2OYHB

Crystal structure of fragment d of gammad298,301a fibrinogen with the peptide ligand gly-his-arg-pro-amide
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
298
structure length
298
Chain Sequence
IPTNLRVLRSILENLRSKIQKLESDVSAQMEYCRTPCTVSCNIPVVSGKECEEIIRKGGETSEMYLIQPDSSVKPYRVYCDMNTENGGWTVIQNRQDGSVDFGRKWDPYKQGFGNVATNTDGKNYCGLPGEYWLGNDKISQLTRMGPTELLIEMEDWKGDKVKAHYGGFTVQNEANKYQISVNKYRGTAGNALMDGASQLMGENRTMTIHNGMFFSTYDRDNDGWLTSDPRKQCSKEDGGGWWYNRCHAANPNGRYYWGGQYTWDMAKHGTDDGVVWMNWKGSWYSMRKMSMKIRPFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fibrinogen alpha chain
publication title Probing the gamma2 Calcium-Binding Site: Studies with gammaD298,301A Fibrinogen Reveal Changes in the gamma294-301 Loop that Alter the Integrity of the "a" Polymerization Site.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Blood clotting
total genus 93
structure length 298
sequence length 298
chains with identical sequence E
ec nomenclature
pdb deposition date 2007-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00147 Fibrinogen_C Fibrinogen beta and gamma chains, C-terminal globular domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2oyhB01
3.90.215.10 Alpha Beta Alpha-Beta Complex Gamma Fibrinogen; Chain A, domain 1 Gamma Fibrinogen, chain A, domain 1 2oyhB02
4.10.530.10 Few Secondary Structures Irregular Gamma-fibrinogen Carboxyl Terminal Fragment; domain 2 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2 2oyhB03
2Z4EB 4EPUA 1M1JB 2HODA 1N73A 4JYOX 1FZBA 3HUSC 2HPCB 2HLOC 1N86C 3E1IB 1JY3P 2A45H 3BVHC 1LT9B 1FZDA 2J3GA 1JY2O 1FZFB 2H43C 2GY7A 1FZAC 2J2PA 1LT9A 2J0YA 2HODB 1N73B 4M7FA 2J64A 2J0HA 1FZBB 2J5ZA 3GHGC 2Q9IC 3HUSA 2HLOA 1LTJC 1N86A 3BVHA 3H32C 2JHHC 1JY2N 1FZEC 2JHLF 1JY3O 1RE3C 1FICA 3FIBA 2H43A 1RE4C 1JC9A 1FZAA 2JHIF 2OYHC 1FZGC 1LWUC 1FZCC 2XNXC 2J3UA 3HUSB 1RF1A 2HLOB 3GHGA 1W2EA 2WNPF 2Q9IA 1N86B 4ZFGA 1RF1C 2J0GA 4NYTA 2OYIA 3BVHB 2A45I 2OYIC 1LTJA 4R9TA 2J1GA 1Z3UA 1JY2P 1M1JC 3H32A 2H43B 2J3FD 2J60A 1FZAB 1FZEA 1RF0C 1FZGB 1RE3A 2HPCC 1RE4A 4JZCA 3E1IC 1T3UA 1FZGA 2OYHA 1RF1B 3GHGB 2Q9IB 1LWUA 1FZCA 1FZFC 2XNXA 1FIBA 2OYIB 1LTJB 2A45G 2FFDC 2JHMF 3H32B 1RF0B 2JHKF 2HODC 1N73C 1FZEB 2Z4EA 1FZBC 1M1JA 1RE3B 2Z4EC 1RE4B 2D39A 1RF0A 1Z3SA 2HPCA 1JY3N 2OYHB 1FIDA 3E1IA 1LWUB 1FZCB 2FIBA 2XNXB 2J61B 2FFDB 2J3FA 1LT9C 2J3OA 1FZFA 4M7HA 4R9JA 2J61A 2FFDA
chains in the Genus database with same CATH superfamily
1SQVE 4JQ0D 1N73A 2P58A 2QE7H 2HPCB 1N86C 1BCCE 1HVVA 3JSVC 2R5DA 1LT9A 1T2KD 1YJ9P 2J0YA 4I6MC 2R44A 1S1CX 1EDKA 1EC5A 3GG2A 2QJKB 2J58A 4OWFA 1SQPG 3BRVB 2DW3A 1FDMA 1RQUA 1W2EA 3AEGC 5KLVD 1R5LA 1QLED 2A45I 3L70G 1JY2P 3GF3A 1RHZB 2Y0DA 1AQTA 1GL2B 3L70D 3LIDA 5AVTB 3ZDMA 1L4AA 1N7SA 3BRTB 3B5ND 1PP9J 2Z4EC 1XTGB 2D39A 4K3AA 2AXCA 5KKZB 1M7LA 2AEMA 1VL2A 2ZT9C 1HJ0A 1SQVJ 1SQQG 1OZHA 1KQLA 2LXCB 3H1JG 3FWNA 1BCCJ 4ZMDA 4UB8H 3V6IA 2YIUC 1PZQA 3AEDC 1KC8Q 3CWBD 2OGUA 3O6QA 2J5ZA 4IOIH 3CCVP 2WSSH 3AE1C 1KYOD 3BVHA 4OGQD 4H13D 4WY4D 1Z56A 1DEEG 5KTBA 3IN6A 3FIBA 1SFCC 2JHIF 2OTKE 4W7YA 1SQXG 2G3AA 2J3UA 2ZXXA 2WNPF 2KXPB 2WWWA 1SQPE 3H32A 4N3YB 1UIIA 3F5HA 2WSFH 4NPFX 1JCCA 1OMIA 4I7ZB 2IFMA 2OYIB 3H6PA 1KQGB 2BEZF 1S4XA 2YXQB 4HH2A 3H1KJ 1KMIZ 3MTUE 1M1JA 3CI9A 3OW2O 2YO3A 1KYOH 2IYOA 1W5CE 2FXOA 2KI7B 4KT0J 1IK7A 1FZCB 1JO5A 2E5TA 1IK9A 5E79E 2ZVOB 5APXA 3FXDA 3JCUH 1LGHB 3L75J 2NPSA 1VQOP 1GK6A 5AVZB 2D2CD 2E75B 3CC7P 1VPCA 1LJ2A 1L0ND 3V2RA 2I8DA 4L75A 1SQQE 2QSIA 2QJYC 2HODB 2N1TA 3AEBC 1GW3A 1EZVG 3H1JE 4C7RA 4YTPC 1X9VA 3M06A 1YI2P 1KQFB 3I55P 3N4XA 4RESB 3WUTA 2JWDA 2QJPC 3HD7B 1XTCC 1S5LH 4BRYB 1ZW0A 3CCMP 2FYNC 2V7QJ 5CBNA 1WMKA 4H0LB 5CJ0A 3AE5C 3HE5A 3CCQP 1URQB 2M3EA 1GTWA 1U7JA 3CD6P 2K88A 3G4SP 3WMM0 1KB9D 5AW4B 1PPJD 3GMAA 3KZIH 4YPCA 4K35A 1SQXE 1BE3D 3L36A 2XNXA 3Q2YA 3LW5J 3L70J 3P32A 3O8ZA 1FZBC 5APSA 1NTKD 3KYQA 4EYYQ 5TJHA 4Y99C 2Z5IA 1BSNA 3TNUB 1ZRTE 4PD4D 3H1IG 4AQRD 2FIBA 2FFDB 3V2NA 1KILE 1L0LK 3CXHH 4L74A 1DD4A 4I2LC 1FJKA 4N6JA 1OVRA 4OVNF 1Y8AA 2ZAEB 3RBXA 5APYA 4U3FD 3CC2P 1KB9H 2IBZE 1P84E 2W27A 1GW4A 2GY7A 4HB1A 4JYCA 2QEXP 3AE2C 2JWAA 3TDKA 2E76D 1RQVA 2W83C 2E74D 3H1JJ 2B88A 1KFMA 3RL0B 1X8YA 1LTJC 1SS1A 1LT1A 5AW1B 3CCSP 2FYUE 1NU1D 2NZ2A 3VTPC 1FICA 5KLVK 1GU4A 2W6AA 3M0DC 2BCCD 3HE4B 1CW5A 3C8VA 1NKZB 1A02F 1EZVE 2Q9IA 1G1IA 3MZWB 2J5UA 3G9RA 2GM4A 4ZKUA 1RF0C 1CSBA 3AE6C 1MFZA 1SQXJ 1LTTC 2YNYA 2JHKF 3M0AA 3RK2C 1IFJA 2R5BA 1YJNP 1YJWP 3P8CD 1FIDA 1LWUB 2IDBA 1H89A 1ZMEC 1FZFA 2FFDA 2R32A 2Z4EB 1Y9BA 3AEEC 3I5CA 2Y0CA 5AW0B 3A0HH 2A45H 3CCUP 1GL2D 3H1IE 2OQQA 1JY2O 2CPSA 2BEQD 4GIFA 1N73B 2O1KA 1L0NJ 1JCDA 1N86A 1ZR4A 2GUSA 1PGJA 3V2PA 1RE4C 1JC9A 5KLIC 1VQMP 5AVVB 2IBZI 2OYHC 1QVFO 1H88A 3CPWO 1D7MA 4NYTA 3CL3D 4RKUJ 3TF5A 2J3FD 2R3CA 3B8EB 3E1IC 2Y9YA 1KV4A 3CXHI 1NTZD 1Q90D 1FIBA 2KB7P 2JHMF 3CCJP 4A7PA 2FXPA 3H1KG 2QA4P 2C9LY 1HBWA 4D6TD 2QIWA 1J1DB 2I1JA 3B5NC 1YTZT 1L4AB 3BATA 2J3OA 1N7SB 3H1LD 2OARA 1PGPA 1EDJA 2AXTE 4LLHA 1S5LX 4N78D 2YMKA 3H1IJ 1BDCA 4DZOA 1OX3A 3L75G 4H44B 3VMAA 1GK4A 2AEJA 2Q6QA 4XFJA 3ITKA 2O3JA 4U3FJ 1OW6A 1UIXA 3CX5E 3G3ZA 1FS0E 3CC4P 3GHGC 5B5EE 1FDOA 4PV1B 2M3BA 1GMJA 5C39A 1L0LD 1NWQA 1M57D 4XA4A 2A06D 2JR8A 1RE3C 5APQA 4JPZB 4R4MA 2PP6A 1X79B 4OGQC 3O6QB 4H13C 2YKQA 4WY4C 1K8AQ 1IO4A 2IZ1A 1RF1A 3AEFC 1Q82Q 3BVHB 2BCCJ 2E75D 3WUVA 2J60A 2WMMA 2KSJA 1FU1A 3Q5RA 1SFCA 2KZJA 2W90A 2PAJA 4L76A 3F89A 5KLVG 1NTKK 5CHXA 3H32B 2WSEJ 2C0XA 2KZIA 1YQ4C 3HD7D 4HYTB 1T6AA 2XKMA 1KILC 3P8MC 4CPGA 4YXWH 2WPSA 3Q5SA 2B89A 1S2EA 3MP7B 1GD2E 4RO0A 2WPQA 4H0LD 2P10A 1G1JA 3TSIA 4EPUA 2NRGA 1M1JB 1URQD 2H88C 2Q5UA 1A02J 1YHQP 5L8RJ 3HUSC 2HLOC 3H1KE 3K5BA 1FZAC 2D2CC 4EOTA 2WVRA 1NAFA 2NPSB 3M91A 2LKMA 1NU1K 4ZNCA 1EQ7A 5KJ7C 1HTLC 3M9QA 3L75E 1SVFA 5CJ4A 2JHLF 3CWBG 4AUWA 1JM0A 2N1TB 4YXDC 1CZQA 1FZGC 3WU2H 3MIWA 1RF1C 3ABVC 3CX5I 1BGYG 5APVA 3CMEP 4KHXA 2WSCH 1J1EC 1BGYD 2KSEA 3A0BH 3HE5B 1SLQA 3AE4C 2Q1KA 2KLUA 1KQSO 3RL0D 1RF0B 1MFTA 1DH3A 1BSHA 5AW5B 3OJAB 5CCGA 5TISH 1NTZJ 1WRGA 3Q3DA 1NAYA 1EXJA 2XNXB 2K1AA 5KLVE 1E79H 1U57A 1FOSF 1JMBA 4D6TJ 2IFNA 4UB8E 2CPBA 1FZBA 4IFMA 3L70E 3QH9A 1GU5A 5B66E 2HFED 2FYZA 1G2CA 2H43C 4JYBA 1SQBK 1HH0A 1YBKA 1JEKA 4ASWA 5CCHD 2KIKA 3MD0A 4WVZA 1DIPA 1RY3A 1L0NG 2E76C 2E43A 2E74C 3HTKA 2KUBA 1FZEC 3N7NA 2RH0A 3L74D 1IFMA 1NGMB 3KDPB 1L0LJ 1EDLA 2KS1A 3L4FA 2IBZD 3M9BA 3VYIA 3L72D 4ZFGA 1HGVA 3VMXA 2H7HA 1S72P 5AW8B 1T8ZA 1LTJA 2VRSA 3PH0A 2Y9ZA 2LXBA 1NTZK 3CWBE 2HPCC 2O01H 1ZLLA 5BU5A 3H25A 2JP3A 3M0DA 3CCLP 3IF4A 3CCRP 2Q9IB 2K9YA 1E5WA 2FYUD 2P1JA 3CXHD 1OIPA 1KYOE 3H1HD 5GTHH 4QMAA 3KXDA 1PPJG 4XE5B 3TYYA 1GDTA 3C9IA 3SSUA 2ZXEB 5CCGC 1RF0A 3L71G 1BE3G 2LR2A 5H2FH 5KLVJ 3CCEP 3BCCD 5AVXB 1GZLA 3L71D 4R9JA 1P84H 1NTKG 1H8AA 4R4LA 1K05A 2B9BA 2IPPA 1NTMD 4HJGH 3MGNA 5BU8B 4C7NA 3L73D 1QL1A 3L37A 1FZFB 4M3LA 4O9BA 1NJIQ 3KHUA 5APWA 2WSCJ 1GL2C 3MHVA 4M7FA 5AVRB 1OXZA 2FY8A 4U3FG 3II6A 5APTA 1S5LE 1VF5B 3PTZA 1M1KQ 1PIXA 3TGUD 2RKLA 2JHHC 4PJ0H 2SPZA 1L4AD 1R8EA 2KYVA 4TT3H 1N7SD 1LTGC 1OWAA 3VP8A 2WSFJ 3OAKA 2KLVA 2I1KA 1ZN5A 2W6JH 1N86B 3KZIE 2K37A 1L0NE 1IC2A 4TLFA 1FOSE 2YKPA 1NU1G 4WWIA 3CWBJ 4H44D 2WPVB 3TK1A 2BCCG 1RE4A 3FWLA 2L91A 4WBAA 1KZUB 2OYHA 3FXEA 5DJUB 1BGYJ 1FBMA 2A45G 4PV1D 1S3JA 3S4RA 2L5GB 4IL6H 1IFIA 3GF7A 1N2DC 1SQPK 3S1KA 2ITAA 3PHLA 4EDFA 4EI2A 3E1IA 3RK3C 1PGQA 5K5GB 1ZXGA 2N9BA 2ZFCA 5GTIH 4GOEA 1NKNA 2Y0EA 5APUA 1YQ3C 1VQ8P 1KB9E 1PPJE 4JYOX 4W80A 1KILB 1LTAC 1IFDA 1NH4A 3VMYA 1X22A 1BE3E 2XNDH 3B5NA 3V2QA 5DJTB 2WT7A 2IZ0A 4I7ZC 2WPRA 3AECC 5KAIH 4PD4E 3GLMA 3AEAC 3NTNA 1S9KD 1OFCX 3W68A 1WT6A 2ZT9B 4NPDA 1SQQK 4W7ZA 2E5YA 1PP9D 1FZCC 1ZP0C 1KORA 4U3FE 3GHGA 1OW8A 1AQ5A 3L74J 3VP9A 1T2KC 1SQBD 2YIUB 3JC22 1SQVD 4UB6H 1FZGB 1RE3A 3W67A 5AW6B 2ZYGA 2KP8A 3P7KA 4WY4A 2QRXA 1RF1B 1P84I 1BCCD 2NPSD 3RGUA 4OH8B 3AE3C 1IJDB 1NU1E 2HODC 3WUUA 3SFDC 3PLNA 3AE8C 2BCCE 1SFCB 1W2BO 1JY3N 1SP4A 1USEA 1NTZG 2N1TD 2G8YA 2PRRA 3SFEC 5AVSB 3HD7C 1JB0J 2GA1A 3BCCJ 1EZVI 4D6TG 4H0LC 2YKOA 4Z1MH 3L71J 1BE3J 3CX5H 3IFMA 2HYNA 1URQC 5B5EH 2J3GA 2MJZA 2K9JB 1KILA 3H1LG 3IR9A 1IZNB 1NTMJ 2P67A 1NTKJ 3CLQA 3L73J 3A3YB 1LTSC 2PFXA 4ZKPA 3HUSA 2HLOA 1JY3O 1Y47A 1FZAA 3RK2D 2XDJA 1ZOYC 1Q7YQ 1L0LG 2Z5HA 1NHLA 5AVWB 2A06G 2ZVNB 5KJ7A 2B87A 1Z3UA 2KNCA 1K73Q 1HGZA 2FYUK 1R5SA 2QJYB 1FZGA 1OW7A 3LIEA 1NU1J 4MN4C 4JBZA 2K3RA 4L73A 2QJPB 5AW7B 3RL0C 3PP5A 1QL2A 2FYNB 3HRNA 3OA7A 1H0TA 2YO2A 3MUDA 2GUVA 1MV8A 3T97A 1NTMK 2E42A 2QVAA 2FXMA 2O1JA 4BXLA 5KAFE 2QG4A 1NTZE 4GDOA 3UIAA 1VQ5P 1SQPD 1CI6A 2K9JA 3RK3E 1FZBB 4WB4A 3SWKA 4D6TE 3B71A 4Y99B 3NMDA 2ZJSE 4JF7A 5CCHC 1G2CB 4I1LA 1NYHA 3H1LE 1KD1Q 2V4HA 1AFOA 2H43A 1JTHA 4IL6X 5AVQB 1LWUC 4N78E 2W8ZA 3HTKB 2P7JA 1LNQA 5CBOA 2V7QH 1FZEA 2KS1B 1SQBJ 3EFFK 1VQ9P 2XZRA 1L0LE 4ASVA 1FDIA 1LTJB 1K9MQ 5AW2B 2A06E 1VF5D 1N73C 1SQQD 3G71P 4B86A 2OTLP 3FGAD 2HPCA 3H1JD 3LW5H 3R2PA 2M0BA 1LT9C 3D6ZA 2WZ7A 3MUDC 5B66H 2IYPA 3VN0A 5E79H 1LTIC 3RK3B 4HKZH 1JY3P 3B4SA 4U7JA 2RMZA 1NVOA 2XU6A 1LTBC 2J2PA 1VQ7P 3RK2B 2Q3EA 1T3JA 3USSA 1SQXD 4C7NB 3Q5PA 1PFIA 1AVOA 3H1LJ 5CMZA 2JDIH 5AW9B 3L35A 2W6BA 3WU2E 1VQ6P 1J1DC 1GL2A 1X0TA 1ZRTD 2JJLA 1L4AC 1SQVK 2Q3IA 3SWYA 3A0BE 1N7SC 2HG5D 5AW3B 1KILD 2J1GA 3EWKA 2C0WA 5AVUB 3L74G 1NO4A 1OVUA 2IBZG 3R4YA 1M8OB 1T3UA 3L72G 4H44C 3NXSA 1J2JB 2UWJE 5TISE 1VQLP 1AVYA 1P84D 1VQ4P 2AEFA 4Y28J 1PV3A 3PRJA 1AV1A 1FE6A 3D70A 1RE4B 2HR3A 1KFNA 2JO1A 2POHA 3FX0A 4GKGA 4PV1C 4C46A 5KLIB 2ZT9D 1N7LA 1QVGO 2OYHB 2WQYC 2FYUG 2CK3H 2WTYA 3PJSK 1VQNP 2J3FA 3H1HG 3V4QA 5KJ7D 1VQKP 1KTMA 1Q2NA 3U1CA 1BGYE 4DJGA 1N8RQ 1JMMA 2XV5A 1QEXA 1EZVD 3BCCG 3E1IB 4DCKA 3BVHC 2OTJP 1ZV8A 2QJKC 1RH5B 3JCUE 4GT1A 1EXIA 5M1BA 2ZYDA 1NTMG 1K04A 3D6YA 3E1RA 1SQPJ 3L73G 3B5NB 1SFCD 3H32C 3EFGA 3CMAP 2OYOA 2WT7B 3A5TA 1HJBA 1YTZI 2JEEA 2QM8A 1MUUA 2OYIA 3TGUG 1JOCA 4R9TA 1M1JC 3RBZA 1PGOA 2KOGA 4JZCA 5GTHE 3U1AA 4RJTA 3GHGB 3H1ID 2N9YB 1FZCA 5KKZC 3NFQA 1LP1B 5H2FE 5EFWB 2NPSC 1RE3B 2ZYAA 3L74E 3A7OA 3KQGA 4WY4B 3A2AA 4H13B 4OGQB 3V5BA 3L72E 4IFFA 1SQQJ 4IFDK 2N1TC 1QGKB 3D71A 1KN7A 2HODA 3S9OA 4DOJA 1DEBA 3IAOA 1M56D 1FZDA 1PL5A 4PD4H 3CXHE 2FBWC 3H1HE 2IX7C 1AJYA 3HD7A 3VOPA 4BRYA 2J0HA 1YIJP 3V4WA 2C9NY 4PJ0E 1DX7A 3E7KA 1KYOI 3BCCE 1URQA 3I56P 3L71E 4BWNA 1JY2N 2RN0A 3RL0g 1MKMA 1VQPP 1M90Q 2XNXC 1NTME 5CCGD 2O01J 3HUSB 1NTKE 3GW6A 2P2UA 2HLOB 3L73E 2J0GA 2OYIC 2M5AB 2PGDA 1FZAB 2D2CB 3QWOC 1PP9G 1HF9A 2KK7A 2QM7A 1QX8A 4IL6E 2FKWB 3TNUA 2M8RA 3VMZA 1FAVA 1SQBG 3M9HA 1BDDA 2B87B 3TGUE 2KNCB 1SQVG 1FJPA 1JUNA 1USDA 3SWFA 3CX5D 1LP1A 5GTIE 1YITP 1Z3SA 4NPEA 1IFNA 3L72J 1BCCG 2J61B 2E75C 5BVZA 2WSEH 1HUCA 1Q86Q 3G6EP 1AA0A 2YMYA 3KPEA 4GOFA 1J1EB 1ZR2A 3AE7C 1NOHA 2FYUJ 3AE9C 1LT9B 1H0TB 3H1HJ 3EQ2A 2J59M 3T97B 2AXTH 5KAIE 1SQXK 3A0HE 2J64A 3HE4A 3Q1MA 3U59A 2Q9IC 1JNMA 4EIJA 2BASA 1VDFA 1HWTC 1EDIA 3C1LA 1CI6B 1DD3A 2H8PD 2WITA 2Q7CA 1L2PA 2YXRB 4UB6E 1YYCA 3BASA 1Q81Q 3P8CE 3RK3D 2R3SA 5CCHA 1FC2C 1KB9I 2H43B 1JTHB 4LC1A 4KJMA 2MKVA 2M5AA 4LGDE 3H1KD 2JKVA 1LWUA 1FZFC 1S9KE 3TGUJ 1IFPA 2FFDC 2E76B 2E74B 1L0NK 5AVYB 1FZEB 2Z4EA 4AYCA 4PD4I 1PP9E 1OVVA 2O01N 1VF5C 1MZ9A 1U7MA 4GODA 1TU3F 3L75D 4M7HA 1SQBE 5KAFH 2H89C 2J61A 4DT0A
chains in the Genus database with same CATH topology
2R32A 2Z4EB 1H8AA 3VN0A 1N73A 3I5CA 1LTIC 5AW0B 3RK3B 2IPPA 2HPCB 1N86C 1JY3P 2A45H 3MGNA 5BU8B 4C7NA 1GL2D 1QL1A 1JY2O 1HVVA 3L37A 1FZFB 4M3LA 2XU6A 1LTBC 4O9BA 2J2PA 2R5DA 1LT9A 2CPSA 5APWA 1T2KD 1GL2C 2J0YA 4GIFA 1N73B 3RK2B 4M7FA 2O1KA 4I6MC 5AVRB 1OXZA 1T3JA 3II6A 4C7NB 5APTA 1JCDA 1N86A 1ZR4A 1PFIA 2GUSA 2J58A 5CMZA 2JHHC 5AW9B 3L35A 3V2PA 2W6BA 1RE4C 1JC9A 1L4AD 3BRVB 1J1DC 1GL2A 2KYVA 5AVVB 1FDMA 1N7SD 1LTGC 2OYHC 1OWAA 3VP8A 1H88A 3OAKA 2JJLA 2KLVA 2I1KA 1L4AC 1SQVK 1W2EA 1ZN5A 2Q3IA 3SWYA 1N86B 4NYTA 1N7SC 2HG5D 5AW3B 2A45I 1KILD 1IC2A 1FOSE 3CL3D 2YKPA 2J1GA 1JY2P 2C0WA 5AVUB 3TK1A 2J3FD 2R3CA 1NO4A 1GL2B 3B8EB 1RE4A 3E1IC 3LIDA 4WBAA 1T3UA 1KZUB 3NXSA 1J2JB 2OYHA 5AVTB 1FIBA 2KB7P 1L4AA 1FBMA 2A45G 2JHMF 1N7SA 2L5GB 3BRTB 1IFIA 3B5ND 1N2DC 1SQPK 2Z4EC 1RE4B 4C46A 1KFNA 1XTGB 2POHA 4GKGA 2D39A 2C9LY 1HBWA 1J1DB 2I1JA 1N7LA 3B5NC 2OYHB 3E1IA 3RK3C 1YTZT 2WTYA 1M7LA 2J3FA 1L4AB 3BATA 2J3OA 2N9BA 2ZFCA 1N7SB 3V4QA 5KJ7D 1NKNA 3U1CA 5APUA 2OARA 1KQLA 1JMMA 4JYOX 2XV5A 4W80A 4LLHA 1KILB 1LTAC 4N78D 1IFDA 1NH4A 3E1IB 3VMYA 3BVHC 4DZOA 3B5NA 1GK4A 3V2QA 1ZV8A 4GT1A 2WT7A 3G3ZA 2WPRA 2J5ZA 3GHGC 2M3BA 3B5NB 3NTNA 1S9KD 1SFCD 3BVHA 3H32C 1NWQA 3EFGA 4WY4D 4XA4A 1Z56A 1WT6A 2WT7B 3A5TA 5KTBA 1RE3C 5APQA 1HJBA 3FIBA 1SFCC 2PP6A 2JHIF 1X79B 1YTZI 4W7YA 1SQQK 4W7ZA 4WY4C 2YKQA 1IO4A 1FZCC 2J3UA 1RF1A 2JEEA 2QM8A 3GHGA 2WNPF 1MUUA 2OYIA 1AQ5A 3BVHB 3VP9A 1T2KC 1JOCA 4R9TA 2WWWA 1M1JC 3H32A 4N3YB 2J60A 2KOGA 2KSJA 1FU1A 2WSFH 1FZGB 1RE3A 4JZCA 5AW6B 1SFCA 1JCCA 3U1AA 2KP8A 3P7KA 2PAJA 2IFMA 4WY4A 1RF1B 3GHGB 1FZCA 2OYIB 1NTKK 2NPSD 5CHXA 3H6PA 4OH8B 3NFQA 1IJDB 3H32B 4HH2A 2HODC 2NPSC 3MTUE 1M1JA 2C0XA 1RE3B 3CI9A 2YO3A 3A7OA 3KQGA 1SFCB 3HD7D 1JY3N 4HYTB 1SP4A 3A2AA 4WY4B 2XKMA 1KILC 3V5BA 2N1TD 1JO5A 1FZCB 3P8MC 4IFFA 4IFDK 2WPSA 1IK9A 1GD2E 5AVSB 3HD7C 2WPQA 5APXA 2N1TC 1G1JA 3TSIA 4EPUA 1M1JB 1URQD 2Q5UA 2HODA 1A02J 1LGHB 4DOJA 2NPSA 2YKOA 3HUSC 1DEBA 2HLOC 1GK6A 3IFMA 5AVZB 2HYNA 1URQC 1FZDA 2J3GA 1VPCA 2MJZA 1KILA 3IR9A 3V2RA 2IX7C 1FZAC 2P67A 4EOTA 3HD7A 3CLQA 2HODB 2N1TA 3VOPA 1NAFA 2J0HA 1GW3A 2NPSB 3M91A 2LKMA 3V4WA 3A3YB 1LTSC 1NU1K 4C7RA 2C9NY 4ZKPA 3HUSA 1EQ7A 1X9VA 1DX7A 2HLOA 5KJ7C 3M06A 1HTLC 3M9QA 1SVFA 1URQA 3N4XA 1JY2N 5CJ4A 4RESB 2JHLF 1JY3O 3HD7B 1XTCC 4AUWA 1FZAA 2N1TB 1CZQA 1FZGC 3RK2D 2XDJA 2XNXC 5CCGD 3HUSB 5CJ0A 2P2UA 3HE5A 2HLOB 3MIWA 1RF1C 2J0GA 2Z5HA 1URQB 1NHLA 5APVA 5AVWB 2OYIC 1GTWA 5KJ7A 1Z3UA 1HGZA 4KHXA 2WSCH 1FZAB 2FYUK 1J1EC 3WMM0 5AW4B 2QM7A 2FKWB 3TNUA 1FZGA 3HE5B 3L36A 1SLQA 2M8RA 3VMZA 1FAVA 2XNXA 3M9HA 3LIEA 3RL0D 1RF0B 3P32A 1DH3A 5AW5B 1FJPA 1JUNA 3O8ZA 3OJAB 5CCGA 3SWFA 1FZBC 5APSA 3KYQA 5AW7B 3RL0C 4Y99C 2Z5IA 3PP5A 1Z3SA 1WRGA 1IFNA 3TNUB 1QL2A 4AQRD 3HRNA 2FIBA 2XNXB 2J61B 3OA7A 2FFDB 2YO2A 3MUDA 3V2NA 5BVZA 2WSEH 2GUVA 1FOSF 1HUCA 1MV8A 1L0LK 3T97A 1NTMK 2YMYA 4I2LC 2IFNA 2E42A 1FJKA 4N6JA 3KPEA 2CPBA 1J1EB 2FXMA 1FZBA 2O1JA 1ZR2A 4IFMA 1NOHA 5APYA 1LT9B 1GU5A 3EQ2A 2W27A 2HFED 2FYZA 1G2CA 1GW4A 2J59M 2H43C 2GY7A 3UIAA 4JYCA 4JYBA 1SQBK 1SQXK 1CI6A 1HH0A 2J64A 3HE4A 5CCHD 1FZBB 4WB4A 3U59A 2Q9IC 1KFMA 3MD0A 3RL0B 4Y99B 1JNMA 4EIJA 2BASA 3NMDA 1RY3A 1X8YA 1LTJC 1VDFA 4JF7A 5CCHC 2E43A 3HTKA 1G2CB 5AW1B 4I1LA 1HWTC 1FZEC 1CI6B 3VTPC 1AFOA 3N7NA 1FICA 2H43A 1JTHA 5KLVK 2H8PD 2W6AA 1GU4A 1IFMA 2WITA 3HE4B 3M0DC 1CW5A 3KDPB 1NKZB 1A02F 5AVQB 2Q7CA 1LWUC 3L4FA 4N78E 3M9BA 3VYIA 2Q9IA 4ZFGA 1HGVA 1G1IA 1YYCA 3BASA 3VMXA 3HTKB 2P7JA 3P8CE 2H7HA 3RK3D 5AW8B 1T8ZA 1LTJA 5CCHA 2GM4A 4ZKUA 2VRSA 2H43B 1JTHB 4LC1A 1FZEA 1CSBA 1NTZK 1RF0C 1MFZA 2HPCC 2O01H 1ZLLA 4LGDE 5BU5A 3M0DA 1LTTC 2XZRA 2YNYA 2Q9IB 1LWUA 1FZFC 1E5WA 2P1JA 1S9KE 1LTJB 2FFDC 1L0NK 5AW2B 2JHKF 5AVYB 3M0AA 1N73C 3RK2C 1FZEB 1IFJA 2Z4EA 4XE5B 3TYYA 1GDTA 2R5BA 3C9IA 2ZXEB 5CCGC 4AYCA 4B86A 1RF0A 2HPCA 3P8CD 3LW5H 1FIDA 1LWUB 5AVXB 1MZ9A 3R2PA 1GZLA 1H89A 1LT9C 1FZFA 4M7HA 2WZ7A 4R9JA 2J61A 2FFDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z4E B;  4EPU A;  1M1J B;  2HOD A;  1N73 A;  4JYO X;  1FZB A;  3HUS C;  2HPC B;  2HLO C;  1N86 C;  3E1I B;  1JY3 P;  2A45 H;  3BVH C;  1LT9 B;  1FZD A;  2J3G A;  1JY2 O;  1FZF B;  2H43 C;  2GY7 A;  1FZA C;  2J2P A;  1LT9 A;  2J0Y A;  2HOD B;  1N73 B;  4M7F A;  2J64 A;  2J0H A;  1FZB B;  2J5Z A;  3GHG C;  2Q9I C;  3HUS A;  2HLO A;  1LTJ C;  1N86 A;  3BVH A;  3H32 C;  2JHH C;  1JY2 N;  1FZE C;  2JHL F;  1JY3 O;  1RE3 C;  1FIC A;  3FIB A;  2H43 A;  1RE4 C;  1JC9 A;  1FZA A;  2JHI F;  2OYH C;  1FZG C;  1LWU C;  1FZC C;  2XNX C;  2J3U A;  3HUS B;  1RF1 A;  2HLO B;  3GHG A;  1W2E A;  2WNP F;  2Q9I A;  1N86 B;  4ZFG A;  1RF1 C;  2J0G A;  4NYT A;  2OYI A;  3BVH B;  2A45 I;  2OYI C;  1LTJ A;  4R9T A;  2J1G A;  1Z3U A;  1JY2 P;  1M1J C;  3H32 A;  2H43 B;  2J3F D;  2J60 A;  1FZA B;  1FZE A;  1RF0 C;  1FZG B;  1RE3 A;  2HPC C;  1RE4 A;  4JZC A;  3E1I C;  1T3U A;  1FZG A;  2OYH A;  1RF1 B;  3GHG B;  2Q9I B;  1LWU A;  1FZC A;  1FZF C;  2XNX A;  1FIB A;  2OYI B;  1LTJ B;  2A45 G;  2FFD C;  2JHM F;  3H32 B;  1RF0 B;  2JHK F;  2HOD C;  1N73 C;  1FZE B;  2Z4E A;  1FZB C;  1M1J A;  1RE3 B;  2Z4E C;  1RE4 B;  2D39 A;  1RF0 A;  1Z3S A;  2HPC A;  1JY3 N;  2OYH B;  1FID A;  3E1I A;  1LWU B;  1FZC B;  2FIB A;  2XNX B;  2J61 B;  2FFD B;  2J3F A;  1LT9 C;  2J3O A;  1FZF A;  4M7H A;  4R9J A;  2J61 A;  2FFD A; 
#chains in the Genus database with same CATH topology
 1SQV E;  4JQ0 D;  1N73 A;  2P58 A;  2QE7 H;  2HPC B;  1N86 C;  1BCC E;  1HVV A;  3JSV C;  2R5D A;  1LT9 A;  1T2K D;  1YJ9 P;  2J0Y A;  4I6M C;  2R44 A;  1S1C X;  1EDK A;  1EC5 A;  3GG2 A;  2QJK B;  2J58 A;  4OWF A;  1SQP G;  3BRV B;  2DW3 A;  1FDM A;  1RQU A;  1W2E A;  3AEG C;  5KLV D;  1R5L A;  1QLE D;  2A45 I;  3L70 G;  1JY2 P;  3GF3 A;  1RHZ B;  2Y0D A;  1AQT A;  1GL2 B;  3L70 D;  3LID A;  5AVT B;  3ZDM A;  1L4A A;  1N7S A;  3BRT B;  3B5N D;  1PP9 J;  2Z4E C;  1XTG B;  2D39 A;  4K3A A;  2AXC A;  5KKZ B;  1M7L A;  2AEM A;  1VL2 A;  2ZT9 C;  1HJ0 A;  1SQV J;  1SQQ G;  1OZH A;  1KQL A;  2LXC B;  3H1J G;  3FWN A;  1BCC J;  4ZMD A;  4UB8 H;  3V6I A;  2YIU C;  1PZQ A;  3AED C;  1KC8 Q;  3CWB D;  2OGU A;  3O6Q A;  2J5Z A;  4IOI H;  3CCV P;  2WSS H;  3AE1 C;  1KYO D;  3BVH A;  4OGQ D;  4H13 D;  4WY4 D;  1Z56 A;  1DEE G;  5KTB A;  3IN6 A;  3FIB A;  1SFC C;  2JHI F;  2OTK E;  4W7Y A;  1SQX G;  2G3A A;  2J3U A;  2ZXX A;  2WNP F;  2KXP B;  2WWW A;  1SQP E;  3H32 A;  4N3Y B;  1UII A;  3F5H A;  2WSF H;  4NPF X;  1JCC A;  1OMI A;  4I7Z B;  2IFM A;  2OYI B;  3H6P A;  1KQG B;  2BEZ F;  1S4X A;  2YXQ B;  4HH2 A;  3H1K J;  1KMI Z;  3MTU E;  1M1J A;  3CI9 A;  3OW2 O;  2YO3 A;  1KYO H;  2IYO A;  1W5C E;  2FXO A;  2KI7 B;  4KT0 J;  1IK7 A;  1FZC B;  1JO5 A;  2E5T A;  1IK9 A;  5E79 E;  2ZVO B;  5APX A;  3FXD A;  3JCU H;  1LGH B;  3L75 J;  2NPS A;  1VQO P;  1GK6 A;  5AVZ B;  2D2C D;  2E75 B;  3CC7 P;  1VPC A;  1LJ2 A;  1L0N D;  3V2R A;  2I8D A;  4L75 A;  1SQQ E;  2QSI A;  2QJY C;  2HOD B;  2N1T A;  3AEB C;  1GW3 A;  1EZV G;  3H1J E;  4C7R A;  4YTP C;  1X9V A;  3M06 A;  1YI2 P;  1KQF B;  3I55 P;  3N4X A;  4RES B;  3WUT A;  2JWD A;  2QJP C;  3HD7 B;  1XTC C;  1S5L H;  4BRY B;  1ZW0 A;  3CCM P;  2FYN C;  2V7Q J;  5CBN A;  1WMK A;  4H0L B;  5CJ0 A;  3AE5 C;  3HE5 A;  3CCQ P;  1URQ B;  2M3E A;  1GTW A;  1U7J A;  3CD6 P;  2K88 A;  3G4S P;  3WMM 0;  1KB9 D;  5AW4 B;  1PPJ D;  3GMA A;  3KZI H;  4YPC A;  4K35 A;  1SQX E;  1BE3 D;  3L36 A;  2XNX A;  3Q2Y A;  3LW5 J;  3L70 J;  3P32 A;  3O8Z A;  1FZB C;  5APS A;  1NTK D;  3KYQ A;  4EYY Q;  5TJH A;  4Y99 C;  2Z5I A;  1BSN A;  3TNU B;  1ZRT E;  4PD4 D;  3H1I G;  4AQR D;  2FIB A;  2FFD B;  3V2N A;  1KIL E;  1L0L K;  3CXH H;  4L74 A;  1DD4 A;  4I2L C;  1FJK A;  4N6J A;  1OVR A;  4OVN F;  1Y8A A;  2ZAE B;  3RBX A;  5APY A;  4U3F D;  3CC2 P;  1KB9 H;  2IBZ E;  1P84 E;  2W27 A;  1GW4 A;  2GY7 A;  4HB1 A;  4JYC A;  2QEX P;  3AE2 C;  2JWA A;  3TDK A;  2E76 D;  1RQV A;  2W83 C;  2E74 D;  3H1J J;  2B88 A;  1KFM A;  3RL0 B;  1X8Y A;  1LTJ C;  1SS1 A;  1LT1 A;  5AW1 B;  3CCS P;  2FYU E;  1NU1 D;  2NZ2 A;  3VTP C;  1FIC A;  5KLV K;  1GU4 A;  2W6A A;  3M0D C;  2BCC D;  3HE4 B;  1CW5 A;  3C8V A;  1NKZ B;  1A02 F;  1EZV E;  2Q9I A;  1G1I A;  3MZW B;  2J5U A;  3G9R A;  2GM4 A;  4ZKU A;  1RF0 C;  1CSB A;  3AE6 C;  1MFZ A;  1SQX J;  1LTT C;  2YNY A;  2JHK F;  3M0A A;  3RK2 C;  1IFJ A;  2R5B A;  1YJN P;  1YJW P;  3P8C D;  1FID A;  1LWU B;  2IDB A;  1H89 A;  1ZME C;  1FZF A;  2FFD A;  2R32 A;  2Z4E B;  1Y9B A;  3AEE C;  3I5C A;  2Y0C A;  5AW0 B;  3A0H H;  2A45 H;  3CCU P;  1GL2 D;  3H1I E;  2OQQ A;  1JY2 O;  2CPS A;  2BEQ D;  4GIF A;  1N73 B;  2O1K A;  1L0N J;  1JCD A;  1N86 A;  1ZR4 A;  2GUS A;  1PGJ A;  3V2P A;  1RE4 C;  1JC9 A;  5KLI C;  1VQM P;  5AVV B;  2IBZ I;  2OYH C;  1QVF O;  1H88 A;  3CPW O;  1D7M A;  4NYT A;  3CL3 D;  4RKU J;  3TF5 A;  2J3F D;  2R3C A;  3B8E B;  3E1I C;  2Y9Y A;  1KV4 A;  3CXH I;  1NTZ D;  1Q90 D;  1FIB A;  2KB7 P;  2JHM F;  3CCJ P;  4A7P A;  2FXP A;  3H1K G;  2QA4 P;  2C9L Y;  1HBW A;  4D6T D;  2QIW A;  1J1D B;  2I1J A;  3B5N C;  1YTZ T;  1L4A B;  3BAT A;  2J3O A;  1N7S B;  3H1L D;  2OAR A;  1PGP A;  1EDJ A;  2AXT E;  4LLH A;  1S5L X;  4N78 D;  2YMK A;  3H1I J;  1BDC A;  4DZO A;  1OX3 A;  3L75 G;  4H44 B;  3VMA A;  1GK4 A;  2AEJ A;  2Q6Q A;  4XFJ A;  3ITK A;  2O3J A;  4U3F J;  1OW6 A;  1UIX A;  3CX5 E;  3G3Z A;  1FS0 E;  3CC4 P;  3GHG C;  5B5E E;  1FDO A;  4PV1 B;  2M3B A;  1GMJ A;  5C39 A;  1L0L D;  1NWQ A;  1M57 D;  4XA4 A;  2A06 D;  2JR8 A;  1RE3 C;  5APQ A;  4JPZ B;  4R4M A;  2PP6 A;  1X79 B;  4OGQ C;  3O6Q B;  4H13 C;  2YKQ A;  4WY4 C;  1K8A Q;  1IO4 A;  2IZ1 A;  1RF1 A;  3AEF C;  1Q82 Q;  3BVH B;  2BCC J;  2E75 D;  3WUV A;  2J60 A;  2WMM A;  2KSJ A;  1FU1 A;  3Q5R A;  1SFC A;  2KZJ A;  2W90 A;  2PAJ A;  4L76 A;  3F89 A;  5KLV G;  1NTK K;  5CHX A;  3H32 B;  2WSE J;  2C0X A;  2KZI A;  1YQ4 C;  3HD7 D;  4HYT B;  1T6A A;  2XKM A;  1KIL C;  3P8M C;  4CPG A;  4YXW H;  2WPS A;  3Q5S A;  2B89 A;  1S2E A;  3MP7 B;  1GD2 E;  4RO0 A;  2WPQ A;  4H0L D;  2P10 A;  1G1J A;  3TSI A;  4EPU A;  2NRG A;  1M1J B;  1URQ D;  2H88 C;  2Q5U A;  1A02 J;  1YHQ P;  5L8R J;  3HUS C;  2HLO C;  3H1K E;  3K5B A;  1FZA C;  2D2C C;  4EOT A;  2WVR A;  1NAF A;  2NPS B;  3M91 A;  2LKM A;  1NU1 K;  4ZNC A;  1EQ7 A;  5KJ7 C;  1HTL C;  3M9Q A;  3L75 E;  1SVF A;  5CJ4 A;  2JHL F;  3CWB G;  4AUW A;  1JM0 A;  2N1T B;  4YXD C;  1CZQ A;  1FZG C;  3WU2 H;  3MIW A;  1RF1 C;  3ABV C;  3CX5 I;  1BGY G;  5APV A;  3CME P;  4KHX A;  2WSC H;  1J1E C;  1BGY D;  2KSE A;  3A0B H;  3HE5 B;  1SLQ A;  3AE4 C;  2Q1K A;  2KLU A;  1KQS O;  3RL0 D;  1RF0 B;  1MFT A;  1DH3 A;  1BSH A;  5AW5 B;  3OJA B;  5CCG A;  5TIS H;  1NTZ J;  1WRG A;  3Q3D A;  1NAY A;  1EXJ A;  2XNX B;  2K1A A;  5KLV E;  1E79 H;  1U57 A;  1FOS F;  1JMB A;  4D6T J;  2IFN A;  4UB8 E;  2CPB A;  1FZB A;  4IFM A;  3L70 E;  3QH9 A;  1GU5 A;  5B66 E;  2HFE D;  2FYZ A;  1G2C A;  2H43 C;  4JYB A;  1SQB K;  1HH0 A;  1YBK A;  1JEK A;  4ASW A;  5CCH D;  2KIK A;  3MD0 A;  4WVZ A;  1DIP A;  1RY3 A;  1L0N G;  2E76 C;  2E43 A;  2E74 C;  3HTK A;  2KUB A;  1FZE C;  3N7N A;  2RH0 A;  3L74 D;  1IFM A;  1NGM B;  3KDP B;  1L0L J;  1EDL A;  2KS1 A;  3L4F A;  2IBZ D;  3M9B A;  3VYI A;  3L72 D;  4ZFG A;  1HGV A;  3VMX A;  2H7H A;  1S72 P;  5AW8 B;  1T8Z A;  1LTJ A;  2VRS A;  3PH0 A;  2Y9Z A;  2LXB A;  1NTZ K;  3CWB E;  2HPC C;  2O01 H;  1ZLL A;  5BU5 A;  3H25 A;  2JP3 A;  3M0D A;  3CCL P;  3IF4 A;  3CCR P;  2Q9I B;  2K9Y A;  1E5W A;  2FYU D;  2P1J A;  3CXH D;  1OIP A;  1KYO E;  3H1H D;  5GTH H;  4QMA A;  3KXD A;  1PPJ G;  4XE5 B;  3TYY A;  1GDT A;  3C9I A;  3SSU A;  2ZXE B;  5CCG C;  1RF0 A;  3L71 G;  1BE3 G;  2LR2 A;  5H2F H;  5KLV J;  3CCE P;  3BCC D;  5AVX B;  1GZL A;  3L71 D;  4R9J A;  1P84 H;  1NTK G;  1H8A A;  4R4L A;  1K05 A;  2B9B A;  2IPP A;  1NTM D;  4HJG H;  3MGN A;  5BU8 B;  4C7N A;  3L73 D;  1QL1 A;  3L37 A;  1FZF B;  4M3L A;  4O9B A;  1NJI Q;  3KHU A;  5APW A;  2WSC J;  1GL2 C;  3MHV A;  4M7F A;  5AVR B;  1OXZ A;  2FY8 A;  4U3F G;  3II6 A;  5APT A;  1S5L E;  1VF5 B;  3PTZ A;  1M1K Q;  1PIX A;  3TGU D;  2RKL A;  2JHH C;  4PJ0 H;  2SPZ A;  1L4A D;  1R8E A;  2KYV A;  4TT3 H;  1N7S D;  1LTG C;  1OWA A;  3VP8 A;  2WSF J;  3OAK A;  2KLV A;  2I1K A;  1ZN5 A;  2W6J H;  1N86 B;  3KZI E;  2K37 A;  1L0N E;  1IC2 A;  4TLF A;  1FOS E;  2YKP A;  1NU1 G;  4WWI A;  3CWB J;  4H44 D;  2WPV B;  3TK1 A;  2BCC G;  1RE4 A;  3FWL A;  2L91 A;  4WBA A;  1KZU B;  2OYH A;  3FXE A;  5DJU B;  1BGY J;  1FBM A;  2A45 G;  4PV1 D;  1S3J A;  3S4R A;  2L5G B;  4IL6 H;  1IFI A;  3GF7 A;  1N2D C;  1SQP K;  3S1K A;  2ITA A;  3PHL A;  4EDF A;  4EI2 A;  3E1I A;  3RK3 C;  1PGQ A;  5K5G B;  1ZXG A;  2N9B A;  2ZFC A;  5GTI H;  4GOE A;  1NKN A;  2Y0E A;  5APU A;  1YQ3 C;  1VQ8 P;  1KB9 E;  1PPJ E;  4JYO X;  4W80 A;  1KIL B;  1LTA C;  1IFD A;  1NH4 A;  3VMY A;  1X22 A;  1BE3 E;  2XND H;  3B5N A;  3V2Q A;  5DJT B;  2WT7 A;  2IZ0 A;  4I7Z C;  2WPR A;  3AEC C;  5KAI H;  4PD4 E;  3GLM A;  3AEA C;  3NTN A;  1S9K D;  1OFC X;  3W68 A;  1WT6 A;  2ZT9 B;  4NPD A;  1SQQ K;  4W7Z A;  2E5Y A;  1PP9 D;  1FZC C;  1ZP0 C;  1KOR A;  4U3F E;  3GHG A;  1OW8 A;  1AQ5 A;  3L74 J;  3VP9 A;  1T2K C;  1SQB D;  2YIU B;  3JC2 2;  1SQV D;  4UB6 H;  1FZG B;  1RE3 A;  3W67 A;  5AW6 B;  2ZYG A;  2KP8 A;  3P7K A;  4WY4 A;  2QRX A;  1RF1 B;  1P84 I;  1BCC D;  2NPS D;  3RGU A;  4OH8 B;  3AE3 C;  1IJD B;  1NU1 E;  2HOD C;  3WUU A;  3SFD C;  3PLN A;  3AE8 C;  2BCC E;  1SFC B;  1W2B O;  1JY3 N;  1SP4 A;  1USE A;  1NTZ G;  2N1T D;  2G8Y A;  2PRR A;  3SFE C;  5AVS B;  3HD7 C;  1JB0 J;  2GA1 A;  3BCC J;  1EZV I;  4D6T G;  4H0L C;  2YKO A;  4Z1M H;  3L71 J;  1BE3 J;  3CX5 H;  3IFM A;  2HYN A;  1URQ C;  5B5E H;  2J3G A;  2MJZ A;  2K9J B;  1KIL A;  3H1L G;  3IR9 A;  1IZN B;  1NTM J;  2P67 A;  1NTK J;  3CLQ A;  3L73 J;  3A3Y B;  1LTS C;  2PFX A;  4ZKP A;  3HUS A;  2HLO A;  1JY3 O;  1Y47 A;  1FZA A;  3RK2 D;  2XDJ A;  1ZOY C;  1Q7Y Q;  1L0L G;  2Z5H A;  1NHL A;  5AVW B;  2A06 G;  2ZVN B;  5KJ7 A;  2B87 A;  1Z3U A;  2KNC A;  1K73 Q;  1HGZ A;  2FYU K;  1R5S A;  2QJY B;  1FZG A;  1OW7 A;  3LIE A;  1NU1 J;  4MN4 C;  4JBZ A;  2K3R A;  4L73 A;  2QJP B;  5AW7 B;  3RL0 C;  3PP5 A;  1QL2 A;  2FYN B;  3HRN A;  3OA7 A;  1H0T A;  2YO2 A;  3MUD A;  2GUV A;  1MV8 A;  3T97 A;  1NTM K;  2E42 A;  2QVA A;  2FXM A;  2O1J A;  4BXL A;  5KAF E;  2QG4 A;  1NTZ E;  4GDO A;  3UIA A;  1VQ5 P;  1SQP D;  1CI6 A;  2K9J A;  3RK3 E;  1FZB B;  4WB4 A;  3SWK A;  4D6T E;  3B71 A;  4Y99 B;  3NMD A;  2ZJS E;  4JF7 A;  5CCH C;  1G2C B;  4I1L A;  1NYH A;  3H1L E;  1KD1 Q;  2V4H A;  1AFO A;  2H43 A;  1JTH A;  4IL6 X;  5AVQ B;  1LWU C;  4N78 E;  2W8Z A;  3HTK B;  2P7J A;  1LNQ A;  5CBO A;  2V7Q H;  1FZE A;  2KS1 B;  1SQB J;  3EFF K;  1VQ9 P;  2XZR A;  1L0L E;  4ASV A;  1FDI A;  1LTJ B;  1K9M Q;  5AW2 B;  2A06 E;  1VF5 D;  1N73 C;  1SQQ D;  3G71 P;  4B86 A;  2OTL P;  3FGA D;  2HPC A;  3H1J D;  3LW5 H;  3R2P A;  2M0B A;  1LT9 C;  3D6Z A;  2WZ7 A;  3MUD C;  5B66 H;  2IYP A;  3VN0 A;  5E79 H;  1LTI C;  3RK3 B;  4HKZ H;  1JY3 P;  3B4S A;  4U7J A;  2RMZ A;  1NVO A;  2XU6 A;  1LTB C;  2J2P A;  1VQ7 P;  3RK2 B;  2Q3E A;  1T3J A;  3USS A;  1SQX D;  4C7N B;  3Q5P A;  1PFI A;  1AVO A;  3H1L J;  5CMZ A;  2JDI H;  5AW9 B;  3L35 A;  2W6B A;  3WU2 E;  1VQ6 P;  1J1D C;  1GL2 A;  1X0T A;  1ZRT D;  2JJL A;  1L4A C;  1SQV K;  2Q3I A;  3SWY A;  3A0B E;  1N7S C;  2HG5 D;  5AW3 B;  1KIL D;  2J1G A;  3EWK A;  2C0W A;  5AVU B;  3L74 G;  1NO4 A;  1OVU A;  2IBZ G;  3R4Y A;  1M8O B;  1T3U A;  3L72 G;  4H44 C;  3NXS A;  1J2J B;  2UWJ E;  5TIS E;  1VQL P;  1AVY A;  1P84 D;  1VQ4 P;  2AEF A;  4Y28 J;  1PV3 A;  3PRJ A;  1AV1 A;  1FE6 A;  3D70 A;  1RE4 B;  2HR3 A;  1KFN A;  2JO1 A;  2POH A;  3FX0 A;  4GKG A;  4PV1 C;  4C46 A;  5KLI B;  2ZT9 D;  1N7L A;  1QVG O;  2OYH B;  2WQY C;  2FYU G;  2CK3 H;  2WTY A;  3PJS K;  1VQN P;  2J3F A;  3H1H G;  3V4Q A;  5KJ7 D;  1VQK P;  1KTM A;  1Q2N A;  3U1C A;  1BGY E;  4DJG A;  1N8R Q;  1JMM A;  2XV5 A;  1QEX A;  1EZV D;  3BCC G;  3E1I B;  4DCK A;  3BVH C;  2OTJ P;  1ZV8 A;  2QJK C;  1RH5 B;  3JCU E;  4GT1 A;  1EXI A;  5M1B A;  2ZYD A;  1NTM G;  1K04 A;  3D6Y A;  3E1R A;  1SQP J;  3L73 G;  3B5N B;  1SFC D;  3H32 C;  3EFG A;  3CMA P;  2OYO A;  2WT7 B;  3A5T A;  1HJB A;  1YTZ I;  2JEE A;  2QM8 A;  1MUU A;  2OYI A;  3TGU G;  1JOC A;  4R9T A;  1M1J C;  3RBZ A;  1PGO A;  2KOG A;  4JZC A;  5GTH E;  3U1A A;  4RJT A;  3GHG B;  3H1I D;  2N9Y B;  1FZC A;  5KKZ C;  3NFQ A;  1LP1 B;  5H2F E;  5EFW B;  2NPS C;  1RE3 B;  2ZYA A;  3L74 E;  3A7O A;  3KQG A;  4WY4 B;  3A2A A;  4H13 B;  4OGQ B;  3V5B A;  3L72 E;  4IFF A;  1SQQ J;  4IFD K;  2N1T C;  1QGK B;  3D71 A;  1KN7 A;  2HOD A;  3S9O A;  4DOJ A;  1DEB A;  3IAO A;  1M56 D;  1FZD A;  1PL5 A;  4PD4 H;  3CXH E;  2FBW C;  3H1H E;  2IX7 C;  1AJY A;  3HD7 A;  3VOP A;  4BRY A;  2J0H A;  1YIJ P;  3V4W A;  2C9N Y;  4PJ0 E;  1DX7 A;  3E7K A;  1KYO I;  3BCC E;  1URQ A;  3I56 P;  3L71 E;  4BWN A;  1JY2 N;  2RN0 A;  3RL0 g;  1MKM A;  1VQP P;  1M90 Q;  2XNX C;  1NTM E;  5CCG D;  2O01 J;  3HUS B;  1NTK E;  3GW6 A;  2P2U A;  2HLO B;  3L73 E;  2J0G A;  2OYI C;  2M5A B;  2PGD A;  1FZA B;  2D2C B;  3QWO C;  1PP9 G;  1HF9 A;  2KK7 A;  2QM7 A;  1QX8 A;  4IL6 E;  2FKW B;  3TNU A;  2M8R A;  3VMZ A;  1FAV A;  1SQB G;  3M9H A;  1BDD A;  2B87 B;  3TGU E;  2KNC B;  1SQV G;  1FJP A;  1JUN A;  1USD A;  3SWF A;  3CX5 D;  1LP1 A;  5GTI E;  1YIT P;  1Z3S A;  4NPE A;  1IFN A;  3L72 J;  1BCC G;  2J61 B;  2E75 C;  5BVZ A;  2WSE H;  1HUC A;  1Q86 Q;  3G6E P;  1AA0 A;  2YMY A;  3KPE A;  4GOF A;  1J1E B;  1ZR2 A;  3AE7 C;  1NOH A;  2FYU J;  3AE9 C;  1LT9 B;  1H0T B;  3H1H J;  3EQ2 A;  2J59 M;  3T97 B;  2AXT H;  5KAI E;  1SQX K;  3A0H E;  2J64 A;  3HE4 A;  3Q1M A;  3U59 A;  2Q9I C;  1JNM A;  4EIJ A;  2BAS A;  1VDF A;  1HWT C;  1EDI A;  3C1L A;  1CI6 B;  1DD3 A;  2H8P D;  2WIT A;  2Q7C A;  1L2P A;  2YXR B;  4UB6 E;  1YYC A;  3BAS A;  1Q81 Q;  3P8C E;  3RK3 D;  2R3S A;  5CCH A;  1FC2 C;  1KB9 I;  2H43 B;  1JTH B;  4LC1 A;  4KJM A;  2MKV A;  2M5A A;  4LGD E;  3H1K D;  2JKV A;  1LWU A;  1FZF C;  1S9K E;  3TGU J;  1IFP A;  2FFD C;  2E76 B;  2E74 B;  1L0N K;  5AVY B;  1FZE B;  2Z4E A;  4AYC A;  4PD4 I;  1PP9 E;  1OVV A;  2O01 N;  1VF5 C;  1MZ9 A;  1U7M A;  4GOD A;  1TU3 F;  3L75 D;  4M7H A;  1SQB E;  5KAF H;  2H89 C;  2J61 A;  4DT0 A; 
#chains in the Genus database with same CATH homology
 2R32 A;  2Z4E B;  1H8A A;  3VN0 A;  1N73 A;  3I5C A;  1LTI C;  5AW0 B;  3RK3 B;  2IPP A;  2HPC B;  1N86 C;  1JY3 P;  2A45 H;  3MGN A;  5BU8 B;  4C7N A;  1GL2 D;  1QL1 A;  1JY2 O;  1HVV A;  3L37 A;  1FZF B;  4M3L A;  2XU6 A;  1LTB C;  4O9B A;  2J2P A;  2R5D A;  1LT9 A;  2CPS A;  5APW A;  1T2K D;  1GL2 C;  2J0Y A;  4GIF A;  1N73 B;  3RK2 B;  4M7F A;  2O1K A;  4I6M C;  5AVR B;  1OXZ A;  1T3J A;  3II6 A;  4C7N B;  5APT A;  1JCD A;  1N86 A;  1ZR4 A;  1PFI A;  2GUS A;  2J58 A;  5CMZ A;  2JHH C;  5AW9 B;  3L35 A;  3V2P A;  2W6B A;  1RE4 C;  1JC9 A;  1L4A D;  3BRV B;  1J1D C;  1GL2 A;  2KYV A;  5AVV B;  1FDM A;  1N7S D;  1LTG C;  2OYH C;  1OWA A;  3VP8 A;  1H88 A;  3OAK A;  2JJL A;  2KLV A;  2I1K A;  1L4A C;  1SQV K;  1W2E A;  1ZN5 A;  2Q3I A;  3SWY A;  1N86 B;  4NYT A;  1N7S C;  2HG5 D;  5AW3 B;  2A45 I;  1KIL D;  1IC2 A;  1FOS E;  3CL3 D;  2YKP A;  2J1G A;  1JY2 P;  2C0W A;  5AVU B;  3TK1 A;  2J3F D;  2R3C A;  1NO4 A;  1GL2 B;  3B8E B;  1RE4 A;  3E1I C;  3LID A;  4WBA A;  1T3U A;  1KZU B;  3NXS A;  1J2J B;  2OYH A;  5AVT B;  1FIB A;  2KB7 P;  1L4A A;  1FBM A;  2A45 G;  2JHM F;  1N7S A;  2L5G B;  3BRT B;  1IFI A;  3B5N D;  1N2D C;  1SQP K;  2Z4E C;  1RE4 B;  4C46 A;  1KFN A;  1XTG B;  2POH A;  4GKG A;  2D39 A;  2C9L Y;  1HBW A;  1J1D B;  2I1J A;  1N7L A;  3B5N C;  2OYH B;  3E1I A;  3RK3 C;  1YTZ T;  2WTY A;  1M7L A;  2J3F A;  1L4A B;  3BAT A;  2J3O A;  2N9B A;  2ZFC A;  1N7S B;  3V4Q A;  5KJ7 D;  1NKN A;  3U1C A;  5APU A;  2OAR A;  1KQL A;  1JMM A;  4JYO X;  2XV5 A;  4W80 A;  4LLH A;  1KIL B;  1LTA C;  4N78 D;  1IFD A;  1NH4 A;  3E1I B;  3VMY A;  3BVH C;  4DZO A;  3B5N A;  1GK4 A;  3V2Q A;  1ZV8 A;  4GT1 A;  2WT7 A;  3G3Z A;  2WPR A;  2J5Z A;  3GHG C;  2M3B A;  3B5N B;  3NTN A;  1S9K D;  1SFC D;  3BVH A;  3H32 C;  1NWQ A;  3EFG A;  4WY4 D;  4XA4 A;  1Z56 A;  1WT6 A;  2WT7 B;  3A5T A;  5KTB A;  1RE3 C;  5APQ A;  1HJB A;  3FIB A;  1SFC C;  2PP6 A;  2JHI F;  1X79 B;  1YTZ I;  4W7Y A;  1SQQ K;  4W7Z A;  4WY4 C;  2YKQ A;  1IO4 A;  1FZC C;  2J3U A;  1RF1 A;  2JEE A;  2QM8 A;  3GHG A;  2WNP F;  1MUU A;  2OYI A;  1AQ5 A;  3BVH B;  3VP9 A;  1T2K C;  1JOC A;  4R9T A;  2WWW A;  1M1J C;  3H32 A;  4N3Y B;  2J60 A;  2KOG A;  2KSJ A;  1FU1 A;  2WSF H;  1FZG B;  1RE3 A;  4JZC A;  5AW6 B;  1SFC A;  1JCC A;  3U1A A;  2KP8 A;  3P7K A;  2PAJ A;  2IFM A;  4WY4 A;  1RF1 B;  3GHG B;  1FZC A;  2OYI B;  1NTK K;  2NPS D;  5CHX A;  3H6P A;  4OH8 B;  3NFQ A;  1IJD B;  3H32 B;  4HH2 A;  2HOD C;  2NPS C;  3MTU E;  1M1J A;  2C0X A;  1RE3 B;  3CI9 A;  2YO3 A;  3A7O A;  3KQG A;  1SFC B;  3HD7 D;  1JY3 N;  4HYT B;  1SP4 A;  3A2A A;  4WY4 B;  2XKM A;  1KIL C;  3V5B A;  2N1T D;  1JO5 A;  1FZC B;  3P8M C;  4IFF A;  4IFD K;  2WPS A;  1IK9 A;  1GD2 E;  5AVS B;  3HD7 C;  2WPQ A;  5APX A;  2N1T C;  1G1J A;  3TSI A;  4EPU A;  1M1J B;  1URQ D;  2Q5U A;  2HOD A;  1A02 J;  1LGH B;  4DOJ A;  2NPS A;  2YKO A;  3HUS C;  1DEB A;  2HLO C;  1GK6 A;  3IFM A;  5AVZ B;  2HYN A;  1URQ C;  1FZD A;  2J3G A;  1VPC A;  2MJZ A;  1KIL A;  3IR9 A;  3V2R A;  2IX7 C;  1FZA C;  2P67 A;  4EOT A;  3HD7 A;  3CLQ A;  2HOD B;  2N1T A;  3VOP A;  1NAF A;  2J0H A;  1GW3 A;  2NPS B;  3M91 A;  2LKM A;  3V4W A;  3A3Y B;  1LTS C;  1NU1 K;  4C7R A;  2C9N Y;  4ZKP A;  3HUS A;  1EQ7 A;  1X9V A;  1DX7 A;  2HLO A;  5KJ7 C;  3M06 A;  1HTL C;  3M9Q A;  1SVF A;  1URQ A;  3N4X A;  1JY2 N;  5CJ4 A;  4RES B;  2JHL F;  1JY3 O;  3HD7 B;  1XTC C;  4AUW A;  1FZA A;  2N1T B;  1CZQ A;  1FZG C;  3RK2 D;  2XDJ A;  2XNX C;  5CCG D;  3HUS B;  5CJ0 A;  2P2U A;  3HE5 A;  2HLO B;  3MIW A;  1RF1 C;  2J0G A;  2Z5H A;  1URQ B;  1NHL A;  5APV A;  5AVW B;  2OYI C;  1GTW A;  5KJ7 A;  1Z3U A;  1HGZ A;  4KHX A;  2WSC H;  1FZA B;  2FYU K;  1J1E C;  3WMM 0;  5AW4 B;  2QM7 A;  2FKW B;  3TNU A;  1FZG A;  3HE5 B;  3L36 A;  1SLQ A;  2M8R A;  3VMZ A;  1FAV A;  2XNX A;  3M9H A;  3LIE A;  3RL0 D;  1RF0 B;  3P32 A;  1DH3 A;  5AW5 B;  1FJP A;  1JUN A;  3O8Z A;  3OJA B;  5CCG A;  3SWF A;  1FZB C;  5APS A;  3KYQ A;  5AW7 B;  3RL0 C;  4Y99 C;  2Z5I A;  3PP5 A;  1Z3S A;  1WRG A;  1IFN A;  3TNU B;  1QL2 A;  4AQR D;  3HRN A;  2FIB A;  2XNX B;  2J61 B;  3OA7 A;  2FFD B;  2YO2 A;  3MUD A;  3V2N A;  5BVZ A;  2WSE H;  2GUV A;  1FOS F;  1HUC A;  1MV8 A;  1L0L K;  3T97 A;  1NTM K;  2YMY A;  4I2L C;  2IFN A;  2E42 A;  1FJK A;  4N6J A;  3KPE A;  2CPB A;  1J1E B;  2FXM A;  1FZB A;  2O1J A;  1ZR2 A;  4IFM A;  1NOH A;  5APY A;  1LT9 B;  1GU5 A;  3EQ2 A;  2W27 A;  2HFE D;  2FYZ A;  1G2C A;  1GW4 A;  2J59 M;  2H43 C;  2GY7 A;  3UIA A;  4JYC A;  4JYB A;  1SQB K;  1SQX K;  1CI6 A;  1HH0 A;  2J64 A;  3HE4 A;  5CCH D;  1FZB B;  4WB4 A;  3U59 A;  2Q9I C;  1KFM A;  3MD0 A;  3RL0 B;  4Y99 B;  1JNM A;  4EIJ A;  2BAS A;  3NMD A;  1RY3 A;  1X8Y A;  1LTJ C;  1VDF A;  4JF7 A;  5CCH C;  2E43 A;  3HTK A;  1G2C B;  5AW1 B;  4I1L A;  1HWT C;  1FZE C;  1CI6 B;  3VTP C;  1AFO A;  3N7N A;  1FIC A;  2H43 A;  1JTH A;  5KLV K;  2H8P D;  2W6A A;  1GU4 A;  1IFM A;  2WIT A;  3HE4 B;  3M0D C;  1CW5 A;  3KDP B;  1NKZ B;  1A02 F;  5AVQ B;  2Q7C A;  1LWU C;  3L4F A;  4N78 E;  3M9B A;  3VYI A;  2Q9I A;  4ZFG A;  1HGV A;  1G1I A;  1YYC A;  3BAS A;  3VMX A;  3HTK B;  2P7J A;  3P8C E;  2H7H A;  3RK3 D;  5AW8 B;  1T8Z A;  1LTJ A;  5CCH A;  2GM4 A;  4ZKU A;  2VRS A;  2H43 B;  1JTH B;  4LC1 A;  1FZE A;  1CSB A;  1NTZ K;  1RF0 C;  1MFZ A;  2HPC C;  2O01 H;  1ZLL A;  4LGD E;  5BU5 A;  3M0D A;  1LTT C;  2XZR A;  2YNY A;  2Q9I B;  1LWU A;  1FZF C;  1E5W A;  2P1J A;  1S9K E;  1LTJ B;  2FFD C;  1L0N K;  5AW2 B;  2JHK F;  5AVY B;  3M0A A;  1N73 C;  3RK2 C;  1FZE B;  1IFJ A;  2Z4E A;  4XE5 B;  3TYY A;  1GDT A;  2R5B A;  3C9I A;  2ZXE B;  5CCG C;  4AYC A;  4B86 A;  1RF0 A;  2HPC A;  3P8C D;  3LW5 H;  1FID A;  1LWU B;  5AVX B;  1MZ9 A;  3R2P A;  1GZL A;  1H89 A;  1LT9 C;  1FZF A;  4M7H A;  2WZ7 A;  4R9J A;  2J61 A;  2FFD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...