2OY7A

The crystal structure of ospa mutant
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
315
structure length
315
Chain Sequence
b'NSVSVDLPGSMKVLVSKSSNADGKYDLIATVDALELSGTSDKNNGSGVLEGVKADASKVKLTISDDLGQTTLEVFKSDGSTLVSKKVTSKDKSSTYEKFNEKGELSEKYITRADKSSTYEKFNEKGELSEKYITRADKSSTYEKFNEKGELSEKYITRADKSSTYEKFNEKGEVSEKYITRADGTRLEYTGIKSDGSGKAKEVLKGYVLEGTLTAEKTTLVVKEGTVTLSKNISKSGEVSVELNDTDSSAATKKTAAWNSGTSTLTITVNSKKTKDLVFTSSNTITVQQYDSNGTSLEGSAVEITKLDEIKNALK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Outer surface protein A
publication title Aromatic cross-strand ladders control the structure and stability of beta-rich peptide self-assembly mimics
pubmed doi rcsb
source organism Borrelia burgdorferi
molecule tags Membrane protein
total genus 63
structure length 315
sequence length 315
ec nomenclature
pdb deposition date 2007-02-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.160 Mainly Beta Beta Barrel Lipocalin C1 set domains (antibody constant domain-like) 2oy7A01
3.90.930.1 Alpha Beta Alpha-Beta Complex Outer Surface Protein A; domain 3 Outer Surface Protein A; domain 3 2oy7A02
3.90.930.30 Alpha Beta Alpha-Beta Complex Outer Surface Protein A; domain 3 Outer Surface Protein A; domain 3 2oy7A03
2OL7A 2OYBO 1OSPO 2OY8A 1RJLC 3EC5A 2FKGA 2FKJA 2OL8O 5B11O 5B3MO 2HKDA 2I5ZO 2OY1O 2AF5A 3AUMO 5B10O 5B2AO 2I5VO 2OY5O 2G8CO 1FJ1E 3CKFA 3CKGA 2OL6O 2OY7A 2PI3O 1P4PA
chains in the Genus database with same CATH superfamily
2OVSA 1CBIA 1VWPB 3VE2A 1I78A 4U3QA 1NC9A 1Z24A 2A2GA 4ZHDA 2BLGA 1VWNB 5HAEA 3FEKA 5IRWA 4IRWA 2QCBA 3E3CA 4NYRA 2WR6A 4ID2A 2UZ2A 1U17A 4ZGFA 1G74A 2OZQA 2VFBA 1VYOA 5D47A 1LDOA 1PTSA 2WPUA 4XMHA 3EW2A 2GTLM 4ZFXA 1VWCB 1UREA 2IZGB 1GX8A 4IO9E 1RL6A 2FKJA 3CQRA 4IB7A 3EYCA 1FE3A 4I60A 3C78X 5H9AA 3FMZA 4GUZA 5F1EA 1A57A 1KL5A 4M7MA 1LPJA 1AVEA 2ZJQE 3ZI8A 1AB0A 1SRHA 4JHQA 2WSJA 3IFBA 2A8GA 3CCVE 5IRUA 1BWYA 1S72E 4UU3A 4YBPA 1JV4A 5HCDC 4GDAA 1G85A 4WCEE 2RTDB 4GZVA 1HBPA 5GADG 4YKMA 4KIIA 4YGZA 1OEJA 4NW4A 2JU7A 1KT3A 1BBPA 1M1KG 2RTPB 3RZYA 2F73A 3DSZA 4NLJA 3BDRA 2WUTA 3OBLA 2BC3A 5FAZA 4KC8A 5LJHA 5L8NA 4BX6A 1DZKA 4ORXA 2QM9A 4U8UO 3NQKA 4Z27A 5BVSA 1NQMA 1N9MA 2DJFA 2OFAA 2IZDB 1LIBA 2GJ5A 2X45A 4U8UN 1N9YA 1K3BA 4O4OA 1HMTA 2ACOA 4QZTA 3CD6E 3HWFA 1VQLE 3J7ZG 3APXA 4A60A 5B3MO 3FW5A 3BSZE 3WBGA 1NP1A 1GT3A 5CE4A 1SWKA 3LTWA 5IRAA 1R0UA 4BX6B 2Z4HA 3DLLE 2IZKA 3VE1A 2Q4NA 1VWRB 2KTDA 4L1NA 4AZRA 1VQ4E 3ZUIA 2KT4B 1YWBA 3BS2A 1SXYA 3U0DA 2K62A 4EQAC 4TLJA 4A8ZA 3CMEE 3AKNA 4MVKA 5FFHA 1S7DA 4GGZA 1FENA 4QNIA 5EPQA 4L3RA 4ODDA 1LCVA 1EPBA 1IKJA 1VWFB 2IZCB 1DF8A 3U03A 4BBOA 1OBUA 3KFFA 1KT7A 1SRFA 4YCHA 3PQUA 5B11O 3PIPE 1JYDA 3BLGA 1ICNA 2QA4E 3FA8A 3UAQA 1EPAA 1K73G 2CZTA 1SWEA 4N7CA 3FR2A 1Y0GA 1HXZA 3CC7E 1VWMB 4RUUA 1VWGB 2RQ0A 2AMMX 5H9NA 3KZAA 1W2BE 5EZ2A 1YIJE 1XCAA 4DQ3A 3UEVA 4Z28A 4OELA 2CBRA 2RN4A 3RBYA 4ZJ0A 1RLBE 4O49A 2LA7A 1VWOB 4PJ2A 1KZXA 3CKFA 3VU1A 1T0VA 1T8VA 4BCSA 4IMOA 4BGFA 2Y32A 4U9CA 1SLDB 4TQ2A 3BRNA 3PH6A 4I9RA 3JS1A 2OVDA 3KVNA 4QYPA 2FHLA 1HMSA 3HK1A 1Y53X 3G7XA 2CQLA 2RTCB 1VWKB 2KTSA 5HZ8A 4GK9A 2NNQA 5HL7E 2QO4A 1KZWA 2RTFB 4YFRA 1N0SA 4NNSA 2RTQB 3P6FA 3FA7A 1SMPI 2LKKA 3STNA 1U18A 1E06A 3FEPA 5H8TA 3WXQA 3HWEA 4YBUA 4MEEA 2GTLO 5F6BA 4CDEA 1VQ8E 2GTLN 2I5VO 5AEOA 1EW3A 5GAGG 5AQ6A 5LJBA 2OTLE 1RJLC 2IZBA 3BY0A 3SAOA 1SWLA 5LJEA 3MX7A 2X4MA 3ZZVA 4ES7A 1MX7A 2POAA 4DNEA 2HZRA 2Z4IA 1LIFA 4BOEA 3RDOA 3D95A 3RDUA 1T68X 2AT3X 2O62A 3CMAE 1QY2A 1VQ7E 4Y59A 3CC4E 1N8RG 5D45A 3CCEE 2FHNX 1JYJA 2Y3EA 5B29A 4CPFA 1ZRYA 3ZWEA 3C77X 1KQWA 4ML7B 1BLRA 1YJNE 4KC7A 3G4SE 3ELXA 1Q7YG 4MVIA 1SLGB 5HA0A 4JGLA 3SZJA 2FS7A 2LFOA 4YCEA 4IOAE 3RKGA 4BX5A 1ICMA 2ACPX 4AZPA 1QFTA 4WBKA 1N4JA 5HZQA 2GH7A 3NBXX 1TOWA 1VWDB 1JJXA 3WJBA 5AJCA 1GT4A 4IAWA 3U9PC 2IZJA 4ORUA 3WJGA 1G5WA 2NNDA 4CK4A 3FR4A 3STMX 1YI2E 1VQKE 3FA6A 3V8UA 1E2TA 2RTOB 2AT8X 2RTGB 1LDQA 4IOCE 4GE1A 3T2XA 3RWXA 3LHNA 1L6MA 2X32A 5CHKA 4KH8A 1FDQA 1SLFB 1X71A 3IA8A 2QO6A 3B2KA 1MUPA 4BX5B 4CDCA 2PI3O 1IKEA 4EKVA 4HPAA 4YH0A 3CQNA 1KFFA 3B2IA 3RE6A 3QQ2A 4HPDA 3CR6A 2QOSC 4GU8A 5HA1A 3NR3A 3X00A 1ML7A 4WHIA 1VYGA 4YKOA 3OW2E 1NDJA 1KXOA 5K06A 5K68A 1D2UA 2MF6A 2G5LA 1MK5A 4QYNA 4ALOA 1KT4A 4HWMA 3B2JA 1OBQA 2ZAIA 2LBVA 1Q86G 5AN9B 1JIWI 3BU1A 1CBSA 3ELZA 5IO6A 1ZNGA 2OFBA 2OY1O 2IZIA 4YFPA 1NJIG 5HZ5A 5FQ7E 3NP1A 4YGGA 1KC8G 2JU8A 2EU7X 2CBSA 2HNXA 1UYNX 2AH7X 3AEHA 1VWLB 1ALBA 2BHVA 2CZUA 1PBOA 3RDXA 2PY1A 5JVGE 1OEEA 1YHQE 1Q82G 4CPEA 1SXXA 1D3SA 3N91A 4Y0QA 2OTJE 5F7GA 2IZFB 3I56E 5K67A 1CJ5A 2GTFX 2CAMA 4WFVA 1X89A 5FQ8E 5BYPA 4GDZA 3NPOA 1PMPA 3SOTA 4YGHA 1W6FA 3HWDA 3NQ9A 2OF8A 4UY8G 1PM1X 3WZQA 1RBPA 3ZW1A 1O1UA 4O4XA 4IB9A 1AVGI 3ZQ3A 1MOYA 2JN3A 2AT5X 3RDQA 3IG9A 2W2FA 4QAEA 1CRBA 5GAEG 2AKQA 3HTYA 2FLJA 4TKHA 5IXGA 2DM5A 2RTMA 4AZMA 2FTBA 4IBAA 1EXSA 4N7DA 5F6ZA 3HOEA 1SLEB 5LKFA 4OS3A 1M90G 4COTA 2I5ZO 4TKBA 1YP7A 4Z2OA 2RTEB 4O3WA 3KFHA 2XKLA 1RAVA 2ASNX 3MG5A 1MDCA 1I9HA 2CM4A 3ZW1B 1NBXA 4CPIA 3O22A 3CCUE 3RY1A 1NGLA 3DTQA 3WJDA 2KW1A 4WFAE 4I9SA 3UEWA 4R0BA 5D8JA 4AZNA 4M6SA 4CDDA 1BJ7A 1SWDA 1LELA 5JD2A 5BVTA 3VG3A 2GC9A 1SY2A 3SLTA 2JMBA 1QG5A 3F8AA 1QWDA 5HTDA 3P6EA 1XKIA 2MWHA 4GJVA 3OE3A 5IO7A 4B55A 1SWGA 2LBAA 2C4IA 1OSPO 3CXCE 2RCQA 4IABA 4A1YA 1I4UA 1SWJA 3P24A 1SRIA 1B0OA 3JQOA 3GE2A 1W5RA 5KICA 3HPEA 1KL3A 3P6GA 2AT6X 3P6CA 1MM9A 4NP1A 1ZNLA 1A18A 2VFCA 1GXAA 2A5BA 1VWEB 1DC9A 1ACDA 4QRLA 2AVIA 1STPA 3APVA 4LZVA 4ZHHA 4CV7A 1ZNDA 4GGTA 1SWUA 1A2DA 2G8CO 5EDCA 1SRJA 4KT5A 4LZUA 2IFBA 2IZLB 4Z2VA 1FTPA 2RA6A 1SWTA 2ALLX 3I55E 4U67E 1FELA 4AZQA 1I04A 3GAQA 3FR5A 3D4RA 1EALA 4HPBA 1ERXA 4FQBB 1YUPA 3S5VA 5HCCC 1QABE 4WF9E 2HKDA 1SWOA 1VWQB 1O8VA 3VPJE 1A3YA 1BSQA 1SWFA 2FGSA 2Q2MA 2FWVA 3UEXA 1VYFA 2OF9A 5LJCA 1SY3A 5KHPA 5CYBA 2X8SA 1DF3A 1NP4A 4DCBA 4GNYA 4NYQA 3KFGA 3ZUOA 1GM6A 4BVMA 1SY1A 2YMSA 1U0XA 1KL4A 2LB6A 4CPHA 4GRJA 3PECA 3EBKA 1STSB 3PEDA 1KT5A 1JZUA 1E02A 3C76X 3NX1A 1JJJA 1ZNEA 3UEUA 1OPAA 2W2AA 1EIIA 2K23A 1SWAA 1E5PA 3WYQA 3AUMO 4ZH6A 1HXLA 5BVQA 1Q81G 1KOIA 5L8IA 1IW2A 3O2YA 1KQXA 1WBIA 3T1DA 2IZAA 3CPWE 3SLJA 4MIRA 5FQ6E 2RTJA 1P4PA 2X8TA 3OJYC 1SXWA 5H1SI 2YG2A 4CPHB 2Y3FA 4ALBA 5HZ6A 4QGXA 3OD9A 1G7NA 1LCWA 3LV4A 3FIDA 1YP6A 3NQ3A 5HCEC 1TVQA 4YFQA 3D9WA 3H3IA 5JVHE 1QFVA 3T2WA 3ZW0A 1CBRA 1MX8A 3VGWA 4ZHFA 5C0NA 2AT0X 4AYHA 4I3BA 2JGSA 3D97A 2HZQA 3SZIA 1BM5A 3FIQA 5D4AA 2RTNB 1AELA 2ZJPE 1E00A 3PP6A 4O3XB 1SWQA 1DZPA 2WQ9A 1RXHA 1O1VA 1FEMA 4UU2A 1EI5A 3CCRE 2ANSA 2OY7A 3VG5A 5HBSA 1AVDA 3ZW0B 2RTHB 1QVGE 4Z2PA 4FBVA 4Y0PA 4BX7A 3IGEA 4I3DA 5L3YA 5B10O 2VDFA 3O19A 2QO5A 5HWZA 1JQPA 1X8OA 1SWRA 1GT1A 2OY8A 2WQAE 2UYWA 2OVEA 4IB6A 3FA9A 2A13A 1DV9A 3MBTA 1HN2A 3Q6LA 5CSEA 2MHDA 4TNNA 2G79A 2X34A 1BRPA 2W2BA 1EUOA 3EC5A 1GX3A 4OMWA 4JNJA 1HQQA 4JO6A 4BX7B 2E4JA 4XMEA 2JW1A 3VHMA 5DG4A 1MVGA 2ZJRE 1SREA 5LJKA 2M4LA 4ZHGA 2L67A 4C5PA 2MJIA 1I05A 1LIDA 3WVMA 1W4TA 2FKGA 1VQOE 3QKGA 5MLCH 1QY0A 4FGIB 3RSWA 2RTIB 4GKCA 4OS0A 1ADLA 2KD2A 3K3LA 1TXLA 3VG4A 4EDEA 3NADA 1YJWE 1SY0A 1YITE 4MISA 1QY1A 1RXKA 3CBSA 4INNA 1DZMA 1SWSA 2HLVA 4CSBA 1DZJA 4ORYA 2BS6A 4GJSA 2R74A 4QQ1A 3PIOE 1VWAB 3CKGA 4ZH9A 3L4RA 4HFOA 4U46A 1DFVA 4Y0RA 1STRB 3WYPA 5B5GA 4ZCBA 2FT9A 1VWIB 3EBWA 1HQPA 3VG7A 2IZHB 4CDFA 1EQDA 1VQPE 1LNMA 4NLIA 2ZSCA 2BT9A 1YWDA 1KT6A 1QVFE 1Y55X 4DQ4A 3VHHA 4IMNA 1K8AG 1YWCA 1LFOA 2RCTA 4TKJA 1HY2A 1BSYA 2QMIA 2OL7A 3JSQA 1SWBA 3FYFA 1GKAA 5JR8A 4O3YA 3I17A 2A5CA 1LIEA 4GH7A 2L5PA 2OVAA 2RTRB 5LJDA 3TGBA 2QEXE 3PQSA 4WFBE 2G7BA 3STKA 1UYOX 1BEBA 2OL8O 1Y9LA 1HMRA 3BX8A 1LCZA 1X8PA 4I6SA 5EEDA 3KFIA 1LKEA 3WZNA 3VHIA 5AJBA 2G78A 2L9CA 4ON1A 2RTBB 1GKAB 2FRSA 4Z6JA 3FENA 3RE5A 1SWHA 2MO5A 3CCJE 3SLOA 2FR2A 1N7YA 1KD1G 2N93A 5IO5A 1KGLA 1EIOA 2X55A 2BS5A 3CCLE 2Q2PA 2JU3A 4AW8A 1I06A 1ZNHA 4OMXA 2XSTA 4LKTA 1H91A 3CCSE 4GGRA 4RUNA 2FS6A 1Y52X 1PEEA 1SRGA 3PDFA 1B4MA 2OYBO 2F01A 3EM0A 2ZAGA 2R73A 2IZEB 4Y0SA 1VQNE 3RDMA 2QOMA 2JOZA 3VG2A 1IJ8A 3SZHA 3FDCA 4XMGA 4ZR2A 2C1QA 3MM0A 2OFRX 1VWBB 5EEEA 3CC2E 3APUA 2NP1A 5L8OA 1CBQA 1LUQA 1VWJB 1K9MG 1TOUA 1X8UA 1YWAA 1BRQA 3WJFA 2RD7C 2X46A 3WJEA 3CMPA 4OS8A 3F6ZB 1SWCA 2NNEA 5DM6E 3B2HA 1JJ2E 4ORSA 2A0AA 5GAHG 1SWPA 1VQME 5LKEA 4YDBA 5FENA 2CM9A 1IFCA 4AZOA 1GX9A 1OEKA 3PPTA 1P6PA 4WFUA 1SA8A 5HTEA 1B56A 3S5XA 2AF5A 1IFBA 2L68A 4HPCA 3PK2A 2WEWA 1ERBA 1WUBA 3P6DA 4OEMA 4ORRA 1UZ2X 5D48A 4YDAA 2WWPA 3EW1A 1VQ6E 1PBYA 4YMYA 2Q9SA 4I95A 3F9DA 4EXZA 4OKAA 3HWGA 2F09A 4QGVA 3D96A 3P6HA 1IIUA 4NV7A 3I0AA 4YVBA 3WZOA 2A3FX 2P8GA 3S26A 2RTLA 4NV8A 3BX7A 2HYSA 4GETA 3VG6A 4QZUA 4U8UM 5H9LA 4KCAA 1NQNA 2Q39A 2FR3A 2A2UA 3BU9A 1N43A 4GNWA 4XMCA 3ZW2A 4FBOA 3TF6A 4QGWA 4WFNE 4XMFA 1RSUB 3S60A 1GGLA 3WOVA 4D6BA 1HBQA 3CWKA 2RTAA 1YJ9E 5B5FA 3TGCA 1JJUA 2WEXA 3RDSA 3G6EE 1S2PA 2OFMX 2OY5O 4XMDA 1AQBA 4IAXA 4EFGA 5DM7E 5KIDA 1VQ9E 1GT5A 4MVEA 3CCME 5F58A 1JMXA 3FLLA 1LF7A 1K24A 3P02A 4O4UA 2R56A 1LICA 3APWA 1YIVA 3T6FA 3TZSA 4K19A 3CBCA 5HZ9A 1OPBA 1OBPA 3EMMA 3MVFA 5F2BA 4ZHCA 1B8EA 3PH5A 3CCQE 3WJCA 1TW4A 3FELA 2MM3A 3KQ0A 3WZPA 4D6AA 2BSZA 4O4SA 4A1HA 5B27A 1X8QA 4NNTA 4TJZA 1VPRA 1QQSA 4PSQA 4BQUA 4LQZA 5B2AO 1VQ5E 1JBHA 5LJGA 1SXUA 4MVLA 4ORWA 2HMBA 4O9SA 4FBRA 1KQSE 4O3ZA 3HOLA 1S44A 3G71E 2AL0X 3TGAA 3FW4A 1BSOA 3Q34A 3NX2A 5H9KA 1FJ1E 4LKPA 4ARHA 2C1SA 1RXJA 4I3CA 4Y5DA 3B2LA 1ZNKA 1X8NA 1JMZA 1VWHB 4BJ8A 4EEJA 2X8FA 3RY2A 1Y9TA 2DJGA 4GD9A 3CF5E 1SWNA 5DPQA 4IB8A 5EDBA 4ZGUA 1MEPA 1RSTB 2X56A 3T6LA 2OL6O 2RTKA 3AKMA
chains in the Genus database with same CATH topology
2OL7A 2OYBO 1OSPO 2OY8A 1RJLC 3EC5A 2FKGA 2FKJA 2OL8O 5B11O 5B3MO 3IGEA 2HKDA 3IG9A 2I5ZO 2OY1O 2AF5A 3AUMO 5B10O 5B2AO 2I5VO 2OY5O 2G8CO 1FJ1E 3CKFA 3CKGA 2OL6O 2OY7A 2PI3O 1P4PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OL7 A;  2OYB O;  1OSP O;  2OY8 A;  1RJL C;  3EC5 A;  2FKG A;  2FKJ A;  2OL8 O;  5B11 O;  5B3M O;  2HKD A;  2I5Z O;  2OY1 O;  2AF5 A;  3AUM O;  5B10 O;  5B2A O;  2I5V O;  2OY5 O;  2G8C O;  1FJ1 E;  3CKF A;  3CKG A;  2OL6 O;  2OY7 A;  2PI3 O;  1P4P A; 
#chains in the Genus database with same CATH topology
 2OVS A;  1CBI A;  1VWP B;  3VE2 A;  1I78 A;  4U3Q A;  1NC9 A;  1Z24 A;  2A2G A;  4ZHD A;  2BLG A;  1VWN B;  5HAE A;  3FEK A;  5IRW A;  4IRW A;  2QCB A;  3E3C A;  4NYR A;  2WR6 A;  4ID2 A;  2UZ2 A;  1U17 A;  4ZGF A;  1G74 A;  2OZQ A;  2VFB A;  1VYO A;  5D47 A;  1LDO A;  1PTS A;  2WPU A;  4XMH A;  3EW2 A;  2GTL M;  4ZFX A;  1VWC B;  1URE A;  2IZG B;  1GX8 A;  4IO9 E;  1RL6 A;  2FKJ A;  3CQR A;  4IB7 A;  3EYC A;  1FE3 A;  4I60 A;  3C78 X;  5H9A A;  3FMZ A;  4GUZ A;  5F1E A;  1A57 A;  1KL5 A;  4M7M A;  1LPJ A;  1AVE A;  2ZJQ E;  3ZI8 A;  1AB0 A;  1SRH A;  4JHQ A;  2WSJ A;  3IFB A;  2A8G A;  3CCV E;  5IRU A;  1BWY A;  1S72 E;  4UU3 A;  4YBP A;  1JV4 A;  5HCD C;  4GDA A;  1G85 A;  4WCE E;  2RTD B;  4GZV A;  1HBP A;  5GAD G;  4YKM A;  4KII A;  4YGZ A;  1OEJ A;  4NW4 A;  2JU7 A;  1KT3 A;  1BBP A;  1M1K G;  2RTP B;  3RZY A;  2F73 A;  3DSZ A;  4NLJ A;  3BDR A;  2WUT A;  3OBL A;  2BC3 A;  5FAZ A;  4KC8 A;  5LJH A;  5L8N A;  4BX6 A;  1DZK A;  4ORX A;  2QM9 A;  4U8U O;  3NQK A;  4Z27 A;  5BVS A;  1NQM A;  1N9M A;  2DJF A;  2OFA A;  2IZD B;  1LIB A;  2GJ5 A;  2X45 A;  4U8U N;  1N9Y A;  1K3B A;  4O4O A;  1HMT A;  2ACO A;  4QZT A;  3CD6 E;  3HWF A;  1VQL E;  3J7Z G;  3APX A;  4A60 A;  5B3M O;  3FW5 A;  3BSZ E;  3WBG A;  1NP1 A;  1GT3 A;  5CE4 A;  1SWK A;  3LTW A;  5IRA A;  1R0U A;  4BX6 B;  2Z4H A;  3DLL E;  2IZK A;  3VE1 A;  2Q4N A;  1VWR B;  2KTD A;  4L1N A;  4AZR A;  1VQ4 E;  3ZUI A;  2KT4 B;  1YWB A;  3BS2 A;  1SXY A;  3U0D A;  2K62 A;  4EQA C;  4TLJ A;  4A8Z A;  3CME E;  3AKN A;  4MVK A;  5FFH A;  1S7D A;  4GGZ A;  1FEN A;  4QNI A;  5EPQ A;  4L3R A;  4ODD A;  1LCV A;  1EPB A;  1IKJ A;  1VWF B;  2IZC B;  1DF8 A;  3U03 A;  4BBO A;  1OBU A;  3KFF A;  1KT7 A;  1SRF A;  4YCH A;  3PQU A;  5B11 O;  3PIP E;  1JYD A;  3BLG A;  1ICN A;  2QA4 E;  3FA8 A;  3UAQ A;  1EPA A;  1K73 G;  2CZT A;  1SWE A;  4N7C A;  3FR2 A;  1Y0G A;  1HXZ A;  3CC7 E;  1VWM B;  4RUU A;  1VWG B;  2RQ0 A;  2AMM X;  5H9N A;  3KZA A;  1W2B E;  5EZ2 A;  1YIJ E;  1XCA A;  4DQ3 A;  3UEV A;  4Z28 A;  4OEL A;  2CBR A;  2RN4 A;  3RBY A;  4ZJ0 A;  1RLB E;  4O49 A;  2LA7 A;  1VWO B;  4PJ2 A;  1KZX A;  3CKF A;  3VU1 A;  1T0V A;  1T8V A;  4BCS A;  4IMO A;  4BGF A;  2Y32 A;  4U9C A;  1SLD B;  4TQ2 A;  3BRN A;  3PH6 A;  4I9R A;  3JS1 A;  2OVD A;  3KVN A;  4QYP A;  2FHL A;  1HMS A;  3HK1 A;  1Y53 X;  3G7X A;  2CQL A;  2RTC B;  1VWK B;  2KTS A;  5HZ8 A;  4GK9 A;  2NNQ A;  5HL7 E;  2QO4 A;  1KZW A;  2RTF B;  4YFR A;  1N0S A;  4NNS A;  2RTQ B;  3P6F A;  3FA7 A;  1SMP I;  2LKK A;  3STN A;  1U18 A;  1E06 A;  3FEP A;  5H8T A;  3WXQ A;  3HWE A;  4YBU A;  4MEE A;  2GTL O;  5F6B A;  4CDE A;  1VQ8 E;  2GTL N;  2I5V O;  5AEO A;  1EW3 A;  5GAG G;  5AQ6 A;  5LJB A;  2OTL E;  1RJL C;  2IZB A;  3BY0 A;  3SAO A;  1SWL A;  5LJE A;  3MX7 A;  2X4M A;  3ZZV A;  4ES7 A;  1MX7 A;  2POA A;  4DNE A;  2HZR A;  2Z4I A;  1LIF A;  4BOE A;  3RDO A;  3D95 A;  3RDU A;  1T68 X;  2AT3 X;  2O62 A;  3CMA E;  1QY2 A;  1VQ7 E;  4Y59 A;  3CC4 E;  1N8R G;  5D45 A;  3CCE E;  2FHN X;  1JYJ A;  2Y3E A;  5B29 A;  4CPF A;  1ZRY A;  3ZWE A;  3C77 X;  1KQW A;  4ML7 B;  1BLR A;  1YJN E;  4KC7 A;  3G4S E;  3ELX A;  1Q7Y G;  4MVI A;  1SLG B;  5HA0 A;  4JGL A;  3SZJ A;  2FS7 A;  2LFO A;  4YCE A;  4IOA E;  3RKG A;  4BX5 A;  1ICM A;  2ACP X;  4AZP A;  1QFT A;  4WBK A;  1N4J A;  5HZQ A;  2GH7 A;  3NBX X;  1TOW A;  1VWD B;  1JJX A;  3WJB A;  5AJC A;  1GT4 A;  4IAW A;  3U9P C;  2IZJ A;  4ORU A;  3WJG A;  1G5W A;  2NND A;  4CK4 A;  3FR4 A;  3STM X;  1YI2 E;  1VQK E;  3FA6 A;  3V8U A;  1E2T A;  2RTO B;  2AT8 X;  2RTG B;  1LDQ A;  4IOC E;  4GE1 A;  3T2X A;  3RWX A;  3LHN A;  1L6M A;  2X32 A;  5CHK A;  4KH8 A;  1FDQ A;  1SLF B;  1X71 A;  3IA8 A;  2QO6 A;  3B2K A;  1MUP A;  4BX5 B;  4CDC A;  2PI3 O;  1IKE A;  4EKV A;  4HPA A;  4YH0 A;  3CQN A;  1KFF A;  3B2I A;  3RE6 A;  3QQ2 A;  4HPD A;  3CR6 A;  2QOS C;  4GU8 A;  5HA1 A;  3NR3 A;  3X00 A;  1ML7 A;  4WHI A;  1VYG A;  4YKO A;  3OW2 E;  1NDJ A;  1KXO A;  5K06 A;  5K68 A;  1D2U A;  2MF6 A;  2G5L A;  1MK5 A;  4QYN A;  4ALO A;  1KT4 A;  4HWM A;  3B2J A;  1OBQ A;  2ZAI A;  2LBV A;  1Q86 G;  5AN9 B;  1JIW I;  3BU1 A;  1CBS A;  3ELZ A;  5IO6 A;  1ZNG A;  2OFB A;  2OY1 O;  2IZI A;  4YFP A;  1NJI G;  5HZ5 A;  5FQ7 E;  3NP1 A;  4YGG A;  1KC8 G;  2JU8 A;  2EU7 X;  2CBS A;  2HNX A;  1UYN X;  2AH7 X;  3AEH A;  1VWL B;  1ALB A;  2BHV A;  2CZU A;  1PBO A;  3RDX A;  2PY1 A;  5JVG E;  1OEE A;  1YHQ E;  1Q82 G;  4CPE A;  1SXX A;  1D3S A;  3N91 A;  4Y0Q A;  2OTJ E;  5F7G A;  2IZF B;  3I56 E;  5K67 A;  1CJ5 A;  2GTF X;  2CAM A;  4WFV A;  1X89 A;  5FQ8 E;  5BYP A;  4GDZ A;  3NPO A;  1PMP A;  3SOT A;  4YGH A;  1W6F A;  3HWD A;  3NQ9 A;  2OF8 A;  4UY8 G;  1PM1 X;  3WZQ A;  1RBP A;  3ZW1 A;  1O1U A;  4O4X A;  4IB9 A;  1AVG I;  3ZQ3 A;  1MOY A;  2JN3 A;  2AT5 X;  3RDQ A;  3IG9 A;  2W2F A;  4QAE A;  1CRB A;  5GAE G;  2AKQ A;  3HTY A;  2FLJ A;  4TKH A;  5IXG A;  2DM5 A;  2RTM A;  4AZM A;  2FTB A;  4IBA A;  1EXS A;  4N7D A;  5F6Z A;  3HOE A;  1SLE B;  5LKF A;  4OS3 A;  1M90 G;  4COT A;  2I5Z O;  4TKB A;  1YP7 A;  4Z2O A;  2RTE B;  4O3W A;  3KFH A;  2XKL A;  1RAV A;  2ASN X;  3MG5 A;  1MDC A;  1I9H A;  2CM4 A;  3ZW1 B;  1NBX A;  4CPI A;  3O22 A;  3CCU E;  3RY1 A;  1NGL A;  3DTQ A;  3WJD A;  2KW1 A;  4WFA E;  4I9S A;  3UEW A;  4R0B A;  5D8J A;  4AZN A;  4M6S A;  4CDD A;  1BJ7 A;  1SWD A;  1LEL A;  5JD2 A;  5BVT A;  3VG3 A;  2GC9 A;  1SY2 A;  3SLT A;  2JMB A;  1QG5 A;  3F8A A;  1QWD A;  5HTD A;  3P6E A;  1XKI A;  2MWH A;  4GJV A;  3OE3 A;  5IO7 A;  4B55 A;  1SWG A;  2LBA A;  2C4I A;  1OSP O;  3CXC E;  2RCQ A;  4IAB A;  4A1Y A;  1I4U A;  1SWJ A;  3P24 A;  1SRI A;  1B0O A;  3JQO A;  3GE2 A;  1W5R A;  5KIC A;  3HPE A;  1KL3 A;  3P6G A;  2AT6 X;  3P6C A;  1MM9 A;  4NP1 A;  1ZNL A;  1A18 A;  2VFC A;  1GXA A;  2A5B A;  1VWE B;  1DC9 A;  1ACD A;  4QRL A;  2AVI A;  1STP A;  3APV A;  4LZV A;  4ZHH A;  4CV7 A;  1ZND A;  4GGT A;  1SWU A;  1A2D A;  2G8C O;  5EDC A;  1SRJ A;  4KT5 A;  4LZU A;  2IFB A;  2IZL B;  4Z2V A;  1FTP A;  2RA6 A;  1SWT A;  2ALL X;  3I55 E;  4U67 E;  1FEL A;  4AZQ A;  1I04 A;  3GAQ A;  3FR5 A;  3D4R A;  1EAL A;  4HPB A;  1ERX A;  4FQB B;  1YUP A;  3S5V A;  5HCC C;  1QAB E;  4WF9 E;  2HKD A;  1SWO A;  1VWQ B;  1O8V A;  3VPJ E;  1A3Y A;  1BSQ A;  1SWF A;  2FGS A;  2Q2M A;  2FWV A;  3UEX A;  1VYF A;  2OF9 A;  5LJC A;  1SY3 A;  5KHP A;  5CYB A;  2X8S A;  1DF3 A;  1NP4 A;  4DCB A;  4GNY A;  4NYQ A;  3KFG A;  3ZUO A;  1GM6 A;  4BVM A;  1SY1 A;  2YMS A;  1U0X A;  1KL4 A;  2LB6 A;  4CPH A;  4GRJ A;  3PEC A;  3EBK A;  1STS B;  3PED A;  1KT5 A;  1JZU A;  1E02 A;  3C76 X;  3NX1 A;  1JJJ A;  1ZNE A;  3UEU A;  1OPA A;  2W2A A;  1EII A;  2K23 A;  1SWA A;  1E5P A;  3WYQ A;  3AUM O;  4ZH6 A;  1HXL A;  5BVQ A;  1Q81 G;  1KOI A;  5L8I A;  1IW2 A;  3O2Y A;  1KQX A;  1WBI A;  3T1D A;  2IZA A;  3CPW E;  3SLJ A;  4MIR A;  5FQ6 E;  2RTJ A;  1P4P A;  2X8T A;  3OJY C;  1SXW A;  5H1S I;  2YG2 A;  4CPH B;  2Y3F A;  4ALB A;  5HZ6 A;  4QGX A;  3OD9 A;  1G7N A;  1LCW A;  3LV4 A;  3FID A;  1YP6 A;  3NQ3 A;  5HCE C;  1TVQ A;  4YFQ A;  3D9W A;  3H3I A;  5JVH E;  1QFV A;  3T2W A;  3ZW0 A;  1CBR A;  1MX8 A;  3VGW A;  4ZHF A;  5C0N A;  2AT0 X;  4AYH A;  4I3B A;  2JGS A;  3D97 A;  2HZQ A;  3SZI A;  1BM5 A;  3FIQ A;  5D4A A;  2RTN B;  1AEL A;  2ZJP E;  1E00 A;  3PP6 A;  4O3X B;  1SWQ A;  1DZP A;  2WQ9 A;  1RXH A;  1O1V A;  1FEM A;  4UU2 A;  1EI5 A;  3CCR E;  2ANS A;  2OY7 A;  3VG5 A;  5HBS A;  1AVD A;  3ZW0 B;  2RTH B;  1QVG E;  4Z2P A;  4FBV A;  4Y0P A;  4BX7 A;  3IGE A;  4I3D A;  5L3Y A;  5B10 O;  2VDF A;  3O19 A;  2QO5 A;  5HWZ A;  1JQP A;  1X8O A;  1SWR A;  1GT1 A;  2OY8 A;  2WQA E;  2UYW A;  2OVE A;  4IB6 A;  3FA9 A;  2A13 A;  1DV9 A;  3MBT A;  1HN2 A;  3Q6L A;  5CSE A;  2MHD A;  4TNN A;  2G79 A;  2X34 A;  1BRP A;  2W2B A;  1EUO A;  3EC5 A;  1GX3 A;  4OMW A;  4JNJ A;  1HQQ A;  4JO6 A;  4BX7 B;  2E4J A;  4XME A;  2JW1 A;  3VHM A;  5DG4 A;  1MVG A;  2ZJR E;  1SRE A;  5LJK A;  2M4L A;  4ZHG A;  2L67 A;  4C5P A;  2MJI A;  1I05 A;  1LID A;  3WVM A;  1W4T A;  2FKG A;  1VQO E;  3QKG A;  5MLC H;  1QY0 A;  4FGI B;  3RSW A;  2RTI B;  4GKC A;  4OS0 A;  1ADL A;  2KD2 A;  3K3L A;  1TXL A;  3VG4 A;  4EDE A;  3NAD A;  1YJW E;  1SY0 A;  1YIT E;  4MIS A;  1QY1 A;  1RXK A;  3CBS A;  4INN A;  1DZM A;  1SWS A;  2HLV A;  4CSB A;  1DZJ A;  4ORY A;  2BS6 A;  4GJS A;  2R74 A;  4QQ1 A;  3PIO E;  1VWA B;  3CKG A;  4ZH9 A;  3L4R A;  4HFO A;  4U46 A;  1DFV A;  4Y0R A;  1STR B;  3WYP A;  5B5G A;  4ZCB A;  2FT9 A;  1VWI B;  3EBW A;  1HQP A;  3VG7 A;  2IZH B;  4CDF A;  1EQD A;  1VQP E;  1LNM A;  4NLI A;  2ZSC A;  2BT9 A;  1YWD A;  1KT6 A;  1QVF E;  1Y55 X;  4DQ4 A;  3VHH A;  4IMN A;  1K8A G;  1YWC A;  1LFO A;  2RCT A;  4TKJ A;  1HY2 A;  1BSY A;  2QMI A;  2OL7 A;  3JSQ A;  1SWB A;  3FYF A;  1GKA A;  5JR8 A;  4O3Y A;  3I17 A;  2A5C A;  1LIE A;  4GH7 A;  2L5P A;  2OVA A;  2RTR B;  5LJD A;  3TGB A;  2QEX E;  3PQS A;  4WFB E;  2G7B A;  3STK A;  1UYO X;  1BEB A;  2OL8 O;  1Y9L A;  1HMR A;  3BX8 A;  1LCZ A;  1X8P A;  4I6S A;  5EED A;  3KFI A;  1LKE A;  3WZN A;  3VHI A;  5AJB A;  2G78 A;  2L9C A;  4ON1 A;  2RTB B;  1GKA B;  2FRS A;  4Z6J A;  3FEN A;  3RE5 A;  1SWH A;  2MO5 A;  3CCJ E;  3SLO A;  2FR2 A;  1N7Y A;  1KD1 G;  2N93 A;  5IO5 A;  1KGL A;  1EIO A;  2X55 A;  2BS5 A;  3CCL E;  2Q2P A;  2JU3 A;  4AW8 A;  1I06 A;  1ZNH A;  4OMX A;  2XST A;  4LKT A;  1H91 A;  3CCS E;  4GGR A;  4RUN A;  2FS6 A;  1Y52 X;  1PEE A;  1SRG A;  3PDF A;  1B4M A;  2OYB O;  2F01 A;  3EM0 A;  2ZAG A;  2R73 A;  2IZE B;  4Y0S A;  1VQN E;  3RDM A;  2QOM A;  2JOZ A;  3VG2 A;  1IJ8 A;  3SZH A;  3FDC A;  4XMG A;  4ZR2 A;  2C1Q A;  3MM0 A;  2OFR X;  1VWB B;  5EEE A;  3CC2 E;  3APU A;  2NP1 A;  5L8O A;  1CBQ A;  1LUQ A;  1VWJ B;  1K9M G;  1TOU A;  1X8U A;  1YWA A;  1BRQ A;  3WJF A;  2RD7 C;  2X46 A;  3WJE A;  3CMP A;  4OS8 A;  3F6Z B;  1SWC A;  2NNE A;  5DM6 E;  3B2H A;  1JJ2 E;  4ORS A;  2A0A A;  5GAH G;  1SWP A;  1VQM E;  5LKE A;  4YDB A;  5FEN A;  2CM9 A;  1IFC A;  4AZO A;  1GX9 A;  1OEK A;  3PPT A;  1P6P A;  4WFU A;  1SA8 A;  5HTE A;  1B56 A;  3S5X A;  2AF5 A;  1IFB A;  2L68 A;  4HPC A;  3PK2 A;  2WEW A;  1ERB A;  1WUB A;  3P6D A;  4OEM A;  4ORR A;  1UZ2 X;  5D48 A;  4YDA A;  2WWP A;  3EW1 A;  1VQ6 E;  1PBY A;  4YMY A;  2Q9S A;  4I95 A;  3F9D A;  4EXZ A;  4OKA A;  3HWG A;  2F09 A;  4QGV A;  3D96 A;  3P6H A;  1IIU A;  4NV7 A;  3I0A A;  4YVB A;  3WZO A;  2A3F X;  2P8G A;  3S26 A;  2RTL A;  4NV8 A;  3BX7 A;  2HYS A;  4GET A;  3VG6 A;  4QZU A;  4U8U M;  5H9L A;  4KCA A;  1NQN A;  2Q39 A;  2FR3 A;  2A2U A;  3BU9 A;  1N43 A;  4GNW A;  4XMC A;  3ZW2 A;  4FBO A;  3TF6 A;  4QGW A;  4WFN E;  4XMF A;  1RSU B;  3S60 A;  1GGL A;  3WOV A;  4D6B A;  1HBQ A;  3CWK A;  2RTA A;  1YJ9 E;  5B5F A;  3TGC A;  1JJU A;  2WEX A;  3RDS A;  3G6E E;  1S2P A;  2OFM X;  2OY5 O;  4XMD A;  1AQB A;  4IAX A;  4EFG A;  5DM7 E;  5KID A;  1VQ9 E;  1GT5 A;  4MVE A;  3CCM E;  5F58 A;  1JMX A;  3FLL A;  1LF7 A;  1K24 A;  3P02 A;  4O4U A;  2R56 A;  1LIC A;  3APW A;  1YIV A;  3T6F A;  3TZS A;  4K19 A;  3CBC A;  5HZ9 A;  1OPB A;  1OBP A;  3EMM A;  3MVF A;  5F2B A;  4ZHC A;  1B8E A;  3PH5 A;  3CCQ E;  3WJC A;  1TW4 A;  3FEL A;  2MM3 A;  3KQ0 A;  3WZP A;  4D6A A;  2BSZ A;  4O4S A;  4A1H A;  5B27 A;  1X8Q A;  4NNT A;  4TJZ A;  1VPR A;  1QQS A;  4PSQ A;  4BQU A;  4LQZ A;  5B2A O;  1VQ5 E;  1JBH A;  5LJG A;  1SXU A;  4MVL A;  4ORW A;  2HMB A;  4O9S A;  4FBR A;  1KQS E;  4O3Z A;  3HOL A;  1S44 A;  3G71 E;  2AL0 X;  3TGA A;  3FW4 A;  1BSO A;  3Q34 A;  3NX2 A;  5H9K A;  1FJ1 E;  4LKP A;  4ARH A;  2C1S A;  1RXJ A;  4I3C A;  4Y5D A;  3B2L A;  1ZNK A;  1X8N A;  1JMZ A;  1VWH B;  4BJ8 A;  4EEJ A;  2X8F A;  3RY2 A;  1Y9T A;  2DJG A;  4GD9 A;  3CF5 E;  1SWN A;  5DPQ A;  4IB8 A;  5EDB A;  4ZGU A;  1MEP A;  1RST B;  2X56 A;  3T6L A;  2OL6 O;  2RTK A;  3AKM A; 
#chains in the Genus database with same CATH homology
 2OL7 A;  2OYB O;  1OSP O;  2OY8 A;  1RJL C;  3EC5 A;  2FKG A;  2FKJ A;  2OL8 O;  5B11 O;  5B3M O;  3IGE A;  2HKD A;  3IG9 A;  2I5Z O;  2OY1 O;  2AF5 A;  3AUM O;  5B10 O;  5B2A O;  2I5V O;  2OY5 O;  2G8C O;  1FJ1 E;  3CKF A;  3CKG A;  2OL6 O;  2OY7 A;  2PI3 O;  1P4P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...