2OY5O

The crystal structure of ospa mutant
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
250
structure length
250
Chain Sequence
b'SHMKNSVSVDLPGSMKVLVSKSSNADGKYDLIATVDALELSGTSDKNNGSGVLEGVKADASKVKLTISDDLGQTTLEVFKSDGSTLVYKYVYSKDKSYTYEYFNEKGEVSYKYIYRADGTRLEYTGIKSDGSGKAKEVLKGYVLEGTLTAEKTTLVVKEGTVTLSKNISKSGEVSVELNDTDSSAATKKTAAWNSGTSTLTITVNSKKTKDLVFTSSNTITVQQYDSNGTSLEGSAVEITKLDEIKNALK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Outer surface protein A
publication title Aromatic cluster mutations produce focal modulations of beta-sheet structure.
pubmed doi rcsb
source organism Borrelia burgdorferi
molecule tags Membrane protein
total genus 54
structure length 250
sequence length 250
ec nomenclature
pdb deposition date 2007-02-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.160 Mainly Beta Beta Barrel Lipocalin C1 set domains (antibody constant domain-like) 2oy5O01
3.90.930.1 Alpha Beta Alpha-Beta Complex Outer Surface Protein A; domain 3 Outer Surface Protein A; domain 3 2oy5O02
2I5VO 2OL7A 2OL6O 2OY1O 3AUMO 2PI3O 5B2AO 2OL8O 1OSPO 2FKJA 1P4PA 2I5ZO 2OY8A 5B10O 2G8CO 3EC5A 5B11O 3CKGA 2OYBO 1FJ1E 2AF5A 5B3MO 2OY7A 2FKGA 2OY5O 2HKDA 3CKFA
chains in the Genus database with same CATH superfamily
3WJBA 1SXUA 5EEDA 4IMNA 5C0NA 1QVFE 1ZNEA 1BSYA 4IMOA 4NNSA 1O1UA 1VWNB 1PBOA 4TKHA 4GD9A 2CBSA 1MX8A 4O9SA 1UZ2X 2RCQA 4ZHHA 4AZNA 1JIWI 5IXGA 1DZJA 5HBSA 4XMFA 4ZH9A 1IFCA 4ORRA 1A2DA 1SWGA 1IKEA 1VWKB 4HPAA 2X32A 2X8SA 4BGFA 4JGLA 3ZW0A 3HWGA 5GAGG 1Y9TA 3C78X 1SY3A 1BWYA 1HBPA 1VWMB 1SWPA 1FENA 2R74A 4QYNA 1I9HA 1KC8G 3BS2A 4GKCA 3UEXA 3L4RA 2CQLA 3P6CA 1B8EA 2RD7C 2A8GA 1SWFA 4WFNE 2AT0X 3DSZA 1QY1A 2DJGA 2NNEA 3FA7A 2OF9A 4D6AA 3BU1A 1GM6A 2OTLE 1JBHA 5FENA 4YGHA 3ZW1A 4YDBA 3WJCA 4FGIB 4GETA 1KZXA 4Y5DA 1NBXA 3HTYA 1X8NA 3NPOA 1LF7A 2CAMA 1HMSA 2ZJRE 4FBOA 3WOVA 5LJCA 1QY0A 2RN4A 3WJEA 2MO5A 1SXWA 2IZGB 5D8JA 1BRPA 1QVGE 2RTGB 4U8UN 1VQNE 2FR2A 2X4MA 1GT3A 1KXOA 1S7DA 4BX7A 1ICNA 3CCEE 1S44A 2QM9A 1LELA 2POAA 2LBVA 4XMDA 2AT8X 1P6PA 3WZNA 4N7DA 5FFHA 2Y3FA 1I04A 2YMSA 5IO7A 5IRAA 2A0AA 2OVAA 4WHIA 1LIFA 1RL6A 3PDFA 2JU7A 3LTWA 1W5RA 5MLCH 5GADG 3CQNA 4YGZA 4Z6JA 4A1YA 2KTDA 1ZNHA 5L8NA 3B2IA 4XMGA 1AVGI 1STPA 4KC7A 4Z27A 1DZPA 3RDOA 1CBIA 2RTLA 3WYQA 4FQBB 1B56A 4UY8G 3ZUIA 1RJLC 4YBUA 5DM6E 2A13A 1ZNLA 5AN9B 3VE1A 2RTRB 3FLLA 1IIUA 2XSTA 2RTIB 1VQLE 2Y32A 3VHIA 1RXHA 3PIPE 4WFUA 5B3MO 5HAEA 1VQPE 5GAHG 3FELA 3RWXA 1NC9A 1VWRB 3CXCE 2HLVA 3PIOE 3CMAE 1SLDB 5HCCC 4O4UA 5B29A 2AMMX 2Q9SA 3PQUA 4KT5A 2OZQA 4CSBA 2C1SA 3I17A 3PK2A 3OBLA 3APUA 1OSPO 3FA9A 3UEVA 3FYFA 1KGLA 3FENA 5FAZA 4I3CA 4WFVA 3NBXX 4ZGUA 3BY0A 2WQ9A 2IZHB 4KCAA 4PSQA 2RTMA 5HZQA 4O4XA 4QZUA 5K67A 2BS5A 1KT3A 1G74A 1JYDA 2KW1A 5HZ5A 4U3QA 5LKEA 4D6BA 4AW8A 4K19A 1JV4A 3T2WA 5B27A 3RE5A 3G71E 3CCQE 1X8PA 1U0XA 1EW3A 1VWLB 3RE6A 1MUPA 4GNWA 1SRJA 1VQ7E 4AZOA 1Y52X 3U9PC 2FTBA 1RBPA 4XMEA 2X8TA 2IZBA 1ICMA 1EPBA 2FS7A 4TLJA 1K73G 1T68X 1SWLA 1FE3A 3CMPA 5B2AO 1SLFB 3NP1A 4L3RA 3ZWEA 5HWZA 4MVKA 2KTSA 1Y53X 1LIEA 1SWCA 1TXLA 3SZIA 3BX8A 3CC2E 2GH7A 3FW5A 3JQOA 5FQ6E 3IGEA 2HZRA 1WUBA 5BVQA 3EM0A 1S72E 3K3LA 2M4LA 4IOCE 1G85A 4CDFA 1VWOB 4ES7A 4ZHCA 1SWSA 1ML7A 1TOWA 4TNNA 1SWHA 1SWNA 2OVSA 2RTBB 5IRWA 4BX5B 2XKLA 3CCRE 4O3YA 3S5VA 2WSJA 1DC9A 1IKJA 4L1NA 4NYQA 2X34A 1EUOA 1KL4A 5FQ8E 3PH6A 4O3ZA 4Z28A 4ORXA 1GT1A 4ZFXA 5F58A 2QA4E 5H9AA 4OS3A 1Q81G 2AT6X 4Z2OA 1GT4A 2JMBA 3EBWA 4N7CA 5LJDA 2RTNB 2ASNX 3SLJA 5GAEG 4CV7A 1B0OA 4ODDA 4HPDA 4CPIA 2LB6A 4JHQA 1JJ2E 1KT6A 2OTJE 1LUQA 3WYPA 3ZQ3A 1SY1A 2R56A 2IZKA 2RTEB 3KVNA 1NP4A 3FR2A 3PQSA 3BLGA 1SWAA 3TZSA 4GZVA 5D47A 5K68A 3WJFA 3ZUOA 4I95A 3NQ3A 3ELXA 4YFPA 2RTCB 4KC8A 4ON1A 1K8AG 5BYPA 2OF8A 4I60A 1FJ1E 4O4OA 4U67E 1N43A 3S60A 4INNA 4MVEA 3D97A 2L5PA 2AKQA 3WVMA 4IAXA 1ZNDA 3B2HA 3P24A 3WZPA 2KT4B 5L8IA 5D4AA 4ML7B 5L8OA 3T6FA 1ZRYA 2IZEB 2RTPB 4GU8A 2W2AA 2RCTA 4WFBE 4ALOA 4GGRA 1AELA 3HWDA 3IA8A 1B4MA 2K62A 5LJHA 1JMXA 1VWPB 1A57A 1SWDA 1TW4A 2L9CA 3KFFA 4IO9E 3RDMA 4GGTA 4OELA 1NDJA 1YP6A 2IZFB 4IBAA 5DM7E 2ZJQE 1RLBE 1OBPA 2MHDA 4WF9E 4B55A 2GTFX 3U0DA 1OPBA 1VWAB 4OS8A 3RDXA 2RTAA 1YHQE 1KQXA 3B2LA 1VWGB 3UAQA 3BU9A 1VQKE 1KZWA 1DFVA 5DG4A 2R73A 4GDAA 4QGVA 3CBCA 1RSUB 1YIVA 4ALBA 3EW1A 1VYGA 3STKA 3FIQA 5HCEC 1YUPA 4Y0RA 4BOEA 3SZHA 2IZCB 3CC4E 3EBKA 3FR5A 3CWKA 3FDCA 1KT7A 1W4TA 4KIIA 5AJCA 4NV7A 1HBQA 3P6HA 2CM9A 4U46A 1U17A 4QRLA 1FDQA 1QQSA 1ALBA 3HK1A 1MDCA 3EMMA 4MISA 5B5FA 5BVTA 1VQ9E 3RY2A 4MEEA 3C76X 1SRGA 3T1DA 1HXZA 4HWMA 2YG2A 3OW2E 1MVGA 4XMCA 4YMYA 4NYRA 3D95A 3LHNA 4BX5A 4ZJ0A 1DF8A 3KFHA 4Y0PA 2W2FA 4GUZA 3ZZVA 1QFVA 4WBKA 4IB8A 3ELZA 2NP1A 2E4JA 1STRB 1M1KG 4ZCBA 5JR8A 4EQAC 4YFQA 1GX8A 2ALLX 5HA1A 4HPBA 4MVLA 2A2UA 4TQ2A 2IZDB 3AKNA 3HOLA 3T2XA 2RTJA 4IABA 4LQZA 1X8UA 4M7MA 1RAVA 1I78A 3CC7E 2Z4IA 1OEJA 3CCLE 3VHHA 1YJ9E 4IB6A 1CBSA 5HTDA 4O3XB 1A18A 2C4IA 2AT3X 3FEPA 5D48A 3ZI8A 2QO5A 2OY7A 2OVEA 3T6LA 1VWBB 1VWDB 1GKAB 4OMWA 5F7GA 4LKPA 1L6MA 4BX6B 1YWDA 1EALA 1M90G 3FA6A 5HZ6A 1KQWA 5LJEA 2LFOA 1IJ8A 4O4SA 4QQ1A 1GXAA 5JD2A 3F9DA 2NNDA 5H9KA 2HKDA 1HQQA 4EKVA 1NJIG 1SRHA 5HZ8A 4AYHA 2KD2A 5L3YA 1JJXA 1VQOE 2F09A 3G7XA 2A3FX 4DCBA 1FEMA 2G8CO 4GJVA 3PPTA 4YVBA 1DF3A 1JJUA 1BM5A 4ORWA 4UU3A 1LKEA 4NW4A 5KHPA 4AZRA 4YFRA 3VG6A 2FHLA 3CMEE 4FBVA 2QCBA 2ACPX 4YKMA 3CKGA 2RTQB 4BVMA 4NLJA 1OEEA 2HNXA 1GX9A 3J7ZG 1TVQA 4NP1A 4ZHGA 3VGWA 3APXA 1VWCB 4IB9A 1VYOA 1JYJA 3TF6A 3WJDA 4CDEA 1LIDA 1AVDA 2FT9A 3F6ZB 2IFBA 3RZYA 2BLGA 1G7NA 1SWRA 2G5LA 3KQ0A 3CQRA 4U9CA 4YCEA 2RTFB 1VQ4E 4DQ4A 1SWTA 5AJBA 5EPQA 1CJ5A 5F2BA 3VG2A 1XKIA 2EU7X 4QGWA 1SWEA 3TGCA 1KQSE 5EZ2A 1X71A 4JO6A 3MG5A 2WEXA 2UYWA 1U18A 4AZPA 2ZAGA 3HWEA 2VDFA 4OEMA 2DJFA 1D2UA 5AQ6A 1VQ8E 1K9MG 2QO6A 3H3IA 2X46A 4QGXA 3GAQA 3JS1A 1E5PA 4OMXA 3SAOA 2HZQA 1K3BA 1STSB 4COTA 4CK4A 1ERXA 3WJGA 1IFBA 2FS6A 3CCSE 2LKKA 2HMBA 4HPCA 1BJ7A 1K24A 1N4JA 4JNJA 3CCME 2GC9A 3KFIA 3I55E 2OFBA 4ZR2A 4IB7A 3FA8A 5IO6A 1Y9LA 5HL7E 4QZTA 1FELA 1XCAA 1S2PA 3FEKA 3VG3A 5KIDA 2X55A 1EXSA 4ZHDA 2WPUA 1LCZA 1LICA 4PJ2A 1PMPA 3OE3A 4CPEA 2OVDA 1OBQA 2AVIA 1VPRA 2A5CA 2AF5A 2JN3A 1SWUA 3VPJE 1EIIA 1VWIB 2VFCA 5LJKA 3AUMO 1QWDA 1HMTA 4QAEA 3KFGA 4DNEA 1OPAA 1KFFA 1VWQB 1MX7A 3RDUA 3MBTA 2ACOA 2FKGA 1SWOA 1PTSA 1VQ5E 1D3SA 1GKAA 5JVHE 2FRSA 4BX6A 3P6EA 2OFAA 2DM5A 3FIDA 3WBGA 4KH8A 3P6GA 4QYPA 1YWBA 3IG9A 2JGSA 3O19A 2AT5X 1VWJB 1RXKA 1QG5A 1BRQA 4LZUA 2BT9A 1SWKA 3S5XA 1W6FA 3VE2A 1KT4A 2GTLO 4CDCA 4BBOA 1CBRA 3KZAA 1Q82G 1E00A 2X45A 4YGGA 2Q2MA 3OD9A 4C5PA 3NQ9A 4ZGFA 2QOMA 5DPQA 3CPWE 4I9RA 2WWPA 3STMX 1LCVA 4QNIA 1BBPA 3STNA 1MOYA 1YI2E 4ZH6A 4TKJA 2OY1O 1GX3A 3I0AA 2QOSC 4EDEA 4MIRA 4YDAA 4CPHA 5CHKA 4GDZA 4AZMA 4LKTA 3VG4A 5F6ZA 2QEXE 2N93A 3G6EE 5F6BA 1HXLA 4TKBA 4GH7A 2X8FA 4M6SA 2Q4NA 1Y0GA 3AKMA 4Z2PA 3FW4A 5B11O 1X8QA 1RSTB 2IZLB 1ZNKA 2WQAE 1IW2A 1AVEA 3WXQA 2JU8A 5F1EA 1VWEB 1JJJA 1O1VA 1YP7A 4Y0QA 1QABE 2MF6A 4RUNA 2OY8A 4A1HA 2G78A 3CD6E 3VG7A 5CE4A 3DTQA 3V8UA 1T0VA 4ORSA 1R0UA 3NX2A 1MK5A 4GNYA 1YWCA 1AB0A 4EFGA 4Z2VA 2JOZA 2FGSA 2PI3O 3RY1A 2OL8O 1Q86G 3SOTA 1UYNX 2GJ5A 4A8ZA 3BX7A 3B2JA 2IZJA 5LJBA 2RTOB 3CCVE 4ORYA 2Y3EA 3P02A 2F73A 1VYFA 4YCHA 4GGZA 1Y55X 1BSOA 4NV8A 4BCSA 3BDRA 2MJIA 4A60A 3MX7A 1HQPA 2FKJA 4NNTA 3D96A 1ERBA 1RXJA 1ACDA 1SA8A 1A3YA 4GK9A 1FTPA 2OY5O 1N9YA 2ANSA 4EXZA 3P6DA 1MM9A 1LIBA 5CYBA 3LV4A 2I5ZO 3I56E 1T8VA 1KOIA 1ZNGA 5H1SI 4GE1A 2IZIA 3D9WA 3FR4A 4UU2A 5JVGE 1AQBA 1SXXA 3BRNA 3SZJA 3PEDA 2VFBA 3NADA 2A2GA 2CZTA 1QY2A 2RTKA 4ORUA 5IO5A 3QKGA 1GGLA 1DZKA 1OBUA 1E02A 2WR6A 2AH7X 3G4SE 3NR3A 1Q7YG 1EIOA 4U8UO 5HTEA 1H91A 2RTDB 1KD1G 3C77X 3JSQA 2JU3A 1E06A 3E3CA 3N91A 4Y59A 5D45A 1UYOX 4FBRA 3APWA 2K23A 1HMRA 1KL3A 4BJ8A 4IAWA 1NQMA 3AEHA 4YH0A 2Q39A 1SY2A 3O2YA 1LPJA 2W2BA 2P8GA 1SRFA 2QO4A 4NLIA 2O62A 4LZVA 2G7BA 1EPAA 2BHVA 4IOAE 2CM4A 2OFMX 3U03A 2ZSCA 3CKFA 4GRJA 1NQNA 4I9SA 1YWAA 4CPHB 2Z4HA 3MM0A 2PY1A 1P4PA 3PECA 3S26A 3FMZA 2QMIA 1I06A 1G5WA 2GTLM 1LDOA 4CPFA 1VQ6E 4YKOA 4CDDA 3CR6A 5HA0A 2FR3A 2OL7A 1DZMA 3VHMA 3CCJE 3HOEA 2L68A 1VQME 3UEUA 4OKAA 1MEPA 3ZW2A 1YITE 4O49A 1KL5A 3SLTA 5H8TA 2WEWA 1CRBA 1SWQA 2OFRX 5BVSA 3O22A 2CZUA 1E2TA 1EQDA 2IZAA 1X89A 2WUTA 5KICA 5EEEA 3RDQA 3TGBA 3VU1A 5HCDC 2HYSA 4TJZA 2I5VO 3ZW0B 4MVIA 1SREA 1O8VA 5EDCA 3B2KA 2A5BA 1VWFB 4Y0SA 2RQ0A 4BQUA 3UEWA 2RTHB 2F01A 3MVFA 1SMPI 3TGAA 3Q6LA 5AEOA 1N0SA 3D4RA 4I3BA 2BC3A 3QQ2A 4WCEE 1EI5A 1N7YA 2RA6A 2CBRA 1UREA 1OEKA 2JW1A 4OS0A 2ZAIA 3HPEA 3PH5A 3ZW1B 3RBYA 1W2BE 1WBIA 4I6SA 3CF5E 3EYCA 2BS6A 3CCUE 4I3DA 1KT5A 1CBQA 3PP6A 1JZUA 3NQKA 1PM1X 1JMZA 1BEBA 1YIJE 5EDBA 1SRIA 3F8AA 3NX1A 1I05A 5K06A 1TOUA 4ZHFA 3RKGA 4WFAE 3GE2A 3Q34A 4BX7B 3VG5A 2C1QA 5B10O 5CSEA 5HZ9A 2GTLN 3APVA 2X56A 3RDSA 5B5GA 4O3WA 4EEJA 2AL0X 1HN2A 1Z24A 1SY0A 1NGLA 3P6FA 1BSQA 2FLJA 1LCWA 2BSZA 5FQ7E 2LA7A 3RSWA 1QFTA 2FHNX 1DV9A 1NP1A 1SWBA 3BSZE 2G79A 1SLEB 1PEEA 3CBSA 3X00A 2MWHA 4R0BA 2UZ2A 4DQ3A 4HFOA 1JQPA 5IRUA 4GJSA 5LKFA 1LNMA 1I4UA 2L67A 4ID2A 1N8RG 1X8OA 4IRWA 5H9NA 4AZQA 2MM3A 1N9MA 3IFBA 1SLGB 4RUUA 3WZOA 4ARHA 1BLRA 2NNQA 3EC5A 1ADLA 5H9LA 1LDQA 1PBYA 2OYBO 3WZQA 1YJNE 2FWVA 1HY2A 3OJYC 2LBAA 2OL6O 3HWFA 1VWHB 2Q2PA 1SXYA 1GT5A 3EW2A 4XMHA 4U8UM 2ZJPE 5LJGA 1LFOA 1YJWE 4YBPA 1SWJA 3DLLE 3SLOA
chains in the Genus database with same CATH topology
2I5VO 2OL7A 2OL6O 2OY1O 3AUMO 2PI3O 5B2AO 2OL8O 1OSPO 2FKJA 1P4PA 2I5ZO 3IGEA 2OY8A 5B10O 2G8CO 3EC5A 5B11O 3CKGA 2OYBO 1FJ1E 2AF5A 5B3MO 2OY7A 3IG9A 2FKGA 2OY5O 1RJLC 2HKDA 3CKFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I5V O;  2OL7 A;  2OL6 O;  2OY1 O;  3AUM O;  2PI3 O;  5B2A O;  2OL8 O;  1OSP O;  2FKJ A;  1P4P A;  2I5Z O;  2OY8 A;  5B10 O;  2G8C O;  3EC5 A;  5B11 O;  3CKG A;  2OYB O;  1FJ1 E;  2AF5 A;  5B3M O;  2OY7 A;  2FKG A;  2OY5 O;  2HKD A;  3CKF A; 
#chains in the Genus database with same CATH topology
 3WJB A;  1SXU A;  5EED A;  4IMN A;  5C0N A;  1QVF E;  1ZNE A;  1BSY A;  4IMO A;  4NNS A;  1O1U A;  1VWN B;  1PBO A;  4TKH A;  4GD9 A;  2CBS A;  1MX8 A;  4O9S A;  1UZ2 X;  2RCQ A;  4ZHH A;  4AZN A;  1JIW I;  5IXG A;  1DZJ A;  5HBS A;  4XMF A;  4ZH9 A;  1IFC A;  4ORR A;  1A2D A;  1SWG A;  1IKE A;  1VWK B;  4HPA A;  2X32 A;  2X8S A;  4BGF A;  4JGL A;  3ZW0 A;  3HWG A;  5GAG G;  1Y9T A;  3C78 X;  1SY3 A;  1BWY A;  1HBP A;  1VWM B;  1SWP A;  1FEN A;  2R74 A;  4QYN A;  1I9H A;  1KC8 G;  3BS2 A;  4GKC A;  3UEX A;  3L4R A;  2CQL A;  3P6C A;  1B8E A;  2RD7 C;  2A8G A;  1SWF A;  4WFN E;  2AT0 X;  3DSZ A;  1QY1 A;  2DJG A;  2NNE A;  3FA7 A;  2OF9 A;  4D6A A;  3BU1 A;  1GM6 A;  2OTL E;  1JBH A;  5FEN A;  4YGH A;  3ZW1 A;  4YDB A;  3WJC A;  4FGI B;  4GET A;  1KZX A;  4Y5D A;  1NBX A;  3HTY A;  1X8N A;  3NPO A;  1LF7 A;  2CAM A;  1HMS A;  2ZJR E;  4FBO A;  3WOV A;  5LJC A;  1QY0 A;  2RN4 A;  3WJE A;  2MO5 A;  1SXW A;  2IZG B;  5D8J A;  1BRP A;  1QVG E;  2RTG B;  4U8U N;  1VQN E;  2FR2 A;  2X4M A;  1GT3 A;  1KXO A;  1S7D A;  4BX7 A;  1ICN A;  3CCE E;  1S44 A;  2QM9 A;  1LEL A;  2POA A;  2LBV A;  4XMD A;  2AT8 X;  1P6P A;  3WZN A;  4N7D A;  5FFH A;  2Y3F A;  1I04 A;  2YMS A;  5IO7 A;  5IRA A;  2A0A A;  2OVA A;  4WHI A;  1LIF A;  1RL6 A;  3PDF A;  2JU7 A;  3LTW A;  1W5R A;  5MLC H;  5GAD G;  3CQN A;  4YGZ A;  4Z6J A;  4A1Y A;  2KTD A;  1ZNH A;  5L8N A;  3B2I A;  4XMG A;  1AVG I;  1STP A;  4KC7 A;  4Z27 A;  1DZP A;  3RDO A;  1CBI A;  2RTL A;  3WYQ A;  4FQB B;  1B56 A;  4UY8 G;  3ZUI A;  1RJL C;  4YBU A;  5DM6 E;  2A13 A;  1ZNL A;  5AN9 B;  3VE1 A;  2RTR B;  3FLL A;  1IIU A;  2XST A;  2RTI B;  1VQL E;  2Y32 A;  3VHI A;  1RXH A;  3PIP E;  4WFU A;  5B3M O;  5HAE A;  1VQP E;  5GAH G;  3FEL A;  3RWX A;  1NC9 A;  1VWR B;  3CXC E;  2HLV A;  3PIO E;  3CMA E;  1SLD B;  5HCC C;  4O4U A;  5B29 A;  2AMM X;  2Q9S A;  3PQU A;  4KT5 A;  2OZQ A;  4CSB A;  2C1S A;  3I17 A;  3PK2 A;  3OBL A;  3APU A;  1OSP O;  3FA9 A;  3UEV A;  3FYF A;  1KGL A;  3FEN A;  5FAZ A;  4I3C A;  4WFV A;  3NBX X;  4ZGU A;  3BY0 A;  2WQ9 A;  2IZH B;  4KCA A;  4PSQ A;  2RTM A;  5HZQ A;  4O4X A;  4QZU A;  5K67 A;  2BS5 A;  1KT3 A;  1G74 A;  1JYD A;  2KW1 A;  5HZ5 A;  4U3Q A;  5LKE A;  4D6B A;  4AW8 A;  4K19 A;  1JV4 A;  3T2W A;  5B27 A;  3RE5 A;  3G71 E;  3CCQ E;  1X8P A;  1U0X A;  1EW3 A;  1VWL B;  3RE6 A;  1MUP A;  4GNW A;  1SRJ A;  1VQ7 E;  4AZO A;  1Y52 X;  3U9P C;  2FTB A;  1RBP A;  4XME A;  2X8T A;  2IZB A;  1ICM A;  1EPB A;  2FS7 A;  4TLJ A;  1K73 G;  1T68 X;  1SWL A;  1FE3 A;  3CMP A;  5B2A O;  1SLF B;  3NP1 A;  4L3R A;  3ZWE A;  5HWZ A;  4MVK A;  2KTS A;  1Y53 X;  1LIE A;  1SWC A;  1TXL A;  3SZI A;  3BX8 A;  3CC2 E;  2GH7 A;  3FW5 A;  3JQO A;  5FQ6 E;  3IGE A;  2HZR A;  1WUB A;  5BVQ A;  3EM0 A;  1S72 E;  3K3L A;  2M4L A;  4IOC E;  1G85 A;  4CDF A;  1VWO B;  4ES7 A;  4ZHC A;  1SWS A;  1ML7 A;  1TOW A;  4TNN A;  1SWH A;  1SWN A;  2OVS A;  2RTB B;  5IRW A;  4BX5 B;  2XKL A;  3CCR E;  4O3Y A;  3S5V A;  2WSJ A;  1DC9 A;  1IKJ A;  4L1N A;  4NYQ A;  2X34 A;  1EUO A;  1KL4 A;  5FQ8 E;  3PH6 A;  4O3Z A;  4Z28 A;  4ORX A;  1GT1 A;  4ZFX A;  5F58 A;  2QA4 E;  5H9A A;  4OS3 A;  1Q81 G;  2AT6 X;  4Z2O A;  1GT4 A;  2JMB A;  3EBW A;  4N7C A;  5LJD A;  2RTN B;  2ASN X;  3SLJ A;  5GAE G;  4CV7 A;  1B0O A;  4ODD A;  4HPD A;  4CPI A;  2LB6 A;  4JHQ A;  1JJ2 E;  1KT6 A;  2OTJ E;  1LUQ A;  3WYP A;  3ZQ3 A;  1SY1 A;  2R56 A;  2IZK A;  2RTE B;  3KVN A;  1NP4 A;  3FR2 A;  3PQS A;  3BLG A;  1SWA A;  3TZS A;  4GZV A;  5D47 A;  5K68 A;  3WJF A;  3ZUO A;  4I95 A;  3NQ3 A;  3ELX A;  4YFP A;  2RTC B;  4KC8 A;  4ON1 A;  1K8A G;  5BYP A;  2OF8 A;  4I60 A;  1FJ1 E;  4O4O A;  4U67 E;  1N43 A;  3S60 A;  4INN A;  4MVE A;  3D97 A;  2L5P A;  2AKQ A;  3WVM A;  4IAX A;  1ZND A;  3B2H A;  3P24 A;  3WZP A;  2KT4 B;  5L8I A;  5D4A A;  4ML7 B;  5L8O A;  3T6F A;  1ZRY A;  2IZE B;  2RTP B;  4GU8 A;  2W2A A;  2RCT A;  4WFB E;  4ALO A;  4GGR A;  1AEL A;  3HWD A;  3IA8 A;  1B4M A;  2K62 A;  5LJH A;  1JMX A;  1VWP B;  1A57 A;  1SWD A;  1TW4 A;  2L9C A;  3KFF A;  4IO9 E;  3RDM A;  4GGT A;  4OEL A;  1NDJ A;  1YP6 A;  2IZF B;  4IBA A;  5DM7 E;  2ZJQ E;  1RLB E;  1OBP A;  2MHD A;  4WF9 E;  4B55 A;  2GTF X;  3U0D A;  1OPB A;  1VWA B;  4OS8 A;  3RDX A;  2RTA A;  1YHQ E;  1KQX A;  3B2L A;  1VWG B;  3UAQ A;  3BU9 A;  1VQK E;  1KZW A;  1DFV A;  5DG4 A;  2R73 A;  4GDA A;  4QGV A;  3CBC A;  1RSU B;  1YIV A;  4ALB A;  3EW1 A;  1VYG A;  3STK A;  3FIQ A;  5HCE C;  1YUP A;  4Y0R A;  4BOE A;  3SZH A;  2IZC B;  3CC4 E;  3EBK A;  3FR5 A;  3CWK A;  3FDC A;  1KT7 A;  1W4T A;  4KII A;  5AJC A;  4NV7 A;  1HBQ A;  3P6H A;  2CM9 A;  4U46 A;  1U17 A;  4QRL A;  1FDQ A;  1QQS A;  1ALB A;  3HK1 A;  1MDC A;  3EMM A;  4MIS A;  5B5F A;  5BVT A;  1VQ9 E;  3RY2 A;  4MEE A;  3C76 X;  1SRG A;  3T1D A;  1HXZ A;  4HWM A;  2YG2 A;  3OW2 E;  1MVG A;  4XMC A;  4YMY A;  4NYR A;  3D95 A;  3LHN A;  4BX5 A;  4ZJ0 A;  1DF8 A;  3KFH A;  4Y0P A;  2W2F A;  4GUZ A;  3ZZV A;  1QFV A;  4WBK A;  4IB8 A;  3ELZ A;  2NP1 A;  2E4J A;  1STR B;  1M1K G;  4ZCB A;  5JR8 A;  4EQA C;  4YFQ A;  1GX8 A;  2ALL X;  5HA1 A;  4HPB A;  4MVL A;  2A2U A;  4TQ2 A;  2IZD B;  3AKN A;  3HOL A;  3T2X A;  2RTJ A;  4IAB A;  4LQZ A;  1X8U A;  4M7M A;  1RAV A;  1I78 A;  3CC7 E;  2Z4I A;  1OEJ A;  3CCL E;  3VHH A;  1YJ9 E;  4IB6 A;  1CBS A;  5HTD A;  4O3X B;  1A18 A;  2C4I A;  2AT3 X;  3FEP A;  5D48 A;  3ZI8 A;  2QO5 A;  2OY7 A;  2OVE A;  3T6L A;  1VWB B;  1VWD B;  1GKA B;  4OMW A;  5F7G A;  4LKP A;  1L6M A;  4BX6 B;  1YWD A;  1EAL A;  1M90 G;  3FA6 A;  5HZ6 A;  1KQW A;  5LJE A;  2LFO A;  1IJ8 A;  4O4S A;  4QQ1 A;  1GXA A;  5JD2 A;  3F9D A;  2NND A;  5H9K A;  2HKD A;  1HQQ A;  4EKV A;  1NJI G;  1SRH A;  5HZ8 A;  4AYH A;  2KD2 A;  5L3Y A;  1JJX A;  1VQO E;  2F09 A;  3G7X A;  2A3F X;  4DCB A;  1FEM A;  2G8C O;  4GJV A;  3PPT A;  4YVB A;  1DF3 A;  1JJU A;  1BM5 A;  4ORW A;  4UU3 A;  1LKE A;  4NW4 A;  5KHP A;  4AZR A;  4YFR A;  3VG6 A;  2FHL A;  3CME E;  4FBV A;  2QCB A;  2ACP X;  4YKM A;  3CKG A;  2RTQ B;  4BVM A;  4NLJ A;  1OEE A;  2HNX A;  1GX9 A;  3J7Z G;  1TVQ A;  4NP1 A;  4ZHG A;  3VGW A;  3APX A;  1VWC B;  4IB9 A;  1VYO A;  1JYJ A;  3TF6 A;  3WJD A;  4CDE A;  1LID A;  1AVD A;  2FT9 A;  3F6Z B;  2IFB A;  3RZY A;  2BLG A;  1G7N A;  1SWR A;  2G5L A;  3KQ0 A;  3CQR A;  4U9C A;  4YCE A;  2RTF B;  1VQ4 E;  4DQ4 A;  1SWT A;  5AJB A;  5EPQ A;  1CJ5 A;  5F2B A;  3VG2 A;  1XKI A;  2EU7 X;  4QGW A;  1SWE A;  3TGC A;  1KQS E;  5EZ2 A;  1X71 A;  4JO6 A;  3MG5 A;  2WEX A;  2UYW A;  1U18 A;  4AZP A;  2ZAG A;  3HWE A;  2VDF A;  4OEM A;  2DJF A;  1D2U A;  5AQ6 A;  1VQ8 E;  1K9M G;  2QO6 A;  3H3I A;  2X46 A;  4QGX A;  3GAQ A;  3JS1 A;  1E5P A;  4OMX A;  3SAO A;  2HZQ A;  1K3B A;  1STS B;  4COT A;  4CK4 A;  1ERX A;  3WJG A;  1IFB A;  2FS6 A;  3CCS E;  2LKK A;  2HMB A;  4HPC A;  1BJ7 A;  1K24 A;  1N4J A;  4JNJ A;  3CCM E;  2GC9 A;  3KFI A;  3I55 E;  2OFB A;  4ZR2 A;  4IB7 A;  3FA8 A;  5IO6 A;  1Y9L A;  5HL7 E;  4QZT A;  1FEL A;  1XCA A;  1S2P A;  3FEK A;  3VG3 A;  5KID A;  2X55 A;  1EXS A;  4ZHD A;  2WPU A;  1LCZ A;  1LIC A;  4PJ2 A;  1PMP A;  3OE3 A;  4CPE A;  2OVD A;  1OBQ A;  2AVI A;  1VPR A;  2A5C A;  2AF5 A;  2JN3 A;  1SWU A;  3VPJ E;  1EII A;  1VWI B;  2VFC A;  5LJK A;  3AUM O;  1QWD A;  1HMT A;  4QAE A;  3KFG A;  4DNE A;  1OPA A;  1KFF A;  1VWQ B;  1MX7 A;  3RDU A;  3MBT A;  2ACO A;  2FKG A;  1SWO A;  1PTS A;  1VQ5 E;  1D3S A;  1GKA A;  5JVH E;  2FRS A;  4BX6 A;  3P6E A;  2OFA A;  2DM5 A;  3FID A;  3WBG A;  4KH8 A;  3P6G A;  4QYP A;  1YWB A;  3IG9 A;  2JGS A;  3O19 A;  2AT5 X;  1VWJ B;  1RXK A;  1QG5 A;  1BRQ A;  4LZU A;  2BT9 A;  1SWK A;  3S5X A;  1W6F A;  3VE2 A;  1KT4 A;  2GTL O;  4CDC A;  4BBO A;  1CBR A;  3KZA A;  1Q82 G;  1E00 A;  2X45 A;  4YGG A;  2Q2M A;  3OD9 A;  4C5P A;  3NQ9 A;  4ZGF A;  2QOM A;  5DPQ A;  3CPW E;  4I9R A;  2WWP A;  3STM X;  1LCV A;  4QNI A;  1BBP A;  3STN A;  1MOY A;  1YI2 E;  4ZH6 A;  4TKJ A;  2OY1 O;  1GX3 A;  3I0A A;  2QOS C;  4EDE A;  4MIR A;  4YDA A;  4CPH A;  5CHK A;  4GDZ A;  4AZM A;  4LKT A;  3VG4 A;  5F6Z A;  2QEX E;  2N93 A;  3G6E E;  5F6B A;  1HXL A;  4TKB A;  4GH7 A;  2X8F A;  4M6S A;  2Q4N A;  1Y0G A;  3AKM A;  4Z2P A;  3FW4 A;  5B11 O;  1X8Q A;  1RST B;  2IZL B;  1ZNK A;  2WQA E;  1IW2 A;  1AVE A;  3WXQ A;  2JU8 A;  5F1E A;  1VWE B;  1JJJ A;  1O1V A;  1YP7 A;  4Y0Q A;  1QAB E;  2MF6 A;  4RUN A;  2OY8 A;  4A1H A;  2G78 A;  3CD6 E;  3VG7 A;  5CE4 A;  3DTQ A;  3V8U A;  1T0V A;  4ORS A;  1R0U A;  3NX2 A;  1MK5 A;  4GNY A;  1YWC A;  1AB0 A;  4EFG A;  4Z2V A;  2JOZ A;  2FGS A;  2PI3 O;  3RY1 A;  2OL8 O;  1Q86 G;  3SOT A;  1UYN X;  2GJ5 A;  4A8Z A;  3BX7 A;  3B2J A;  2IZJ A;  5LJB A;  2RTO B;  3CCV E;  4ORY A;  2Y3E A;  3P02 A;  2F73 A;  1VYF A;  4YCH A;  4GGZ A;  1Y55 X;  1BSO A;  4NV8 A;  4BCS A;  3BDR A;  2MJI A;  4A60 A;  3MX7 A;  1HQP A;  2FKJ A;  4NNT A;  3D96 A;  1ERB A;  1RXJ A;  1ACD A;  1SA8 A;  1A3Y A;  4GK9 A;  1FTP A;  2OY5 O;  1N9Y A;  2ANS A;  4EXZ A;  3P6D A;  1MM9 A;  1LIB A;  5CYB A;  3LV4 A;  2I5Z O;  3I56 E;  1T8V A;  1KOI A;  1ZNG A;  5H1S I;  4GE1 A;  2IZI A;  3D9W A;  3FR4 A;  4UU2 A;  5JVG E;  1AQB A;  1SXX A;  3BRN A;  3SZJ A;  3PED A;  2VFB A;  3NAD A;  2A2G A;  2CZT A;  1QY2 A;  2RTK A;  4ORU A;  5IO5 A;  3QKG A;  1GGL A;  1DZK A;  1OBU A;  1E02 A;  2WR6 A;  2AH7 X;  3G4S E;  3NR3 A;  1Q7Y G;  1EIO A;  4U8U O;  5HTE A;  1H91 A;  2RTD B;  1KD1 G;  3C77 X;  3JSQ A;  2JU3 A;  1E06 A;  3E3C A;  3N91 A;  4Y59 A;  5D45 A;  1UYO X;  4FBR A;  3APW A;  2K23 A;  1HMR A;  1KL3 A;  4BJ8 A;  4IAW A;  1NQM A;  3AEH A;  4YH0 A;  2Q39 A;  1SY2 A;  3O2Y A;  1LPJ A;  2W2B A;  2P8G A;  1SRF A;  2QO4 A;  4NLI A;  2O62 A;  4LZV A;  2G7B A;  1EPA A;  2BHV A;  4IOA E;  2CM4 A;  2OFM X;  3U03 A;  2ZSC A;  3CKF A;  4GRJ A;  1NQN A;  4I9S A;  1YWA A;  4CPH B;  2Z4H A;  3MM0 A;  2PY1 A;  1P4P A;  3PEC A;  3S26 A;  3FMZ A;  2QMI A;  1I06 A;  1G5W A;  2GTL M;  1LDO A;  4CPF A;  1VQ6 E;  4YKO A;  4CDD A;  3CR6 A;  5HA0 A;  2FR3 A;  2OL7 A;  1DZM A;  3VHM A;  3CCJ E;  3HOE A;  2L68 A;  1VQM E;  3UEU A;  4OKA A;  1MEP A;  3ZW2 A;  1YIT E;  4O49 A;  1KL5 A;  3SLT A;  5H8T A;  2WEW A;  1CRB A;  1SWQ A;  2OFR X;  5BVS A;  3O22 A;  2CZU A;  1E2T A;  1EQD A;  2IZA A;  1X89 A;  2WUT A;  5KIC A;  5EEE A;  3RDQ A;  3TGB A;  3VU1 A;  5HCD C;  2HYS A;  4TJZ A;  2I5V O;  3ZW0 B;  4MVI A;  1SRE A;  1O8V A;  5EDC A;  3B2K A;  2A5B A;  1VWF B;  4Y0S A;  2RQ0 A;  4BQU A;  3UEW A;  2RTH B;  2F01 A;  3MVF A;  1SMP I;  3TGA A;  3Q6L A;  5AEO A;  1N0S A;  3D4R A;  4I3B A;  2BC3 A;  3QQ2 A;  4WCE E;  1EI5 A;  1N7Y A;  2RA6 A;  2CBR A;  1URE A;  1OEK A;  2JW1 A;  4OS0 A;  2ZAI A;  3HPE A;  3PH5 A;  3ZW1 B;  3RBY A;  1W2B E;  1WBI A;  4I6S A;  3CF5 E;  3EYC A;  2BS6 A;  3CCU E;  4I3D A;  1KT5 A;  1CBQ A;  3PP6 A;  1JZU A;  3NQK A;  1PM1 X;  1JMZ A;  1BEB A;  1YIJ E;  5EDB A;  1SRI A;  3F8A A;  3NX1 A;  1I05 A;  5K06 A;  1TOU A;  4ZHF A;  3RKG A;  4WFA E;  3GE2 A;  3Q34 A;  4BX7 B;  3VG5 A;  2C1Q A;  5B10 O;  5CSE A;  5HZ9 A;  2GTL N;  3APV A;  2X56 A;  3RDS A;  5B5G A;  4O3W A;  4EEJ A;  2AL0 X;  1HN2 A;  1Z24 A;  1SY0 A;  1NGL A;  3P6F A;  1BSQ A;  2FLJ A;  1LCW A;  2BSZ A;  5FQ7 E;  2LA7 A;  3RSW A;  1QFT A;  2FHN X;  1DV9 A;  1NP1 A;  1SWB A;  3BSZ E;  2G79 A;  1SLE B;  1PEE A;  3CBS A;  3X00 A;  2MWH A;  4R0B A;  2UZ2 A;  4DQ3 A;  4HFO A;  1JQP A;  5IRU A;  4GJS A;  5LKF A;  1LNM A;  1I4U A;  2L67 A;  4ID2 A;  1N8R G;  1X8O A;  4IRW A;  5H9N A;  4AZQ A;  2MM3 A;  1N9M A;  3IFB A;  1SLG B;  4RUU A;  3WZO A;  4ARH A;  1BLR A;  2NNQ A;  3EC5 A;  1ADL A;  5H9L A;  1LDQ A;  1PBY A;  2OYB O;  3WZQ A;  1YJN E;  2FWV A;  1HY2 A;  3OJY C;  2LBA A;  2OL6 O;  3HWF A;  1VWH B;  2Q2P A;  1SXY A;  1GT5 A;  3EW2 A;  4XMH A;  4U8U M;  2ZJP E;  5LJG A;  1LFO A;  1YJW E;  4YBP A;  1SWJ A;  3DLL E;  3SLO A; 
#chains in the Genus database with same CATH homology
 2I5V O;  2OL7 A;  2OL6 O;  2OY1 O;  3AUM O;  2PI3 O;  5B2A O;  2OL8 O;  1OSP O;  2FKJ A;  1P4P A;  2I5Z O;  3IGE A;  2OY8 A;  5B10 O;  2G8C O;  3EC5 A;  5B11 O;  3CKG A;  2OYB O;  1FJ1 E;  2AF5 A;  5B3M O;  2OY7 A;  3IG9 A;  2FKG A;  2OY5 O;  1RJL C;  2HKD A;  3CKF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...