2OYBO

The crystal structure of ospa mutant
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
246
structure length
246
Chain Sequence
b'NSVSVDLPGSMKVLVSKSSNADGKYDLIATVDALELSGTSDKNNGSGVLEGVKADASKVKLTISDDLGQTTLEVFKSDGSTLVSKYVTSKDKSSTYEKFNEKGEVSEKYITRADGTRLEYTGIKSDGSGKAKEVLKGYVLEGTLTAEKTTLVVKEGTVTLSKNISKSGEVSVELNDTDSSAATKKTAAWNSGTSTLTITVNSKKTKDLVFTSSNTITVQQYDSNGTSLEGSAVEITKLDEIKNALK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Outer surface protein A
publication title Aromatic cross-strand ladders control the structure and stability of beta-rich peptide self-assembly mimics
pubmed doi rcsb
source organism Borrelia burgdorferi
molecule tags Membrane protein
total genus 50
structure length 246
sequence length 246
ec nomenclature
pdb deposition date 2007-02-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.160 Mainly Beta Beta Barrel Lipocalin C1 set domains (antibody constant domain-like) 2oybO01
3.90.930.1 Alpha Beta Alpha-Beta Complex Outer Surface Protein A; domain 3 Outer Surface Protein A; domain 3 2oybO02
1P4PA 2PI3O 2OL6O 2OY8A 1FJ1E 2OL7A 3AUMO 2G8CO 2I5ZO 2FKGA 2AF5A 2FKJA 2I5VO 2OY1O 2OY5O 2HKDA 2OL8O 2OYBO 3EC5A 1OSPO 5B2AO 5B10O 5B11O 5B3MO 3CKFA 3CKGA 2OY7A
chains in the Genus database with same CATH superfamily
1EIOA 3CXCE 3APVA 4NP1A 3FA8A 1YJWE 1P6PA 4QYPA 1X71A 4IMNA 4YGGA 5BYPA 5AQ6A 4O4SA 5D45A 4R0BA 3FDCA 1HBPA 4LKPA 4GE1A 2IZKA 1OEJA 1T68X 5HZ5A 5CYBA 2KW1A 1MDCA 1VWJB 1QY0A 1SWKA 5IRUA 1DFVA 4EDEA 5HTDA 4QZTA 1SWQA 2OVAA 2HNXA 4YCEA 2WQ9A 4ZJ0A 3MG5A 3C78X 1AQBA 1Y0GA 5H9KA 4INNA 3F6ZB 4GD9A 2L68A 1ZNHA 4Z28A 5D48A 2LA7A 3CF5E 2ZJQE 1N43A 4GNWA 5L8IA 4AZRA 4ES7A 5F6BA 1LF7A 1O1VA 3KQ0A 3DLLE 1VWHB 3F9DA 4DQ3A 1QY2A 2QOMA 1KL3A 5AN9B 4A60A 5EDBA 2X46A 5HA1A 1DC9A 3HWDA 1OEEA 2KT4B 3VHMA 1A3YA 4ML7B 5B5GA 5HTEA 2ZAIA 1SA8A 3CBCA 2LBAA 3ZW1A 3PPTA 1EI5A 3RE6A 2LFOA 4ZGUA 5DM6E 4IAWA 1FENA 1QWDA 1VWDB 4I95A 3KFIA 5HA0A 3RWXA 5C0NA 2RTBB 2WEWA 2RQ0A 1EIIA 3WJEA 1UZ2X 4BQUA 1Q7YG 2RTLA 5LJCA 3I55E 3WJFA 1EXSA 1X8NA 1TVQA 4XMHA 1YWCA 3WOVA 1SLDB 1VYFA 1GKAA 3B2LA 1VWGB 2UZ2A 2GTLM 1VWPB 5HCCC 3WZPA 3OBLA 2FS6A 2G79A 1DF8A 4YFRA 3BRNA 1YWBA 4ZHFA 3PK2A 1BSOA 2MO5A 2AMMX 2W2FA 3VG2A 4ALBA 4I3CA 2A3FX 4IABA 4NLIA 1MEPA 3VG5A 4BGFA 2NNQA 1CBQA 4CPIA 1VWMB 4HFOA 3OE3A 2OTJE 2G5LA 3FEKA 1B0OA 2OFAA 1BEBA 2GH7A 2VDFA 1SWRA 2L67A 4WFUA 4XMGA 1K9MG 2FGSA 1VQOE 3F8AA 1JMXA 5AJCA 1LIDA 4AZOA 4IOAE 3CCRE 4OS0A 2O62A 1I9HA 1TOUA 2Y32A 2R74A 3N91A 1EPAA 4QYNA 3NQ3A 4PSQA 4Y0QA 1VWCB 2ACPX 4U8UO 2RTDB 3OJYC 4BX6A 4YH0A 2BS6A 1YWDA 1VWBB 1NQMA 3P02A 4ORUA 3D96A 4BCSA 2KTDA 5HZ9A 2QO6A 4UU2A 3SLOA 1ACDA 3S26A 3BSZE 1LELA 2X8SA 1LFOA 4NV8A 1N9MA 1IFBA 5JVHE 4HPAA 3WYQA 1BWYA 1SWEA 2OY7A 1LCWA 2G7BA 2Z4HA 3WZQA 3FR4A 5D4AA 1ZNKA 3T2WA 2ZAGA 3EBWA 2RN4A 3WJBA 2IZFB 3S5XA 1S72E 1LDOA 4IAXA 4BX7A 4D6AA 2CAMA 1DZPA 3D9WA 4EXZA 3UEUA 4LZVA 4FQBB 3UEXA 4BX5A 3CCQE 4Z2VA 1ERBA 1SWOA 3ZW0B 2F73A 1Q86G 4ZHHA 4NYRA 4ZHCA 4RUUA 4TKJA 2AT5X 5CE4A 4KCAA 5HWZA 4AZPA 2AT8X 1DV9A 1LIFA 4WHIA 3SLTA 2FT9A 1Y52X 2VFBA 4YFQA 2RTRB 1RBPA 5B10O 4BJ8A 3O19A 1SWJA 4GDAA 2RTMA 1VYOA 1KGLA 3BLGA 2X45A 5F2BA 2OL7A 1SWCA 1LICA 2AVIA 4YMYA 1VQ9E 4RUNA 3KZAA 5EPQA 2MJIA 4ORWA 1YIVA 5FAZA 2WWPA 3CCVE 3CPWE 1DF3A 5GADG 2RTGB 3ELXA 3STMX 5BVSA 1X8PA 1SWTA 1KT7A 1T8VA 2G8CO 4LKTA 4GUZA 1FEMA 3D97A 1LDQA 1YWAA 4A1HA 1Y9LA 3CKFA 3HOEA 1IKEA 5B27A 4I3DA 1SRIA 1BLRA 4M6SA 1KQSE 1AELA 3BY0A 1MVGA 2A2UA 3AKMA 1ICMA 1SLGB 5LKEA 2GTFX 1JQPA 1RL6A 1QVGE 1P4PA 1SY3A 3U9PC 4CV7A 2RTOB 1K3BA 5KIDA 1VQ5E 1NDJA 4O4XA 4AZQA 3WXQA 5F58A 5GAHG 1YJNE 1VWLB 4CK4A 4PJ2A 5K68A 3WVMA 1G5WA 2RTHB 3DTQA 1SWGA 5KICA 4I9SA 1JJUA 5K67A 1M1KG 3FR2A 3T6LA 1Y9TA 1O1UA 2XKLA 4YDAA 1CJ5A 1EW3A 3ZWEA 2CM9A 1MK5A 4XMEA 3CC2E 4OS3A 1JYDA 2LB6A 1SLFB 3T1DA 1EUOA 4HPDA 1QABE 4TKHA 1RXKA 5EEEA 4ZHGA 2E4JA 3VHIA 3APXA 1A2DA 2A5CA 1PM1X 3JS1A 2WQAE 5LJKA 1ERXA 3UEWA 3APWA 3VG7A 3KFFA 1R0UA 3WZOA 1DZKA 1N7YA 1Y53X 4O4UA 4YFPA 1B8EA 1DZJA 4DNEA 1KZWA 1ADLA 2R73A 3BU1A 1QVFE 2ACOA 2LBVA 4O3YA 1DZMA 3NP1A 5DPQA 4AW8A 3QKGA 2OYBO 2RD7C 3CCJE 2OF8A 1KT3A 4O49A 5HL7E 1STPA 1BSQA 2ALLX 4BVMA 1AVDA 4GZVA 4Z6JA 2A8GA 2M4LA 1SXXA 1SWLA 4GGRA 4U3QA 4HWMA 4QAEA 1YIJE 1S7DA 3IA8A 5IRWA 2QMIA 1ICNA 3NQ9A 5EZ2A 3NPOA 3ELZA 1SWUA 3CMPA 4IB8A 4NV7A 5H8TA 3GAQA 2OTLE 1KZXA 3O2YA 1NC9A 3FA7A 2L9CA 1U18A 4WFNE 3LV4A 2A5BA 4CDCA 3FMZA 1A57A 1S2PA 1HQPA 1LCZA 2A0AA 5FENA 3EW2A 3G6EE 1JJ2E 1MOYA 5GAEG 1SMPI 4IB6A 1JIWI 4Y5DA 3VE2A 5B5FA 1NQNA 3IG9A 1UYOX 2AF5A 1IFCA 4LZUA 2FHNX 1SWBA 1HQQA 1TOWA 1B4MA 3CCEE 1VWOB 3PP6A 1RJLC 5AJBA 4BBOA 1LNMA 2NP1A 1HBQA 3TF6A 1RXJA 3EYCA 2X55A 4XMCA 2ZSCA 3BDRA 1YITE 2F09A 5L8OA 2BT9A 1NBXA 5HZ8A 1ZNDA 3UAQA 1OSPO 2ZJPE 1IW2A 3CC7E 4U9CA 5LKFA 5B3MO 2OFBA 2NNEA 1CBRA 1G7NA 1XKIA 2IZCB 4QQ1A 1Q82G 4ZR2A 3AUMO 4I6SA 2FR2A 1QFTA 1EALA 3WZNA 2IZIA 1G85A 2A13A 5B11O 2QEXE 2IZBA 2JU7A 4B55A 1Y55X 1PBOA 3SZIA 3C76X 4CPEA 4HPBA 5FQ6E 4GU8A 1SWPA 3RKGA 1SRHA 1KT4A 2OY8A 1FJ1E 4TLJA 5FQ7E 1YP7A 2BLGA 4U67E 3NR3A 4GH7A 2OY1O 3AEHA 2DM5A 1KL5A 1VWFB 1VWQB 2RCQA 4WF9E 1D3SA 3EM0A 4O3WA 1AB0A 4QRLA 2Y3FA 5IO7A 2MWHA 1SWSA 1BSYA 3EBKA 1N0SA 4COTA 1FDQA 2BC3A 2RTIB 3CC4E 5EDCA 4O3ZA 1QQSA 3ZZVA 2CBRA 4YCHA 3ZW1B 3HPEA 3S60A 2P8GA 2Z4IA 1EQDA 3BX7A 5HZQA 4AZMA 2FKGA 4A8ZA 4XMFA 1GX8A 4CPHA 3SOTA 1U0XA 5JR8A 1PTSA 4U8UN 4KIIA 4N7CA 4CSBA 2OVDA 4YGZA 1SY1A 2OF9A 1FE3A 1SREA 1NP1A 2OVEA 1K24A 1VQME 1GKAB 2FHLA 5LJGA 4KC8A 3EW1A 3FIDA 1VWRB 1VQKE 4CDDA 1KOIA 2AT6X 3WBGA 1MM9A 2MM3A 4EQAC 4O9SA 1OBUA 4Z27A 3P6HA 1TW4A 4DCBA 1YI2E 4MEEA 1HXLA 4ODDA 2ZJRE 4FGIB 3I56E 4OELA 1HMRA 2HMBA 1ZNGA 1BRQA 2XSTA 3FA9A 5L8NA 4YDBA 3QQ2A 1JBHA 4K19A 1I78A 1WBIA 3VG3A 2G78A 3JSQA 3ZI8A 2MF6A 1CBIA 2OFMX 1VPRA 4GGTA 2DJFA 4OS8A 1D2UA 2L5PA 4Z2OA 2OY5O 2OL8O 2C1QA 4WFAE 5JD2A 3CR6A 2ANSA 2WUTA 2F01A 3J7ZG 3FIQA 2Q2PA 3ZUOA 1O8VA 4GDZA 4MVKA 1E02A 3FW5A 2VFCA 3RDXA 5AEOA 1AVGI 3GE2A 1SRFA 3WYPA 2JMBA 2Y3EA 5IRAA 4CDFA 5FFHA 3VGWA 4YBUA 1GT4A 4WBKA 4NNTA 1SWNA 4L3RA 3RY2A 1ZNLA 2MHDA 2GTLO 1OEKA 3C77X 1X8QA 1PEEA 2CBSA 2RA6A 3FYFA 4QGWA 1GXAA 4GKCA 3P6DA 5LJEA 3BX8A 2KTSA 3VG6A 3B2IA 5HCDC 3PH5A 5JVGE 2GC9A 4Z2PA 3HOLA 4OKAA 5B29A 3PIOE 5EEDA 2RTCB 4Y0SA 1VWKB 2AH7X 4KH8A 3S5VA 2W2AA 1VQ7E 3E3CA 1W6FA 2C1SA 3APUA 1SY2A 2FTBA 1GM6A 1RLBE 3KFGA 4N7DA 3MX7A 4I9RA 2QO4A 4ORYA 3T6FA 5F7GA 1PBYA 3ZUIA 3RDOA 2R56A 3LTWA 1KC8G 1A18A 1I4UA 1JYJA 1VWEB 3CMEE 2I5ZO 3ZW2A 5K06A 1YUPA 1VQ6E 2FWVA 1L6MA 2RCTA 3FEPA 2QO5A 3TZSA 3FA6A 3ZQ3A 4YVBA 2IFBA 1OBPA 3OW2E 4EKVA 1EPBA 1SXYA 2Q39A 2X32A 1MX8A 3CCUE 2BS5A 1VQ4E 4WFVA 2RTFB 3NBXX 3NQKA 1YJ9E 1JZUA 1STSB 4YGHA 3P6FA 5L3YA 2RTPB 1BJ7A 4KT5A 3DSZA 3CQNA 1RSTB 2WEXA 4QGVA 4HPCA 4ORSA 4ZHDA 1S44A 3D95A 3RDQA 1BM5A 3AKNA 1JJXA 3V8UA 1NJIG 4MIRA 2KD2A 1RXHA 2WR6A 1LUQA 1SY0A 4U8UM 1RSUB 5D47A 4JGLA 1GX3A 1JMZA 2YMSA 4MVEA 1PMPA 3CBSA 3G71E 1HMTA 2JW1A 2OFRX 3HWFA 4Y0RA 4YKMA 1W2BE 2OZQA 3NADA 2BHVA 4MVIA 4NYQA 3P6EA 2FS7A 1STRB 4L1NA 2AL0X 5HBSA 2A2GA 3B2JA 3O22A 5IO6A 5MLCH 1U17A 4IBAA 5H9NA 3RY1A 3SZJA 2OVSA 5LJDA 4NNSA 3TGCA 4C5PA 2FKJA 1LCVA 1KT5A 4ZH6A 5H1SI 4IRWA 1SWDA 1E5PA 1GGLA 1HY2A 1Z24A 5KHPA 3G7XA 3TGAA 2IZHB 3SZHA 3FELA 1UYNX 4KC7A 1VWAB 3I0AA 4UU3A 3WJCA 1K8AG 2Q4NA 3RDMA 5CHKA 2RTNB 4JHQA 1I04A 1NGLA 3KFHA 3NX2A 4OMWA 1M90G 4ZH9A 4YBPA 1E06A 1X8OA 4GRJA 1ZNEA 1QFVA 3H3IA 2AT3X 2Q2MA 1HXZA 3HWGA 2AKQA 2JU8A 5LJHA 3CWKA 2K62A 1E00A 1OPBA 1KT6A 2HLVA 1JJJA 3PQUA 1OBQA 3I17A 1VQPE 1VWNB 1I05A 1VYGA 1X89A 2NNDA 3G4SE 5B2AO 4CDEA 4FBOA 5H9LA 4TJZA 2PI3O 3KVNA 1N9YA 4GETA 3UEVA 1MX7A 3RDUA 2Q9SA 2CZTA 2QA4E 2WSJA 3WJDA 2N93A 3PEDA 2LKKA 1BRPA 4FBVA 2IZGB 3CKGA 4D6BA 3STNA 2FRSA 2C4IA 1VQ8E 2X4MA 2JN3A 4I3BA 3EC5A 3VHHA 4ID2A 1LIEA 4EEJA 3FLLA 1H91A 1I06A 3ZW0A 2RTKA 1FELA 3FW4A 1KQXA 3P6GA 4QGXA 1UREA 3CCLE 1VWIB 4CPFA 4O4OA 2FR3A 1IKJA 1X8UA 3HK1A 5IO5A 4MVLA 4TNNA 2ASNX 2IZEB 1ML7A 3Q6LA 4GJSA 3VG4A 1RAVA 2IZLB 3U0DA 1K73G 3OD9A 2YG2A 2HKDA 4UY8G 3TGBA 5HZ6A 2PY1A 4GNYA 3VPJE 3WJGA 4GGZA 1SXWA 1KQWA 3PH6A 1SWFA 4JO6A 4M7MA 1IIUA 4ON1A 3MBTA 4ALOA 4Y59A 1TXLA 2JGSA 3B2KA 4ORRA 4IB9A 5BVQA 3RSWA 3RDSA 4XMDA 3SLJA 2RTEB 2CZUA 4ZGFA 3JQOA 5FQ8E 4Y0PA 3B2HA 4GJVA 4ZCBA 5CSEA 1N8RG 2HZRA 3CCSE 2JU3A 2W2BA 2IZJA 1BBPA 5LJBA 1E2TA 1KXOA 2X8TA 4JNJA 2HYSA 4GK9A 1N4JA 3IFBA 4I60A 4BOEA 1LIBA 1Q81G 4OMXA 3CD6E 1FTPA 1GT5A 4A1YA 4CPHB 2I5VO 4IB7A 3RBYA 3IGEA 2QOSC 1LKEA 1HN2A 1VQLE 1GT1A 3HTYA 3VE1A 3PIPE 4U46A 3PQSA 1LPJA 4BX6B 4WCEE 2UYWA 4NLJA 1HMSA 1CRBA 4TKBA 4WFBE 1AVEA 3K3LA 5H9AA 4QNIA 2BSZA 4IOCE 2GTLN 1NP4A 2IZAA 5GAGG 2X34A 3PECA 1SRJA 4IMOA 2POAA 5HAEA 1SWAA 4ZFXA 4IO9E 1W5RA 4OEMA 1ZRYA 1KD1G 3P24A 1JV4A 4ARHA 4LQZA 1VQNE 1SLEB 3X00A 1GT3A 2DJGA 3NX1A 3EMMA 3Q34A 1QG5A 2CM4A 5HCEC 4BX7B 5D8JA 4MISA 2OL6O 1YP6A 3U03A 3CMAE 3T2XA 1OPAA 4BX5B 1B56A 3PDFA 1IJ8A 1GX9A 2RTQB 2HZQA 3MM0A 3RE5A 3RZYA 3D4RA 4YKOA 1G74A 3VU1A 2QCBA 4AYHA 3CQRA 2RTJA 4AZNA 3FR5A 2RTAA 1SWHA 3SAOA 3MVFA 3FENA 2IZDB 5IXGA 2X56A 2K23A 5DG4A 1KFFA 2GJ5A 2EU7X 2X8FA 5F1EA 3STKA 4TQ2A 4FBRA 1ALBA 1YHQE 1CBSA 2QM9A 5F6ZA 1W4TA 4O3XB 2JOZA 3BU9A 4NW4A 1SXUA 3LHNA 1QY1A 3P6CA 1SRGA 2FLJA 2CQLA 5DM7E 4EFGA 2AT0X 3L4RA 1MUPA 1KL4A 4QZUA 3CCME 2WPUA 1T0VA 4DQ4A 5BVTA 3HWEA 1XCAA 4ORXA 3BS2A 1WUBA
chains in the Genus database with same CATH topology
1P4PA 2PI3O 1RJLC 2OL6O 2OY8A 1FJ1E 2OL7A 3AUMO 2G8CO 2I5ZO 3IG9A 2FKGA 2AF5A 2FKJA 2I5VO 2OY1O 3IGEA 2OY5O 2HKDA 2OL8O 2OYBO 3EC5A 1OSPO 5B2AO 5B10O 5B11O 5B3MO 3CKFA 3CKGA 2OY7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P4P A;  2PI3 O;  2OL6 O;  2OY8 A;  1FJ1 E;  2OL7 A;  3AUM O;  2G8C O;  2I5Z O;  2FKG A;  2AF5 A;  2FKJ A;  2I5V O;  2OY1 O;  2OY5 O;  2HKD A;  2OL8 O;  2OYB O;  3EC5 A;  1OSP O;  5B2A O;  5B10 O;  5B11 O;  5B3M O;  3CKF A;  3CKG A;  2OY7 A; 
#chains in the Genus database with same CATH topology
 1EIO A;  3CXC E;  3APV A;  4NP1 A;  3FA8 A;  1YJW E;  1P6P A;  4QYP A;  1X71 A;  4IMN A;  4YGG A;  5BYP A;  5AQ6 A;  4O4S A;  5D45 A;  4R0B A;  3FDC A;  1HBP A;  4LKP A;  4GE1 A;  2IZK A;  1OEJ A;  1T68 X;  5HZ5 A;  5CYB A;  2KW1 A;  1MDC A;  1VWJ B;  1QY0 A;  1SWK A;  5IRU A;  1DFV A;  4EDE A;  5HTD A;  4QZT A;  1SWQ A;  2OVA A;  2HNX A;  4YCE A;  2WQ9 A;  4ZJ0 A;  3MG5 A;  3C78 X;  1AQB A;  1Y0G A;  5H9K A;  4INN A;  3F6Z B;  4GD9 A;  2L68 A;  1ZNH A;  4Z28 A;  5D48 A;  2LA7 A;  3CF5 E;  2ZJQ E;  1N43 A;  4GNW A;  5L8I A;  4AZR A;  4ES7 A;  5F6B A;  1LF7 A;  1O1V A;  3KQ0 A;  3DLL E;  1VWH B;  3F9D A;  4DQ3 A;  1QY2 A;  2QOM A;  1KL3 A;  5AN9 B;  4A60 A;  5EDB A;  2X46 A;  5HA1 A;  1DC9 A;  3HWD A;  1OEE A;  2KT4 B;  3VHM A;  1A3Y A;  4ML7 B;  5B5G A;  5HTE A;  2ZAI A;  1SA8 A;  3CBC A;  2LBA A;  3ZW1 A;  3PPT A;  1EI5 A;  3RE6 A;  2LFO A;  4ZGU A;  5DM6 E;  4IAW A;  1FEN A;  1QWD A;  1VWD B;  4I95 A;  3KFI A;  5HA0 A;  3RWX A;  5C0N A;  2RTB B;  2WEW A;  2RQ0 A;  1EII A;  3WJE A;  1UZ2 X;  4BQU A;  1Q7Y G;  2RTL A;  5LJC A;  3I55 E;  3WJF A;  1EXS A;  1X8N A;  1TVQ A;  4XMH A;  1YWC A;  3WOV A;  1SLD B;  1VYF A;  1GKA A;  3B2L A;  1VWG B;  2UZ2 A;  2GTL M;  1VWP B;  5HCC C;  3WZP A;  3OBL A;  2FS6 A;  2G79 A;  1DF8 A;  4YFR A;  3BRN A;  1YWB A;  4ZHF A;  3PK2 A;  1BSO A;  2MO5 A;  2AMM X;  2W2F A;  3VG2 A;  4ALB A;  4I3C A;  2A3F X;  4IAB A;  4NLI A;  1MEP A;  3VG5 A;  4BGF A;  2NNQ A;  1CBQ A;  4CPI A;  1VWM B;  4HFO A;  3OE3 A;  2OTJ E;  2G5L A;  3FEK A;  1B0O A;  2OFA A;  1BEB A;  2GH7 A;  2VDF A;  1SWR A;  2L67 A;  4WFU A;  4XMG A;  1K9M G;  2FGS A;  1VQO E;  3F8A A;  1JMX A;  5AJC A;  1LID A;  4AZO A;  4IOA E;  3CCR E;  4OS0 A;  2O62 A;  1I9H A;  1TOU A;  2Y32 A;  2R74 A;  3N91 A;  1EPA A;  4QYN A;  3NQ3 A;  4PSQ A;  4Y0Q A;  1VWC B;  2ACP X;  4U8U O;  2RTD B;  3OJY C;  4BX6 A;  4YH0 A;  2BS6 A;  1YWD A;  1VWB B;  1NQM A;  3P02 A;  4ORU A;  3D96 A;  4BCS A;  2KTD A;  5HZ9 A;  2QO6 A;  4UU2 A;  3SLO A;  1ACD A;  3S26 A;  3BSZ E;  1LEL A;  2X8S A;  1LFO A;  4NV8 A;  1N9M A;  1IFB A;  5JVH E;  4HPA A;  3WYQ A;  1BWY A;  1SWE A;  2OY7 A;  1LCW A;  2G7B A;  2Z4H A;  3WZQ A;  3FR4 A;  5D4A A;  1ZNK A;  3T2W A;  2ZAG A;  3EBW A;  2RN4 A;  3WJB A;  2IZF B;  3S5X A;  1S72 E;  1LDO A;  4IAX A;  4BX7 A;  4D6A A;  2CAM A;  1DZP A;  3D9W A;  4EXZ A;  3UEU A;  4LZV A;  4FQB B;  3UEX A;  4BX5 A;  3CCQ E;  4Z2V A;  1ERB A;  1SWO A;  3ZW0 B;  2F73 A;  1Q86 G;  4ZHH A;  4NYR A;  4ZHC A;  4RUU A;  4TKJ A;  2AT5 X;  5CE4 A;  4KCA A;  5HWZ A;  4AZP A;  2AT8 X;  1DV9 A;  1LIF A;  4WHI A;  3SLT A;  2FT9 A;  1Y52 X;  2VFB A;  4YFQ A;  2RTR B;  1RBP A;  5B10 O;  4BJ8 A;  3O19 A;  1SWJ A;  4GDA A;  2RTM A;  1VYO A;  1KGL A;  3BLG A;  2X45 A;  5F2B A;  2OL7 A;  1SWC A;  1LIC A;  2AVI A;  4YMY A;  1VQ9 E;  4RUN A;  3KZA A;  5EPQ A;  2MJI A;  4ORW A;  1YIV A;  5FAZ A;  2WWP A;  3CCV E;  3CPW E;  1DF3 A;  5GAD G;  2RTG B;  3ELX A;  3STM X;  5BVS A;  1X8P A;  1SWT A;  1KT7 A;  1T8V A;  2G8C O;  4LKT A;  4GUZ A;  1FEM A;  3D97 A;  1LDQ A;  1YWA A;  4A1H A;  1Y9L A;  3CKF A;  3HOE A;  1IKE A;  5B27 A;  4I3D A;  1SRI A;  1BLR A;  4M6S A;  1KQS E;  1AEL A;  3BY0 A;  1MVG A;  2A2U A;  3AKM A;  1ICM A;  1SLG B;  5LKE A;  2GTF X;  1JQP A;  1RL6 A;  1QVG E;  1P4P A;  1SY3 A;  3U9P C;  4CV7 A;  2RTO B;  1K3B A;  5KID A;  1VQ5 E;  1NDJ A;  4O4X A;  4AZQ A;  3WXQ A;  5F58 A;  5GAH G;  1YJN E;  1VWL B;  4CK4 A;  4PJ2 A;  5K68 A;  3WVM A;  1G5W A;  2RTH B;  3DTQ A;  1SWG A;  5KIC A;  4I9S A;  1JJU A;  5K67 A;  1M1K G;  3FR2 A;  3T6L A;  1Y9T A;  1O1U A;  2XKL A;  4YDA A;  1CJ5 A;  1EW3 A;  3ZWE A;  2CM9 A;  1MK5 A;  4XME A;  3CC2 E;  4OS3 A;  1JYD A;  2LB6 A;  1SLF B;  3T1D A;  1EUO A;  4HPD A;  1QAB E;  4TKH A;  1RXK A;  5EEE A;  4ZHG A;  2E4J A;  3VHI A;  3APX A;  1A2D A;  2A5C A;  1PM1 X;  3JS1 A;  2WQA E;  5LJK A;  1ERX A;  3UEW A;  3APW A;  3VG7 A;  3KFF A;  1R0U A;  3WZO A;  1DZK A;  1N7Y A;  1Y53 X;  4O4U A;  4YFP A;  1B8E A;  1DZJ A;  4DNE A;  1KZW A;  1ADL A;  2R73 A;  3BU1 A;  1QVF E;  2ACO A;  2LBV A;  4O3Y A;  1DZM A;  3NP1 A;  5DPQ A;  4AW8 A;  3QKG A;  2OYB O;  2RD7 C;  3CCJ E;  2OF8 A;  1KT3 A;  4O49 A;  5HL7 E;  1STP A;  1BSQ A;  2ALL X;  4BVM A;  1AVD A;  4GZV A;  4Z6J A;  2A8G A;  2M4L A;  1SXX A;  1SWL A;  4GGR A;  4U3Q A;  4HWM A;  4QAE A;  1YIJ E;  1S7D A;  3IA8 A;  5IRW A;  2QMI A;  1ICN A;  3NQ9 A;  5EZ2 A;  3NPO A;  3ELZ A;  1SWU A;  3CMP A;  4IB8 A;  4NV7 A;  5H8T A;  3GAQ A;  2OTL E;  1KZX A;  3O2Y A;  1NC9 A;  3FA7 A;  2L9C A;  1U18 A;  4WFN E;  3LV4 A;  2A5B A;  4CDC A;  3FMZ A;  1A57 A;  1S2P A;  1HQP A;  1LCZ A;  2A0A A;  5FEN A;  3EW2 A;  3G6E E;  1JJ2 E;  1MOY A;  5GAE G;  1SMP I;  4IB6 A;  1JIW I;  4Y5D A;  3VE2 A;  5B5F A;  1NQN A;  3IG9 A;  1UYO X;  2AF5 A;  1IFC A;  4LZU A;  2FHN X;  1SWB A;  1HQQ A;  1TOW A;  1B4M A;  3CCE E;  1VWO B;  3PP6 A;  1RJL C;  5AJB A;  4BBO A;  1LNM A;  2NP1 A;  1HBQ A;  3TF6 A;  1RXJ A;  3EYC A;  2X55 A;  4XMC A;  2ZSC A;  3BDR A;  1YIT E;  2F09 A;  5L8O A;  2BT9 A;  1NBX A;  5HZ8 A;  1ZND A;  3UAQ A;  1OSP O;  2ZJP E;  1IW2 A;  3CC7 E;  4U9C A;  5LKF A;  5B3M O;  2OFB A;  2NNE A;  1CBR A;  1G7N A;  1XKI A;  2IZC B;  4QQ1 A;  1Q82 G;  4ZR2 A;  3AUM O;  4I6S A;  2FR2 A;  1QFT A;  1EAL A;  3WZN A;  2IZI A;  1G85 A;  2A13 A;  5B11 O;  2QEX E;  2IZB A;  2JU7 A;  4B55 A;  1Y55 X;  1PBO A;  3SZI A;  3C76 X;  4CPE A;  4HPB A;  5FQ6 E;  4GU8 A;  1SWP A;  3RKG A;  1SRH A;  1KT4 A;  2OY8 A;  1FJ1 E;  4TLJ A;  5FQ7 E;  1YP7 A;  2BLG A;  4U67 E;  3NR3 A;  4GH7 A;  2OY1 O;  3AEH A;  2DM5 A;  1KL5 A;  1VWF B;  1VWQ B;  2RCQ A;  4WF9 E;  1D3S A;  3EM0 A;  4O3W A;  1AB0 A;  4QRL A;  2Y3F A;  5IO7 A;  2MWH A;  1SWS A;  1BSY A;  3EBK A;  1N0S A;  4COT A;  1FDQ A;  2BC3 A;  2RTI B;  3CC4 E;  5EDC A;  4O3Z A;  1QQS A;  3ZZV A;  2CBR A;  4YCH A;  3ZW1 B;  3HPE A;  3S60 A;  2P8G A;  2Z4I A;  1EQD A;  3BX7 A;  5HZQ A;  4AZM A;  2FKG A;  4A8Z A;  4XMF A;  1GX8 A;  4CPH A;  3SOT A;  1U0X A;  5JR8 A;  1PTS A;  4U8U N;  4KII A;  4N7C A;  4CSB A;  2OVD A;  4YGZ A;  1SY1 A;  2OF9 A;  1FE3 A;  1SRE A;  1NP1 A;  2OVE A;  1K24 A;  1VQM E;  1GKA B;  2FHL A;  5LJG A;  4KC8 A;  3EW1 A;  3FID A;  1VWR B;  1VQK E;  4CDD A;  1KOI A;  2AT6 X;  3WBG A;  1MM9 A;  2MM3 A;  4EQA C;  4O9S A;  1OBU A;  4Z27 A;  3P6H A;  1TW4 A;  4DCB A;  1YI2 E;  4MEE A;  1HXL A;  4ODD A;  2ZJR E;  4FGI B;  3I56 E;  4OEL A;  1HMR A;  2HMB A;  1ZNG A;  1BRQ A;  2XST A;  3FA9 A;  5L8N A;  4YDB A;  3QQ2 A;  1JBH A;  4K19 A;  1I78 A;  1WBI A;  3VG3 A;  2G78 A;  3JSQ A;  3ZI8 A;  2MF6 A;  1CBI A;  2OFM X;  1VPR A;  4GGT A;  2DJF A;  4OS8 A;  1D2U A;  2L5P A;  4Z2O A;  2OY5 O;  2OL8 O;  2C1Q A;  4WFA E;  5JD2 A;  3CR6 A;  2ANS A;  2WUT A;  2F01 A;  3J7Z G;  3FIQ A;  2Q2P A;  3ZUO A;  1O8V A;  4GDZ A;  4MVK A;  1E02 A;  3FW5 A;  2VFC A;  3RDX A;  5AEO A;  1AVG I;  3GE2 A;  1SRF A;  3WYP A;  2JMB A;  2Y3E A;  5IRA A;  4CDF A;  5FFH A;  3VGW A;  4YBU A;  1GT4 A;  4WBK A;  4NNT A;  1SWN A;  4L3R A;  3RY2 A;  1ZNL A;  2MHD A;  2GTL O;  1OEK A;  3C77 X;  1X8Q A;  1PEE A;  2CBS A;  2RA6 A;  3FYF A;  4QGW A;  1GXA A;  4GKC A;  3P6D A;  5LJE A;  3BX8 A;  2KTS A;  3VG6 A;  3B2I A;  5HCD C;  3PH5 A;  5JVG E;  2GC9 A;  4Z2P A;  3HOL A;  4OKA A;  5B29 A;  3PIO E;  5EED A;  2RTC B;  4Y0S A;  1VWK B;  2AH7 X;  4KH8 A;  3S5V A;  2W2A A;  1VQ7 E;  3E3C A;  1W6F A;  2C1S A;  3APU A;  1SY2 A;  2FTB A;  1GM6 A;  1RLB E;  3KFG A;  4N7D A;  3MX7 A;  4I9R A;  2QO4 A;  4ORY A;  3T6F A;  5F7G A;  1PBY A;  3ZUI A;  3RDO A;  2R56 A;  3LTW A;  1KC8 G;  1A18 A;  1I4U A;  1JYJ A;  1VWE B;  3CME E;  2I5Z O;  3ZW2 A;  5K06 A;  1YUP A;  1VQ6 E;  2FWV A;  1L6M A;  2RCT A;  3FEP A;  2QO5 A;  3TZS A;  3FA6 A;  3ZQ3 A;  4YVB A;  2IFB A;  1OBP A;  3OW2 E;  4EKV A;  1EPB A;  1SXY A;  2Q39 A;  2X32 A;  1MX8 A;  3CCU E;  2BS5 A;  1VQ4 E;  4WFV A;  2RTF B;  3NBX X;  3NQK A;  1YJ9 E;  1JZU A;  1STS B;  4YGH A;  3P6F A;  5L3Y A;  2RTP B;  1BJ7 A;  4KT5 A;  3DSZ A;  3CQN A;  1RST B;  2WEX A;  4QGV A;  4HPC A;  4ORS A;  4ZHD A;  1S44 A;  3D95 A;  3RDQ A;  1BM5 A;  3AKN A;  1JJX A;  3V8U A;  1NJI G;  4MIR A;  2KD2 A;  1RXH A;  2WR6 A;  1LUQ A;  1SY0 A;  4U8U M;  1RSU B;  5D47 A;  4JGL A;  1GX3 A;  1JMZ A;  2YMS A;  4MVE A;  1PMP A;  3CBS A;  3G71 E;  1HMT A;  2JW1 A;  2OFR X;  3HWF A;  4Y0R A;  4YKM A;  1W2B E;  2OZQ A;  3NAD A;  2BHV A;  4MVI A;  4NYQ A;  3P6E A;  2FS7 A;  1STR B;  4L1N A;  2AL0 X;  5HBS A;  2A2G A;  3B2J A;  3O22 A;  5IO6 A;  5MLC H;  1U17 A;  4IBA A;  5H9N A;  3RY1 A;  3SZJ A;  2OVS A;  5LJD A;  4NNS A;  3TGC A;  4C5P A;  2FKJ A;  1LCV A;  1KT5 A;  4ZH6 A;  5H1S I;  4IRW A;  1SWD A;  1E5P A;  1GGL A;  1HY2 A;  1Z24 A;  5KHP A;  3G7X A;  3TGA A;  2IZH B;  3SZH A;  3FEL A;  1UYN X;  4KC7 A;  1VWA B;  3I0A A;  4UU3 A;  3WJC A;  1K8A G;  2Q4N A;  3RDM A;  5CHK A;  2RTN B;  4JHQ A;  1I04 A;  1NGL A;  3KFH A;  3NX2 A;  4OMW A;  1M90 G;  4ZH9 A;  4YBP A;  1E06 A;  1X8O A;  4GRJ A;  1ZNE A;  1QFV A;  3H3I A;  2AT3 X;  2Q2M A;  1HXZ A;  3HWG A;  2AKQ A;  2JU8 A;  5LJH A;  3CWK A;  2K62 A;  1E00 A;  1OPB A;  1KT6 A;  2HLV A;  1JJJ A;  3PQU A;  1OBQ A;  3I17 A;  1VQP E;  1VWN B;  1I05 A;  1VYG A;  1X89 A;  2NND A;  3G4S E;  5B2A O;  4CDE A;  4FBO A;  5H9L A;  4TJZ A;  2PI3 O;  3KVN A;  1N9Y A;  4GET A;  3UEV A;  1MX7 A;  3RDU A;  2Q9S A;  2CZT A;  2QA4 E;  2WSJ A;  3WJD A;  2N93 A;  3PED A;  2LKK A;  1BRP A;  4FBV A;  2IZG B;  3CKG A;  4D6B A;  3STN A;  2FRS A;  2C4I A;  1VQ8 E;  2X4M A;  2JN3 A;  4I3B A;  3EC5 A;  3VHH A;  4ID2 A;  1LIE A;  4EEJ A;  3FLL A;  1H91 A;  1I06 A;  3ZW0 A;  2RTK A;  1FEL A;  3FW4 A;  1KQX A;  3P6G A;  4QGX A;  1URE A;  3CCL E;  1VWI B;  4CPF A;  4O4O A;  2FR3 A;  1IKJ A;  1X8U A;  3HK1 A;  5IO5 A;  4MVL A;  4TNN A;  2ASN X;  2IZE B;  1ML7 A;  3Q6L A;  4GJS A;  3VG4 A;  1RAV A;  2IZL B;  3U0D A;  1K73 G;  3OD9 A;  2YG2 A;  2HKD A;  4UY8 G;  3TGB A;  5HZ6 A;  2PY1 A;  4GNY A;  3VPJ E;  3WJG A;  4GGZ A;  1SXW A;  1KQW A;  3PH6 A;  1SWF A;  4JO6 A;  4M7M A;  1IIU A;  4ON1 A;  3MBT A;  4ALO A;  4Y59 A;  1TXL A;  2JGS A;  3B2K A;  4ORR A;  4IB9 A;  5BVQ A;  3RSW A;  3RDS A;  4XMD A;  3SLJ A;  2RTE B;  2CZU A;  4ZGF A;  3JQO A;  5FQ8 E;  4Y0P A;  3B2H A;  4GJV A;  4ZCB A;  5CSE A;  1N8R G;  2HZR A;  3CCS E;  2JU3 A;  2W2B A;  2IZJ A;  1BBP A;  5LJB A;  1E2T A;  1KXO A;  2X8T A;  4JNJ A;  2HYS A;  4GK9 A;  1N4J A;  3IFB A;  4I60 A;  4BOE A;  1LIB A;  1Q81 G;  4OMX A;  3CD6 E;  1FTP A;  1GT5 A;  4A1Y A;  4CPH B;  2I5V O;  4IB7 A;  3RBY A;  3IGE A;  2QOS C;  1LKE A;  1HN2 A;  1VQL E;  1GT1 A;  3HTY A;  3VE1 A;  3PIP E;  4U46 A;  3PQS A;  1LPJ A;  4BX6 B;  4WCE E;  2UYW A;  4NLJ A;  1HMS A;  1CRB A;  4TKB A;  4WFB E;  1AVE A;  3K3L A;  5H9A A;  4QNI A;  2BSZ A;  4IOC E;  2GTL N;  1NP4 A;  2IZA A;  5GAG G;  2X34 A;  3PEC A;  1SRJ A;  4IMO A;  2POA A;  5HAE A;  1SWA A;  4ZFX A;  4IO9 E;  1W5R A;  4OEM A;  1ZRY A;  1KD1 G;  3P24 A;  1JV4 A;  4ARH A;  4LQZ A;  1VQN E;  1SLE B;  3X00 A;  1GT3 A;  2DJG A;  3NX1 A;  3EMM A;  3Q34 A;  1QG5 A;  2CM4 A;  5HCE C;  4BX7 B;  5D8J A;  4MIS A;  2OL6 O;  1YP6 A;  3U03 A;  3CMA E;  3T2X A;  1OPA A;  4BX5 B;  1B56 A;  3PDF A;  1IJ8 A;  1GX9 A;  2RTQ B;  2HZQ A;  3MM0 A;  3RE5 A;  3RZY A;  3D4R A;  4YKO A;  1G74 A;  3VU1 A;  2QCB A;  4AYH A;  3CQR A;  2RTJ A;  4AZN A;  3FR5 A;  2RTA A;  1SWH A;  3SAO A;  3MVF A;  3FEN A;  2IZD B;  5IXG A;  2X56 A;  2K23 A;  5DG4 A;  1KFF A;  2GJ5 A;  2EU7 X;  2X8F A;  5F1E A;  3STK A;  4TQ2 A;  4FBR A;  1ALB A;  1YHQ E;  1CBS A;  2QM9 A;  5F6Z A;  1W4T A;  4O3X B;  2JOZ A;  3BU9 A;  4NW4 A;  1SXU A;  3LHN A;  1QY1 A;  3P6C A;  1SRG A;  2FLJ A;  2CQL A;  5DM7 E;  4EFG A;  2AT0 X;  3L4R A;  1MUP A;  1KL4 A;  4QZU A;  3CCM E;  2WPU A;  1T0V A;  4DQ4 A;  5BVT A;  3HWE A;  1XCA A;  4ORX A;  3BS2 A;  1WUB A; 
#chains in the Genus database with same CATH homology
 1P4P A;  2PI3 O;  1RJL C;  2OL6 O;  2OY8 A;  1FJ1 E;  2OL7 A;  3AUM O;  2G8C O;  2I5Z O;  3IG9 A;  2FKG A;  2AF5 A;  2FKJ A;  2I5V O;  2OY1 O;  3IGE A;  2OY5 O;  2HKD A;  2OL8 O;  2OYB O;  3EC5 A;  1OSP O;  5B2A O;  5B10 O;  5B11 O;  5B3M O;  3CKF A;  3CKG A;  2OY7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...