2OY8A

The crystal structure of ospa mutant
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
315
structure length
315
Chain Sequence
b'NSVSVDLPGSMKVLVSKSSNADGKYDLIATVDALELSGTSDKNNGSGVLEGVKADASKVKLTISDDLGQTTLEVFKSDGSTLVSKKVTSKDKSSTYEKFNEKGELSEKKITRADKSSTYEKFNEKGELSEKKITRADKSSTYEKFNEKGELSEKKITRADKSSTYEKFNEKGEVSEKIITRADGTRLEYTGIKSDGSGKAKEVLKGYVLEGTLTAEKTTLVVKEGTVTLSKNISKSGEVSVELNDTDSSAATKKTAAWNSGTSTLTITVNSKKTKDLVFTSSNTITVQQYDSNGTSLEGSAVEITKLDEIKNALK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Outer surface protein A
publication title Aromatic cross-strand ladders control the structure and stability of beta-rich peptide self-assembly mimics
pubmed doi rcsb
source organism Borrelia burgdorferi
molecule tags Membrane protein
total genus 67
structure length 315
sequence length 315
ec nomenclature
pdb deposition date 2007-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00820 Lipoprotein_1 Borrelia lipoprotein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.160 Mainly Beta Beta Barrel Lipocalin C1 set domains (antibody constant domain-like) 2oy8A01
3.90.930.1 Alpha Beta Alpha-Beta Complex Outer Surface Protein A; domain 3 Outer Surface Protein A; domain 3 2oy8A02
3.90.930.30 Alpha Beta Alpha-Beta Complex Outer Surface Protein A; domain 3 Outer Surface Protein A; domain 3 2oy8A03
2OY1O 2FKJA 2OL6O 2OY8A 2OL8O 3CKFA 2I5ZO 2OY5O 2PI3O 2OL7A 1OSPO 2OYBO 3AUMO 1RJLC 5B3MO 2OY7A 5B2AO 3EC5A 2FKGA 1FJ1E 2HKDA 3CKGA 5B11O 2I5VO 2G8CO 5B10O 1P4PA 2AF5A
chains in the Genus database with same CATH superfamily
1DFVA 1HN2A 3CCUE 3FW4A 3RDMA 3TF6A 4IMOA 4QGXA 1OEJA 4GH7A 3EW2A 4N7CA 1W6FA 4AYHA 1SY2A 3D96A 1D2UA 4NYRA 3FDCA 1JMXA 2IZIA 5CHKA 3BU1A 2MM3A 1YWAA 1LDQA 1B8EA 3HWDA 4NNSA 2ZAIA 2GTLO 3FEKA 3CCVE 3FR2A 2BSZA 2A13A 1LKEA 4ZH6A 1EW3A 1VWPB 3EW1A 3VU1A 4IO9E 1NJIG 3VHIA 3V8UA 4FBVA 3ZW0B 1FTPA 2IZJA 3D95A 5LJBA 3QKGA 4WFNE 4CDCA 1O1UA 2WEWA 4QRLA 1HBPA 2R56A 1VWMB 3EBWA 2QA4E 3PDFA 1TW4A 4Z6JA 5B11O 4AZOA 1IFBA 3RDXA 1G5WA 2QCBA 3FIDA 1NBXA 3B2HA 2DJGA 3UEVA 1A18A 4MIRA 2CM9A 1H91A 1HQPA 4GDAA 1VWCB 4QYNA 4IMNA 4KH8A 3Q6LA 4BBOA 4CPIA 4ON1A 5DM6E 3FA6A 2VDFA 3KFGA 3NX1A 2R74A 1SWNA 4WF9E 1VQPE 3F6ZB 1DF3A 3NR3A 3FIQA 2IZHB 4LKTA 3C77X 5B10O 4INNA 1VQLE 4MVLA 4FBRA 4YFRA 1IFCA 1BSQA 1NP1A 4U8UO 1EI5A 4DQ4A 3ZW1A 2FR3A 1RXHA 3BLGA 1S7DA 1LCVA 1FE3A 5F1EA 4TKHA 4GD9A 1TVQA 1GXAA 5D47A 3APXA 1SRIA 3GE2A 5AJBA 2F01A 3SLJA 2BHVA 4GU8A 4O9SA 1GM6A 4NLIA 4BX6A 2OY1O 1AVEA 3P6EA 1E00A 1FENA 1RBPA 2AVIA 4ORWA 3O22A 3HWEA 1MOYA 1Q81G 1VWQB 4TKJA 2FTBA 2W2FA 3RBYA 3SZHA 4GGZA 3ZW2A 4IOAE 1PBOA 3AKNA 5K68A 4YFQA 4O3YA 3AKMA 2RTMA 3MBTA 2A8GA 3WVMA 4CDFA 1VWRB 1X8UA 2Q2PA 3P6CA 2AL0X 2OZQA 2VFCA 4BX5A 1T8VA 5GAEG 3BX7A 3FA7A 5L8OA 1ZNHA 1KC8G 2G5LA 4KCAA 1E06A 2RTQB 3BDRA 4ZJ0A 1BEBA 2NNQA 2RTOB 4MVKA 1JV4A 1EXSA 3RDOA 1CBIA 1MDCA 4NV8A 3U0DA 5LKEA 5EPQA 4IB6A 2JU8A 5GAGG 1PTSA 1UYNX 1Y53X 2YMSA 4YCHA 4NV7A 1YJWE 2JU3A 1BLRA 2IZFB 4O49A 1BRPA 1B56A 3N91A 3FELA 1OPAA 2L5PA 5D45A 3PPTA 3FMZA 1MX7A 1SWKA 2JOZA 3PK2A 3APWA 1N8RG 2AT6X 4YGZA 2OF9A 1DZMA 2X8TA 4QYPA 5GAHG 2A2GA 2RD7C 4ID2A 4AZNA 5B2AO 2DJFA 3CBSA 3NQ3A 4I9RA 2Y3FA 3VG2A 4QGVA 2K62A 4M6SA 4NYQA 2OL8O 3RE6A 2P8GA 2HLVA 3CC4E 4A1YA 4GRJA 1LIBA 3WZQA 4QZUA 1YWBA 1S2PA 2UZ2A 2X4MA 1LIEA 5EEDA 3G7XA 1VWKB 3OD9A 4MEEA 2L68A 3WJBA 1QVFE 2CZTA 1VWNB 1NQNA 3ZQ3A 1VQ4E 2PY1A 3NX2A 1VYOA 1BRQA 3STKA 1GKAB 1OEKA 4O3XB 4QZTA 2M4LA 4BVMA 4GJSA 5LJCA 1VQKE 5LJGA 1U0XA 4ML7B 2OY5O 2A2UA 1SWPA 1Y52X 2OL7A 1ERBA 4HPCA 4O4SA 5EDBA 5KICA 1EPBA 3RDUA 1SWDA 1EUOA 1ADLA 1XKIA 1BWYA 1HMRA 2CBSA 1SXWA 2XSTA 5HZ9A 2JGSA 1ICMA 5HWZA 2MF6A 3CBCA 5HA0A 5F2BA 2JU7A 4UU3A 3O19A 4NW4A 3IG9A 1YP6A 4Z2PA 1VQOE 1PM1X 4KIIA 3P6HA 3APUA 5HA1A 3HWFA 4YKOA 4LZUA 4Y0RA 2RTIB 3VPJE 2AH7X 1KT5A 1IJ8A 5AEOA 2QO6A 1SY3A 2AT3X 2LA7A 1X8QA 1DV9A 1SMPI 2FR2A 1YJNE 1LNMA 4EKVA 1FJ1E 2RTCB 4MVIA 4BCSA 3NQ9A 4XMDA 1SXYA 2C1SA 1JJXA 1YI2E 1IKEA 3RSWA 4ZGUA 4WBKA 4XMGA 1G85A 2E4JA 4PJ2A 2WWPA 3AEHA 2OVEA 3WBGA 2CQLA 1UREA 2A3FX 4XMFA 2RTLA 1A2DA 1XCAA 2C1QA 4CV7A 4EQAC 1SWUA 4COTA 1B0OA 4CPHA 1QY1A 2F73A 2QMIA 1Y9TA 4A1HA 3APVA 2FT9A 4L1NA 3ELZA 4GKCA 2OYBO 1QFTA 2QO4A 1ZNEA 3OJYC 1VQME 1EALA 4O4XA 2NP1A 1Y55X 4GGTA 4U8UN 1RXJA 1SWAA 2BLGA 4MISA 4A8ZA 2IZGB 2FLJA 3F9DA 2LB6A 5LKFA 1KL3A 3CCRE 3VHHA 1GX8A 1MK5A 2UYWA 2RTNB 1VWJB 2FGSA 3KFHA 2DM5A 4Y0SA 4Z28A 3FW5A 4Y59A 2X8FA 1PMPA 2RTKA 1LCWA 2W2BA 1JIWI 5JVHE 2QOSC 2RTPB 4WHIA 4YH0A 5FAZA 1AVGI 3DTQA 5B3MO 2KTSA 5HBSA 3FR5A 1SRHA 2JMBA 4BX7B 1SRGA 5H9AA 2IZLB 3VE1A 1CRBA 5JR8A 3BS2A 3PIPE 3T1DA 2MJIA 3KFFA 4K19A 3AUMO 3HPEA 1GKAA 3D97A 3BRNA 4ZCBA 4YGGA 1CJ5A 4Z2OA 2ZAGA 1KT7A 4AZQA 4IRWA 3EM0A 3P6FA 3FA8A 1X8PA 2RTEB 1RJLC 1STSB 3B2JA 5K67A 3SAOA 5L3YA 1MUPA 1VQ9E 4YBUA 4IB7A 1SWTA 4OS3A 5IO7A 1SLGB 5DG4A 2XKLA 1JJJA 5HZ5A 2RTFB 4GUZA 3NADA 3L4RA 3CC2E 3SLOA 1SXXA 3FEPA 5AN9B 1SWQA 2ANSA 5IRWA 4EEJA 1KL5A 1E5PA 4D6BA 2W2AA 3DSZA 5JD2A 1VPRA 3WJDA 1SWJA 1FDQA 2FRSA 4FQBB 3CMAE 2KD2A 2NNEA 1RAVA 5HZQA 2G78A 3ZWEA 4HWMA 1ERXA 1STRB 3QQ2A 1NP4A 1GT1A 4NP1A 2OFAA 5IXGA 2IZAA 1PBYA 5BVTA 1LCZA 5LJKA 2ALLX 3GAQA 4XMHA 1ZRYA 3Q34A 4TLJA 1KD1G 2G7BA 4ORUA 3WZPA 2FS6A 5BVSA 3PIOE 3J7ZG 1SWBA 5H9KA 4JGLA 3C78X 4XMCA 3CKFA 4GGRA 1GX3A 4WFAE 1L6MA 2RTAA 2OTJE 1IIUA 4IB8A 1ZNLA 2L67A 4L3RA 2AT0X 4OMXA 1BJ7A 1JYDA 4O4UA 4C5PA 1VWOB 1VWLB 1A3YA 2GH7A 3NPOA 2GC9A 2BS6A 1DF8A 4IAXA 1D3SA 3RWXA 1SLDB 1QWDA 2OY7A 3UAQA 1U18A 5B27A 2HZQA 4HPDA 3OW2E 4GDZA 2RCQA 2ZJRE 1GT5A 4AZRA 4LKPA 2X8SA 1BM5A 3G4SE 2HYSA 4EFGA 3RZYA 3FLLA 5EEEA 5KIDA 2CAMA 1LDOA 1VWFB 1SWEA 3CF5E 3WJEA 1ZNKA 4IBAA 1QABE 1VWBB 1TOUA 4YBPA 3EMMA 4KT5A 2LBVA 1AQBA 1CBQA 2GTFX 1M1KG 3WJFA 5FQ6E 2HKDA 2OF8A 1GT4A 5HTEA 5BVQA 3ZW0A 1U17A 3U03A 1E2TA 1STPA 5FFHA 4U46A 1KT3A 1SWRA 1UYOX 2IZEB 5HCEC 3IFBA 4LQZA 2RA6A 2IZDB 1VQ7E 1VQ8E 1LPJA 4BX7A 2JW1A 4ZHGA 4EDEA 2OTLE 2L9CA 3FR4A 1OBQA 3BSZE 1BSYA 1SLFB 2RTRB 5IO6A 3RE5A 3FA9A 4BQUA 2X34A 4U9CA 4A60A 5K06A 1VWAB 2Z4HA 1Q7YG 4ZHFA 3T6FA 1W4TA 3D9WA 2RN4A 3KQ0A 4JNJA 4OS8A 4AW8A 5H9NA 3VG5A 3PEDA 3P6GA 1NDJA 3T2XA 5IRUA 1EIOA 3P24A 1BBPA 1B4MA 1N0SA 2OFMX 1SLEB 4XMEA 2OVSA 5H8TA 2Q39A 4IAWA 1K9MG 1VWEB 4KC7A 5D8JA 2WR6A 2X32A 1N9MA 1K8AG 3CMEE 3UEUA 4ORYA 1SWCA 4ALOA 3TGAA 4YVBA 5KHPA 3ZI8A 2F09A 4OELA 1Y0GA 5HCCC 4ARHA 3PQSA 2G8CO 3U9PC 3X00A 1KT4A 5CYBA 1VQ5E 2K23A 2AKQA 2OL6O 4M7MA 1T68X 1PEEA 2AT8X 2MHDA 1Q82G 3OBLA 5L8NA 2Y3EA 4UY8G 4O4OA 1X8OA 4WFUA 1JZUA 3LHNA 4ODDA 4CSBA 3C76X 5HZ6A 2WQ9A 1Y9LA 1QQSA 5H1SI 1E02A 1K3BA 5D48A 3WYPA 3S60A 3VGWA 5HCDC 1YIJE 2I5VO 1W5RA 3ZUIA 2ACPX 2AF5A 3VE2A 5MLCH 5F7GA 4CDEA 3SLTA 1QY2A 1LIDA 4JO6A 5CSEA 1ICNA 2MWHA 2A0AA 1TXLA 1IW2A 4WCEE 5EDCA 4GZVA 1AB0A 1G7NA 3S26A 5C0NA 5DPQA 4Z27A 3JSQA 3K3LA 2Q9SA 4YFPA 4ALBA 3JS1A 3ZZVA 1OSPO 3CCJE 5LJDA 1LELA 1O1VA 4ORRA 3B2IA 1KQWA 4BJ8A 1EPAA 1I78A 3HWGA 3CQRA 2CBRA 1JMZA 5JVGE 3CCLE 3RY2A 4N7DA 3IGEA 1ML7A 4DQ3A 3CQNA 2BS5A 4IB9A 1I4UA 2IZCB 3PECA 2X55A 5F58A 5F6BA 1LIFA 2QEXE 4KC8A 5IRAA 2OFBA 2FWVA 5CE4A 3WZOA 2HZRA 1KZWA 3HOLA 1NC9A 4ZH9A 2NNDA 2RTBB 3T2WA 4I3DA 1JQPA 2AMMX 1EQDA 2R73A 5B29A 1YP7A 1O8VA 4YKMA 1S44A 3CC7E 4EXZA 4I95A 1KT6A 4BGFA 3LV4A 2FKJA 4AZPA 1X89A 2I5ZO 2WUTA 3MVFA 4IABA 1LFOA 1YIVA 1RXKA 1MM9A 1VYGA 5BYPA 4JHQA 2C4IA 4OS0A 3HTYA 4U3QA 1SRJA 4GE1A 1HXLA 3B2LA 2ACOA 3LTWA 1LF7A 2FKGA 5L8IA 3CCQE 2Q2MA 1R0UA 1G74A 1CBSA 1DZKA 3CMPA 3UEWA 4YMYA 3CCSE 4TKBA 1YHQE 4ZHHA 3MX7A 1I9HA 4CDDA 1YITE 1N43A 1SWLA 1ZNGA 2GTLM 2FHNX 1VWGB 3BX8A 3PQUA 4QQ1A 4I3CA 1JYJA 1WBIA 5HAEA 3EYCA 3I17A 1SWOA 3KFIA 3CCEE 2Y32A 2HMBA 3S5VA 4CPEA 4QNIA 4ORSA 3EBKA 2RTDB 1JBHA 4ZGFA 2RTJA 5FQ8E 2ZJQE 4AZMA 2X56A 4ES7A 2CM4A 5AJCA 3WXQA 4OMWA 3TGBA 4FGIB 4D6AA 2AT5X 3B2KA 1OPBA 5FQ7E 2MO5A 1IKJA 3G6EE 1RSUB 3UEXA 1X71A 3STNA 2RQ0A 2JN3A 5FENA 3WZNA 2WQAE 4RUNA 1KQXA 3PH6A 5HTDA 2VFBA 2LFOA 5LJHA 1VWDB 4YDAA 3CWKA 1YJ9E 2Q4NA 3VG4A 1YUPA 1MEPA 3WYQA 4CK4A 1KQSE 4O3WA 1M90G 3I56E 2ZJPE 1I04A 4OEMA 2PI3O 1YWDA 4IOCE 1GX9A 1KFFA 5IO5A 4U8UM 1ALBA 2RCTA 1SXUA 3NQKA 3P6DA 1HMSA 2KW1A 4GJVA 4DCBA 4HPBA 3BY0A 3ZUOA 4I9SA 1QY0A 2O62A 2QO5A 1KZXA 1Q86G 4O3ZA 2QM9A 1HMTA 3STMX 4ZR2A 1DZPA 1I05A 1KGLA 1I06A 1KL4A 1EIIA 4Y0PA 4Z2VA 3FENA 3T6LA 3H3IA 4FBOA 1VWIB 1S72E 4GK9A 1A57A 2WEXA 1MVGA 3SZIA 2EU7X 4CPHB 4BOEA 4WFVA 4ORXA 2Z4IA 1FEMA 4PSQA 4YCEA 2OVDA 1ZNDA 5DM7E 2CZUA 1BSOA 3TGCA 1SWFA 4NNTA 3WJCA 2BT9A 2KTDA 1GGLA 1N7YA 4Y5DA 5AQ6A 4TQ2A 3HOEA 1CBRA 3O2YA 1HXZA 3TZSA 2QOMA 5HZ8A 1RSTB 1FELA 3RDQA 2N93A 1N9YA 4I6SA 4B55A 1NQMA 4HPAA 3DLLE 1K24A 5B5FA 1RL6A 3D4RA 3RY1A 1KOIA 1OBUA 1SY0A 2LBAA 3KZAA 1KXOA 4RUUA 2KT4B 4U67E 4TNNA 3CKGA 3P02A 4HFOA 1AELA 4LZVA 1ACDA 1QVGE 5D4AA 1SRFA 3BU9A 1JJUA 3OE3A 4R0BA 3S5XA 1QFVA 2ZSCA 3EC5A 4DNEA 4I60A 1DC9A 1SA8A 3CCME 1P6PA 4QGWA 2WPUA 1SWSA 1QG5A 1YWCA 3MG5A 3VG7A 1DZJA 5LJEA 1AVDA 4NLJA 3RDSA 1W2BE 3CR6A 3KVNA 3SOTA 2HNXA 5F6ZA 1VYFA 3RKGA 4Y0QA 1SWGA 2IZBA 4OKAA 3SZJA 1T0VA 5H9LA 2OY8A 2A5BA 2OVAA 3PH5A 5EZ2A 3ZW1B 3FYFA 4MVEA 3WOVA 3ELXA 4ZFXA 3I0AA 2BC3A 1VQNE 5HL7E 5GADG 2POAA 1MX8A 3NBXX 1X8NA 4QAEA 1LUQA 1Z24A 2GJ5A 5B5GA 2X45A 1OBPA 2YG2A 1P4PA 2GTLN 2G79A 1RLBE 1NGLA 1SREA 3CXCE 4ZHCA 4BX6B 4ZHDA 4UU2A 1UZ2X 2A5CA 1JJ2E 2FHLA 1SY1A 3I55E 4YDBA 3E3CA 1OEEA 3CPWE 3VHMA 3PP6A 1HQQA 1TOWA 3NP1A 2IFBA 3VG6A 1LICA 3F8AA 3IA8A 1K73G 1HBQA 3VG3A 1WUBA 4I3BA 3CD6E 1HY2A 1N4JA 3HK1A 1SWHA 3WJGA 4GNYA 2OFRX 4WFBE 1VQ6E 1GT3A 2IZKA 2FS7A 2X46A 3JQOA 4GNWA 1VWHB 2RTGB 3G71E 2WSJA 2ASNX 4YGHA 4TJZA 4CPFA 2RTHB 4BX5B 2LKKA 4GETA 3MM0A
chains in the Genus database with same CATH topology
2OY1O 2FKJA 2OL6O 2OY8A 2OL8O 3CKFA 2I5ZO 2OY5O 2PI3O 3IGEA 2OL7A 1OSPO 2OYBO 3AUMO 1RJLC 5B3MO 2OY7A 5B2AO 3EC5A 2FKGA 1FJ1E 2HKDA 3IG9A 3CKGA 5B11O 2I5VO 2G8CO 5B10O 1P4PA 2AF5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OY1 O;  2FKJ A;  2OL6 O;  2OY8 A;  2OL8 O;  3CKF A;  2I5Z O;  2OY5 O;  2PI3 O;  2OL7 A;  1OSP O;  2OYB O;  3AUM O;  1RJL C;  5B3M O;  2OY7 A;  5B2A O;  3EC5 A;  2FKG A;  1FJ1 E;  2HKD A;  3CKG A;  5B11 O;  2I5V O;  2G8C O;  5B10 O;  1P4P A;  2AF5 A; 
#chains in the Genus database with same CATH topology
 1DFV A;  1HN2 A;  3CCU E;  3FW4 A;  3RDM A;  3TF6 A;  4IMO A;  4QGX A;  1OEJ A;  4GH7 A;  3EW2 A;  4N7C A;  1W6F A;  4AYH A;  1SY2 A;  3D96 A;  1D2U A;  4NYR A;  3FDC A;  1JMX A;  2IZI A;  5CHK A;  3BU1 A;  2MM3 A;  1YWA A;  1LDQ A;  1B8E A;  3HWD A;  4NNS A;  2ZAI A;  2GTL O;  3FEK A;  3CCV E;  3FR2 A;  2BSZ A;  2A13 A;  1LKE A;  4ZH6 A;  1EW3 A;  1VWP B;  3EW1 A;  3VU1 A;  4IO9 E;  1NJI G;  3VHI A;  3V8U A;  4FBV A;  3ZW0 B;  1FTP A;  2IZJ A;  3D95 A;  5LJB A;  3QKG A;  4WFN E;  4CDC A;  1O1U A;  2WEW A;  4QRL A;  1HBP A;  2R56 A;  1VWM B;  3EBW A;  2QA4 E;  3PDF A;  1TW4 A;  4Z6J A;  5B11 O;  4AZO A;  1IFB A;  3RDX A;  1G5W A;  2QCB A;  3FID A;  1NBX A;  3B2H A;  2DJG A;  3UEV A;  1A18 A;  4MIR A;  2CM9 A;  1H91 A;  1HQP A;  4GDA A;  1VWC B;  4QYN A;  4IMN A;  4KH8 A;  3Q6L A;  4BBO A;  4CPI A;  4ON1 A;  5DM6 E;  3FA6 A;  2VDF A;  3KFG A;  3NX1 A;  2R74 A;  1SWN A;  4WF9 E;  1VQP E;  3F6Z B;  1DF3 A;  3NR3 A;  3FIQ A;  2IZH B;  4LKT A;  3C77 X;  5B10 O;  4INN A;  1VQL E;  4MVL A;  4FBR A;  4YFR A;  1IFC A;  1BSQ A;  1NP1 A;  4U8U O;  1EI5 A;  4DQ4 A;  3ZW1 A;  2FR3 A;  1RXH A;  3BLG A;  1S7D A;  1LCV A;  1FE3 A;  5F1E A;  4TKH A;  4GD9 A;  1TVQ A;  1GXA A;  5D47 A;  3APX A;  1SRI A;  3GE2 A;  5AJB A;  2F01 A;  3SLJ A;  2BHV A;  4GU8 A;  4O9S A;  1GM6 A;  4NLI A;  4BX6 A;  2OY1 O;  1AVE A;  3P6E A;  1E00 A;  1FEN A;  1RBP A;  2AVI A;  4ORW A;  3O22 A;  3HWE A;  1MOY A;  1Q81 G;  1VWQ B;  4TKJ A;  2FTB A;  2W2F A;  3RBY A;  3SZH A;  4GGZ A;  3ZW2 A;  4IOA E;  1PBO A;  3AKN A;  5K68 A;  4YFQ A;  4O3Y A;  3AKM A;  2RTM A;  3MBT A;  2A8G A;  3WVM A;  4CDF A;  1VWR B;  1X8U A;  2Q2P A;  3P6C A;  2AL0 X;  2OZQ A;  2VFC A;  4BX5 A;  1T8V A;  5GAE G;  3BX7 A;  3FA7 A;  5L8O A;  1ZNH A;  1KC8 G;  2G5L A;  4KCA A;  1E06 A;  2RTQ B;  3BDR A;  4ZJ0 A;  1BEB A;  2NNQ A;  2RTO B;  4MVK A;  1JV4 A;  1EXS A;  3RDO A;  1CBI A;  1MDC A;  4NV8 A;  3U0D A;  5LKE A;  5EPQ A;  4IB6 A;  2JU8 A;  5GAG G;  1PTS A;  1UYN X;  1Y53 X;  2YMS A;  4YCH A;  4NV7 A;  1YJW E;  2JU3 A;  1BLR A;  2IZF B;  4O49 A;  1BRP A;  1B56 A;  3N91 A;  3FEL A;  1OPA A;  2L5P A;  5D45 A;  3PPT A;  3FMZ A;  1MX7 A;  1SWK A;  2JOZ A;  3PK2 A;  3APW A;  1N8R G;  2AT6 X;  4YGZ A;  2OF9 A;  1DZM A;  2X8T A;  4QYP A;  5GAH G;  2A2G A;  2RD7 C;  4ID2 A;  4AZN A;  5B2A O;  2DJF A;  3CBS A;  3NQ3 A;  4I9R A;  2Y3F A;  3VG2 A;  4QGV A;  2K62 A;  4M6S A;  4NYQ A;  2OL8 O;  3RE6 A;  2P8G A;  2HLV A;  3CC4 E;  4A1Y A;  4GRJ A;  1LIB A;  3WZQ A;  4QZU A;  1YWB A;  1S2P A;  2UZ2 A;  2X4M A;  1LIE A;  5EED A;  3G7X A;  1VWK B;  3OD9 A;  4MEE A;  2L68 A;  3WJB A;  1QVF E;  2CZT A;  1VWN B;  1NQN A;  3ZQ3 A;  1VQ4 E;  2PY1 A;  3NX2 A;  1VYO A;  1BRQ A;  3STK A;  1GKA B;  1OEK A;  4O3X B;  4QZT A;  2M4L A;  4BVM A;  4GJS A;  5LJC A;  1VQK E;  5LJG A;  1U0X A;  4ML7 B;  2OY5 O;  2A2U A;  1SWP A;  1Y52 X;  2OL7 A;  1ERB A;  4HPC A;  4O4S A;  5EDB A;  5KIC A;  1EPB A;  3RDU A;  1SWD A;  1EUO A;  1ADL A;  1XKI A;  1BWY A;  1HMR A;  2CBS A;  1SXW A;  2XST A;  5HZ9 A;  2JGS A;  1ICM A;  5HWZ A;  2MF6 A;  3CBC A;  5HA0 A;  5F2B A;  2JU7 A;  4UU3 A;  3O19 A;  4NW4 A;  3IG9 A;  1YP6 A;  4Z2P A;  1VQO E;  1PM1 X;  4KII A;  3P6H A;  3APU A;  5HA1 A;  3HWF A;  4YKO A;  4LZU A;  4Y0R A;  2RTI B;  3VPJ E;  2AH7 X;  1KT5 A;  1IJ8 A;  5AEO A;  2QO6 A;  1SY3 A;  2AT3 X;  2LA7 A;  1X8Q A;  1DV9 A;  1SMP I;  2FR2 A;  1YJN E;  1LNM A;  4EKV A;  1FJ1 E;  2RTC B;  4MVI A;  4BCS A;  3NQ9 A;  4XMD A;  1SXY A;  2C1S A;  1JJX A;  1YI2 E;  1IKE A;  3RSW A;  4ZGU A;  4WBK A;  4XMG A;  1G85 A;  2E4J A;  4PJ2 A;  2WWP A;  3AEH A;  2OVE A;  3WBG A;  2CQL A;  1URE A;  2A3F X;  4XMF A;  2RTL A;  1A2D A;  1XCA A;  2C1Q A;  4CV7 A;  4EQA C;  1SWU A;  4COT A;  1B0O A;  4CPH A;  1QY1 A;  2F73 A;  2QMI A;  1Y9T A;  4A1H A;  3APV A;  2FT9 A;  4L1N A;  3ELZ A;  4GKC A;  2OYB O;  1QFT A;  2QO4 A;  1ZNE A;  3OJY C;  1VQM E;  1EAL A;  4O4X A;  2NP1 A;  1Y55 X;  4GGT A;  4U8U N;  1RXJ A;  1SWA A;  2BLG A;  4MIS A;  4A8Z A;  2IZG B;  2FLJ A;  3F9D A;  2LB6 A;  5LKF A;  1KL3 A;  3CCR E;  3VHH A;  1GX8 A;  1MK5 A;  2UYW A;  2RTN B;  1VWJ B;  2FGS A;  3KFH A;  2DM5 A;  4Y0S A;  4Z28 A;  3FW5 A;  4Y59 A;  2X8F A;  1PMP A;  2RTK A;  1LCW A;  2W2B A;  1JIW I;  5JVH E;  2QOS C;  2RTP B;  4WHI A;  4YH0 A;  5FAZ A;  1AVG I;  3DTQ A;  5B3M O;  2KTS A;  5HBS A;  3FR5 A;  1SRH A;  2JMB A;  4BX7 B;  1SRG A;  5H9A A;  2IZL B;  3VE1 A;  1CRB A;  5JR8 A;  3BS2 A;  3PIP E;  3T1D A;  2MJI A;  3KFF A;  4K19 A;  3AUM O;  3HPE A;  1GKA A;  3D97 A;  3BRN A;  4ZCB A;  4YGG A;  1CJ5 A;  4Z2O A;  2ZAG A;  1KT7 A;  4AZQ A;  4IRW A;  3EM0 A;  3P6F A;  3FA8 A;  1X8P A;  2RTE B;  1RJL C;  1STS B;  3B2J A;  5K67 A;  3SAO A;  5L3Y A;  1MUP A;  1VQ9 E;  4YBU A;  4IB7 A;  1SWT A;  4OS3 A;  5IO7 A;  1SLG B;  5DG4 A;  2XKL A;  1JJJ A;  5HZ5 A;  2RTF B;  4GUZ A;  3NAD A;  3L4R A;  3CC2 E;  3SLO A;  1SXX A;  3FEP A;  5AN9 B;  1SWQ A;  2ANS A;  5IRW A;  4EEJ A;  1KL5 A;  1E5P A;  4D6B A;  2W2A A;  3DSZ A;  5JD2 A;  1VPR A;  3WJD A;  1SWJ A;  1FDQ A;  2FRS A;  4FQB B;  3CMA E;  2KD2 A;  2NNE A;  1RAV A;  5HZQ A;  2G78 A;  3ZWE A;  4HWM A;  1ERX A;  1STR B;  3QQ2 A;  1NP4 A;  1GT1 A;  4NP1 A;  2OFA A;  5IXG A;  2IZA A;  1PBY A;  5BVT A;  1LCZ A;  5LJK A;  2ALL X;  3GAQ A;  4XMH A;  1ZRY A;  3Q34 A;  4TLJ A;  1KD1 G;  2G7B A;  4ORU A;  3WZP A;  2FS6 A;  5BVS A;  3PIO E;  3J7Z G;  1SWB A;  5H9K A;  4JGL A;  3C78 X;  4XMC A;  3CKF A;  4GGR A;  1GX3 A;  4WFA E;  1L6M A;  2RTA A;  2OTJ E;  1IIU A;  4IB8 A;  1ZNL A;  2L67 A;  4L3R A;  2AT0 X;  4OMX A;  1BJ7 A;  1JYD A;  4O4U A;  4C5P A;  1VWO B;  1VWL B;  1A3Y A;  2GH7 A;  3NPO A;  2GC9 A;  2BS6 A;  1DF8 A;  4IAX A;  1D3S A;  3RWX A;  1SLD B;  1QWD A;  2OY7 A;  3UAQ A;  1U18 A;  5B27 A;  2HZQ A;  4HPD A;  3OW2 E;  4GDZ A;  2RCQ A;  2ZJR E;  1GT5 A;  4AZR A;  4LKP A;  2X8S A;  1BM5 A;  3G4S E;  2HYS A;  4EFG A;  3RZY A;  3FLL A;  5EEE A;  5KID A;  2CAM A;  1LDO A;  1VWF B;  1SWE A;  3CF5 E;  3WJE A;  1ZNK A;  4IBA A;  1QAB E;  1VWB B;  1TOU A;  4YBP A;  3EMM A;  4KT5 A;  2LBV A;  1AQB A;  1CBQ A;  2GTF X;  1M1K G;  3WJF A;  5FQ6 E;  2HKD A;  2OF8 A;  1GT4 A;  5HTE A;  5BVQ A;  3ZW0 A;  1U17 A;  3U03 A;  1E2T A;  1STP A;  5FFH A;  4U46 A;  1KT3 A;  1SWR A;  1UYO X;  2IZE B;  5HCE C;  3IFB A;  4LQZ A;  2RA6 A;  2IZD B;  1VQ7 E;  1VQ8 E;  1LPJ A;  4BX7 A;  2JW1 A;  4ZHG A;  4EDE A;  2OTL E;  2L9C A;  3FR4 A;  1OBQ A;  3BSZ E;  1BSY A;  1SLF B;  2RTR B;  5IO6 A;  3RE5 A;  3FA9 A;  4BQU A;  2X34 A;  4U9C A;  4A60 A;  5K06 A;  1VWA B;  2Z4H A;  1Q7Y G;  4ZHF A;  3T6F A;  1W4T A;  3D9W A;  2RN4 A;  3KQ0 A;  4JNJ A;  4OS8 A;  4AW8 A;  5H9N A;  3VG5 A;  3PED A;  3P6G A;  1NDJ A;  3T2X A;  5IRU A;  1EIO A;  3P24 A;  1BBP A;  1B4M A;  1N0S A;  2OFM X;  1SLE B;  4XME A;  2OVS A;  5H8T A;  2Q39 A;  4IAW A;  1K9M G;  1VWE B;  4KC7 A;  5D8J A;  2WR6 A;  2X32 A;  1N9M A;  1K8A G;  3CME E;  3UEU A;  4ORY A;  1SWC A;  4ALO A;  3TGA A;  4YVB A;  5KHP A;  3ZI8 A;  2F09 A;  4OEL A;  1Y0G A;  5HCC C;  4ARH A;  3PQS A;  2G8C O;  3U9P C;  3X00 A;  1KT4 A;  5CYB A;  1VQ5 E;  2K23 A;  2AKQ A;  2OL6 O;  4M7M A;  1T68 X;  1PEE A;  2AT8 X;  2MHD A;  1Q82 G;  3OBL A;  5L8N A;  2Y3E A;  4UY8 G;  4O4O A;  1X8O A;  4WFU A;  1JZU A;  3LHN A;  4ODD A;  4CSB A;  3C76 X;  5HZ6 A;  2WQ9 A;  1Y9L A;  1QQS A;  5H1S I;  1E02 A;  1K3B A;  5D48 A;  3WYP A;  3S60 A;  3VGW A;  5HCD C;  1YIJ E;  2I5V O;  1W5R A;  3ZUI A;  2ACP X;  2AF5 A;  3VE2 A;  5MLC H;  5F7G A;  4CDE A;  3SLT A;  1QY2 A;  1LID A;  4JO6 A;  5CSE A;  1ICN A;  2MWH A;  2A0A A;  1TXL A;  1IW2 A;  4WCE E;  5EDC A;  4GZV A;  1AB0 A;  1G7N A;  3S26 A;  5C0N A;  5DPQ A;  4Z27 A;  3JSQ A;  3K3L A;  2Q9S A;  4YFP A;  4ALB A;  3JS1 A;  3ZZV A;  1OSP O;  3CCJ E;  5LJD A;  1LEL A;  1O1V A;  4ORR A;  3B2I A;  1KQW A;  4BJ8 A;  1EPA A;  1I78 A;  3HWG A;  3CQR A;  2CBR A;  1JMZ A;  5JVG E;  3CCL E;  3RY2 A;  4N7D A;  3IGE A;  1ML7 A;  4DQ3 A;  3CQN A;  2BS5 A;  4IB9 A;  1I4U A;  2IZC B;  3PEC A;  2X55 A;  5F58 A;  5F6B A;  1LIF A;  2QEX E;  4KC8 A;  5IRA A;  2OFB A;  2FWV A;  5CE4 A;  3WZO A;  2HZR A;  1KZW A;  3HOL A;  1NC9 A;  4ZH9 A;  2NND A;  2RTB B;  3T2W A;  4I3D A;  1JQP A;  2AMM X;  1EQD A;  2R73 A;  5B29 A;  1YP7 A;  1O8V A;  4YKM A;  1S44 A;  3CC7 E;  4EXZ A;  4I95 A;  1KT6 A;  4BGF A;  3LV4 A;  2FKJ A;  4AZP A;  1X89 A;  2I5Z O;  2WUT A;  3MVF A;  4IAB A;  1LFO A;  1YIV A;  1RXK A;  1MM9 A;  1VYG A;  5BYP A;  4JHQ A;  2C4I A;  4OS0 A;  3HTY A;  4U3Q A;  1SRJ A;  4GE1 A;  1HXL A;  3B2L A;  2ACO A;  3LTW A;  1LF7 A;  2FKG A;  5L8I A;  3CCQ E;  2Q2M A;  1R0U A;  1G74 A;  1CBS A;  1DZK A;  3CMP A;  3UEW A;  4YMY A;  3CCS E;  4TKB A;  1YHQ E;  4ZHH A;  3MX7 A;  1I9H A;  4CDD A;  1YIT E;  1N43 A;  1SWL A;  1ZNG A;  2GTL M;  2FHN X;  1VWG B;  3BX8 A;  3PQU A;  4QQ1 A;  4I3C A;  1JYJ A;  1WBI A;  5HAE A;  3EYC A;  3I17 A;  1SWO A;  3KFI A;  3CCE E;  2Y32 A;  2HMB A;  3S5V A;  4CPE A;  4QNI A;  4ORS A;  3EBK A;  2RTD B;  1JBH A;  4ZGF A;  2RTJ A;  5FQ8 E;  2ZJQ E;  4AZM A;  2X56 A;  4ES7 A;  2CM4 A;  5AJC A;  3WXQ A;  4OMW A;  3TGB A;  4FGI B;  4D6A A;  2AT5 X;  3B2K A;  1OPB A;  5FQ7 E;  2MO5 A;  1IKJ A;  3G6E E;  1RSU B;  3UEX A;  1X71 A;  3STN A;  2RQ0 A;  2JN3 A;  5FEN A;  3WZN A;  2WQA E;  4RUN A;  1KQX A;  3PH6 A;  5HTD A;  2VFB A;  2LFO A;  5LJH A;  1VWD B;  4YDA A;  3CWK A;  1YJ9 E;  2Q4N A;  3VG4 A;  1YUP A;  1MEP A;  3WYQ A;  4CK4 A;  1KQS E;  4O3W A;  1M90 G;  3I56 E;  2ZJP E;  1I04 A;  4OEM A;  2PI3 O;  1YWD A;  4IOC E;  1GX9 A;  1KFF A;  5IO5 A;  4U8U M;  1ALB A;  2RCT A;  1SXU A;  3NQK A;  3P6D A;  1HMS A;  2KW1 A;  4GJV A;  4DCB A;  4HPB A;  3BY0 A;  3ZUO A;  4I9S A;  1QY0 A;  2O62 A;  2QO5 A;  1KZX A;  1Q86 G;  4O3Z A;  2QM9 A;  1HMT A;  3STM X;  4ZR2 A;  1DZP A;  1I05 A;  1KGL A;  1I06 A;  1KL4 A;  1EII A;  4Y0P A;  4Z2V A;  3FEN A;  3T6L A;  3H3I A;  4FBO A;  1VWI B;  1S72 E;  4GK9 A;  1A57 A;  2WEX A;  1MVG A;  3SZI A;  2EU7 X;  4CPH B;  4BOE A;  4WFV A;  4ORX A;  2Z4I A;  1FEM A;  4PSQ A;  4YCE A;  2OVD A;  1ZND A;  5DM7 E;  2CZU A;  1BSO A;  3TGC A;  1SWF A;  4NNT A;  3WJC A;  2BT9 A;  2KTD A;  1GGL A;  1N7Y A;  4Y5D A;  5AQ6 A;  4TQ2 A;  3HOE A;  1CBR A;  3O2Y A;  1HXZ A;  3TZS A;  2QOM A;  5HZ8 A;  1RST B;  1FEL A;  3RDQ A;  2N93 A;  1N9Y A;  4I6S A;  4B55 A;  1NQM A;  4HPA A;  3DLL E;  1K24 A;  5B5F A;  1RL6 A;  3D4R A;  3RY1 A;  1KOI A;  1OBU A;  1SY0 A;  2LBA A;  3KZA A;  1KXO A;  4RUU A;  2KT4 B;  4U67 E;  4TNN A;  3CKG A;  3P02 A;  4HFO A;  1AEL A;  4LZV A;  1ACD A;  1QVG E;  5D4A A;  1SRF A;  3BU9 A;  1JJU A;  3OE3 A;  4R0B A;  3S5X A;  1QFV A;  2ZSC A;  3EC5 A;  4DNE A;  4I60 A;  1DC9 A;  1SA8 A;  3CCM E;  1P6P A;  4QGW A;  2WPU A;  1SWS A;  1QG5 A;  1YWC A;  3MG5 A;  3VG7 A;  1DZJ A;  5LJE A;  1AVD A;  4NLJ A;  3RDS A;  1W2B E;  3CR6 A;  3KVN A;  3SOT A;  2HNX A;  5F6Z A;  1VYF A;  3RKG A;  4Y0Q A;  1SWG A;  2IZB A;  4OKA A;  3SZJ A;  1T0V A;  5H9L A;  2OY8 A;  2A5B A;  2OVA A;  3PH5 A;  5EZ2 A;  3ZW1 B;  3FYF A;  4MVE A;  3WOV A;  3ELX A;  4ZFX A;  3I0A A;  2BC3 A;  1VQN E;  5HL7 E;  5GAD G;  2POA A;  1MX8 A;  3NBX X;  1X8N A;  4QAE A;  1LUQ A;  1Z24 A;  2GJ5 A;  5B5G A;  2X45 A;  1OBP A;  2YG2 A;  1P4P A;  2GTL N;  2G79 A;  1RLB E;  1NGL A;  1SRE A;  3CXC E;  4ZHC A;  4BX6 B;  4ZHD A;  4UU2 A;  1UZ2 X;  2A5C A;  1JJ2 E;  2FHL A;  1SY1 A;  3I55 E;  4YDB A;  3E3C A;  1OEE A;  3CPW E;  3VHM A;  3PP6 A;  1HQQ A;  1TOW A;  3NP1 A;  2IFB A;  3VG6 A;  1LIC A;  3F8A A;  3IA8 A;  1K73 G;  1HBQ A;  3VG3 A;  1WUB A;  4I3B A;  3CD6 E;  1HY2 A;  1N4J A;  3HK1 A;  1SWH A;  3WJG A;  4GNY A;  2OFR X;  4WFB E;  1VQ6 E;  1GT3 A;  2IZK A;  2FS7 A;  2X46 A;  3JQO A;  4GNW A;  1VWH B;  2RTG B;  3G71 E;  2WSJ A;  2ASN X;  4YGH A;  4TJZ A;  4CPF A;  2RTH B;  4BX5 B;  2LKK A;  4GET A;  3MM0 A; 
#chains in the Genus database with same CATH homology
 2OY1 O;  2FKJ A;  2OL6 O;  2OY8 A;  2OL8 O;  3CKF A;  2I5Z O;  2OY5 O;  2PI3 O;  3IGE A;  2OL7 A;  1OSP O;  2OYB O;  3AUM O;  1RJL C;  5B3M O;  2OY7 A;  5B2A O;  3EC5 A;  2FKG A;  1FJ1 E;  2HKD A;  3IG9 A;  3CKG A;  5B11 O;  2I5V O;  2G8C O;  5B10 O;  1P4P A;  2AF5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...