2OY1O

The crystal structure of ospa mutant
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
247
structure length
247
Chain Sequence
b'MKNSVSVDLPGSMKVLVSKSSNADGKYDLIATVDALELSGTSDKNNGSGVLEGVKADASKVKLTISDDLGQTTLEVFKSDGSTLVSKKVTSNGSSTEEKIIIDGIIIEKIITRADGTRLEYTGIKSDGSGKAKEVLKGYVLEGTLTAEKTTLVVKEGTVTLSKNISKSGEVSVELNDTDSSAATKKTAAWNSGTSTLTITVNSKKTKDLVFTSSNTITVQQYDSNGTSLEGSAVEITKLDEIKNALK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Outer surface protein A
publication title beta-Strand Flipping and Slipping Triggered by Turn Replacement Reveal the Opportunistic Nature of beta-Strand Pairing
pubmed doi rcsb
source organism Borrelia burgdorferi
molecule tags Membrane protein
total genus 42
structure length 247
sequence length 247
ec nomenclature
pdb deposition date 2007-02-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.160 Mainly Beta Beta Barrel Lipocalin C1 set domains (antibody constant domain-like) 2oy1O01
3.90.930.1 Alpha Beta Alpha-Beta Complex Outer Surface Protein A; domain 3 Outer Surface Protein A; domain 3 2oy1O02
2OY7A 2OL6O 1P4PA 3CKFA 3CKGA 5B11O 2PI3O 2OL7A 1OSPO 2OY5O 2OL8O 2FKJA 2G8CO 2I5ZO 2HKDA 2OY8A 3EC5A 5B10O 5B3MO 3AUMO 2OYBO 2OY1O 2I5VO 5B2AO 2FKGA 1FJ1E 2AF5A
chains in the Genus database with same CATH superfamily
1JJXA 3CKFA 5D4AA 3TF6A 3RDMA 2CBRA 5L8OA 1SWCA 1DF3A 3PIOE 3PEDA 1H91A 4BGFA 5B10O 1KL3A 4DNEA 5HCEC 2ACPX 1UYNX 2CZUA 1KD1G 3P6FA 2W2AA 3FIDA 1VQPE 4Z2OA 1RLBE 1ZNLA 1HMTA 1AQBA 4MVKA 4ZHGA 4GKCA 5CSEA 2X56A 5FQ7E 2OL7A 2A2UA 4ORYA 2CM9A 3FA7A 1A3YA 1DZKA 4PSQA 3STMX 3CF5E 3WYQA 1MX8A 2JU7A 1VWBB 3HWEA 5HZQA 1QFTA 3RDUA 4DQ4A 4ID2A 2HNXA 3PPTA 1ML7A 1TXLA 1NP4A 2RTPB 4GH7A 4GGTA 4OS3A 1HBQA 1XCAA 1SWSA 1VYGA 3IFBA 3OJYC 1T8VA 1GM6A 1W4TA 4YKOA 5JVHE 1EALA 4MISA 4WFVA 2JN3A 1YIJE 5B5FA 4YBPA 3T2XA 4AZMA 1PBOA 4NV8A 2BS6A 1AVEA 3EBWA 4R0BA 2M4LA 5IXGA 4IBAA 2L5PA 4TNNA 1VWDB 5F6BA 3TGAA 1SXYA 4I3BA 4TQ2A 2RTAA 1X8UA 1VWMB 4NV7A 4BX5B 1QVFE 1YI2E 3EM0A 1G85A 4MIRA 1BBPA 2RTFB 2C4IA 3OD9A 1NQNA 3VHMA 1Z24A 2KD2A 2IZJA 1SWFA 3HPEA 1LPJA 3STKA 3WZQA 2Q39A 2QO4A 3PECA 3VG3A 4KIIA 3FA9A 4PJ2A 5LJGA 4BCSA 2QCBA 1Q7YG 5B11O 1E00A 5EEEA 4ZH9A 4YDBA 5BVQA 1XKIA 2RTEB 1NBXA 5CE4A 5LJCA 4U8UO 1KT3A 1UYOX 2UYWA 4ES7A 1ZNGA 4Y59A 4ARHA 1VWOB 5KICA 1OPBA 3PP6A 3WBGA 4Z6JA 1MUPA 3FW5A 1VQKE 1B4MA 1HN2A 5IO7A 2A13A 5HZ9A 2DJGA 4Y0SA 1R0UA 4IAWA 2DM5A 1OPAA 3HK1A 3NBXX 2N93A 3ZW2A 3P02A 3BU9A 3UEXA 1BSQA 2GJ5A 1DZMA 1VQ4E 2AKQA 1OBPA 1N8RG 2IZDB 2QM9A 1E2TA 3SOTA 1SWGA 1VQ9E 3S5VA 1GX8A 4U3QA 3FDCA 1BLRA 5H9KA 5L3YA 4IB7A 3CBCA 1I9HA 5B5GA 3NQ3A 2AVIA 2NNQA 2PI3O 4O4XA 4IMOA 4GK9A 4N7CA 3H3IA 1QVGE 1DZPA 4NNSA 4YMYA 1JYDA 4FQBB 4Z28A 3VGWA 1NGLA 5HZ6A 1FENA 1SRIA 1VWQB 4JGLA 4ZHCA 4IB8A 4GGZA 5DPQA 3KFHA 5AJCA 3LTWA 5DG4A 3CCRE 3ELXA 4U9CA 4TKHA 4CPIA 3F9DA 3NQKA 2OFBA 3LV4A 1PTSA 1VWKB 4CPFA 3JSQA 2AH7X 2OL8O 2OFAA 1EQDA 2I5ZO 3U9PC 3AEHA 1B0OA 2XSTA 1CBQA 4NLJA 1RBPA 1YWBA 4ORUA 2Y32A 1W2BE 4MVIA 2MWHA 1Y9LA 5BYPA 1P4PA 1SXWA 1VYOA 2FKJA 2WEXA 5LJKA 4GJVA 1RXHA 2ASNX 1GT1A 1N0SA 3LHNA 4WFAE 3CCSE 4AZQA 2Y3EA 3KFFA 2R73A 4QGWA 1SRJA 3BDRA 4ORRA 2G8CO 1YIVA 3ELZA 5KIDA 4I60A 4BX6B 4FBRA 1JQPA 1ZNKA 1TVQA 3KFGA 4JHQA 2WPUA 1DC9A 1IKJA 2KT4B 5LJDA 2HMBA 1GKAB 5FQ6E 3P6DA 1BRPA 2OVEA 2A5BA 5K06A 3D9WA 3EYCA 1BEBA 1U18A 1LCVA 4M7MA 2OTJE 2ALLX 2IZKA 2X46A 1LICA 3HTYA 4HPDA 2C1SA 3CR6A 5FQ8E 1SRHA 4ML7B 2LBAA 1SWJA 2F01A 5HBSA 4A8ZA 1HQPA 3OBLA 1MM9A 1EPAA 3RE6A 4CDFA 1UREA 4OEMA 1PEEA 1U0XA 4ZH6A 3SLJA 1RXJA 2OY7A 4U67E 1YP7A 2LKKA 3U0DA 4AZOA 3TZSA 3BRNA 5GAEG 2O62A 1CRBA 1BJ7A 1M90G 2RTLA 1TOUA 2QO5A 3MG5A 2FGSA 2OFMX 2AT6X 1VQOE 2LFOA 1Q81G 5IO6A 1SWQA 4A1YA 1JJUA 4YDAA 1PMPA 1K9MG 1SWNA 3ZUOA 1SY0A 4EDEA 1STRB 1STSB 4NNTA 2IZCB 1YJWE 4AZPA 2AT3X 3NADA 1LCZA 1N7YA 2GTFX 3FA8A 3RZYA 3TGBA 2EU7X 2AT8X 1QABE 1VQNE 1EIIA 1ACDA 3HWDA 2X32A 1SWTA 1YUPA 3VHHA 1QY0A 4U8UM 1NQMA 3RWXA 3VG6A 4GD9A 4A60A 2KTSA 2VFCA 1SRFA 2FRSA 2BT9A 3IGEA 1VQ7E 5HWZA 3WYPA 3VE1A 2NP1A 2L9CA 1E02A 1SLGB 4ZGFA 3VG4A 4DCBA 1VWPB 1DFVA 4Z27A 1QY1A 2IZEB 1SLDB 2GTLO 5IRUA 1K73G 5MLCH 2RCQA 3B2HA 4YGHA 3PDFA 3EC5A 1LIFA 2WQ9A 1O8VA 3D97A 3E3CA 4AZRA 4YBUA 1KQSE 2OL6O 1VWCB 1T0VA 1QFVA 3MX7A 3NR3A 1ZRYA 3CC7E 1Y55X 1IIUA 3PH6A 2PY1A 3ZQ3A 2GTLN 1I04A 1X89A 1KT4A 2Q2PA 2DJFA 3RSWA 1VWEB 4HFOA 1BWYA 3VPJE 4WHIA 1JYJA 3NX1A 2Q9SA 4BX7A 4YFRA 5EEDA 2X45A 1VWGB 3ZW1B 3CPWE 3VHIA 3BLGA 1DZJA 5F7GA 4N7DA 4YCHA 3APUA 1LKEA 4NP1A 3PH5A 3FELA 1GX3A 1VWAB 1VWNB 5BVSA 4L1NA 1N43A 3SZJA 1KQWA 4D6BA 2IZFB 2QEXE 2NNDA 4QZTA 3OE3A 3VG5A 1KL5A 2HKDA 4OMXA 4YFPA 4IB9A 4UY8G 4EEJA 4ALOA 3ZW0A 5F1EA 4O4OA 4AYHA 4ZHHA 3RE5A 4XMHA 5LJBA 1EUOA 3CXCE 2RTBB 1OEKA 1K8AG 3CC2E 1MK5A 5EPQA 2R74A 3FW4A 4FBOA 1KFFA 2RTRB 3VG2A 3AUMO 3HWFA 1YWAA 5CYBA 2R56A 4M6SA 3O2YA 3O22A 1KT6A 2X8SA 1RSUB 2P8GA 4XMGA 3CMPA 5D47A 2IZBA 1S44A 2FHNX 4ZHDA 4BVMA 1KL4A 2AF5A 2YMSA 2CBSA 2OFRX 2OVDA 2MM3A 1U17A 2FR2A 1LUQA 4YFQA 2G79A 4GUZA 3RKGA 1MVGA 4CPEA 1SWHA 1E5PA 1KQXA 1Q86G 5D8JA 3WJFA 1W5RA 2VFBA 3BY0A 1X8PA 1ICMA 1OBQA 5AEOA 3EMMA 5AN9B 4ZJ0A 2FLJA 1SY3A 5JD2A 1K3BA 2GC9A 2MF6A 2X8FA 3RDXA 4CPHB 2CM4A 4I3DA 3T6FA 3UEVA 3CCLE 1LF7A 2BC3A 1JJ2E 3PIPE 2L67A 4KH8A 3QKGA 4ZFXA 1X71A 1IFBA 4OKAA 4FBVA 2OTLE 2HYSA 3RDOA 4BX5A 1VQ5E 3NP1A 2Y3FA 3S5XA 1G74A 1JIWI 3APXA 3NPOA 2RTJA 1D3SA 4NLIA 1SWDA 2KTDA 1ZNDA 4OELA 2RTIB 3FIQA 1IW2A 1FEMA 5FFHA 2IZGB 5LJEA 1GT3A 4MVLA 3CKGA 3FR2A 2Z4IA 3WJEA 3NX2A 3F8AA 4MVEA 3FMZA 1DV9A 2G5LA 1EXSA 3APWA 2BLGA 3PK2A 3SZHA 5H1SI 4GRJA 3RDQA 2RTDB 4BBOA 1ADLA 3WJGA 3SZIA 1SWOA 4KC8A 4LZVA 4QYPA 5F2BA 1RSTB 3CD6E 1RAVA 1GT4A 5HA1A 4D6AA 2A0AA 5DM6E 4MEEA 4YGZA 5EDCA 4O4SA 3SAOA 1LIDA 3WZPA 2OY5O 4UU2A 4CSBA 4ORSA 1YJNE 4O4UA 1EW3A 1JV4A 3I0AA 3CCUE 4GZVA 3BSZE 1Y9TA 4CDDA 2AT0X 1KT5A 1I78A 3D95A 3HOEA 5IRAA 1JMZA 1ERBA 1YHQE 2ZJPE 4GETA 3GAQA 4BOEA 4JNJA 2HLVA 5C0NA 1A57A 1FELA 1AB0A 5H9NA 1X8QA 2IZIA 4LZUA 1I06A 1JJJA 1SLEB 2RTHB 3CC4E 1TOWA 3FR4A 2OF8A 1YITE 5B29A 3STNA 3P6HA 4I9RA 4ON1A 5HZ8A 2JU3A 5HAEA 1EIOA 1FJ1E 2X55A 1KC8G 5JR8A 1SY2A 3CMEE 3C77X 2LBVA 1SWUA 4XMDA 1VWLB 2LA7A 2JW1A 2ANSA 3MBTA 2FS6A 2IFBA 2ACOA 1SWLA 1KT7A 4Y0RA 4GJSA 2F73A 1SY1A 5FENA 2MO5A 1STPA 1QY2A 3KFIA 4LKTA 2RCTA 1CBRA 1L6MA 4GDZA 2IZAA 4QQ1A 3OW2E 4O9SA 1VPRA 2AT5X 1D2UA 1YJ9E 4XMCA 3G7XA 2RTGB 4Z2VA 4BX7B 3P6GA 4LQZA 4WFBE 1ERXA 2OY1O 4ORWA 3MM0A 4C5PA 3J7ZG 4GU8A 4QGXA 4Y0PA 3VE2A 4ZCBA 4EFGA 3P6EA 5EDBA 5HL7E 3F6ZB 2Q4NA 1P6PA 2JGSA 3UEUA 5D45A 2K62A 3QQ2A 4UU3A 2I5VO 4IABA 4I95A 5H9LA 5CHKA 3T6LA 2QOSC 3PQUA 4QRLA 2A5CA 1SRGA 3T2WA 1SXXA 3UEWA 4BX6A 2RTKA 5HTDA 2JOZA 1GKAA 1HQQA 4JO6A 1ZNEA 3GE2A 1HXLA 4L3RA 5JVGE 2RTOB 1FDQA 3B2LA 1VYFA 4OS8A 4IAXA 4XMFA 4IOCE 4K19A 3V8UA 4IO9E 2CAMA 1RL6A 2RQ0A 2JMBA 1B56A 3N91A 4XMEA 2F09A 3AKMA 4TKJA 2QA4E 2POAA 4OS0A 2WQAE 5H9AA 5B3MO 3VG7A 1GT5A 3Q34A 1DF8A 1MX7A 3D4RA 3S26A 4O49A 5D48A 3RY1A 5F58A 4IRWA 4IB6A 1S72E 4ZGUA 4OMWA 1VWRB 4ZHFA 4WF9E 1B8EA 1YWCA 2RA6A 1VQ8E 2G7BA 2RTMA 3CCJE 1CBSA 4ODDA 4IMNA 1NJIG 1LCWA 3HWGA 2KW1A 3FEPA 4YGGA 3BS2A 5FAZA 1GXAA 1IKEA 4HWMA 1LELA 1SWRA 1QWDA 5GADG 1IJ8A 1SMPI 2ZJRE 3UAQA 1AVGI 1FTPA 2QOMA 3FENA 2BHVA 3HOLA 4GE1A 2HZQA 2IZHB 3FYFA 4QNIA 4ORXA 1SWBA 2RD7C 3KZAA 1OEJA 2K23A 1GX9A 4QAEA 4QZUA 5L8NA 4WFUA 1M1KG 4EXZA 3G6EE 4ALBA 1RXKA 3I17A 2CQLA 2W2FA 2BS5A 3SLTA 5HZ5A 3WXQA 3TGCA 4I6SA 1BRQA 3RDSA 3U03A 4CDEA 1RJLC 3IA8A 4LKPA 4YVBA 2FHLA 2FS7A 1BSYA 1HY2A 2A3FX 1AVDA 3JQOA 2E4JA 2CZTA 1KXOA 1X8OA 2A8GA 4O3XB 2WWPA 3O19A 1SWPA 3B2JA 2OF9A 1YWDA 1ZNHA 4NYRA 2G78A 1A2DA 1VQ6E 1JMXA 2QMIA 3CQNA 1LIBA 2X34A 1O1VA 4COTA 3ZWEA 3AKNA 3DTQA 4B55A 2NNEA 3C78X 4GGRA 1VWFB 3WVMA 3EBKA 1KGLA 1S7DA 1EPBA 1GGLA 3ZUIA 2RN4A 3RY2A 3T1DA 2Q2MA 3PQSA 1LIEA 3CWKA 3KVNA 3KQ0A 2OZQA 1SA8A 3SLOA 3RBYA 3BU1A 4FGIB 1NC9A 1JZUA 2L68A 2QO6A 5HCDC 2MJIA 3ZW1A 4BQUA 3VU1A 1VWJB 3WZNA 1SREA 4U8UN 2HZRA 4BJ8A 5AJBA 1SWAA 3L4RA 1HMRA 4WBKA 1VWHB 4INNA 5HA0A 1KZWA 1HXZA 3IG9A 2Z4HA 5GAHG 1G5WA 5F6ZA 1KZXA 3JS1A 2FT9A 1ICNA 1VQME 1BM5A 1OBUA 5EZ2A 3NQ9A 2MHDA 3EW1A 2FWVA 2OVSA 4A1HA 4TLJA 2OVAA 4U46A 1BSOA 2W2BA 2UZ2A 1HMSA 2GH7A 1Q82G 1QQSA 3APVA 1QG5A 1EI5A 5AQ6A 3ZZVA 4GDAA 4IOAE 2RTCB 1O1UA 5GAGG 2AL0X 3P6CA 3WJBA 4CV7A 3CMAE 2C1QA 4YKMA 2X4MA 1CJ5A 1A18A 1JBHA 1T68X 1WBIA 1CBIA 3P24A 5K67A 4O3WA 3I55E 2YG2A 4GNWA 2ZJQE 2ZAGA 2OYBO 2JU8A 3Q6LA 4AZNA 4AW8A 1VQLE 2WR6A 4O3ZA 1N9YA 5B27A 3MVFA 3B2KA 1LNMA 1MEPA 1YP6A 2GTLM 3S60A 3I56E 2ZAIA 3ZI8A 3WOVA 1WUBA 1I05A 1N4JA 1G7NA 4Y5DA 3CCVE 1VWIB 2AMMX 4KT5A 4I9SA 2VDFA 1OEEA 3FR5A 1LDOA 2WSJA 1I4UA 4CDCA 3DSZA 4GNYA 4NW4A 4EKVA 1ALBA 2OY8A 2BSZA 3CCME 5LJHA 1LFOA 1Y52X 3FEKA 5DM7E 2FR3A 1KOIA 3B2IA 4CPHA 4I3CA 1UZ2X 4QGVA 4QYNA 5IRWA 3CBSA 3EW2A 2RTNB 4YH0A 1X8NA 4Z2PA 3C76X 4HPBA 5B2AO 3DLLE 4HPAA 5K68A 4TJZA 4NYQA 4CK4A 4WFNE 4WCEE 3FA6A 2FTBA 1PBYA 1MDCA 5HCCC 4TKBA 1Y0GA 5BVTA 1LDQA 1S2PA 1NDJA 3G4SE 5L8IA 4YCEA 4RUNA 4O3YA 4KCAA 1MOYA 1K24A 3BX7A 3CQRA 1OSPO 1NP1A 4Y0QA 4EQAC 4KC7A 1N9MA 5LKEA 1AELA 1HBPA 2X8TA 2LB6A 1SLFB 5KHPA 5HTEA 2FKGA 2RTQB 1Y53X 5H8TA 4DQ3A 1TW4A 2A2GA 2WUTA 4HPCA 3WJCA 3CCEE 3WJDA 3CCQE 1E06A 1SWEA 1SXUA 1SWKA 3FLLA 1FE3A 2XKLA 2WEWA 3BX8A 3WZOA 3K3LA 4RUUA 3D96A 5LKFA 2ZSCA 4ZR2A 5IO5A 3G71E 1W6FA 1IFCA 3ZW0B 2IZLB 1PM1X 3X00A
chains in the Genus database with same CATH topology
2OY7A 2OL6O 1P4PA 3CKFA 3CKGA 5B11O 2PI3O 2OL7A 1OSPO 2OY5O 2OL8O 3IGEA 2FKJA 2G8CO 2I5ZO 2HKDA 2OY8A 3EC5A 1RJLC 5B10O 5B3MO 3AUMO 2OYBO 2OY1O 2I5VO 5B2AO 3IG9A 2FKGA 1FJ1E 2AF5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OY7 A;  2OL6 O;  1P4P A;  3CKF A;  3CKG A;  5B11 O;  2PI3 O;  2OL7 A;  1OSP O;  2OY5 O;  2OL8 O;  2FKJ A;  2G8C O;  2I5Z O;  2HKD A;  2OY8 A;  3EC5 A;  5B10 O;  5B3M O;  3AUM O;  2OYB O;  2OY1 O;  2I5V O;  5B2A O;  2FKG A;  1FJ1 E;  2AF5 A; 
#chains in the Genus database with same CATH topology
 1JJX A;  3CKF A;  5D4A A;  3TF6 A;  3RDM A;  2CBR A;  5L8O A;  1SWC A;  1DF3 A;  3PIO E;  3PED A;  1H91 A;  4BGF A;  5B10 O;  1KL3 A;  4DNE A;  5HCE C;  2ACP X;  1UYN X;  2CZU A;  1KD1 G;  3P6F A;  2W2A A;  3FID A;  1VQP E;  4Z2O A;  1RLB E;  1ZNL A;  1HMT A;  1AQB A;  4MVK A;  4ZHG A;  4GKC A;  5CSE A;  2X56 A;  5FQ7 E;  2OL7 A;  2A2U A;  4ORY A;  2CM9 A;  3FA7 A;  1A3Y A;  1DZK A;  4PSQ A;  3STM X;  3CF5 E;  3WYQ A;  1MX8 A;  2JU7 A;  1VWB B;  3HWE A;  5HZQ A;  1QFT A;  3RDU A;  4DQ4 A;  4ID2 A;  2HNX A;  3PPT A;  1ML7 A;  1TXL A;  1NP4 A;  2RTP B;  4GH7 A;  4GGT A;  4OS3 A;  1HBQ A;  1XCA A;  1SWS A;  1VYG A;  3IFB A;  3OJY C;  1T8V A;  1GM6 A;  1W4T A;  4YKO A;  5JVH E;  1EAL A;  4MIS A;  4WFV A;  2JN3 A;  1YIJ E;  5B5F A;  4YBP A;  3T2X A;  4AZM A;  1PBO A;  4NV8 A;  2BS6 A;  1AVE A;  3EBW A;  4R0B A;  2M4L A;  5IXG A;  4IBA A;  2L5P A;  4TNN A;  1VWD B;  5F6B A;  3TGA A;  1SXY A;  4I3B A;  4TQ2 A;  2RTA A;  1X8U A;  1VWM B;  4NV7 A;  4BX5 B;  1QVF E;  1YI2 E;  3EM0 A;  1G85 A;  4MIR A;  1BBP A;  2RTF B;  2C4I A;  3OD9 A;  1NQN A;  3VHM A;  1Z24 A;  2KD2 A;  2IZJ A;  1SWF A;  3HPE A;  1LPJ A;  3STK A;  3WZQ A;  2Q39 A;  2QO4 A;  3PEC A;  3VG3 A;  4KII A;  3FA9 A;  4PJ2 A;  5LJG A;  4BCS A;  2QCB A;  1Q7Y G;  5B11 O;  1E00 A;  5EEE A;  4ZH9 A;  4YDB A;  5BVQ A;  1XKI A;  2RTE B;  1NBX A;  5CE4 A;  5LJC A;  4U8U O;  1KT3 A;  1UYO X;  2UYW A;  4ES7 A;  1ZNG A;  4Y59 A;  4ARH A;  1VWO B;  5KIC A;  1OPB A;  3PP6 A;  3WBG A;  4Z6J A;  1MUP A;  3FW5 A;  1VQK E;  1B4M A;  1HN2 A;  5IO7 A;  2A13 A;  5HZ9 A;  2DJG A;  4Y0S A;  1R0U A;  4IAW A;  2DM5 A;  1OPA A;  3HK1 A;  3NBX X;  2N93 A;  3ZW2 A;  3P02 A;  3BU9 A;  3UEX A;  1BSQ A;  2GJ5 A;  1DZM A;  1VQ4 E;  2AKQ A;  1OBP A;  1N8R G;  2IZD B;  2QM9 A;  1E2T A;  3SOT A;  1SWG A;  1VQ9 E;  3S5V A;  1GX8 A;  4U3Q A;  3FDC A;  1BLR A;  5H9K A;  5L3Y A;  4IB7 A;  3CBC A;  1I9H A;  5B5G A;  3NQ3 A;  2AVI A;  2NNQ A;  2PI3 O;  4O4X A;  4IMO A;  4GK9 A;  4N7C A;  3H3I A;  1QVG E;  1DZP A;  4NNS A;  4YMY A;  1JYD A;  4FQB B;  4Z28 A;  3VGW A;  1NGL A;  5HZ6 A;  1FEN A;  1SRI A;  1VWQ B;  4JGL A;  4ZHC A;  4IB8 A;  4GGZ A;  5DPQ A;  3KFH A;  5AJC A;  3LTW A;  5DG4 A;  3CCR E;  3ELX A;  4U9C A;  4TKH A;  4CPI A;  3F9D A;  3NQK A;  2OFB A;  3LV4 A;  1PTS A;  1VWK B;  4CPF A;  3JSQ A;  2AH7 X;  2OL8 O;  2OFA A;  1EQD A;  2I5Z O;  3U9P C;  3AEH A;  1B0O A;  2XST A;  1CBQ A;  4NLJ A;  1RBP A;  1YWB A;  4ORU A;  2Y32 A;  1W2B E;  4MVI A;  2MWH A;  1Y9L A;  5BYP A;  1P4P A;  1SXW A;  1VYO A;  2FKJ A;  2WEX A;  5LJK A;  4GJV A;  1RXH A;  2ASN X;  1GT1 A;  1N0S A;  3LHN A;  4WFA E;  3CCS E;  4AZQ A;  2Y3E A;  3KFF A;  2R73 A;  4QGW A;  1SRJ A;  3BDR A;  4ORR A;  2G8C O;  1YIV A;  3ELZ A;  5KID A;  4I60 A;  4BX6 B;  4FBR A;  1JQP A;  1ZNK A;  1TVQ A;  3KFG A;  4JHQ A;  2WPU A;  1DC9 A;  1IKJ A;  2KT4 B;  5LJD A;  2HMB A;  1GKA B;  5FQ6 E;  3P6D A;  1BRP A;  2OVE A;  2A5B A;  5K06 A;  3D9W A;  3EYC A;  1BEB A;  1U18 A;  1LCV A;  4M7M A;  2OTJ E;  2ALL X;  2IZK A;  2X46 A;  1LIC A;  3HTY A;  4HPD A;  2C1S A;  3CR6 A;  5FQ8 E;  1SRH A;  4ML7 B;  2LBA A;  1SWJ A;  2F01 A;  5HBS A;  4A8Z A;  1HQP A;  3OBL A;  1MM9 A;  1EPA A;  3RE6 A;  4CDF A;  1URE A;  4OEM A;  1PEE A;  1U0X A;  4ZH6 A;  3SLJ A;  1RXJ A;  2OY7 A;  4U67 E;  1YP7 A;  2LKK A;  3U0D A;  4AZO A;  3TZS A;  3BRN A;  5GAE G;  2O62 A;  1CRB A;  1BJ7 A;  1M90 G;  2RTL A;  1TOU A;  2QO5 A;  3MG5 A;  2FGS A;  2OFM X;  2AT6 X;  1VQO E;  2LFO A;  1Q81 G;  5IO6 A;  1SWQ A;  4A1Y A;  1JJU A;  4YDA A;  1PMP A;  1K9M G;  1SWN A;  3ZUO A;  1SY0 A;  4EDE A;  1STR B;  1STS B;  4NNT A;  2IZC B;  1YJW E;  4AZP A;  2AT3 X;  3NAD A;  1LCZ A;  1N7Y A;  2GTF X;  3FA8 A;  3RZY A;  3TGB A;  2EU7 X;  2AT8 X;  1QAB E;  1VQN E;  1EII A;  1ACD A;  3HWD A;  2X32 A;  1SWT A;  1YUP A;  3VHH A;  1QY0 A;  4U8U M;  1NQM A;  3RWX A;  3VG6 A;  4GD9 A;  4A60 A;  2KTS A;  2VFC A;  1SRF A;  2FRS A;  2BT9 A;  3IGE A;  1VQ7 E;  5HWZ A;  3WYP A;  3VE1 A;  2NP1 A;  2L9C A;  1E02 A;  1SLG B;  4ZGF A;  3VG4 A;  4DCB A;  1VWP B;  1DFV A;  4Z27 A;  1QY1 A;  2IZE B;  1SLD B;  2GTL O;  5IRU A;  1K73 G;  5MLC H;  2RCQ A;  3B2H A;  4YGH A;  3PDF A;  3EC5 A;  1LIF A;  2WQ9 A;  1O8V A;  3D97 A;  3E3C A;  4AZR A;  4YBU A;  1KQS E;  2OL6 O;  1VWC B;  1T0V A;  1QFV A;  3MX7 A;  3NR3 A;  1ZRY A;  3CC7 E;  1Y55 X;  1IIU A;  3PH6 A;  2PY1 A;  3ZQ3 A;  2GTL N;  1I04 A;  1X89 A;  1KT4 A;  2Q2P A;  2DJF A;  3RSW A;  1VWE B;  4HFO A;  1BWY A;  3VPJ E;  4WHI A;  1JYJ A;  3NX1 A;  2Q9S A;  4BX7 A;  4YFR A;  5EED A;  2X45 A;  1VWG B;  3ZW1 B;  3CPW E;  3VHI A;  3BLG A;  1DZJ A;  5F7G A;  4N7D A;  4YCH A;  3APU A;  1LKE A;  4NP1 A;  3PH5 A;  3FEL A;  1GX3 A;  1VWA B;  1VWN B;  5BVS A;  4L1N A;  1N43 A;  3SZJ A;  1KQW A;  4D6B A;  2IZF B;  2QEX E;  2NND A;  4QZT A;  3OE3 A;  3VG5 A;  1KL5 A;  2HKD A;  4OMX A;  4YFP A;  4IB9 A;  4UY8 G;  4EEJ A;  4ALO A;  3ZW0 A;  5F1E A;  4O4O A;  4AYH A;  4ZHH A;  3RE5 A;  4XMH A;  5LJB A;  1EUO A;  3CXC E;  2RTB B;  1OEK A;  1K8A G;  3CC2 E;  1MK5 A;  5EPQ A;  2R74 A;  3FW4 A;  4FBO A;  1KFF A;  2RTR B;  3VG2 A;  3AUM O;  3HWF A;  1YWA A;  5CYB A;  2R56 A;  4M6S A;  3O2Y A;  3O22 A;  1KT6 A;  2X8S A;  1RSU B;  2P8G A;  4XMG A;  3CMP A;  5D47 A;  2IZB A;  1S44 A;  2FHN X;  4ZHD A;  4BVM A;  1KL4 A;  2AF5 A;  2YMS A;  2CBS A;  2OFR X;  2OVD A;  2MM3 A;  1U17 A;  2FR2 A;  1LUQ A;  4YFQ A;  2G79 A;  4GUZ A;  3RKG A;  1MVG A;  4CPE A;  1SWH A;  1E5P A;  1KQX A;  1Q86 G;  5D8J A;  3WJF A;  1W5R A;  2VFB A;  3BY0 A;  1X8P A;  1ICM A;  1OBQ A;  5AEO A;  3EMM A;  5AN9 B;  4ZJ0 A;  2FLJ A;  1SY3 A;  5JD2 A;  1K3B A;  2GC9 A;  2MF6 A;  2X8F A;  3RDX A;  4CPH B;  2CM4 A;  4I3D A;  3T6F A;  3UEV A;  3CCL E;  1LF7 A;  2BC3 A;  1JJ2 E;  3PIP E;  2L67 A;  4KH8 A;  3QKG A;  4ZFX A;  1X71 A;  1IFB A;  4OKA A;  4FBV A;  2OTL E;  2HYS A;  3RDO A;  4BX5 A;  1VQ5 E;  3NP1 A;  2Y3F A;  3S5X A;  1G74 A;  1JIW I;  3APX A;  3NPO A;  2RTJ A;  1D3S A;  4NLI A;  1SWD A;  2KTD A;  1ZND A;  4OEL A;  2RTI B;  3FIQ A;  1IW2 A;  1FEM A;  5FFH A;  2IZG B;  5LJE A;  1GT3 A;  4MVL A;  3CKG A;  3FR2 A;  2Z4I A;  3WJE A;  3NX2 A;  3F8A A;  4MVE A;  3FMZ A;  1DV9 A;  2G5L A;  1EXS A;  3APW A;  2BLG A;  3PK2 A;  3SZH A;  5H1S I;  4GRJ A;  3RDQ A;  2RTD B;  4BBO A;  1ADL A;  3WJG A;  3SZI A;  1SWO A;  4KC8 A;  4LZV A;  4QYP A;  5F2B A;  1RST B;  3CD6 E;  1RAV A;  1GT4 A;  5HA1 A;  4D6A A;  2A0A A;  5DM6 E;  4MEE A;  4YGZ A;  5EDC A;  4O4S A;  3SAO A;  1LID A;  3WZP A;  2OY5 O;  4UU2 A;  4CSB A;  4ORS A;  1YJN E;  4O4U A;  1EW3 A;  1JV4 A;  3I0A A;  3CCU E;  4GZV A;  3BSZ E;  1Y9T A;  4CDD A;  2AT0 X;  1KT5 A;  1I78 A;  3D95 A;  3HOE A;  5IRA A;  1JMZ A;  1ERB A;  1YHQ E;  2ZJP E;  4GET A;  3GAQ A;  4BOE A;  4JNJ A;  2HLV A;  5C0N A;  1A57 A;  1FEL A;  1AB0 A;  5H9N A;  1X8Q A;  2IZI A;  4LZU A;  1I06 A;  1JJJ A;  1SLE B;  2RTH B;  3CC4 E;  1TOW A;  3FR4 A;  2OF8 A;  1YIT E;  5B29 A;  3STN A;  3P6H A;  4I9R A;  4ON1 A;  5HZ8 A;  2JU3 A;  5HAE A;  1EIO A;  1FJ1 E;  2X55 A;  1KC8 G;  5JR8 A;  1SY2 A;  3CME E;  3C77 X;  2LBV A;  1SWU A;  4XMD A;  1VWL B;  2LA7 A;  2JW1 A;  2ANS A;  3MBT A;  2FS6 A;  2IFB A;  2ACO A;  1SWL A;  1KT7 A;  4Y0R A;  4GJS A;  2F73 A;  1SY1 A;  5FEN A;  2MO5 A;  1STP A;  1QY2 A;  3KFI A;  4LKT A;  2RCT A;  1CBR A;  1L6M A;  4GDZ A;  2IZA A;  4QQ1 A;  3OW2 E;  4O9S A;  1VPR A;  2AT5 X;  1D2U A;  1YJ9 E;  4XMC A;  3G7X A;  2RTG B;  4Z2V A;  4BX7 B;  3P6G A;  4LQZ A;  4WFB E;  1ERX A;  2OY1 O;  4ORW A;  3MM0 A;  4C5P A;  3J7Z G;  4GU8 A;  4QGX A;  4Y0P A;  3VE2 A;  4ZCB A;  4EFG A;  3P6E A;  5EDB A;  5HL7 E;  3F6Z B;  2Q4N A;  1P6P A;  2JGS A;  3UEU A;  5D45 A;  2K62 A;  3QQ2 A;  4UU3 A;  2I5V O;  4IAB A;  4I95 A;  5H9L A;  5CHK A;  3T6L A;  2QOS C;  3PQU A;  4QRL A;  2A5C A;  1SRG A;  3T2W A;  1SXX A;  3UEW A;  4BX6 A;  2RTK A;  5HTD A;  2JOZ A;  1GKA A;  1HQQ A;  4JO6 A;  1ZNE A;  3GE2 A;  1HXL A;  4L3R A;  5JVG E;  2RTO B;  1FDQ A;  3B2L A;  1VYF A;  4OS8 A;  4IAX A;  4XMF A;  4IOC E;  4K19 A;  3V8U A;  4IO9 E;  2CAM A;  1RL6 A;  2RQ0 A;  2JMB A;  1B56 A;  3N91 A;  4XME A;  2F09 A;  3AKM A;  4TKJ A;  2QA4 E;  2POA A;  4OS0 A;  2WQA E;  5H9A A;  5B3M O;  3VG7 A;  1GT5 A;  3Q34 A;  1DF8 A;  1MX7 A;  3D4R A;  3S26 A;  4O49 A;  5D48 A;  3RY1 A;  5F58 A;  4IRW A;  4IB6 A;  1S72 E;  4ZGU A;  4OMW A;  1VWR B;  4ZHF A;  4WF9 E;  1B8E A;  1YWC A;  2RA6 A;  1VQ8 E;  2G7B A;  2RTM A;  3CCJ E;  1CBS A;  4ODD A;  4IMN A;  1NJI G;  1LCW A;  3HWG A;  2KW1 A;  3FEP A;  4YGG A;  3BS2 A;  5FAZ A;  1GXA A;  1IKE A;  4HWM A;  1LEL A;  1SWR A;  1QWD A;  5GAD G;  1IJ8 A;  1SMP I;  2ZJR E;  3UAQ A;  1AVG I;  1FTP A;  2QOM A;  3FEN A;  2BHV A;  3HOL A;  4GE1 A;  2HZQ A;  2IZH B;  3FYF A;  4QNI A;  4ORX A;  1SWB A;  2RD7 C;  3KZA A;  1OEJ A;  2K23 A;  1GX9 A;  4QAE A;  4QZU A;  5L8N A;  4WFU A;  1M1K G;  4EXZ A;  3G6E E;  4ALB A;  1RXK A;  3I17 A;  2CQL A;  2W2F A;  2BS5 A;  3SLT A;  5HZ5 A;  3WXQ A;  3TGC A;  4I6S A;  1BRQ A;  3RDS A;  3U03 A;  4CDE A;  1RJL C;  3IA8 A;  4LKP A;  4YVB A;  2FHL A;  2FS7 A;  1BSY A;  1HY2 A;  2A3F X;  1AVD A;  3JQO A;  2E4J A;  2CZT A;  1KXO A;  1X8O A;  2A8G A;  4O3X B;  2WWP A;  3O19 A;  1SWP A;  3B2J A;  2OF9 A;  1YWD A;  1ZNH A;  4NYR A;  2G78 A;  1A2D A;  1VQ6 E;  1JMX A;  2QMI A;  3CQN A;  1LIB A;  2X34 A;  1O1V A;  4COT A;  3ZWE A;  3AKN A;  3DTQ A;  4B55 A;  2NNE A;  3C78 X;  4GGR A;  1VWF B;  3WVM A;  3EBK A;  1KGL A;  1S7D A;  1EPB A;  1GGL A;  3ZUI A;  2RN4 A;  3RY2 A;  3T1D A;  2Q2M A;  3PQS A;  1LIE A;  3CWK A;  3KVN A;  3KQ0 A;  2OZQ A;  1SA8 A;  3SLO A;  3RBY A;  3BU1 A;  4FGI B;  1NC9 A;  1JZU A;  2L68 A;  2QO6 A;  5HCD C;  2MJI A;  3ZW1 A;  4BQU A;  3VU1 A;  1VWJ B;  3WZN A;  1SRE A;  4U8U N;  2HZR A;  4BJ8 A;  5AJB A;  1SWA A;  3L4R A;  1HMR A;  4WBK A;  1VWH B;  4INN A;  5HA0 A;  1KZW A;  1HXZ A;  3IG9 A;  2Z4H A;  5GAH G;  1G5W A;  5F6Z A;  1KZX A;  3JS1 A;  2FT9 A;  1ICN A;  1VQM E;  1BM5 A;  1OBU A;  5EZ2 A;  3NQ9 A;  2MHD A;  3EW1 A;  2FWV A;  2OVS A;  4A1H A;  4TLJ A;  2OVA A;  4U46 A;  1BSO A;  2W2B A;  2UZ2 A;  1HMS A;  2GH7 A;  1Q82 G;  1QQS A;  3APV A;  1QG5 A;  1EI5 A;  5AQ6 A;  3ZZV A;  4GDA A;  4IOA E;  2RTC B;  1O1U A;  5GAG G;  2AL0 X;  3P6C A;  3WJB A;  4CV7 A;  3CMA E;  2C1Q A;  4YKM A;  2X4M A;  1CJ5 A;  1A18 A;  1JBH A;  1T68 X;  1WBI A;  1CBI A;  3P24 A;  5K67 A;  4O3W A;  3I55 E;  2YG2 A;  4GNW A;  2ZJQ E;  2ZAG A;  2OYB O;  2JU8 A;  3Q6L A;  4AZN A;  4AW8 A;  1VQL E;  2WR6 A;  4O3Z A;  1N9Y A;  5B27 A;  3MVF A;  3B2K A;  1LNM A;  1MEP A;  1YP6 A;  2GTL M;  3S60 A;  3I56 E;  2ZAI A;  3ZI8 A;  3WOV A;  1WUB A;  1I05 A;  1N4J A;  1G7N A;  4Y5D A;  3CCV E;  1VWI B;  2AMM X;  4KT5 A;  4I9S A;  2VDF A;  1OEE A;  3FR5 A;  1LDO A;  2WSJ A;  1I4U A;  4CDC A;  3DSZ A;  4GNY A;  4NW4 A;  4EKV A;  1ALB A;  2OY8 A;  2BSZ A;  3CCM E;  5LJH A;  1LFO A;  1Y52 X;  3FEK A;  5DM7 E;  2FR3 A;  1KOI A;  3B2I A;  4CPH A;  4I3C A;  1UZ2 X;  4QGV A;  4QYN A;  5IRW A;  3CBS A;  3EW2 A;  2RTN B;  4YH0 A;  1X8N A;  4Z2P A;  3C76 X;  4HPB A;  5B2A O;  3DLL E;  4HPA A;  5K68 A;  4TJZ A;  4NYQ A;  4CK4 A;  4WFN E;  4WCE E;  3FA6 A;  2FTB A;  1PBY A;  1MDC A;  5HCC C;  4TKB A;  1Y0G A;  5BVT A;  1LDQ A;  1S2P A;  1NDJ A;  3G4S E;  5L8I A;  4YCE A;  4RUN A;  4O3Y A;  4KCA A;  1MOY A;  1K24 A;  3BX7 A;  3CQR A;  1OSP O;  1NP1 A;  4Y0Q A;  4EQA C;  4KC7 A;  1N9M A;  5LKE A;  1AEL A;  1HBP A;  2X8T A;  2LB6 A;  1SLF B;  5KHP A;  5HTE A;  2FKG A;  2RTQ B;  1Y53 X;  5H8T A;  4DQ3 A;  1TW4 A;  2A2G A;  2WUT A;  4HPC A;  3WJC A;  3CCE E;  3WJD A;  3CCQ E;  1E06 A;  1SWE A;  1SXU A;  1SWK A;  3FLL A;  1FE3 A;  2XKL A;  2WEW A;  3BX8 A;  3WZO A;  3K3L A;  4RUU A;  3D96 A;  5LKF A;  2ZSC A;  4ZR2 A;  5IO5 A;  3G71 E;  1W6F A;  1IFC A;  3ZW0 B;  2IZL B;  1PM1 X;  3X00 A; 
#chains in the Genus database with same CATH homology
 2OY7 A;  2OL6 O;  1P4P A;  3CKF A;  3CKG A;  5B11 O;  2PI3 O;  2OL7 A;  1OSP O;  2OY5 O;  2OL8 O;  3IGE A;  2FKJ A;  2G8C O;  2I5Z O;  2HKD A;  2OY8 A;  3EC5 A;  1RJL C;  5B10 O;  5B3M O;  3AUM O;  2OYB O;  2OY1 O;  2I5V O;  5B2A O;  3IG9 A;  2FKG A;  1FJ1 E;  2AF5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...