2OYHB

Crystal structure of fragment d of gammad298,301a fibrinogen with the peptide ligand gly-his-arg-pro-amide
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
298
structure length
298
Chain Sequence
IPTNLRVLRSILENLRSKIQKLESDVSAQMEYCRTPCTVSCNIPVVSGKECEEIIRKGGETSEMYLIQPDSSVKPYRVYCDMNTENGGWTVIQNRQDGSVDFGRKWDPYKQGFGNVATNTDGKNYCGLPGEYWLGNDKISQLTRMGPTELLIEMEDWKGDKVKAHYGGFTVQNEANKYQISVNKYRGTAGNALMDGASQLMGENRTMTIHNGMFFSTYDRDNDGWLTSDPRKQCSKEDGGGWWYNRCHAANPNGRYYWGGQYTWDMAKHGTDDGVVWMNWKGSWYSMRKMSMKIRPFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Probing the gamma2 Calcium-Binding Site: Studies with gammaD298,301A Fibrinogen Reveal Changes in the gamma294-301 Loop that Alter the Integrity of the "a" Polymerization Site.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Blood clotting
molecule keywords Fibrinogen alpha chain
total genus 93
structure length 298
sequence length 298
chains with identical sequence E
ec nomenclature
pdb deposition date 2007-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00147 Fibrinogen_C Fibrinogen beta and gamma chains, C-terminal globular domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2oyhB01
3.90.215.10 Alpha Beta Alpha-Beta Complex Gamma Fibrinogen; Chain A, domain 1 Gamma Fibrinogen, chain A, domain 1 2oyhB02
4.10.530.10 Few Secondary Structures Irregular Gamma-fibrinogen Carboxyl Terminal Fragment; domain 2 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2 2oyhB03
2J2PA 2A45I 2FFDB 1JC9A 2XNXA 1FZGB 2FFDC 2H43A 2D39A 2HPCB 1RF1B 1RF1A 1FZDA 3H32B 2FIBA 4EPUA 1N86B 1JY2N 1LWUA 2Q9IA 1LT9C 3H32A 2Z4EA 1FZGC 1FZAB 1LWUC 2J61B 2Q9IC 2J0HA 2JHMF 2JHIF 2XNXB 2J64A 1RE4B 2HODC 2OYHC 1JY2O 2Z4EC 4R9TA 1FZEB 1LTJB 4M7HA 3HUSC 2HLOC 1RE3C 2OYIA 2J3UA 1FZBB 1T3UA 2J60A 3GHGC 1M1JB 1FZCB 1N73B 1FIBA 2HLOA 3HUSA 2A45H 2HPCA 3E1IB 1Z3SA 2H43B 3GHGA 1FIDA 1LT9A 1FZAA 3BVHC 1FZFC 2J3FD 2J3OA 2JHLF 1Z3UA 1N86A 1FZFB 2J1GA 1RF0A 1JY3P 1RF0B 2OYHA 2H43C 1JY3N 4JZCA 2WNPF 2OYIB 1M1JC 2J3FA 4JYOX 2J3GA 2OYIC 1RE4A 1RE3B 1N73A 3E1IA 1RF0C 3HUSB 2HLOB 1FZEC 2FFDA 1FZCA 1JY3O 2J0YA 4NYTA 1W2EA 2J61A 4ZFGA 1FZBA 3FIBA 1FZFA 3BVHB 1JY2P 1LWUB 2J5ZA 2Q9IB 1FZEA 2J0GA 3BVHA 1FZAC 1N73C 1FZCC 2JHKF 2HODA 3E1IC 1LTJA 1LT9B 3GHGB 1N86C 1FZBC 2JHHC 1M1JA 1RE3A 3H32C 1LTJC 4R9JA 1FZGA 2GY7A 2Z4EB 2OYHB 2HODB 2A45G 1RF1C 1RE4C 1FICA 4M7FA 2HPCC 2XNXC
chains in the Genus database with same CATH superfamily
3II6A 5KLVE 1SQXG 2IZ0A 1VL2A 2PRRA 4DJGA 1FOSE 1OX3A 1FZAB 3L71G 3MIWA 2OQQA 3BASA 1T6AA 3FWNA 2JHMF 2J64A 2Z4EC 2BCCD 2HLOC 1KQSO 1K05A 2BCCE 3JCUH 3CXHD 3SWKA 2OYIA 2A06G 1FIBA 1Z3SA 2H43B 2QIWA 2FYZA 2FYUJ 1AVOA 2E75C 1LTBC 2R5BA 2V7QJ 4RJTA 1JO5A 1NWQA 2YXRB 4BWNA 1YYCA 1VQ8P 1BE3J 2E74B 2J3GA 1VQ7P 1URQC 2HLOB 1FZEC 2ITAA 2JEEA 1A02J 1N2DC 1M1KQ 1SFCA 1LTAC 1IFMA 3CC7P 3BVHA 1L4AC 1LTJA 1GK4A 3WUUA 4WY4C 2E76C 1Q86Q 1RE3A 3CCUP 4R9JA 3L74D 1RY3A 1IJDB 2GUSA 3L73E 2XZRA 4HJGH 3RK3C 3D70A 5AW4B 3L71D 3HD7B 5TISH 3PH0A 1NTKE 2K3RA 1FC2C 3L73G 5BU8B 1YIJP 2KSJA 2IBZI 1LWUC 1GU4A 3RK3D 4ZNCA 3CCJP 1PZQA 2XNXB 1OVRA 2VRSA 1BGYG 3A0BH 2O01J 3AE5C 4L74A 2OYHC 1ZRTD 2ZT9B 1NJIQ 1K9MQ 2W27A 1BSHA 3TF5A 2WPRA 4OGQC 1FZBB 2JO1A 5AVYB 3B5NA 3GF7A 4WY4A 2IFNA 5CCGA 1CW5A 3E1IB 3H1LG 3CWBE 3GHGA 3RL0C 3GLMA 5APQA 2JDIH 3H1JE 3VYIA 1FZFB 5KAIH 3CCLP 1M1JC 1KV4A 1SQXE 1QL1A 3CXHI 3L70E 2FFDA 1JY3O 3CXHH 1W2EA 5BU5A 1AQTA 4YPCA 2V4HA 3AEFC 2KP8A 1G2CA 3FXDA 4IL6H 3AE6C 2M3EA 1L0LD 5AVUB 1WT6A 4GOEA 2RKLA 2ZJSE 1MV8A 4BXLA 3LIDA 1KB9E 1L0NG 1FICA 1JEKA 2GUVA 3LIEA 2HFED 2FFDC 3JSVC 1SQPG 2AEJA 1GZLA 1KQFB 2Q5UA 4PV1C 2XDJA 3CLQA 4WY4B 1JY2N 1X0TA 1LT9C 1L4AB 2WPSA 3SSUA 5CCHD 1P84D 1OMIA 2RH0A 1WRGA 4PD4E 1Y9BA 1EZVD 5AW3B 4UB6H 3AEDC 4DT0A 1G1JA 2CPBA 4BRYA 2A45H 3GW6A 1NTMG 1HH0A 1NU1J 1NTZG 3R4YA 2IBZE 2N9YB 3G3ZA 1SQVG 1MUUA 1NTZK 1VQMP 1GW3A 2ZYGA 1SVFA 4JZCA 1NU1D 1H89A 1IK7A 4R4LA 3GMAA 5APYA 2AXCA 1JB0J 3HD7A 5KKZC 1J2JB 4B86A 1SQBK 3HTKB 1YTZT 1IFPA 2M3BA 1EDIA 4IOIH 1FZFA 2E76D 1JY2P 1YHQP 1FZAC 3E1IC 1KYOD 1XTCC 1JNMA 1M56D 1DIPA 3L35A 2JHHC 1M1JA 2QM7A 2RN0A 2A45G 4AUWA 3KDPB 3N4XA 2WSFH 1JC9A 3O8ZA 1HVVA 4N78D 4D6TG 4L75A 2ZAEB 5AVVB 3H1IG 1R5LA 2WT7B 2Q3EA 4ASWA 1Y47A 3CX5E 3P7KA 3A5TA 3HTKA 2OTJP 1PGOA 2AXTE 5K5GB 1S9KD 3U59A 1LTJB 3HUSC 1D7MA 2JP3A 1BSNA 2I1KA 4I7ZC 3RBXA 1JM0A 1AV1A 1M1JB 1VQ4P 2Y0EA 5CCGD 4H44C 1N7SB 3H1HD 3H1HE 1KC8Q 1JCCA 1RF0B 1M8OB 2Y9ZA 1ZN5A 1G1IA 1N7SD 3TNUA 3HUSB 2NPSB 3G6EP 1FZCA 3L71J 2FYNB 1L0LK 1OVVA 1GMJA 2P67A 1H0TB 2Q9IB 1BE3D 5CBNA 4O9BA 1JUNA 4LLHA 1NGMB 3QH9A 1OFCX 4RESB 2O01N 2E75D 2C0XA 2XU6A 2HPCC 4GDOA 3L74E 3OJAB 1L4AD 5AVQB 2KNCB 3T97B 3OA7A 5APWA 1NKZB 1WMKA 2R5DA 2N1TA 2LXBA 5AW5B 5KAIE 2FY8A 2PFXA 3CCEP 4H0LC 4D6TD 1IFDA 3E7KA 3BRVB 2FYUD 2QJKC 2J58A 3AE1C 3EFFK 2DW3A 3RK3E 2WTYA 3CMAP 3KHUA 3CL3D 1T3UA 3SWFA 2NPSA 3KXDA 1NTMJ 3Q5RA 2K9YA 2A06E 2JHLF 1VQNP 2Q1KA 1SQVJ 2ZYDA 1VQPP 5KAFH 4I1LA 1NYHA 1SFCD 2I1JA 1NAYA 2GM4A 4UB8H 1QL2A 2OYIC 3NMDA 1X22A 4OH8B 1GDTA 3V2NA 3USSA 1S2EA 3L71E 2H89C 3P8CD 3AEBC 2OTLP 1BCCE 2E5TA 2OTKE 3H1IE 1PL5A 1FZBC 1ZR2A 1LNQA 2MKVA 3CX5D 3U1AA 3L74J 5AW9B 2N1TB 1NH4A 5H2FH 2C0WA 4U3FG 1M90Q 1RF1B 1L4AA 2E74D 3PJSK 3BCCG 3HE4B 1MZ9A 4EPUA 1EXIA 2IYPA 3CX5H 1S3JA 2J0HA 5CMZA 3MHVA 3V5BA 4WWIA 5B5EH 4GT1A 4Y99B 3VTPC 2J60A 3CCSP 1AFOA 1FZFC 4IFFA 2FYUE 1N7SC 1HGZA 3L75J 1PGJA 1SQQE 4ASVA 1JY3P 1URQD 2OYIB 1SQVK 1BE3E 3CC2P 1NOHA 3A2AA 1FOSF 1OIPA 4JYCA 4C7NB 3FIBA 4I2LC 1LWUB 1FBMA 1U7MA 3GHGB 2QSIA 4PD4H 2KLVA 5KLIC 2KYVA 1DX7A 3L73J 2IX7C 2I8DA 2KXPB 3L37A 1P84E 2QJKB 3S4RA 3KZIH 1M57D 3JC22 1S1CX 3RK3B 1R5SA 2Y0CA 1J1DC 2XNXA 3WMM0 4H13B 1FZDA 1H8AA 1NTKJ 1H88A 1CI6A 4PV1B 1LWUA 3WU2E 3A0HE 1N8RQ 3M06A 2QA4P 5KLVK 1YJNP 2JHIF 5GTIE 1GU5A 1ZP0C 3A3YB 2HODC 2W6JH 1GL2D 4D6TJ 3EWKA 3RK2D 2J3UA 2WVRA 3U1CA 1S9KE 1KFMA 1M7LA 2K1AA 5H2FE 1FZCB 3HD7D 3RL0g 2O1KA 4ZKPA 1LT9A 2G3AA 3H1JJ 2FYNC 3L75E 1SQQJ 2J1GA 2KUBA 2E43A 2NPSC 1DD3A 1A02F 2WPVB 1SQPK 2ZFCA 5B66E 3HE5A 2KS1B 2H88C 2KB7P 4JYOX 2E5YA 2YXQB 4U3FJ 3IFMA 1L2PA 2WMMA 5B5EE 1KILC 1USDA 4ZFGA 2B88A 5AVZB 3V2PA 1YQ3C 1VF5D 4NPEA 1SQPJ 4RO0A 1KB9I 1KD1Q 4A7PA 1PV3A 1KILE 1SQPD 1PP9D 2OYOA 2C9LY 2J2PA 1NKNA 1ZV8A 5KJ7C 1FAVA 1T8ZA 4GIFA 3D6ZA 3TGUD 1SQQK 2P7JA 1HF9A 3AEAC 3L75G 1HBWA 4Y28J 1FS0E 5KJ7D 1NU1G 1JTHB 1L0ND 1RE4B 2YKPA 3V4WA 4M7HA 4D6TE 1RE3C 3B71A 2FYUK 1NAFA 1IC2A 4N6JA 2KLUA 2IYOA 3MD0A 2FYUG 1N73B 5KAFE 4K3AA 1NU1E 2J3FD 1IFIA 4OVNF 5AVWB 3PHLA 1EZVG 4H0LD 1J1EB 3M9HA 4OGQB 1GTWA 3E1IA 1SQVD 1EQ7A 2L91A 1OW7A 1QEXA 1HGVA 3VMAA 5KLVG 4WVZA 1EXJA 4I6MC 3M0DC 2W83C 5AVXB 3B5NB 2YMKA 1KB9H 1FJKA 2QJYB 2GY7A 4IFDK 3B4SA 2KZJA 2K88A 2B87B 2WSFJ 1GL2C 4GKGA 2Q6QA 2HR3A 1BGYD 3UIAA 2D2CC 1KB9D 1SQBJ 2Q9IA 3L72J 1LJ2A 3A0HH 1VDFA 3AEGC 1DD4A 3M9BA 4IFMA 3TGUJ 2YIUC 2FXMA 1ZOYC 3L72D 3L75D 3MUDC 4W80A 3TSIA 1AJYA 2NRGA 1NTZE 3OAKA 4K35A 4MN4C 5C39A 4NPFX 3H25A 2IFMA 5AVTB 4WB4A 2NPSD 2AEMA 5APXA 2O1JA 3H1HJ 1L0NE 2D2CD 1HUCA 1KORA 4PJ0E 2H43C 1JY3N 2ZXXA 1OZHA 3BCCJ 1BDCA 5AVRB 3M91A 1TU3F 3H1HG 3MTUE 1Q90D 5APUA 2JKVA 1Q2NA 2BEZF 1NU1K 4NYTA 3GG2A 3LW5H 3Q1MA 3TYYA 2CK3H 1Q81Q 3KYQA 5E79H 4JBZA 1N73C 1K8AQ 2JWDA 2N9BA 4AYCA 1P84H 4OGQD 3KZIE 1R8EA 1LTGC 3H32C 2ZT9C 1AA0A 3H1LE 3FXEA 4M7FA 4QMAA 1CI6B 1P84I 3Q5PA 1LTIC 1LP1A 3W68A 4XFJA 2HPCB 1LT1A 1PPJD 1JCDA 2QEXP 4BRYB 3V2RA 2YO3A 3L70G 5CJ0A 1IFNA 2Z4EA 3CMEP 3M9QA 4Z1MH 2KIKA 1VQ9P 2ZT9D 4EYYQ 1ZRTE 2E76B 1NTZJ 3S9OA 3HRNA 3H1KE 1ZLLA 5GTHE 3NFQA 3BVHC 3CWBD 1N7LA 3AE4C 4GODA 1PIXA 1KILB 1SQVE 1YJWP 4H44B 1L0NJ 1CSBA 1FDIA 1URQA 1FDMA 1SP4A 1BDDA 1YQ4C 1OW8A 3BCCE 1U57A 2YKQA 5AW2B 1U7JA 1N73A 4H44D 3G4SP 1PPJG 3PP5A 1AQ5A 1FZBA 3H1ID 5AW0B 3L74G 3F89A 1G2CB 2IZ1A 2J0GA 3H1JG 1H0TA 1BCCJ 3Q2YA 2P1JA 3L36A 3VP9A 1JMBA 3GF3A 1BCCG 2HODB 4HKZH 2ZVNB 2Q3IA 2IDBA 3AE3C 4C7RA 4EDFA 4L76A 1FE6A 2N1TC 2O3JA 1JTHA 2YO2A 5AW8B 3W67A 1PP9E 1SQQG 1KILA 1SS1A 1DH3A 3H32B 1FU1A 1QX8A 5AW6B 3C1LA 1ZR4A 1N86B 2GA1A 1GL2B 4KJMA 2NZ2A 3O6QA 1FZGC 4JQ0D 3TGUG 1NHLA 2M8RA 2W6BA 4PD4D 3B5NC 1KYOH 1NTKD 3M0DA 4HB1A 2WSSH 1T2KD 1VQOP 1L0NK 1QLED 3A0BE 3GHGC 4HH2A 2HLOA 3MUDA 3SFEC 3B8EB 3PLNA 1RQUA 2IBZD 1N86A 4CPGA 5CCHC 5EFWB 2OYHA 4PV1D 1J1EC 2W90A 2B89A 2OARA 4W7YA 1RF0C 2J0YA 2QRXA 2WSCJ 1KFNA 3MGNA 1AVYA 2WZ7A 3BVHB 2QM8A 3TNUB 1LT9B 1KYOE 1PPJE 3E1RA 4Y99C 1LTJC 1EZVE 3V4QA 2XNXC 1PGPA 2FFDB 2CPSA 1YTZI 2XNDH 2FXPA 3RL0D 5KLVJ 2B87A 2FIBA 3HE5B 1IZNB 2LR2A 4XE5B 1NO4A 1VF5B 1X8YA 4YTPC 1S5LH 2R44A 2BEQD 1PFIA 3CI9A 5APSA 3R2PA 1LTTC 2BCCJ 3MZWB 3VOPA 2M5AA 3CCQP 1LGHB 1T3JA 1KQGB 3M0AA 1S4XA 3NXSA 1SQXD 1W2BO 1MFTA 2YKOA 1GD2E 1SFCB 5KKZB 1YBKA 3VMYA 1CZQA 2R3CA 3CC4P 3I55P 1JOCA 4U3FE 3FX0A 4U3FD 2E75B 3TDKA 1PP9G 3LW5J 2XKMA 4EIJA 1DEBA 3PRJA 1FZEA 1YJ9P 1NTMD 1SQPE 2Y0DA 4JYBA 3QWOC 4WBAA 1L0LJ 4DCKA 2Z4EB 3HD7C 3ABVC 4LGDE 1HJBA 3L4FA 2KOGA 1ZW0A 3TK1A 3L73D 4NPDA 3I5CA 1FZGB 2WPQA 3KQGA 2ZXEB 3SWYA 3EFGA 1W5CE 2HG5D 1E79H 1KYOI 1SLQA 4H13C 3F5HA 1Z56A 2Y9YA 3IN6A 2L5GB 1PGQA 3P8CE 5AVSB 3AECC 1J1DB 5APVA 1Q7YQ 2KZIA 3VMXA 1OXZA 3CWBG 4U7JA 1FZEB 1S5LE 2AXTH 1RHZB 5AW1B 2K37A 2KK7A 1RH5B 3H1KG 2B9BA 3CWBJ 5CBOA 1GW4A 1EDJA 3OW2O 1EC5A 1Z3UA 2AEFA 1KQLA 1DEEG 4EOTA 2WNPF 3H1LD 4KT0J 1SQXJ 2G8YA 5APTA 3L70J 1NVOA 2J61A 1MFZA 2YIUB 2FKWB 4YXDC 1BCCD 2J5ZA 3K5BA 2YMYA 3KPEA 2KI7B 1HTLC 4R4MA 2FXOA 1X9VA 2YNYA 3IF4A 1L0LE 4TT3H 2KNCA 3T97A 3H6PA 1FZGA 3FWLA 1VQ5P 1RE4C 3L72G 5BVZA 2BCCG 5KLVD 2A45I 3V2QA 3P32A 2N1TD 2P10A 4RKUJ 4PJ0H 2V7QH 2D39A 2C9NY 2A06D 1RF1A 3O6QB 1IK9A 1KILD 3VN0A 2PP6A 4KHXA 1BE3G 5L8RJ 2SPZA 1SQBE 3L72E 3H32A 5B66H 3ZDMA 3TGUE 2PAJA 2MJZA 5E79E 3AE8C 2JR8A 4R9TA 2KS1A 4XA4A 3SFDC 2ZYAA 1YI2P 5M1BA 1OW6A 1KMIZ 3AEEC 4M3LA 2M0BA 2JJLA 1S5LX 3HUSA 2H8PD 2HPCA 1N7SA 1UIXA 3V6IA 2HYNA 5CHXA 2J3OA 4HYTB 2Z5HA 1K04A 1URQB 1EDLA 1EDKA 2WQYC 1VPCA 1QGKB 4PD4I 3WU2H 1E5WA 3B5ND 1KZUB 1XTGB 1VF5C 3H1KD 2W6AA 3VP8A 1FZCC 1RQVA 1FJPA 4YXWH 2P58A 4ZKUA 3A7OA 3CD6P 3G71P 1NTMK 1QVGO 3H1LJ 1RF1C 3BCCD 5CCGC 3ITKA 3HE4A 4AQRD 1ZXGA 2QE7H 4UB8E 3L70D 1IO4A 2LXCB 4H0LB 2WSEH 3Q5SA 2H43A 3BATA 3CPWO 4H13D 3RK2C 3WUVA 5KTBA 2D2CB 2WITA 3S1KA 5KJ7A 4C46A 4IL6X 4JPZB 3RK2B 3G9RA 2POHA 4N3YB 4LC1A 3MP7B 2QJPC 1ZMEC 2IPPA 3CX5I 4IL6E 1BGYE 3AE7C 1JY2O 2QJYC 3NTNA 2WT7A 2W8ZA 2JWAA 1SQBD 3IR9A 3H1KJ 3H1JD 3BRTB 1FIDA 3VMZA 4L73A 4GOFA 1SQXK 1GL2A 4W7ZA 3D6YA 2LKMA 2BASA 1KN7A 3Q3DA 2J3FA 3EQ2A 2RMZA 2XV5A 3WUTA 4DOJA 2P2UA 3CCVP 5GTIH 3RGUA 4TLFA 3RBZA 1OWAA 1GK6A 3AE9C 5CCHA 1VQKP 1N86C 2J5UA 1VQLP 2OYHB 4WY4D 3JCUE 2Q7CA 1VQ6P 2KSEA 4OWFA 3PTZA 1PP9J 3C8VA 2K9JA 1LP1B 1EZVI 1Q82Q 2ZVOB 5TISE 3CXHE 1K73Q 5KLIB 1KTMA 1LTSC 1L0LG 1YITP 3AE2C 1NTKG 1IFJA 2FBWC 1OVUA 1S72P 2WSCH 4ZMDA 2J61B 2Q9IC 1MKMA 1NTKK 1T2KC 5AW7B 3D71A 1BGYJ 1UIIA 1JMMA 3I56P 2UWJE 1USEA 1X79B 1SQQD 4N78E 2PGDA 2J59M 4C7NA 2R32A 1QVFO 3P8MC 2Z5IA 1NTME 1FZAA 1SFCC 5GTHH 2OGUA 4DZOA 2R3SA 5TJHA 5DJUB 3RL0B 1RF0A 1HJ0A 2E74C 1FDOA 4I7ZB 5CJ4A 1RE4A 1RE3B 2QG4A 2O01H 3CCMP 3FGAD 2E42A 3N7NA 2WWWA 2M5AB 1SQBG 1Y8AA 3CCRP 5DJTB 4UB6E 2JHKF 2HODA 3H1IJ 1NTZD 4JF7A 2H7HA 2QVAA 3C9IA 4EI2A 2IBZG 1HWTC 3IAOA 2K9JB 2WSEJ 2QJPB
chains in the Genus database with same CATH topology
3II6A 3TK1A 3OJAB 3I5CA 1L4AD 1FZGB 2WPQA 3KQGA 5AVQB 1GL2C 2ZXEB 4GKGA 3SWYA 3OA7A 3EFGA 5APWA 1NKZB 2HG5D 2R5DA 2N1TA 1SLQA 3UIAA 5AW5B 2Q9IA 1Z56A 1FOSE 2L5GB 3P8CE 5AVSB 1VDFA 1FZAB 1J1DB 3M9BA 3MIWA 1IFDA 4IFMA 5APVA 3BASA 3BRVB 2FXMA 3VMXA 2JHMF 2J64A 2J58A 2Z4EC 1OXZA 1FZEB 4W80A 3TSIA 2HLOC 2OYIA 2WTYA 3CL3D 1T3UA 3SWFA 3OAKA 5AW1B 2NPSA 1FIBA 2IFMA 1Z3SA 5AVTB 4WB4A 2H43B 2NPSD 1GW4A 5APXA 2FYZA 2JHLF 1LTBC 2O1JA 1Z3UA 2R5BA 1HUCA 1KQLA 1JO5A 2H43C 4I1LA 4EOTA 1JY3N 2WNPF 1NWQA 1SFCD 2I1JA 1YYCA 2GM4A 5AVRB 3M91A 2J3GA 1QL2A 2OYIC 3MTUE 1URQC 5APUA 3NMDA 2HLOB 5APTA 4OH8B 1FZEC 1GDTA 1NU1K 2JEEA 3V2NA 4NYTA 2J61A 1A02J 1MFZA 1N2DC 3LW5H 1SFCA 1LTAC 1IFMA 2FKWB 3P8CD 3TYYA 2J5ZA 3KYQA 3BVHA 1L4AC 1N73C 2YMYA 3KPEA 1LTJA 2N9BA 1GK4A 1HTLC 4AYCA 4WY4C 1X9VA 1FZBC 2YNYA 1ZR2A 1RE3A 3T97A 1LTGC 3H32C 3H6PA 4R9JA 1FZGA 1RY3A 1IJDB 2GUSA 1RE4C 2XZRA 4M7FA 5BVZA 2A45I 3V2QA 3U1AA 3P32A 5AW9B 2N1TB 1CI6B 2N1TD 3RK3C 1NH4A 2C0WA 1LTIC 5AW4B 2HPCB 2D39A 2C9NY 1RF1B 1RF1A 3HD7B 1L4AA 1IK9A 1KILD 3VN0A 1JCDA 2PP6A 4KHXA 3HE4B 1MZ9A 4EPUA 3V2RA 2YO3A 5BU8B 5CJ0A 1IFNA 2KSJA 3H32A 2Z4EA 1GU4A 1LWUC 3RK3D 2PAJA 3M9QA 2J0HA 5CMZA 2MJZA 2XNXB 2VRSA 3V5BA 2OYHC 4R9TA 4GT1A 2W27A 4XA4A 4Y99B 2WPRA 1FZBB 3VTPC 4M3LA 5AVYB 3B5NA 2J60A 4WY4A 2JJLA 2IFNA 3HRNA 5CCGA 1CW5A 3HUSA 3E1IB 2H8PD 2HPCA 1ZLLA 3GHGA 1N7SA 3RL0C 3NFQA 1AFOA 1FZFC 3BVHC 1N7LA 2HYNA 5APQA 4IFFA 5CHXA 2J3OA 1KILB 1N7SC 1HGZA 3VYIA 1FZFB 4HYTB 2Z5HA 1CSBA 1JY3P 1URQA 1URQD 1URQB 1FDMA 2OYIB 1SP4A 1SQVK 1M1JC 1VPCA 1QL1A 2YKQA 5AW2B 1NOHA 3A2AA 1FOSF 1N73A 2FFDA 1JY3O 4JYCA 1E5WA 1W2EA 3PP5A 5BU5A 1AQ5A 3B5ND 1FZBA 4C7NB 3FIBA 1KZUB 1XTGB 5AW0B 2KP8A 4I2LC 1G2CB 1G2CA 1LWUB 2W6AA 2J0GA 3VP8A 1FBMA 1FZCC 5AVUB 1FJPA 3GHGB 1WT6A 4ZKUA 2KLVA 2KYVA 2P1JA 3A7OA 1MV8A 3L36A 3VP9A 1NTMK 3LIDA 1DX7A 2HODB 1RF1C 1FICA 2IX7C 3L37A 2Q3IA 5CCGC 2GUVA 3HE4A 4AQRD 4C7RA 2N1TC 3RK3B 3LIEA 1JTHA 2YO2A 5AW8B 1J1DC 2XNXA 2HFED 2FFDC 1IO4A 2WSEH 1KILA 3WMM0 2H43A 3BATA 1DH3A 1GZLA 3RK2C 5KTBA 1FZDA 2WITA 2Q5UA 3H32B 1H8AA 1FU1A 5KJ7A 1H88A 5AW6B 1CI6A 4C46A 2XDJA 1ZR4A 3CLQA 4WY4B 1N86B 1JY2N 1LWUA 3RK2B 1LT9C 2POHA 4N3YB 1GL2B 1L4AB 1FZGC 2WPSA 3M06A 4LC1A 5KLVK 5CCHD 1NHLA 2IPPA 2JHIF 1GU5A 3A3YB 2M8RA 2HODC 1JY2O 2W6BA 1GL2D 3B5NC 1WRGA 3RK2D 3NTNA 3M0DA 1T2KD 2J3UA 3U1CA 1S9KE 2WT7A 1L0NK 5AW3B 3GHGC 1KFMA 1M7LA 1G1JA 2CPBA 3IR9A 4HH2A 1FZCB 2HLOA 2A45H 3HD7D 3MUDA 2O1KA 4ZKPA 3BRTB 1FIDA 1LT9A 3B8EB 1HH0A 3VMZA 3G3ZA 1N86A 1MUUA 1NTZK 2J1GA 5CCHC 2E43A 2NPSC 1GW3A 1SQXK 1GL2A 4W7ZA 2OYHA 1A02F 2LKMA 1SVFA 2BASA 4JZCA 2ZFCA 1SQPK 1J1EC 3HE5A 1H89A 2KB7P 2J3FA 4JYOX 5APYA 3IFMA 3EQ2A 2OARA 3HD7A 4W7YA 1RF0C 1J2JB 4B86A 2XV5A 1SQBK 4DOJA 3HTKB 3MGNA 2J0YA 1KFNA 1KILC 1YTZT 2P2UA 2M3BA 4ZFGA 5AVZB 2WZ7A 1FZFA 3BVHB 3V2PA 1JY2P 1FZAC 1OWAA 3E1IC 1GK6A 2QM8A 1XTCC 3TNUB 1JNMA 1LT9B 5CCHA 1N86C 3L35A 2JHHC 1M1JA 4Y99C 2QM7A 1LTJC 2C9LY 2OYHB 2A45G 3V4QA 4WY4D 2XNXC 2Q7CA 2J2PA 2FFDB 1NKNA 3KDPB 4AUWA 2CPSA 3N4XA 1ZV8A 2WSFH 1YTZI 1FAVA 5KJ7C 1JC9A 3O8ZA 1HVVA 4N78D 1T8ZA 5AVVB 4GIFA 1SQQK 3RL0D 2P7JA 2WT7B 2FIBA 3HE5B 1LTSC 1HBWA 4XE5B 1NO4A 1IFJA 2WSCH 3P7KA 2J61B 2Q9IC 3A5TA 3HTKA 5KJ7D 1X8YA 1NTKK 1T2KC 5AW7B 1JTHB 1PFIA 1RE4B 2YKPA 3CI9A 1S9KD 5APSA 1JMMA 3U59A 3V4WA 1LTJB 4M7HA 3HUSC 3R2PA 1RE3C 1LTTC 3VOPA 2I1KA 2FYUK 1NAFA 1LGHB 1X79B 4N78E 2J59M 1IC2A 1T3JA 2R32A 4C7NA 4N6JA 1M1JB 3MD0A 1N73B 3M0AA 3NXSA 3P8MC 2Z5IA 5CCGD 1FZAA 1SFCC 2J3FD 4DZOA 1N7SB 1IFIA 2YKOA 1GD2E 5AVWB 1JCCA 1SFCB 3RL0B 1RF0A 1RF0B 3VMYA 1CZQA 2R3CA 1JOCA 1J1EB 1ZN5A 3M9HA 1G1IA 1N7SD 5CJ4A 1RE4A 1RE3B 3TNUA 1GTWA 3E1IA 3HUSB 2NPSB 2O01H 2E42A 1EQ7A 1FZCA 3N7NA 1L0LK 2WWWA 2P67A 2XKMA 1HGVA 4EIJA 1DEBA 2Q9IB 1FZEA 4O9BA 1JUNA 2JHKF 2HODA 4LLHA 4JF7A 2H7HA 4JYBA 4RESB 3C9IA 4I6MC 3M0DC 4WBAA 1HWTC 5AVXB 2C0XA 3B5NB 2XU6A 1FJKA 2GY7A 2Z4EB 3HD7C 2HPCC 4LGDE 1HJBA 3L4FA 4IFDK 2KOGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J2P A;  2A45 I;  2FFD B;  1JC9 A;  2XNX A;  1FZG B;  2FFD C;  2H43 A;  2D39 A;  2HPC B;  1RF1 B;  1RF1 A;  1FZD A;  3H32 B;  2FIB A;  4EPU A;  1N86 B;  1JY2 N;  1LWU A;  2Q9I A;  1LT9 C;  3H32 A;  2Z4E A;  1FZG C;  1FZA B;  1LWU C;  2J61 B;  2Q9I C;  2J0H A;  2JHM F;  2JHI F;  2XNX B;  2J64 A;  1RE4 B;  2HOD C;  2OYH C;  1JY2 O;  2Z4E C;  4R9T A;  1FZE B;  1LTJ B;  4M7H A;  3HUS C;  2HLO C;  1RE3 C;  2OYI A;  2J3U A;  1FZB B;  1T3U A;  2J60 A;  3GHG C;  1M1J B;  1FZC B;  1N73 B;  1FIB A;  2HLO A;  3HUS A;  2A45 H;  2HPC A;  3E1I B;  1Z3S A;  2H43 B;  3GHG A;  1FID A;  1LT9 A;  1FZA A;  3BVH C;  1FZF C;  2J3F D;  2J3O A;  2JHL F;  1Z3U A;  1N86 A;  1FZF B;  2J1G A;  1RF0 A;  1JY3 P;  1RF0 B;  2OYH A;  2H43 C;  1JY3 N;  4JZC A;  2WNP F;  2OYI B;  1M1J C;  2J3F A;  4JYO X;  2J3G A;  2OYI C;  1RE4 A;  1RE3 B;  1N73 A;  3E1I A;  1RF0 C;  3HUS B;  2HLO B;  1FZE C;  2FFD A;  1FZC A;  1JY3 O;  2J0Y A;  4NYT A;  1W2E A;  2J61 A;  4ZFG A;  1FZB A;  3FIB A;  1FZF A;  3BVH B;  1JY2 P;  1LWU B;  2J5Z A;  2Q9I B;  1FZE A;  2J0G A;  3BVH A;  1FZA C;  1N73 C;  1FZC C;  2JHK F;  2HOD A;  3E1I C;  1LTJ A;  1LT9 B;  3GHG B;  1N86 C;  1FZB C;  2JHH C;  1M1J A;  1RE3 A;  3H32 C;  1LTJ C;  4R9J A;  1FZG A;  2GY7 A;  2Z4E B;  2OYH B;  2HOD B;  2A45 G;  1RF1 C;  1RE4 C;  1FIC A;  4M7F A;  2HPC C;  2XNX C; 
#chains in the Genus database with same CATH topology
 3II6 A;  5KLV E;  1SQX G;  2IZ0 A;  1VL2 A;  2PRR A;  4DJG A;  1FOS E;  1OX3 A;  1FZA B;  3L71 G;  3MIW A;  2OQQ A;  3BAS A;  1T6A A;  3FWN A;  2JHM F;  2J64 A;  2Z4E C;  2BCC D;  2HLO C;  1KQS O;  1K05 A;  2BCC E;  3JCU H;  3CXH D;  3SWK A;  2OYI A;  2A06 G;  1FIB A;  1Z3S A;  2H43 B;  2QIW A;  2FYZ A;  2FYU J;  1AVO A;  2E75 C;  1LTB C;  2R5B A;  2V7Q J;  4RJT A;  1JO5 A;  1NWQ A;  2YXR B;  4BWN A;  1YYC A;  1VQ8 P;  1BE3 J;  2E74 B;  2J3G A;  1VQ7 P;  1URQ C;  2HLO B;  1FZE C;  2ITA A;  2JEE A;  1A02 J;  1N2D C;  1M1K Q;  1SFC A;  1LTA C;  1IFM A;  3CC7 P;  3BVH A;  1L4A C;  1LTJ A;  1GK4 A;  3WUU A;  4WY4 C;  2E76 C;  1Q86 Q;  1RE3 A;  3CCU P;  4R9J A;  3L74 D;  1RY3 A;  1IJD B;  2GUS A;  3L73 E;  2XZR A;  4HJG H;  3RK3 C;  3D70 A;  5AW4 B;  3L71 D;  3HD7 B;  5TIS H;  3PH0 A;  1NTK E;  2K3R A;  1FC2 C;  3L73 G;  5BU8 B;  1YIJ P;  2KSJ A;  2IBZ I;  1LWU C;  1GU4 A;  3RK3 D;  4ZNC A;  3CCJ P;  1PZQ A;  2XNX B;  1OVR A;  2VRS A;  1BGY G;  3A0B H;  2O01 J;  3AE5 C;  4L74 A;  2OYH C;  1ZRT D;  2ZT9 B;  1NJI Q;  1K9M Q;  2W27 A;  1BSH A;  3TF5 A;  2WPR A;  4OGQ C;  1FZB B;  2JO1 A;  5AVY B;  3B5N A;  3GF7 A;  4WY4 A;  2IFN A;  5CCG A;  1CW5 A;  3E1I B;  3H1L G;  3CWB E;  3GHG A;  3RL0 C;  3GLM A;  5APQ A;  2JDI H;  3H1J E;  3VYI A;  1FZF B;  5KAI H;  3CCL P;  1M1J C;  1KV4 A;  1SQX E;  1QL1 A;  3CXH I;  3L70 E;  2FFD A;  1JY3 O;  3CXH H;  1W2E A;  5BU5 A;  1AQT A;  4YPC A;  2V4H A;  3AEF C;  2KP8 A;  1G2C A;  3FXD A;  4IL6 H;  3AE6 C;  2M3E A;  1L0L D;  5AVU B;  1WT6 A;  4GOE A;  2RKL A;  2ZJS E;  1MV8 A;  4BXL A;  3LID A;  1KB9 E;  1L0N G;  1FIC A;  1JEK A;  2GUV A;  3LIE A;  2HFE D;  2FFD C;  3JSV C;  1SQP G;  2AEJ A;  1GZL A;  1KQF B;  2Q5U A;  4PV1 C;  2XDJ A;  3CLQ A;  4WY4 B;  1JY2 N;  1X0T A;  1LT9 C;  1L4A B;  2WPS A;  3SSU A;  5CCH D;  1P84 D;  1OMI A;  2RH0 A;  1WRG A;  4PD4 E;  1Y9B A;  1EZV D;  5AW3 B;  4UB6 H;  3AED C;  4DT0 A;  1G1J A;  2CPB A;  4BRY A;  2A45 H;  3GW6 A;  1NTM G;  1HH0 A;  1NU1 J;  1NTZ G;  3R4Y A;  2IBZ E;  2N9Y B;  3G3Z A;  1SQV G;  1MUU A;  1NTZ K;  1VQM P;  1GW3 A;  2ZYG A;  1SVF A;  4JZC A;  1NU1 D;  1H89 A;  1IK7 A;  4R4L A;  3GMA A;  5APY A;  2AXC A;  1JB0 J;  3HD7 A;  5KKZ C;  1J2J B;  4B86 A;  1SQB K;  3HTK B;  1YTZ T;  1IFP A;  2M3B A;  1EDI A;  4IOI H;  1FZF A;  2E76 D;  1JY2 P;  1YHQ P;  1FZA C;  3E1I C;  1KYO D;  1XTC C;  1JNM A;  1M56 D;  1DIP A;  3L35 A;  2JHH C;  1M1J A;  2QM7 A;  2RN0 A;  2A45 G;  4AUW A;  3KDP B;  3N4X A;  2WSF H;  1JC9 A;  3O8Z A;  1HVV A;  4N78 D;  4D6T G;  4L75 A;  2ZAE B;  5AVV B;  3H1I G;  1R5L A;  2WT7 B;  2Q3E A;  4ASW A;  1Y47 A;  3CX5 E;  3P7K A;  3A5T A;  3HTK A;  2OTJ P;  1PGO A;  2AXT E;  5K5G B;  1S9K D;  3U59 A;  1LTJ B;  3HUS C;  1D7M A;  2JP3 A;  1BSN A;  2I1K A;  4I7Z C;  3RBX A;  1JM0 A;  1AV1 A;  1M1J B;  1VQ4 P;  2Y0E A;  5CCG D;  4H44 C;  1N7S B;  3H1H D;  3H1H E;  1KC8 Q;  1JCC A;  1RF0 B;  1M8O B;  2Y9Z A;  1ZN5 A;  1G1I A;  1N7S D;  3TNU A;  3HUS B;  2NPS B;  3G6E P;  1FZC A;  3L71 J;  2FYN B;  1L0L K;  1OVV A;  1GMJ A;  2P67 A;  1H0T B;  2Q9I B;  1BE3 D;  5CBN A;  4O9B A;  1JUN A;  4LLH A;  1NGM B;  3QH9 A;  1OFC X;  4RES B;  2O01 N;  2E75 D;  2C0X A;  2XU6 A;  2HPC C;  4GDO A;  3L74 E;  3OJA B;  1L4A D;  5AVQ B;  2KNC B;  3T97 B;  3OA7 A;  5APW A;  1NKZ B;  1WMK A;  2R5D A;  2N1T A;  2LXB A;  5AW5 B;  5KAI E;  2FY8 A;  2PFX A;  3CCE P;  4H0L C;  4D6T D;  1IFD A;  3E7K A;  3BRV B;  2FYU D;  2QJK C;  2J58 A;  3AE1 C;  3EFF K;  2DW3 A;  3RK3 E;  2WTY A;  3CMA P;  3KHU A;  3CL3 D;  1T3U A;  3SWF A;  2NPS A;  3KXD A;  1NTM J;  3Q5R A;  2K9Y A;  2A06 E;  2JHL F;  1VQN P;  2Q1K A;  1SQV J;  2ZYD A;  1VQP P;  5KAF H;  4I1L A;  1NYH A;  1SFC D;  2I1J A;  1NAY A;  2GM4 A;  4UB8 H;  1QL2 A;  2OYI C;  3NMD A;  1X22 A;  4OH8 B;  1GDT A;  3V2N A;  3USS A;  1S2E A;  3L71 E;  2H89 C;  3P8C D;  3AEB C;  2OTL P;  1BCC E;  2E5T A;  2OTK E;  3H1I E;  1PL5 A;  1FZB C;  1ZR2 A;  1LNQ A;  2MKV A;  3CX5 D;  3U1A A;  3L74 J;  5AW9 B;  2N1T B;  1NH4 A;  5H2F H;  2C0W A;  4U3F G;  1M90 Q;  1RF1 B;  1L4A A;  2E74 D;  3PJS K;  3BCC G;  3HE4 B;  1MZ9 A;  4EPU A;  1EXI A;  2IYP A;  3CX5 H;  1S3J A;  2J0H A;  5CMZ A;  3MHV A;  3V5B A;  4WWI A;  5B5E H;  4GT1 A;  4Y99 B;  3VTP C;  2J60 A;  3CCS P;  1AFO A;  1FZF C;  4IFF A;  2FYU E;  1N7S C;  1HGZ A;  3L75 J;  1PGJ A;  1SQQ E;  4ASV A;  1JY3 P;  1URQ D;  2OYI B;  1SQV K;  1BE3 E;  3CC2 P;  1NOH A;  3A2A A;  1FOS F;  1OIP A;  4JYC A;  4C7N B;  3FIB A;  4I2L C;  1LWU B;  1FBM A;  1U7M A;  3GHG B;  2QSI A;  4PD4 H;  2KLV A;  5KLI C;  2KYV A;  1DX7 A;  3L73 J;  2IX7 C;  2I8D A;  2KXP B;  3L37 A;  1P84 E;  2QJK B;  3S4R A;  3KZI H;  1M57 D;  3JC2 2;  1S1C X;  3RK3 B;  1R5S A;  2Y0C A;  1J1D C;  2XNX A;  3WMM 0;  4H13 B;  1FZD A;  1H8A A;  1NTK J;  1H88 A;  1CI6 A;  4PV1 B;  1LWU A;  3WU2 E;  3A0H E;  1N8R Q;  3M06 A;  2QA4 P;  5KLV K;  1YJN P;  2JHI F;  5GTI E;  1GU5 A;  1ZP0 C;  3A3Y B;  2HOD C;  2W6J H;  1GL2 D;  4D6T J;  3EWK A;  3RK2 D;  2J3U A;  2WVR A;  3U1C A;  1S9K E;  1KFM A;  1M7L A;  2K1A A;  5H2F E;  1FZC B;  3HD7 D;  3RL0 g;  2O1K A;  4ZKP A;  1LT9 A;  2G3A A;  3H1J J;  2FYN C;  3L75 E;  1SQQ J;  2J1G A;  2KUB A;  2E43 A;  2NPS C;  1DD3 A;  1A02 F;  2WPV B;  1SQP K;  2ZFC A;  5B66 E;  3HE5 A;  2KS1 B;  2H88 C;  2KB7 P;  4JYO X;  2E5Y A;  2YXQ B;  4U3F J;  3IFM A;  1L2P A;  2WMM A;  5B5E E;  1KIL C;  1USD A;  4ZFG A;  2B88 A;  5AVZ B;  3V2P A;  1YQ3 C;  1VF5 D;  4NPE A;  1SQP J;  4RO0 A;  1KB9 I;  1KD1 Q;  4A7P A;  1PV3 A;  1KIL E;  1SQP D;  1PP9 D;  2OYO A;  2C9L Y;  2J2P A;  1NKN A;  1ZV8 A;  5KJ7 C;  1FAV A;  1T8Z A;  4GIF A;  3D6Z A;  3TGU D;  1SQQ K;  2P7J A;  1HF9 A;  3AEA C;  3L75 G;  1HBW A;  4Y28 J;  1FS0 E;  5KJ7 D;  1NU1 G;  1JTH B;  1L0N D;  1RE4 B;  2YKP A;  3V4W A;  4M7H A;  4D6T E;  1RE3 C;  3B71 A;  2FYU K;  1NAF A;  1IC2 A;  4N6J A;  2KLU A;  2IYO A;  3MD0 A;  2FYU G;  1N73 B;  5KAF E;  4K3A A;  1NU1 E;  2J3F D;  1IFI A;  4OVN F;  5AVW B;  3PHL A;  1EZV G;  4H0L D;  1J1E B;  3M9H A;  4OGQ B;  1GTW A;  3E1I A;  1SQV D;  1EQ7 A;  2L91 A;  1OW7 A;  1QEX A;  1HGV A;  3VMA A;  5KLV G;  4WVZ A;  1EXJ A;  4I6M C;  3M0D C;  2W83 C;  5AVX B;  3B5N B;  2YMK A;  1KB9 H;  1FJK A;  2QJY B;  2GY7 A;  4IFD K;  3B4S A;  2KZJ A;  2K88 A;  2B87 B;  2WSF J;  1GL2 C;  4GKG A;  2Q6Q A;  2HR3 A;  1BGY D;  3UIA A;  2D2C C;  1KB9 D;  1SQB J;  2Q9I A;  3L72 J;  1LJ2 A;  3A0H H;  1VDF A;  3AEG C;  1DD4 A;  3M9B A;  4IFM A;  3TGU J;  2YIU C;  2FXM A;  1ZOY C;  3L72 D;  3L75 D;  3MUD C;  4W80 A;  3TSI A;  1AJY A;  2NRG A;  1NTZ E;  3OAK A;  4K35 A;  4MN4 C;  5C39 A;  4NPF X;  3H25 A;  2IFM A;  5AVT B;  4WB4 A;  2NPS D;  2AEM A;  5APX A;  2O1J A;  3H1H J;  1L0N E;  2D2C D;  1HUC A;  1KOR A;  4PJ0 E;  2H43 C;  1JY3 N;  2ZXX A;  1OZH A;  3BCC J;  1BDC A;  5AVR B;  3M91 A;  1TU3 F;  3H1H G;  3MTU E;  1Q90 D;  5APU A;  2JKV A;  1Q2N A;  2BEZ F;  1NU1 K;  4NYT A;  3GG2 A;  3LW5 H;  3Q1M A;  3TYY A;  2CK3 H;  1Q81 Q;  3KYQ A;  5E79 H;  4JBZ A;  1N73 C;  1K8A Q;  2JWD A;  2N9B A;  4AYC A;  1P84 H;  4OGQ D;  3KZI E;  1R8E A;  1LTG C;  3H32 C;  2ZT9 C;  1AA0 A;  3H1L E;  3FXE A;  4M7F A;  4QMA A;  1CI6 B;  1P84 I;  3Q5P A;  1LTI C;  1LP1 A;  3W68 A;  4XFJ A;  2HPC B;  1LT1 A;  1PPJ D;  1JCD A;  2QEX P;  4BRY B;  3V2R A;  2YO3 A;  3L70 G;  5CJ0 A;  1IFN A;  2Z4E A;  3CME P;  3M9Q A;  4Z1M H;  2KIK A;  1VQ9 P;  2ZT9 D;  4EYY Q;  1ZRT E;  2E76 B;  1NTZ J;  3S9O A;  3HRN A;  3H1K E;  1ZLL A;  5GTH E;  3NFQ A;  3BVH C;  3CWB D;  1N7L A;  3AE4 C;  4GOD A;  1PIX A;  1KIL B;  1SQV E;  1YJW P;  4H44 B;  1L0N J;  1CSB A;  1FDI A;  1URQ A;  1FDM A;  1SP4 A;  1BDD A;  1YQ4 C;  1OW8 A;  3BCC E;  1U57 A;  2YKQ A;  5AW2 B;  1U7J A;  1N73 A;  4H44 D;  3G4S P;  1PPJ G;  3PP5 A;  1AQ5 A;  1FZB A;  3H1I D;  5AW0 B;  3L74 G;  3F89 A;  1G2C B;  2IZ1 A;  2J0G A;  3H1J G;  1H0T A;  1BCC J;  3Q2Y A;  2P1J A;  3L36 A;  3VP9 A;  1JMB A;  3GF3 A;  1BCC G;  2HOD B;  4HKZ H;  2ZVN B;  2Q3I A;  2IDB A;  3AE3 C;  4C7R A;  4EDF A;  4L76 A;  1FE6 A;  2N1T C;  2O3J A;  1JTH A;  2YO2 A;  5AW8 B;  3W67 A;  1PP9 E;  1SQQ G;  1KIL A;  1SS1 A;  1DH3 A;  3H32 B;  1FU1 A;  1QX8 A;  5AW6 B;  3C1L A;  1ZR4 A;  1N86 B;  2GA1 A;  1GL2 B;  4KJM A;  2NZ2 A;  3O6Q A;  1FZG C;  4JQ0 D;  3TGU G;  1NHL A;  2M8R A;  2W6B A;  4PD4 D;  3B5N C;  1KYO H;  1NTK D;  3M0D A;  4HB1 A;  2WSS H;  1T2K D;  1VQO P;  1L0N K;  1QLE D;  3A0B E;  3GHG C;  4HH2 A;  2HLO A;  3MUD A;  3SFE C;  3B8E B;  3PLN A;  1RQU A;  2IBZ D;  1N86 A;  4CPG A;  5CCH C;  5EFW B;  2OYH A;  4PV1 D;  1J1E C;  2W90 A;  2B89 A;  2OAR A;  4W7Y A;  1RF0 C;  2J0Y A;  2QRX A;  2WSC J;  1KFN A;  3MGN A;  1AVY A;  2WZ7 A;  3BVH B;  2QM8 A;  3TNU B;  1LT9 B;  1KYO E;  1PPJ E;  3E1R A;  4Y99 C;  1LTJ C;  1EZV E;  3V4Q A;  2XNX C;  1PGP A;  2FFD B;  2CPS A;  1YTZ I;  2XND H;  2FXP A;  3RL0 D;  5KLV J;  2B87 A;  2FIB A;  3HE5 B;  1IZN B;  2LR2 A;  4XE5 B;  1NO4 A;  1VF5 B;  1X8Y A;  4YTP C;  1S5L H;  2R44 A;  2BEQ D;  1PFI A;  3CI9 A;  5APS A;  3R2P A;  1LTT C;  2BCC J;  3MZW B;  3VOP A;  2M5A A;  3CCQ P;  1LGH B;  1T3J A;  1KQG B;  3M0A A;  1S4X A;  3NXS A;  1SQX D;  1W2B O;  1MFT A;  2YKO A;  1GD2 E;  1SFC B;  5KKZ B;  1YBK A;  3VMY A;  1CZQ A;  2R3C A;  3CC4 P;  3I55 P;  1JOC A;  4U3F E;  3FX0 A;  4U3F D;  2E75 B;  3TDK A;  1PP9 G;  3LW5 J;  2XKM A;  4EIJ A;  1DEB A;  3PRJ A;  1FZE A;  1YJ9 P;  1NTM D;  1SQP E;  2Y0D A;  4JYB A;  3QWO C;  4WBA A;  1L0L J;  4DCK A;  2Z4E B;  3HD7 C;  3ABV C;  4LGD E;  1HJB A;  3L4F A;  2KOG A;  1ZW0 A;  3TK1 A;  3L73 D;  4NPD A;  3I5C A;  1FZG B;  2WPQ A;  3KQG A;  2ZXE B;  3SWY A;  3EFG A;  1W5C E;  2HG5 D;  1E79 H;  1KYO I;  1SLQ A;  4H13 C;  3F5H A;  1Z56 A;  2Y9Y A;  3IN6 A;  2L5G B;  1PGQ A;  3P8C E;  5AVS B;  3AEC C;  1J1D B;  5APV A;  1Q7Y Q;  2KZI A;  3VMX A;  1OXZ A;  3CWB G;  4U7J A;  1FZE B;  1S5L E;  2AXT H;  1RHZ B;  5AW1 B;  2K37 A;  2KK7 A;  1RH5 B;  3H1K G;  2B9B A;  3CWB J;  5CBO A;  1GW4 A;  1EDJ A;  3OW2 O;  1EC5 A;  1Z3U A;  2AEF A;  1KQL A;  1DEE G;  4EOT A;  2WNP F;  3H1L D;  4KT0 J;  1SQX J;  2G8Y A;  5APT A;  3L70 J;  1NVO A;  2J61 A;  1MFZ A;  2YIU B;  2FKW B;  4YXD C;  1BCC D;  2J5Z A;  3K5B A;  2YMY A;  3KPE A;  2KI7 B;  1HTL C;  4R4M A;  2FXO A;  1X9V A;  2YNY A;  3IF4 A;  1L0L E;  4TT3 H;  2KNC A;  3T97 A;  3H6P A;  1FZG A;  3FWL A;  1VQ5 P;  1RE4 C;  3L72 G;  5BVZ A;  2BCC G;  5KLV D;  2A45 I;  3V2Q A;  3P32 A;  2N1T D;  2P10 A;  4RKU J;  4PJ0 H;  2V7Q H;  2D39 A;  2C9N Y;  2A06 D;  1RF1 A;  3O6Q B;  1IK9 A;  1KIL D;  3VN0 A;  2PP6 A;  4KHX A;  1BE3 G;  5L8R J;  2SPZ A;  1SQB E;  3L72 E;  3H32 A;  5B66 H;  3ZDM A;  3TGU E;  2PAJ A;  2MJZ A;  5E79 E;  3AE8 C;  2JR8 A;  4R9T A;  2KS1 A;  4XA4 A;  3SFD C;  2ZYA A;  1YI2 P;  5M1B A;  1OW6 A;  1KMI Z;  3AEE C;  4M3L A;  2M0B A;  2JJL A;  1S5L X;  3HUS A;  2H8P D;  2HPC A;  1N7S A;  1UIX A;  3V6I A;  2HYN A;  5CHX A;  2J3O A;  4HYT B;  2Z5H A;  1K04 A;  1URQ B;  1EDL A;  1EDK A;  2WQY C;  1VPC A;  1QGK B;  4PD4 I;  3WU2 H;  1E5W A;  3B5N D;  1KZU B;  1XTG B;  1VF5 C;  3H1K D;  2W6A A;  3VP8 A;  1FZC C;  1RQV A;  1FJP A;  4YXW H;  2P58 A;  4ZKU A;  3A7O A;  3CD6 P;  3G71 P;  1NTM K;  1QVG O;  3H1L J;  1RF1 C;  3BCC D;  5CCG C;  3ITK A;  3HE4 A;  4AQR D;  1ZXG A;  2QE7 H;  4UB8 E;  3L70 D;  1IO4 A;  2LXC B;  4H0L B;  2WSE H;  3Q5S A;  2H43 A;  3BAT A;  3CPW O;  4H13 D;  3RK2 C;  3WUV A;  5KTB A;  2D2C B;  2WIT A;  3S1K A;  5KJ7 A;  4C46 A;  4IL6 X;  4JPZ B;  3RK2 B;  3G9R A;  2POH A;  4N3Y B;  4LC1 A;  3MP7 B;  2QJP C;  1ZME C;  2IPP A;  3CX5 I;  4IL6 E;  1BGY E;  3AE7 C;  1JY2 O;  2QJY C;  3NTN A;  2WT7 A;  2W8Z A;  2JWA A;  1SQB D;  3IR9 A;  3H1K J;  3H1J D;  3BRT B;  1FID A;  3VMZ A;  4L73 A;  4GOF A;  1SQX K;  1GL2 A;  4W7Z A;  3D6Y A;  2LKM A;  2BAS A;  1KN7 A;  3Q3D A;  2J3F A;  3EQ2 A;  2RMZ A;  2XV5 A;  3WUT A;  4DOJ A;  2P2U A;  3CCV P;  5GTI H;  3RGU A;  4TLF A;  3RBZ A;  1OWA A;  1GK6 A;  3AE9 C;  5CCH A;  1VQK P;  1N86 C;  2J5U A;  1VQL P;  2OYH B;  4WY4 D;  3JCU E;  2Q7C A;  1VQ6 P;  2KSE A;  4OWF A;  3PTZ A;  1PP9 J;  3C8V A;  2K9J A;  1LP1 B;  1EZV I;  1Q82 Q;  2ZVO B;  5TIS E;  3CXH E;  1K73 Q;  5KLI B;  1KTM A;  1LTS C;  1L0L G;  1YIT P;  3AE2 C;  1NTK G;  1IFJ A;  2FBW C;  1OVU A;  1S72 P;  2WSC H;  4ZMD A;  2J61 B;  2Q9I C;  1MKM A;  1NTK K;  1T2K C;  5AW7 B;  3D71 A;  1BGY J;  1UII A;  1JMM A;  3I56 P;  2UWJ E;  1USE A;  1X79 B;  1SQQ D;  4N78 E;  2PGD A;  2J59 M;  4C7N A;  2R32 A;  1QVF O;  3P8M C;  2Z5I A;  1NTM E;  1FZA A;  1SFC C;  5GTH H;  2OGU A;  4DZO A;  2R3S A;  5TJH A;  5DJU B;  3RL0 B;  1RF0 A;  1HJ0 A;  2E74 C;  1FDO A;  4I7Z B;  5CJ4 A;  1RE4 A;  1RE3 B;  2QG4 A;  2O01 H;  3CCM P;  3FGA D;  2E42 A;  3N7N A;  2WWW A;  2M5A B;  1SQB G;  1Y8A A;  3CCR P;  5DJT B;  4UB6 E;  2JHK F;  2HOD A;  3H1I J;  1NTZ D;  4JF7 A;  2H7H A;  2QVA A;  3C9I A;  4EI2 A;  2IBZ G;  1HWT C;  3IAO A;  2K9J B;  2WSE J;  2QJP B; 
#chains in the Genus database with same CATH homology
 3II6 A;  3TK1 A;  3OJA B;  3I5C A;  1L4A D;  1FZG B;  2WPQ A;  3KQG A;  5AVQ B;  1GL2 C;  2ZXE B;  4GKG A;  3SWY A;  3OA7 A;  3EFG A;  5APW A;  1NKZ B;  2HG5 D;  2R5D A;  2N1T A;  1SLQ A;  3UIA A;  5AW5 B;  2Q9I A;  1Z56 A;  1FOS E;  2L5G B;  3P8C E;  5AVS B;  1VDF A;  1FZA B;  1J1D B;  3M9B A;  3MIW A;  1IFD A;  4IFM A;  5APV A;  3BAS A;  3BRV B;  2FXM A;  3VMX A;  2JHM F;  2J64 A;  2J58 A;  2Z4E C;  1OXZ A;  1FZE B;  4W80 A;  3TSI A;  2HLO C;  2OYI A;  2WTY A;  3CL3 D;  1T3U A;  3SWF A;  3OAK A;  5AW1 B;  2NPS A;  1FIB A;  2IFM A;  1Z3S A;  5AVT B;  4WB4 A;  2H43 B;  2NPS D;  1GW4 A;  5APX A;  2FYZ A;  2JHL F;  1LTB C;  2O1J A;  1Z3U A;  2R5B A;  1HUC A;  1KQL A;  1JO5 A;  2H43 C;  4I1L A;  4EOT A;  1JY3 N;  2WNP F;  1NWQ A;  1SFC D;  2I1J A;  1YYC A;  2GM4 A;  5AVR B;  3M91 A;  2J3G A;  1QL2 A;  2OYI C;  3MTU E;  1URQ C;  5APU A;  3NMD A;  2HLO B;  5APT A;  4OH8 B;  1FZE C;  1GDT A;  1NU1 K;  2JEE A;  3V2N A;  4NYT A;  2J61 A;  1A02 J;  1MFZ A;  1N2D C;  3LW5 H;  1SFC A;  1LTA C;  1IFM A;  2FKW B;  3P8C D;  3TYY A;  2J5Z A;  3KYQ A;  3BVH A;  1L4A C;  1N73 C;  2YMY A;  3KPE A;  1LTJ A;  2N9B A;  1GK4 A;  1HTL C;  4AYC A;  4WY4 C;  1X9V A;  1FZB C;  2YNY A;  1ZR2 A;  1RE3 A;  3T97 A;  1LTG C;  3H32 C;  3H6P A;  4R9J A;  1FZG A;  1RY3 A;  1IJD B;  2GUS A;  1RE4 C;  2XZR A;  4M7F A;  5BVZ A;  2A45 I;  3V2Q A;  3U1A A;  3P32 A;  5AW9 B;  2N1T B;  1CI6 B;  2N1T D;  3RK3 C;  1NH4 A;  2C0W A;  1LTI C;  5AW4 B;  2HPC B;  2D39 A;  2C9N Y;  1RF1 B;  1RF1 A;  3HD7 B;  1L4A A;  1IK9 A;  1KIL D;  3VN0 A;  1JCD A;  2PP6 A;  4KHX A;  3HE4 B;  1MZ9 A;  4EPU A;  3V2R A;  2YO3 A;  5BU8 B;  5CJ0 A;  1IFN A;  2KSJ A;  3H32 A;  2Z4E A;  1GU4 A;  1LWU C;  3RK3 D;  2PAJ A;  3M9Q A;  2J0H A;  5CMZ A;  2MJZ A;  2XNX B;  2VRS A;  3V5B A;  2OYH C;  4R9T A;  4GT1 A;  2W27 A;  4XA4 A;  4Y99 B;  2WPR A;  1FZB B;  3VTP C;  4M3L A;  5AVY B;  3B5N A;  2J60 A;  4WY4 A;  2JJL A;  2IFN A;  3HRN A;  5CCG A;  1CW5 A;  3HUS A;  3E1I B;  2H8P D;  2HPC A;  1ZLL A;  3GHG A;  1N7S A;  3RL0 C;  3NFQ A;  1AFO A;  1FZF C;  3BVH C;  1N7L A;  2HYN A;  5APQ A;  4IFF A;  5CHX A;  2J3O A;  1KIL B;  1N7S C;  1HGZ A;  3VYI A;  1FZF B;  4HYT B;  2Z5H A;  1CSB A;  1JY3 P;  1URQ A;  1URQ D;  1URQ B;  1FDM A;  2OYI B;  1SP4 A;  1SQV K;  1M1J C;  1VPC A;  1QL1 A;  2YKQ A;  5AW2 B;  1NOH A;  3A2A A;  1FOS F;  1N73 A;  2FFD A;  1JY3 O;  4JYC A;  1E5W A;  1W2E A;  3PP5 A;  5BU5 A;  1AQ5 A;  3B5N D;  1FZB A;  4C7N B;  3FIB A;  1KZU B;  1XTG B;  5AW0 B;  2KP8 A;  4I2L C;  1G2C B;  1G2C A;  1LWU B;  2W6A A;  2J0G A;  3VP8 A;  1FBM A;  1FZC C;  5AVU B;  1FJP A;  3GHG B;  1WT6 A;  4ZKU A;  2KLV A;  2KYV A;  2P1J A;  3A7O A;  1MV8 A;  3L36 A;  3VP9 A;  1NTM K;  3LID A;  1DX7 A;  2HOD B;  1RF1 C;  1FIC A;  2IX7 C;  3L37 A;  2Q3I A;  5CCG C;  2GUV A;  3HE4 A;  4AQR D;  4C7R A;  2N1T C;  3RK3 B;  3LIE A;  1JTH A;  2YO2 A;  5AW8 B;  1J1D C;  2XNX A;  2HFE D;  2FFD C;  1IO4 A;  2WSE H;  1KIL A;  3WMM 0;  2H43 A;  3BAT A;  1DH3 A;  1GZL A;  3RK2 C;  5KTB A;  1FZD A;  2WIT A;  2Q5U A;  3H32 B;  1H8A A;  1FU1 A;  5KJ7 A;  1H88 A;  5AW6 B;  1CI6 A;  4C46 A;  2XDJ A;  1ZR4 A;  3CLQ A;  4WY4 B;  1N86 B;  1JY2 N;  1LWU A;  3RK2 B;  1LT9 C;  2POH A;  4N3Y B;  1GL2 B;  1L4A B;  1FZG C;  2WPS A;  3M06 A;  4LC1 A;  5KLV K;  5CCH D;  1NHL A;  2IPP A;  2JHI F;  1GU5 A;  3A3Y B;  2M8R A;  2HOD C;  1JY2 O;  2W6B A;  1GL2 D;  3B5N C;  1WRG A;  3RK2 D;  3NTN A;  3M0D A;  1T2K D;  2J3U A;  3U1C A;  1S9K E;  2WT7 A;  1L0N K;  5AW3 B;  3GHG C;  1KFM A;  1M7L A;  1G1J A;  2CPB A;  3IR9 A;  4HH2 A;  1FZC B;  2HLO A;  2A45 H;  3HD7 D;  3MUD A;  2O1K A;  4ZKP A;  3BRT B;  1FID A;  1LT9 A;  3B8E B;  1HH0 A;  3VMZ A;  3G3Z A;  1N86 A;  1MUU A;  1NTZ K;  2J1G A;  5CCH C;  2E43 A;  2NPS C;  1GW3 A;  1SQX K;  1GL2 A;  4W7Z A;  2OYH A;  1A02 F;  2LKM A;  1SVF A;  2BAS A;  4JZC A;  2ZFC A;  1SQP K;  1J1E C;  3HE5 A;  1H89 A;  2KB7 P;  2J3F A;  4JYO X;  5APY A;  3IFM A;  3EQ2 A;  2OAR A;  3HD7 A;  4W7Y A;  1RF0 C;  1J2J B;  4B86 A;  2XV5 A;  1SQB K;  4DOJ A;  3HTK B;  3MGN A;  2J0Y A;  1KFN A;  1KIL C;  1YTZ T;  2P2U A;  2M3B A;  4ZFG A;  5AVZ B;  2WZ7 A;  1FZF A;  3BVH B;  3V2P A;  1JY2 P;  1FZA C;  1OWA A;  3E1I C;  1GK6 A;  2QM8 A;  1XTC C;  3TNU B;  1JNM A;  1LT9 B;  5CCH A;  1N86 C;  3L35 A;  2JHH C;  1M1J A;  4Y99 C;  2QM7 A;  1LTJ C;  2C9L Y;  2OYH B;  2A45 G;  3V4Q A;  4WY4 D;  2XNX C;  2Q7C A;  2J2P A;  2FFD B;  1NKN A;  3KDP B;  4AUW A;  2CPS A;  3N4X A;  1ZV8 A;  2WSF H;  1YTZ I;  1FAV A;  5KJ7 C;  1JC9 A;  3O8Z A;  1HVV A;  4N78 D;  1T8Z A;  5AVV B;  4GIF A;  1SQQ K;  3RL0 D;  2P7J A;  2WT7 B;  2FIB A;  3HE5 B;  1LTS C;  1HBW A;  4XE5 B;  1NO4 A;  1IFJ A;  2WSC H;  3P7K A;  2J61 B;  2Q9I C;  3A5T A;  3HTK A;  5KJ7 D;  1X8Y A;  1NTK K;  1T2K C;  5AW7 B;  1JTH B;  1PFI A;  1RE4 B;  2YKP A;  3CI9 A;  1S9K D;  5APS A;  1JMM A;  3U59 A;  3V4W A;  1LTJ B;  4M7H A;  3HUS C;  3R2P A;  1RE3 C;  1LTT C;  3VOP A;  2I1K A;  2FYU K;  1NAF A;  1LGH B;  1X79 B;  4N78 E;  2J59 M;  1IC2 A;  1T3J A;  2R32 A;  4C7N A;  4N6J A;  1M1J B;  3MD0 A;  1N73 B;  3M0A A;  3NXS A;  3P8M C;  2Z5I A;  5CCG D;  1FZA A;  1SFC C;  2J3F D;  4DZO A;  1N7S B;  1IFI A;  2YKO A;  1GD2 E;  5AVW B;  1JCC A;  1SFC B;  3RL0 B;  1RF0 A;  1RF0 B;  3VMY A;  1CZQ A;  2R3C A;  1JOC A;  1J1E B;  1ZN5 A;  3M9H A;  1G1I A;  1N7S D;  5CJ4 A;  1RE4 A;  1RE3 B;  3TNU A;  1GTW A;  3E1I A;  3HUS B;  2NPS B;  2O01 H;  2E42 A;  1EQ7 A;  1FZC A;  3N7N A;  1L0L K;  2WWW A;  2P67 A;  2XKM A;  1HGV A;  4EIJ A;  1DEB A;  2Q9I B;  1FZE A;  4O9B A;  1JUN A;  2JHK F;  2HOD A;  4LLH A;  4JF7 A;  2H7H A;  4JYB A;  4RES B;  3C9I A;  4I6M C;  3M0D C;  4WBA A;  1HWT C;  5AVX B;  2C0X A;  3B5N B;  2XU6 A;  1FJK A;  2GY7 A;  2Z4E B;  3HD7 C;  2HPC C;  4LGD E;  1HJB A;  3L4F A;  4IFD K;  2KOG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...