4US9 A;  2AXT U;  3NVZ A;  2ZTD A;  1N5X A;  3EUB 2;  7ICQ A;  3PV8 A;  5KFH A;  2ZTC A;  5KG6 A;  2G07 A;  5AI0 A;  2AJQ A;  4DL2 A;  4DQQ A;  2YML A;  4RT2 A;  2FLP A;  1SXE A;  1T7P A;  3GQC A;  5AK6 A;  4NLC A;  1OUQ A;  4KTQ A;  5J2B A;  4UB4 A;  3MBY A;  3ISD A;  2RQ5 A;  4OO1 J;  1OXJ A;  2PI4 A;  5KFO A;  5GTH U;  1L8O A;  2EDU A;  1XNS A;  4DQI A;  2EZZ A;  3BQT A;  2KIC A;  3GFK B;  1UT8 A;  9ICW A;  2I9G A;  8ICA A;  1RXW A;  5CRX A;  2YQE A;  1SXD A;  2V4Q A;  5F9L A;  3A0B U;  5KFR A;  5CWR A;  2E8N A;  1BPY A;  1L5U A;  4P2H A;  2G5H B;  4J9S A;  4HAI A;  3T5H A;  2BCU A;  5KL1 B;  4P4M A;  4LZG A;  3M6Z A;  5ALP A;  5L1J A;  4IQW A;  5J0U A;  2GLE A;  4CCH A;  5AI6 A;  2BQR A;  2W9M A;  2R8G A;  3GZF A;  1Z1B A;  4NM2 A;  1F5S A;  1KQQ A;  1U4B A;  2YX8 A;  3C1Y A;  2RRD A;  4LZD A;  8ICR A;  2UVR A;  3AL0 B;  4KLE A;  1CEZ A;  4F4W A;  3AEV A;  3SYZ A;  2WF9 A;  2HHV A;  4IRD A;  5JTI A;  4K4G A;  4M2Y A;  2JEJ A;  2KFZ A;  3ZDB A;  2PMZ F;  2XGP A;  4F4K A;  2F77 X;  2KJ9 A;  5KG0 A;  2W11 A;  3F2B A;  1ZQQ A;  5AIA A;  5H2F U;  3RJH A;  4C4S A;  3OHA A;  5AIB A;  3KHR A;  4UAW A;  1X9X A;  1YZ7 A;  2LHT A;  2JV3 A;  4YMM A;  2FJ6 A;  3MR5 A;  4MEX A;  2KN7 A;  4I2B A;  4Z6E A;  3F2C A;  2QAR B;  7ICO A;  3SAF A;  3D2S A;  4RQM A;  4KMO B;  4DSJ A;  4UAR A;  2BKE A;  4M9L A;  4QZF A;  4KMU A;  2XY7 A;  4KLD A;  4F4X A;  2W8K A;  3I1Y A;  1NKC A;  1ZQY A;  4RQ4 A;  1HEK A;  4YR2 A;  5ALO A;  4Y2Q A;  2XO7 A;  3RBE A;  3PSI A;  4OJO A;  2K8C B;  4C0Z A;  2J6U A;  4XQ8 A;  3PR4 A;  4KLT A;  5ALK A;  1BPX A;  4I27 A;  3G6X A;  2E1E A;  5J2J A;  5KTQ A;  4R8U A;  3HW8 A;  2D3D A;  4UB3 A;  7ICV A;  4YFK A;  1NJX A;  3QX7 A;  1QQ7 A;  4QWD A;  2I5H A;  5DLF A;  3PR5 B;  5J2F A;  1D8L A;  3UMG A;  2C2E A;  4DLE A;  4ELT A;  2HBJ A;  4I28 A;  4UAU A;  4YR0 A;  4DWI A;  2H3V A;  2C22 A;  5L9X A;  8ICX A;  1LV5 A;  1ZD3 A;  1WCN A;  1S97 A;  4I2C A;  4I2F A;  2KZZ A;  5ALQ A;  2E8P A;  4YXM A;  3PMN A;  4XA5 A;  2ZIV B;  4B9S A;  4ED0 A;  2G09 A;  3EZ5 A;  5J0O A;  3PW0 A;  1HUO A;  5D4B A;  1QSL A;  3PX6 A;  3K1Z A;  5EE9 A;  1TAQ A;  1KFS A;  2GH1 A;  3GDX A;  1ZQC A;  2ZIW A;  3SV3 A;  1N63 A;  2MU2 A;  2QKQ A;  5J2E A;  8ICJ A;  2HHW A;  1TE2 A;  2NO4 A;  3NTU A;  2DBY A;  2KHQ A;  5KL8 B;  1XC9 A;  3OGU A;  3Q8Q B;  2HBK A;  2P66 A;  1KFT A;  2GO7 A;  5EE0 A;  1WYG A;  8ICE A;  4IR9 A;  2HSZ A;  9ICC A;  4KLQ A;  3WK6 A;  1A0P A;  3NRW A;  9ICQ A;  1TFR A;  3MC1 A;  4KLU A;  3ED5 A;  1IV8 A;  3KFU F;  1NK9 A;  2AQ0 A;  4C4T A;  4J9O A;  2WF8 A;  4ED7 A;  3ORY A;  5B5E U;  2ATL A;  1PZN A;  1SIJ A;  2JEF A;  3C5F A;  1PVQ A;  5ALD A;  3HRD D;  2KNJ A;  2KZM A;  4YQW A;  1D8B A;  2IMW P;  5J0W A;  2JR5 A;  2YTU A;  3D2N A;  5ALJ A;  3QZ7 A;  4J03 A;  1SV4 A;  9ICI A;  3DV9 A;  3V7J A;  9ICO A;  2LKY A;  1KRP A;  4GC7 A;  4O5C A;  3BZK A;  2HHU A;  1DRG A;  4QZD A;  2PI5 A;  3AQE A;  1RQL A;  3ZD8 A;  3IRU A;  1L7M A;  3H0M B;  2HHQ A;  3Q8S B;  3I28 A;  1BGX T;  2HW3 A;  1X6J A;  2LYA A;  3F5A A;  2BDU A;  3ZDD A;  3UPQ A;  5AKE A;  5AKH A;  1NK6 A;  1ZJN A;  3HX0 A;  3TAD C;  4DL4 A;  1LKY A;  5D49 A;  4DL5 A;  1QSY A;  3SEI A;  4M9H A;  5CB1 A;  2B21 A;  2MRL A;  2C2R A;  4NY8 A;  3EPI A;  2W03 A;  4DSI A;  3PVX A;  2QB0 B;  4RQ8 A;  2VJ5 A;  3MGV A;  4YMO A;  2XCA A;  2Y0S F;  5DB6 A;  5ALG A;  2BCV A;  1MSW D;  3SZ2 A;  4PPX A;  2KJ5 A;  4C4R A;  9ICK A;  2KK0 A;  2N1R A;  4U6P A;  3FM9 A;  3OJU A;  4DSE A;  1ZQP A;  1ZQI A;  4FFD A;  4YVZ A;  4DCC A;  4DQR A;  1U49 A;  4KN7 A;  3IM1 A;  2A1J B;  4NL9 C;  3QEB Z;  2NRX A;  3T5L A;  2DGZ A;  3KHG A;  4KIT B;  2XC9 A;  4OJL A;  2F76 X;  5KFB A;  3K4G A;  4J9M A;  3OHB A;  1ZQJ A;  3VC8 A;  4QZ8 A;  3H8S A;  1SV0 A;  3NRZ A;  4BXO A;  3A0H U;  3ETL A;  8ICF A;  3IG5 A;  3GV7 B;  5KFN A;  3PW7 A;  4M6W A;  3C2K A;  3SMV A;  4EEL A;  5J0Q A;  4RQ0 A;  2BQU A;  4ECQ A;  4ECX A;  1DGJ A;  1ZQL A;  8ICY A;  2J6T A;  1N2X A;  4F8R A;  5KFX A;  3GII A;  3GIL A;  3H8M A;  2JGA A;  4UB2 A;  3BS5 B;  4MEY A;  3Q8P B;  4J9R A;  3QUT A;  5AK3 A;  2WAQ C;  1T4G A;  4DFJ A;  3FYH A;  4FBU A;  3RF9 A;  3MGH A;  1NJY A;  1UCV A;  1WCL A;  9ICT A;  2C2D A;  1SWW A;  3WU2 U;  3WKB A;  2B6G A;  2O6K A;  2G08 A;  2AGQ A;  8ICM A;  3SI8 A;  4IRK A;  1SB3 C;  2OM6 A;  1COO A;  1Z3E B;  3KBB A;  3N97 B;  1EXN A;  1XSL A;  2BZF A;  5J2A A;  4TUQ A;  2FMQ A;  1FIQ A;  4ELU A;  5EOZ A;  8ICI A;  3H4D A;  3MDA A;  1L7N A;  4RZR A;  5J0P A;  4R65 A;  2PFN A;  3IP4 B;  8ICU A;  1ZQZ A;  5J2K A;  3ISC A;  1M6Y A;  2BCR A;  2VA2 A;  2HHS A;  3T3F A;  1C20 A;  4HYK A;  5ALV A;  4B9M A;  4J9L A;  1FFV A;  1JX4 A;  5EE1 A;  4IR1 A;  1BPB A;  3T5J A;  3TAD A;  1RQN A;  2ASD A;  2IOF K;  4NJ8 A;  3E58 A;  5ALH A;  5IIK A;  4Q44 A;  1KDH A;  4J9N A;  2VKQ A;  7ICJ A;  5KFV A;  4F3O A;  7ICU A;  4QZG A;  3KOO A;  4PJ0 U;  4RQ3 A;  2D8C A;  3MFI A;  9ICE A;  3M8S A;  9ICN A;  3M1Y A;  3GV5 B;  4DQS A;  3IV6 A;  4GFJ A;  1XO0 A;  4NLZ A;  4F4Y A;  4IRC A;  8ICT A;  5J0R A;  4KX5 A;  3QU7 A;  3GIJ A;  4P0P A;  1JAL A;  5IIN A;  3SD7 A;  5KFL A;  4NL9 A;  3AMZ A;  3N7P D;  2Z7J A;  4TQS A;  2BDP A;  3QU5 A;  1ARO P;  2I6X A;  2ZTE A;  2W04 A;  5AKY A;  2UVW A;  2YB1 A;  1VLB A;  1O03 A;  2QB1 A;  4UB6 U;  4C8N A;  3PY8 A;  1IIP A;  2AHO B;  1TK5 A;  5HP4 A;  4US8 A;  2QLT A;  1H38 A;  1ZQB A;  1XSP A;  4ED8 A;  4J9K A;  1B0X A;  4CF3 A;  3PNC A;  1NOM A;  1PK1 A;  3RB6 A;  5KFS A;  2F8L A;  4M04 A;  1SZH A;  3JPO A;  4UBC A;  1X42 A;  2H3I A;  4R64 A;  1U45 A;  3C23 A;  1S0M A;  4EYH B;  4P0Q B;  1DK2 A;  2KZ3 A;  1ZD2 P;  1S0O A;  1S76 D;  3EW9 A;  3UXO A;  3C5G A;  2BHN A;  2AGP A;  5AKZ A;  2KIW A;  2OHF A;  1TAM A;  1V97 A;  1RZT A;  5KT5 A;  5DKW A;  3ZD9 A;  4RNN A;  2W9B A;  5DLG A;  5J2I A;  3BS7 A;  4NLB A;  4RQ7 A;  5CHG A;  3V6H A;  2DFL A;  2F1H A;  2H3F A;  5ALE A;  3S6J A;  2FLL A;  3UXP A;  3PW4 A;  4PL2 A;  1RDF A;  3M7D A;  5DDM A;  2ODG A;  5CP2 A;  3K1R B;  4B9L A;  1B22 A;  4I2I A;  2R8H A;  2ZUD A;  2G0A A;  3HWT A;  3QXG A;  7ICG A;  4RPY A;  4M9J A;  3RJI A;  1ECW A;  3F53 A;  9ICG A;  4ECZ A;  3K75 D;  3QUQ A;  3LWL A;  3AM9 A;  4RQ1 A;  2HOI A;  4IQU A;  3G6Y A;  2KMD A;  2JZB B;  1X6I A;  3ICX A;  4Y2T A;  3BJY A;  1JI7 A;  3QU4 A;  4QIW F;  5K4L A;  1SWV A;  3Q8R B;  2IOF A;  2KTQ A;  4CE6 A;  2ES6 A;  5JU5 A;  5T14 A;  3QNM A;  5L1I A;  2RP5 A;  4KLF A;  2XIC A;  1B43 A;  4Y2Y A; 
#chains in the Genus database with same CATH homology
 2OH2 A;  3H0R B;  4CDG A;  2CRX A;  1IIP A;  2Y0S F;  1NZB A;  3F2C A;  2JH7 A;  2WB1 F;  3SAF A;  1CRX A;  2G07 A;  3D2S A;  2KHQ A;  5KL8 B;  3OPX A;  1HIW A;  4NV0 A;  2KJ5 A;  2HBK A;  3GU3 A;  3D2Q A;  3IG8 A;  4KMO B;  2N1R A;  4U6P A;  4PL1 A;  4OJ6 A;  3E0F A;  1UPH A;  5HR7 A;  3IP4 B;  3ONN A;  4NLC A;  2Q4T A;  2XI9 A;  2F8L A;  2VIX A;  2YB4 A;  4ACO A;  1PVR A;  1OUQ A;  2MA1 A;  4OO1 J;  1P7D A;  1SZH A;  2K4E A;  2VJ4 A;  3F5E A;  5HR6 A;  3LYS A;  3F2D A;  1HEK A;  2D6F C;  3C28 A;  2K8A A;  4FZL A;  2K4H A;  3L3F X;  1XNS A;  2WB1 C;  2ZIW B;  1A0P A;  1MA7 A;  2H3I A;  4P0Q B;  2KIC A;  3NRW A;  4QJF B;  2DGZ A;  4FE3 A;  1WUD A;  3PSI A;  4ICA A;  2CN1 A;  2F76 X;  2K8C B;  4OJL A;  4OJO A;  4C0Z A;  4CRX A;  3KFU F;  5C0Y A;  3KZX A;  5CRX A;  3PSP A;  3PST A;  3AQF A;  4FZM A;  2E1E A;  2DF4 B;  4AYB F;  2OXO A;  2KEY A;  2G06 A;  2KIW A;  4OJP A;  1TAM A;  3VC8 A;  2HBL A;  4CGZ A;  1PVQ A;  2E1F A;  2CPR A;  3N7S C;  3O0F A;  2KV2 A;  2RHF A;  2HMX A;  2KHV A;  2KNJ A;  2GOL A;  2W7P A;  2NV3 A;  1D8B A;  2JMG A;  4NWI A;  2G5H B;  2JHD A;  2HOF A;  5A0L A;  4NLB A;  3SAG A;  2K8B B;  3D2N A;  2VKQ A;  2KJ8 A;  3IG5 A;  5KL1 B;  2H3Q A;  2H3F A;  4AYB C;  3M6Z A;  4JMU A;  4O3M A;  3M6K A;  3PSF A;  3SMV A;  2LKY A;  3HKZ C;  3C29 A;  2XID A;  4PL2 A;  2H3Z A;  2ZIX B;  2ZIV A;  3M7D A;  2K89 A;  1DRG A;  1XO0 A;  1F44 A;  4GFJ A;  1YT3 A;  3LVV A;  3SQI A;  3AQE A;  3GZF A;  2HBJ A;  2ZIX A;  2JGA A;  1Z1B A;  4WJ3 B;  1GO3 F;  2YX8 A;  2E5S A;  3NUQ A;  2H3V A;  3H0L B;  1URJ A;  3HKZ F;  3N7R C;  3CP8 A;  3H0M B;  2XVT A;  3LVW A;  4KX5 A;  2LYB A;  4OJ5 A;  2HOQ A;  2RRD A;  3DEE A;  2KOB A;  4U7C A;  3T79 A;  2LBO A;  2G0A A;  2W7O A;  3CRX A;  1L6N A;  2G5I B;  2PMZ C;  3CYM A;  4KX3 A;  2WAQ C;  3AL0 B;  1KBU A;  2LYA A;  2R18 A;  4BUG A;  2F2A B;  3SAH A;  3F5A A;  4P0P A;  4QNL A;  1ECW A;  2BDU A;  3F53 A;  3RF9 A;  4IC9 A;  4A8E A;  1ED1 A;  2ZXI A;  4QIW C;  2KVC A;  2ZIV B;  3ALR A;  2PMZ F;  2ZIU B;  2OYY A;  3N7P D;  2WAQ F;  3VCB A;  2G09 A;  2HOI A;  3RFA A;  2KD1 A;  2JH1 A;  2KKV A;  2ZIU A;  2Z7J A;  1Z19 A;  2F77 X;  3ICX A;  2KJ9 A;  1A6S A;  2G08 A;  2HBM A;  3PZP A;  1Q3V A;  2A3V A;  3F2B A;  2DQN B;  4QIW F;  1PVP A;  3IN5 A;  1Q3U A;  4BX9 C;  2M0N A;  3K1Z A;  2OM6 A;  2Y0S C;  2MRL A;  5T14 A;  2W04 A;  1T94 A;  4BJQ A;  2W03 A;  2ZXH A;  2RP5 A;  2YB1 A;  1ZQ1 C;  2GH1 A;  2XIC A;  4P0P B;  2VJ5 A;  2ZG6 A;  3MGV A;  2KKP A;  2LHT A;  2ZIW A;  4P0Q A;  4FZN A;  2K4I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...