2OYHB

Crystal structure of fragment d of gammad298,301a fibrinogen with the peptide ligand gly-his-arg-pro-amide
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
298
structure length
298
Chain Sequence
b'IPTNLRVLRSILENLRSKIQKLESDVSAQMEYCRTPCTVSCNIPVVSGKECEEIIRKGGETSEMYLIQPDSSVKPYRVYCDMNTENGGWTVIQNRQDGSVDFGRKWDPYKQGFGNVATNTDGKNYCGLPGEYWLGNDKISQLTRMGPTELLIEMEDWKGDKVKAHYGGFTVQNEANKYQISVNKYRGTAGNALMDGASQLMGENRTMTIHNGMFFSTYDRDNDGWLTSDPRKQCSKEDGGGWWYNRCHAANPNGRYYWGGQYTWDMAKHGTDDGVVWMNWKGSWYSMRKMSMKIRPFF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fibrinogen alpha chain
molecule tags Blood clotting
source organism Homo sapiens
publication title Probing the gamma2 Calcium-Binding Site: Studies with gammaD298,301A Fibrinogen Reveal Changes in the gamma294-301 Loop that Alter the Integrity of the "a" Polymerization Site.
pubmed doi rcsb
total genus 93
structure length 298
sequence length 298
chains with identical sequence E
ec nomenclature
pdb deposition date 2007-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00147 Fibrinogen_C Fibrinogen beta and gamma chains, C-terminal globular domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2oyhB01
3.90.215.10 Alpha Beta Alpha-Beta Complex Gamma Fibrinogen; Chain A, domain 1 Gamma Fibrinogen, chain A, domain 1 2oyhB02
4.10.530.10 Few Secondary Structures Irregular Gamma-fibrinogen Carboxyl Terminal Fragment; domain 2 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2 2oyhB03
1FZGA 1LTJC 1Z3UA 2J0HA 2JHIF 2A45I 1LT9C 2H43A 1FZFC 2Z4EA 4ZFGA 2JHHC 3H32B 1LTJA 2J1GA 2HODC 1JY2P 1JY3P 2HLOA 2Q9IA 1N86C 2J3FA 2JHLF 3HUSC 1RE3B 2JHMF 3E1IC 2H43C 1LT9A 2OYIA 1RE3C 3HUSB 4M7HA 2J3GA 3GHGB 2J60A 2FFDA 1FZCC 1FZGC 4M7FA 1JC9A 1LT9B 2J64A 1RE3A 2OYHA 2WNPF 2FIBA 1JY3N 1JY2N 1RF0A 1Z3SA 2HPCB 2A45H 1JY3O 3HUSA 2GY7A 1T3UA 2HLOC 1FZFB 1FZAA 2HLOB 2J0GA 2HPCC 2J3OA 1LWUB 3FIBA 2JHKF 1LWUC 4JZCA 3H32A 1N86B 3E1IB 2H43B 2OYHC 1M1JB 1N73C 3GHGC 1N73B 1N73A 1LWUA 2J3FD 2D39A 1FZGB 1FZAB 2XNXC 2J5ZA 1M1JC 4JYOX 4NYTA 1FZEC 2HODA 1N86A 3E1IA 2Q9IC 2J3UA 1FZEB 2HPCA 1RF0C 3BVHB 2OYHB 1FICA 1FZFA 1RF1B 1FIDA 2J0YA 2J2PA 3GHGA 1RF0B 2FFDC 2XNXB 2OYIB 1FZBC 1RF1C 1JY2O 2J61A 2Q9IB 2XNXA 1FZBA 2FFDB 1LTJB 4R9JA 1FZAC 1FZBB 1RF1A 2Z4EC 2J61B 3BVHA 1FIBA 3H32C 3BVHC 1W2EA 2Z4EB 1RE4B 1FZCA 4EPUA 1FZDA 1FZEA 1FZCB 1RE4A 2A45G 2HODB 1M1JA 2OYIC 1RE4C 4R9TA
chains in the Genus database with same CATH superfamily
4WY4C 1FOSF 3HD7A 3KDPB 2YIUC 2I1KA 2B9BA 4ZFGA 2MJZA 1FZFC 1AVYA 1JB0J 3VMYA 1X22A 4C7NB 1KMIZ 2AXTE 4OVNF 2OYIA 3BCCG 4M7HA 2FYNC 3CMEP 4Y99B 1BE3E 2FYUG 5GTHH 1LT9B 1NGMB 1JCDA 1QEXA 1IFNA 5TISH 1BCCD 2KIKA 1OW7A 1NTKK 1T3UA 3RBXA 4NPDA 3II6A 3L71G 1YTZT 1VF5C 2H43B 2JWDA 2BCCJ 4IL6E 3WU2E 3H1HG 4OGQD 3O6QB 1N73A 2J3FD 3L75G 2C9LY 3T97A 1OW8A 3AE3C 1EDLA 3BVHB 1YQ4C 3A0HE 1OVRA 4CPGA 3WMM0 1LNQA 1QX8A 1GL2D 2P1JA 5AW4B 3TGUD 2WVRA 2W6BA 4ZKPA 4NPEA 5BU5A 2Z4EC 3H1JE 4K35A 4AQRD 5CJ4A 2GM4A 5AW6B 4DZOA 1NU1G 1SQXD 3OA7A 3L70E 3P8MC 1NH4A 5B5EE 3WUUA 1HGVA 3EFFK 2HG5D 3TSIA 1QL2A 1HF9A 3CCQP 1SQXJ 3L70G 5AVTB 2A45I 3H1IE 3M9QA 3A5TA 4H0LD 1ZV8A 2QJYB 2E5TA 3E1IC 4KHXA 1LTIC 1ZW0A 3HUSB 3HRNA 3LIEA 1HGZA 2E75C 3V2PA 3IF4A 1VQOP 5KTBA 3GG2A 2K1AA 3L36A 3RL0B 2W83C 2FBWC 1URQA 2YKOA 4XA4A 1JO5A 2J3OA 2GA1A 1NTKD 1L4AB 1BGYG 1L0NG 2NPSD 2BCCD 3H25A 5E79H 5CCHA 1N86A 3P8CD 3TK1A 1SFCB 5CBNA 1VL2A 2FYUK 1RF0B 3KQGA 4N6JA 1AQ5A 1FZBC 5TJHA 2AEJA 1CW5A 4EDFA 1KN7A 2WSFJ 2J61A 1SQXG 1NTZJ 2H8PD 3ZDMA 1SFCC 2K88A 3FXEA 4IL6H 1M57D 3OJAB 4WY4D 1N8RQ 2PGDA 2C0WA 3BCCE 2W6JH 1FIBA 3L70D 3L74G 2Z4EB 2QA4P 2ITAA 4L76A 2O1JA 1USEA 2HODB 1KV4A 2RMZA 4R9TA 1LTJC 1ZR4A 1IFJA 1J1DB 1MUUA 3VMZA 4H44C 2UWJE 3H32B 1LTJA 1AFOA 1NTZG 2QEXP 2WTYA 2QE7H 3U59A 1OXZA 1YHQP 4I6MC 1RE3B 2JHMF 1WT6A 2FYUJ 1KZUB 1SQQG 2FFDA 2B89A 1AQTA 3U1AA 4M7FA 3KPEA 3L72G 1NTKG 4PD4D 1FJPA 1ZOYC 1U7JA 5AW7B 1JNMA 1Z3SA 3W67A 1SQVJ 5GTIH 2BCCG 1JY3O 2RN0A 4UB6E 1OVUA 2N1TA 3FIBA 1PPJE 3S9OA 1NAYA 2V4HA 3FXDA 1FZAB 2XNXC 1FC2C 1L2PA 2HPCA 4GOFA 2ZXXA 3ITKA 2SPZA 5CMZA 1RF1B 2BASA 3L74D 3OAKA 5AVSB 4Z1MH 4N78E 2OYIB 1Q81Q 1ZRTE 1JY2O 2QJPC 2JKVA 1N2DC 2FFDB 3V2QA 3LW5H 2O01N 1URQC 2FXOA 2CK3H 2HYNA 1SQBK 2KK7A 4DCKA 1DH3A 4ZKUA 4Y28J 3D6YA 3Q5SA 1FZCA 1FZCB 5AVRB 1EXJA 1NJIQ 1T2KC 1SQQD 1SQPE 2PAJA 2R3CA 2J0HA 1L4AA 2YIUB 1OWAA 1VQ8P 1KFNA 3R4YA 4RO0A 3TGUJ 2J60A 2J64A 5CCGD 4C7NA 3AE7C 3L72E 1MZ9A 4W7YA 1RF0A 2R3SA 2J59M 1G2CB 1T6AA 4HYTB 3V2RA 4AUWA 2KXPB 1SQPK 4U7JA 2HLOB 1NTKE 1HUCA 2WMMA 5GTHE 1LTTC 5B5EH 3GW6A 2W27A 2AXTH 4HH2A 4Y99C 2KSJA 2I8DA 5CCGA 4C46A 2ZFCA 3L35A 4EIJA 1ZXGA 1NVOA 1PP9D 3CC2P 1KFMA 2OYHB 4N78D 1VQKP 3HD7C 1NU1E 5C39A 1L4AD 1S9KE 1BSNA 2Q3IA 1RF1C 1EZVG 1SS1A 3L74J 1IFPA 3CXHD 2J61B 1NTZK 1RQVA 1OFCX 1T3JA 3K5BA 3HE4A 3KXDA 1HWTC 3MIWA 4EPUA 3CX5D 2E75B 1RE4A 2OYIC 3JC22 5DJTB 2FYNB 1VQPP 3PTZA 4U3FD 3V6IA 1LT9C 1NKNA 1KB9E 5TISE 4W7ZA 2IYOA 1EDKA 3AEDC 1FU1A 1Z56A 1KB9H 3TYYA 1NTME 1RE3C 1YJNP 1S2EA 2KZIA 2YO3A 4H13C 2YMKA 2B87B 5KAIE 1L0NJ 4OH8B 2ZT9D 2N9YB 3CD6P 3QH9A 2E42A 3G6EP 2FYUE 3C8VA 3LIDA 1FS0E 3PP5A 1EZVE 4IFMA 3WUVA 1L4AC 5AW2B 1LTAC 1PP9G 1HH0A 4D6TG 2BEZF 1BCCE 3B5NA 2ZT9B 1EQ7A 1EDJA 4BRYB 4NYTA 4KT0J 3TGUE 5KJ7A 1NTMD 3IFMA 1ZRTD 1BE3D 4OGQC 1FE6A 2C0XA 1S4XA 1IK9A 1GK6A 2KYVA 2IX7C 3RK2B 1FZBB 4HB1A 4JPZB 4XE5B 1J2JB 1NTMJ 1KQSO 4KJMA 3G4SP 4C7RA 4LLHA 1PPJD 2KZJA 5AVYB 3VP8A 2R5BA 1RE4B 2O1KA 2MKVA 1SQBJ 1IO4A 3H1KJ 2V7QJ 1SQPG 2O3JA 2H43A 1QL1A 2JHHC 2ZVOB 2JEEA 1N86C 1S5LH 2RH0A 3HUSC 2B87A 3SWFA 2ZYGA 1JC9A 1KILD 2WWWA 3H1HD 5KJ7C 4H0LB 2YKQA 2J0GA 4GODA 1SP4A 4UB6H 2KS1A 1FJKA 3RK2C 3F5HA 2HODA 3A2AA 3E1IA 5KLVK 3H1LG 4YTPC 3AEFC 4DOJA 1FICA 1LTGC 1PPJG 5KLVD 1FZBA 3CX5H 2GUSA 1PFIA 3P7KA 1KYOD 1XTCC 4BWNA 4O9BA 3BVHC 1U7MA 2I1JA 1VF5D 2WSCH 1CI6A 3AE8C 2A45G 1PGQA 2LXBA 4U3FE 1YQ3C 2YXQB 3C9IA 3FGAD 4OWFA 1FDOA 1AA0A 2ZAEB 4YPCA 5BU8B 4AYCA 2QM8A 1SQBE 2JHLF 2OARA 1YYCA 1DIPA 4RESB 1RE3A 1W2BO 2QVAA 2JDIH 1JOCA 5KLVJ 1MV8A 1LP1B 2A45H 2JJLA 4EOTA 2J58A 3HUSA 5AW5B 3HE5A 4HJGH 1WRGA 4GKGA 2K9JA 5CCGC 5AVWB 1S72P 2KOGA 3H1IJ 3VTPC 2A06G 3MGNA 1SQXE 2P2UA 3C1LA 2PP6A 1RF0C 1BGYE 4H0LC 1R8EA 1FZFA 4ASWA 2AEFA 2J5UA 3H1JJ 3HD7D 1JTHA 2QJPB 1VQ4P 3AEAC 1LTJB 3AE6C 3L73G 2Y0DA 1LJ2A 3Q5RA 3CWBE 5CBOA 4H44B 3SWYA 1L0NK 3UIAA 2CPSA 2E5YA 1GZLA 3A3YB 1SQPJ 3D70A 2Z5HA 5AVZB 1OVVA 5DJUB 1D7MA 2QG4A 4ZMDA 5KJ7D 4R4LA 2E74B 4B86A 3H1IG 3IN6A 1L0LE 3B4SA 3V5BA 2Q9IA 2IDBA 4EI2A 2J3GA 3CC7P 4K3AA 1T2KD 1X8YA 1FZGC 1KB9I 1GU4A 3GF3A 4JYBA 1BE3J 3L75J 5APYA 1GW4A 1Q90D 1SVFA 4H13D 2BCCE 2N1TD 3PRJA 3M0AA 1HJ0A 2ZT9C 3HTKB 1NU1J 1ZN5A 2W6AA 1K73Q 1NOHA 2M0BA 1EC5A 3S4RA 4JF7A 1W5CE 1FIDA 3NXSA 1DD3A 5AVXB 3GHGA 3EWKA 2FFDC 2WSEH 4I7ZB 1KYOE 4D6TE 3CLQA 3RK3D 1FZAC 2FYZA 2FYUD 1RF1A 4PD4E 5AVVB 2E74C 1AJYA 1PP9J 2JR8A 2WPQA 3CX5E 4I7ZC 3VP9A 2ZXEB 1QVGO 1S3JA 2ZYAA 2DW3A 1CZQA 2K9JB 2K37A 2XDJA 5AW8B 2JHIF 1L0LK 1U57A 3MUDC 1KQGB 4GDOA 1P84I 1L0NE 1FOSE 2NPSA 3MTUE 2KSEA 1Q2NA 2OYHA 3KHUA 3AEEC 4WWIA 4W80A 4IFDK 3T97B 1Y8AA 1BSHA 2OTKE 1NU1K 5KLIB 4EYYQ 3A0HH 1URQD 3B71A 3HTKA 1GTWA 2QRXA 1X79B 4DJGA 3JCUE 2QJKB 3A0BE 2Q7CA 4JYOX 1FAVA 3WU2H 2LR2A 3RK2D 1H88A 2XZRA 3QWOC 5AVQB 1J1EC 1EZVI 4QMAA 3U1CA 3L37A 4PV1C 1A02J 1R5SA 1XTGB 4WVZA 2W90A 4OGQB 4JQ0D 4HKZH 1BCCG 4M3LA 3EQ2A 4A7PA 3L71D 4L74A 1KILE 3BVHA 4D6TD 5APUA 5APVA 3H32C 4TT3H 3H1JG 5M1BA 3CCJP 5KAIH 3HD7B 4UB8H 3CWBG 2JO1A 2QJYC 4IOIH 4GIFA 2WZ7A 3IR9A 3BASA 3BRTB 1NTMG 3AE2C 3FWNA 2Z4EA 1BCCJ 1H8AA 1SLQA 4JYCA 1QLED 2P67A 3PH0A 2HFED 2YXRB 3GHGB 4MN4C 4RKUJ 1VQ5P 2A06E 3L71E 1ZP0C 1KILA 3H1KD 2WSFH 2M5AA 2AEMA 1BE3G 3CXHI 3VN0A 4TLFA 1Q86Q 2IZ0A 2J3UA 3MUDA 2N1TB 2ZYDA 1YTZI 3CX5I 2Q1KA 1VQ6P 2BEQD 1SQVD 2K9YA 3H1HJ 1NTZD 4L75A 2IBZD 3JCUH 1PV3A 1PGJA 1JTHB 1SFCD 3L72D 1S5LX 3L74E 4LC1A 3CCLP 4WY4A 5B66H 1S5LE 3H1KE 3D6ZA 3M91A 1KB9D 2D2CB 4ASVA 3D71A 1SQBD 1RE4C 2P7JA 2WITA 2B88A 2VRSA 3HE4B 1VDFA 4N3YB 2GUVA 2Q6QA 1Y9BA 1SQQK 2KLUA 2E76D 2OGUA 3B5ND 1OZHA 2K3RA 3L73J 2CPBA 3WUTA 2WNPF 2L91A 2HPCB 1K04A 1IJDB 2JHKF 3H1LD 2WT7B 4PV1D 1N86B 2Y0EA 1M1JB 3V4QA 1NWQA 1N73C 2LXCB 1LT1A 1FZGB 5KLVG 1M7LA 4I1LA 2J5ZA 2IBZG 1ZMEC 2KS1B 3VYIA 3SFDC 3L72J 1URQB 5AVUB 2AXCA 2KLVA 2J0YA 2H88C 2IPPA 3R2PA 1VQ9P 4UB8E 5APQA 1X0TA 5EFWB 1VPCA 4L73A 1FDIA 4IL6X 3M9BA 3Q3DA 5KAFE 1MKMA 3RK3C 2P10A 2ZJSE 3CI9A 1P84D 5E79E 3JSVC 2E74D 3AE1C 1GDTA 5AW1B 3VOPA 1M1JA 1G1JA 1JMBA 2WPRA 1IFMA 3AEBC 2KP8A 1PL5A 3SFEC 5AW9B 3USSA 3W68A 2G3AA 3L73E 1N7SB 1DEEG 1GD2E 2J3FA 3E7KA 2WSEJ 1KTMA 1NAFA 3L75E 1L0LD 1GU5A 2A06D 1IFDA 3H6PA 3L4FA 5KLIC 2NPSB 5GTIE 3RK3E 3VMAA 1J1DC 1NHLA 2PRRA 5CCHC 3E1RA 1UIIA 2HPCC 1LWUB 1LWUC 1KQLA 3H32A 2YNYA 1SQQJ 1KYOH 3AECC 2OYHC 1YITP 1KILB 3FX0A 1KQFB 3H1ID 3RK3B 3RL0D 5APWA 1IZNB 1CI6B 2N1TC 2POHA 2G8YA 2WSSH 1AVOA 1HTLC 3I5CA 3RGUA 3CWBJ 1BDDA 2E75D 2Q9IB 3BCCD 1PGPA 2KB7P 1IC2A 1L0LJ 1E5WA 4PD4H 1Q7YQ 1ZLLA 2YO2A 1P84E 4LGDE 1M8OB 1FZDA 2H7HA 1FZEA 3I55P 3S1KA 3P8CE 2NPSC 3HE5B 2V7QH 3PJSK 3AE4C 1KC8Q 3L75D 2C9NY 2J1GA 2HODC 4RJTA 1NTZE 2HLOA 2L5GB 2O01J 3TDKA 1YI2P 2WPSA 2XU6A 1KORA 2JWAA 3ABVC 2IFNA 1PIXA 1JY3N 3CXHE 3TGUG 1FZAA 1Q82Q 1JM0A 3CCMP 1JMMA 1IFIA 5KKZB 2YKPA 1LTBC 1HJBA 3NTNA 3Q2YA 4IFFA 4WB4A 3GHGC 1NU1D 2Z5IA 5APTA 2M5AB 5KKZC 2P58A 1E79H 5APSA 4H44D 5KLVE 3V4WA 3CCVP 1WMKA 3GMAA 3CL3D 2NRGA 2J2PA 2QJKC 1BGYD 2OYOA 3CXHH 1H0TB 1L0ND 2KI7B 1N7SA 1NYHA 1GW3A 4R9JA 1NO4A 1SQVK 3BRVB 3AEGC 2Q3EA 3H1HE 1FBMA 1K8AQ 1OX3A 3MZWB 4U3FJ 1SFCA 3LW5J 3CMAP 1GL2B 2NZ2A 1QGKB 1GMJA 1YJ9P 1FZGA 1G1IA 2LKMA 5CCHD 4XFJA 4GT1A 5APXA 2E43A 1N7SC 1JY3P 1LT9A 4PJ0H 2FKWB 2E76C 2O01H 3B5NC 2KNCA 1HVVA 3BATA 2KNCB 2FIBA 2XNDH 3H1JD 1JY2N 2N9BA 3RL0C 1KILC 2RKLA 3EFGA 1UIXA 4BRYA 3AE9C 2FY8A 2XKMA 1FZFB 1CSBA 3P32A 3KZIH 3FWLA 4JZCA 3Q5PA 3M0DA 1OW6A 4DT0A 3PLNA 1RH5B 4NPFX 2WT7A 1SQPD 1NTMK 1PP9E 1M1JC 1N7LA 2WPVB 1SQQE 1MFZA 1FZEB 3G71P 1YJWP 1PGOA 4D6TJ 3CCUP 1PZQA 3RL0g 3GLMA 2IBZE 2IFMA 1VF5B 1K9MQ 1H0TA 1SQVE 3AE5C 3CWBD 1S1CX 3RBZA 2QSIA 1VQ7P 3CPWO 3GF7A 3I56P 1LTSC 5L8RJ 1S9KD 1RHZB 1LGHB 1GL2A 2E76B 4ZNCA 2OQQA 2JP3A 4WY4B 1Z3UA 1SQXK 1SQVG 1VQMP 3CC4P 2M8RA 5CHXA 4YXDC 1M1KQ 3F89A 3L71J 4R4MA 1EDIA 1Y47A 3H1KG 3BCCJ 1FZCC 1T8ZA 1VQNP 1K05A 3MD0A 1H89A 3MHVA 2W8ZA 1VQLP 2GY7A 2Q5UA 2R5DA 2PFXA 1JUNA 1SQBG 3E1IB 3PHLA 2QM7A 2OTJP 3MP7B 3N4XA 3O6QA 1N73B 1LWUA 2D39A 1M90Q 2ZVNB 1LP1A 2Y0CA 1YIJP 4JBZA 1X9VA 4PV1B 2QIWA 2XNXB 1USDA 1JEKA 1IK7A 2XNXA 1BGYJ 2FXPA 1ZR2A 3G9RA 2WSCJ 3A7OA 3H1LE 1DEBA 1N7SD 1EZVD 1A02F 2IZ1A 3CCSP 1GL2C 3V2NA 3NFQA 2D2CC 3B8EB 3H1LJ 5AW0B 3G3ZA 1P84H 5AW3B 3SWKA 3L70J 1AV1A 3KYQA 4H13B 2R32A 1JY2P 3CCEP 1KD1Q 3Q1MA 4BXLA 3NMDA 5B66E 2H43C 1MFTA 1BDCA 3TNUB 3L73D 1RQUA 3SSUA 3TNUA 4WBAA 3A0BH 4I2LC 3N7NA 1R5LA 4YXWH 5K5GB 2HLOC 5H2FE 5CJ0A 2H89C 2R44A 1HBWA 2KUBA 2IBZI 2OTLP 2Y9YA 2YMYA 1KYOI 3M0DC 1OMIA 1NTKJ 2WQYC 3O8ZA 5BVZA 2M3EA 1FZEC 2Q9IC 4PD4I 1DX7A 1EXIA 5KAFH 3M06A 4U3FG 5H2FH 1G2CA 1J1EB 1DD4A 1QVFO 3OW2O 1M56D 2D2CD 3M9HA 2HR3A 2IYPA 1FDMA 1YBKA 2FXMA 3KZIE 1RY3A 3TF5A 1NKZB 1TU3F 1JCCA 4GOEA 2XV5A 1W2EA 1OIPA 3B5NB 2Y9ZA 2M3BA 3CCRP 3IAOA 4PJ0E 1GK4A 3VMXA 1L0LG
chains in the Genus database with same CATH topology
3P8CE 2NPSC 2XDJA 3HE5B 5AW8B 4WY4C 1FOSF 3HD7A 3KDPB 2JHIF 1L0LK 1LT9C 1NKNA 2I1KA 1FZFC 4ZFGA 2MJZA 4W7ZA 2C9NY 2J1GA 3VMYA 2HODC 1FU1A 1Z56A 2HLOA 2L5GB 4C7NB 3TYYA 4M7HA 2OYIA 1RE3C 2WPSA 2XU6A 2YO3A 4Y99B 1FOSE 2NPSA 1LT9B 3MTUE 1JCDA 2IFNA 2OYHA 4OH8B 1JY3N 1IFNA 4W80A 1NTKK 2E42A 4IFDK 1T3UA 3LIDA 1NU1K 1FZAA 3II6A 3PP5A 4IFMA 1L4AC 5AW2B 1JMMA 1IFIA 1LTAC 1YTZT 1HH0A 2YKPA 1URQD 3HTKA 1LTBC 1HJBA 2H43B 3NTNA 1GTWA 4IFFA 4WB4A 1X79B 3GHGC 1N73A 2J3FD 2Z5IA 3B5NA 5APTA 1EQ7A 2Q7CA 2C9LY 1FAVA 3T97A 4JYOX 4NYTA 3RK2D 1H88A 2XZRA 5AVQB 1J1EC 5APSA 5KJ7A 3U1CA 3BVHB 3IFMA 3V4WA 3L37A 1A02J 3CL3D 2J2PA 1XTGB 3WMM0 2C0XA 1GL2D 2P1JA 1N7SA 5AW4B 1IK9A 1GK6A 1GW3A 4M3LA 2KYVA 4R9JA 2IX7C 1NO4A 3EQ2A 1SQVK 3RK2B 2W6BA 1FZBB 4ZKPA 5BU5A 4XE5B 2Z4EC 3BRVB 1J2JB 3BVHA 5APUA 5APVA 3H32C 4C7RA 4LLHA 5AVYB 1FBMA 4AQRD 5CJ4A 2GM4A 5AW6B 3VP8A 2R5BA 4DZOA 1RE4B 3HD7B 1SFCA 3OA7A 3P8MC 1NH4A 2O1KA 1GL2B 1HGVA 4GIFA 2WZ7A 1IO4A 3IR9A 2HG5D 3TSIA 3BASA 1QL2A 3BRTB 1FZGA 1G1IA 2LKMA 5AVTB 2A45I 2H43A 1QL1A 3M9QA 2Z4EA 3A5TA 5CCHD 2JHHC 4GT1A 5APXA 2E43A 1H8AA 1ZV8A 1SLQA 1N7SC 1JY3P 2JEEA 4JYCA 4KHXA 1N86C 3E1IC 3HUSC 1LTIC 1LT9A 2P67A 3HUSB 2FKWB 3HRNA 2O01H 3B5NC 3LIEA 3SWFA 1HVVA 1HGZA 2HFED 3BATA 3GHGB 1JC9A 3V2PA 1KILD 2WWWA 2FIBA 5KTBA 1JY2N 2N9BA 5KJ7C 3RL0C 3L36A 1KILC 3RL0B 3EFGA 1URQA 2YKOA 4XA4A 2XKMA 2YKQA 1FZFB 1CSBA 2J0GA 3P32A 1JO5A 2J3OA 1SP4A 1KILA 4JZCA 3M0DA 2WSFH 1L4AB 1FJKA 2WT7A 1NTMK 3VN0A 3RK2C 2NPSD 1M1JC 1N7LA 5CCHA 2HODA 1N86A 3A2AA 3E1IA 2J3UA 1MFZA 3P8CD 1FZEB 5KLVK 3MUDA 3TK1A 1SFCB 2N1TB 1YTZI 4DOJA 1FICA 1LTGC 2IFMA 2FYUK 1RF0B 3KQGA 4N6JA 1AQ5A 1FZBC 1CW5A 2J61A 1FZBA 2H8PD 1SFCC 2GUSA 1PFIA 3P7KA 1JTHB 3OJAB 4WY4D 1SFCD 2C0WA 1XTCC 4LC1A 1FIBA 1LTSC 1S9KD 4WY4A 4O9BA 3M91A 3BVHC 2Z4EB 1LGHB 2I1JA 1GL2A 2WSCH 1CI6A 2O1JA 2A45G 2HODB 1RE4C 4R9TA 3C9IA 2P7JA 2WITA 2VRSA 4WY4B 1LTJC 1Z3UA 1ZR4A 1SQXK 1IFJA 3HE4B 1J1DB 1MUUA 3VMZA 1VDFA 4N3YB 2GUVA 3H32B 1LTJA 1AFOA 5BU8B 2WTYA 1SQQK 4AYCA 2QM8A 2M8RA 5CHXA 3U59A 1OXZA 3B5ND 2JHLF 4I6MC 1RE3B 2JHMF 1WT6A 2OARA 1KZUB 1YYCA 2FFDA 4RESB 3U1AA 1FZCC 1T8ZA 4M7FA 2CPBA 3KPEA 3MD0A 1RE3A 2WNPF 1FJPA 1JOCA 1H89A 1MV8A 5AW7B 1JNMA 1Z3SA 2HPCB 2A45H 2JJLA 4EOTA 1JY3O 2J58A 3HUSA 2GY7A 1IJDB 2Q5UA 2N1TA 2R5DA 5AW5B 3FIBA 3HE5A 1JUNA 2JHKF 1WRGA 2WT7B 4GKGA 5CCGC 5AVWB 1N86B 3E1IB 2KOGA 3VTPC 2QM7A 1M1JB 3V4QA 1NWQA 3MGNA 1N73C 3N4XA 1N73B 1LWUA 2P2UA 2D39A 1FZGB 1M7LA 1FZAB 4I1LA 2XNXC 2J5ZA 2PP6A 2HPCA 3VYIA 1RF0C 1FZFA 1X9VA 5CMZA 1RF1B 1URQB 5AVUB 2KLVA 2J0YA 2BASA 3OAKA 5AVSB 2IPPA 3HD7D 2XNXB 3R2PA 4N78E 2OYIB 1JY2O 5APQA 1JTHA 2XNXA 1N2DC 1VPCA 2FFDB 1LTJB 3M9BA 3V2QA 1ZR2A 3LW5H 3RK3C 1URQC 3A7OA 3CI9A 3SWYA 1L0NK 2HYNA 1SQBK 3UIAA 1DEBA 2CPSA 1DH3A 4ZKUA 1N7SD 1GDTA 1GZLA 1FZCA 5AW1B 1A02F 3A3YB 3VOPA 1FZCB 1M1JA 2Z5HA 1G1JA 1GL2C 2WPRA 5AVZB 5AVRB 3V2NA 3NFQA 1T2KC 1IFMA 3B8EB 5AW0B 2KP8A 2PAJA 2R3CA 5KJ7D 2J0HA 1L4AA 3G3ZA 4B86A 5AW9B 5AW3B 3KYQA 1N7SB 3V5BA 2R32A 1JY2P 2Q9IA 1GD2E 2J3FA 3NMDA 1OWAA 1NAFA 2H43C 1KFNA 2J3GA 3TNUB 2J60A 1T2KD 1X8YA 1GU5A 3TNUA 1FZGC 4WBAA 2J64A 1IFDA 3H6PA 3N7NA 4I2LC 4C7NA 5CCGD 1GU4A 3L4FA 1MZ9A 4W7YA 4JYBA 1RF0A 2NPSB 2J59M 1G2CB 4HYTB 3V2RA 1J1DC 5APYA 1NHLA 1GW4A 5CCHC 2HLOC 4AUWA 1SQPK 1SVFA 2N1TD 5CJ0A 2HLOB 2HPCC 1LWUB 1HUCA 1LWUC 1KQLA 1HBWA 3H32A 2YNYA 3M0AA 1LTTC 2OYHC 2W27A 2YMYA 3HTKB 4HH2A 4Y99C 2KSJA 5CCGA 1KILB 3M0DC 1ZN5A 2W6AA 4C46A 2ZFCA 1NOHA 3L35A 4EIJA 3O8ZA 5BVZA 3RK3B 3RL0D 5APWA 1FZEC 2Q9IC 4JF7A 2N1TC 1CI6B 2POHA 1KFMA 1HTLC 2OYHB 3I5CA 1DX7A 3M06A 4N78D 1FIDA 3HD7C 3NXSA 1G2CA 5AVXB 3GHGA 1J1EB 1L4AD 2WSEH 1S9KE 2FFDC 2Q3IA 3M9HA 1RF1C 1FDMA 2Q9IB 2FXMA 3CLQA 2KB7P 3RK3D 1IC2A 1RY3A 1FZAC 2FYZA 1RF1A 2J61B 1E5WA 1NKZB 5AVVB 1NTZK 1JCCA 1ZLLA 1T3JA 2WPQA 2YO2A 2XV5A 1W2EA 3VP9A 2ZXEB 3HE4A 4LGDE 3B5NB 2M3BA 1HWTC 3MIWA 4EPUA 1FZDA 2H7HA 1FZEA 1RE4A 2OYIC 1CZQA 1GK4A 3VMXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FZG A;  1LTJ C;  1Z3U A;  2J0H A;  2JHI F;  2A45 I;  1LT9 C;  2H43 A;  1FZF C;  2Z4E A;  4ZFG A;  2JHH C;  3H32 B;  1LTJ A;  2J1G A;  2HOD C;  1JY2 P;  1JY3 P;  2HLO A;  2Q9I A;  1N86 C;  2J3F A;  2JHL F;  3HUS C;  1RE3 B;  2JHM F;  3E1I C;  2H43 C;  1LT9 A;  2OYI A;  1RE3 C;  3HUS B;  4M7H A;  2J3G A;  3GHG B;  2J60 A;  2FFD A;  1FZC C;  1FZG C;  4M7F A;  1JC9 A;  1LT9 B;  2J64 A;  1RE3 A;  2OYH A;  2WNP F;  2FIB A;  1JY3 N;  1JY2 N;  1RF0 A;  1Z3S A;  2HPC B;  2A45 H;  1JY3 O;  3HUS A;  2GY7 A;  1T3U A;  2HLO C;  1FZF B;  1FZA A;  2HLO B;  2J0G A;  2HPC C;  2J3O A;  1LWU B;  3FIB A;  2JHK F;  1LWU C;  4JZC A;  3H32 A;  1N86 B;  3E1I B;  2H43 B;  2OYH C;  1M1J B;  1N73 C;  3GHG C;  1N73 B;  1N73 A;  1LWU A;  2J3F D;  2D39 A;  1FZG B;  1FZA B;  2XNX C;  2J5Z A;  1M1J C;  4JYO X;  4NYT A;  1FZE C;  2HOD A;  1N86 A;  3E1I A;  2Q9I C;  2J3U A;  1FZE B;  2HPC A;  1RF0 C;  3BVH B;  2OYH B;  1FIC A;  1FZF A;  1RF1 B;  1FID A;  2J0Y A;  2J2P A;  3GHG A;  1RF0 B;  2FFD C;  2XNX B;  2OYI B;  1FZB C;  1RF1 C;  1JY2 O;  2J61 A;  2Q9I B;  2XNX A;  1FZB A;  2FFD B;  1LTJ B;  4R9J A;  1FZA C;  1FZB B;  1RF1 A;  2Z4E C;  2J61 B;  3BVH A;  1FIB A;  3H32 C;  3BVH C;  1W2E A;  2Z4E B;  1RE4 B;  1FZC A;  4EPU A;  1FZD A;  1FZE A;  1FZC B;  1RE4 A;  2A45 G;  2HOD B;  1M1J A;  2OYI C;  1RE4 C;  4R9T A; 
#chains in the Genus database with same CATH topology
 4WY4 C;  1FOS F;  3HD7 A;  3KDP B;  2YIU C;  2I1K A;  2B9B A;  4ZFG A;  2MJZ A;  1FZF C;  1AVY A;  1JB0 J;  3VMY A;  1X22 A;  4C7N B;  1KMI Z;  2AXT E;  4OVN F;  2OYI A;  3BCC G;  4M7H A;  2FYN C;  3CME P;  4Y99 B;  1BE3 E;  2FYU G;  5GTH H;  1LT9 B;  1NGM B;  1JCD A;  1QEX A;  1IFN A;  5TIS H;  1BCC D;  2KIK A;  1OW7 A;  1NTK K;  1T3U A;  3RBX A;  4NPD A;  3II6 A;  3L71 G;  1YTZ T;  1VF5 C;  2H43 B;  2JWD A;  2BCC J;  4IL6 E;  3WU2 E;  3H1H G;  4OGQ D;  3O6Q B;  1N73 A;  2J3F D;  3L75 G;  2C9L Y;  3T97 A;  1OW8 A;  3AE3 C;  1EDL A;  3BVH B;  1YQ4 C;  3A0H E;  1OVR A;  4CPG A;  3WMM 0;  1LNQ A;  1QX8 A;  1GL2 D;  2P1J A;  5AW4 B;  3TGU D;  2WVR A;  2W6B A;  4ZKP A;  4NPE A;  5BU5 A;  2Z4E C;  3H1J E;  4K35 A;  4AQR D;  5CJ4 A;  2GM4 A;  5AW6 B;  4DZO A;  1NU1 G;  1SQX D;  3OA7 A;  3L70 E;  3P8M C;  1NH4 A;  5B5E E;  3WUU A;  1HGV A;  3EFF K;  2HG5 D;  3TSI A;  1QL2 A;  1HF9 A;  3CCQ P;  1SQX J;  3L70 G;  5AVT B;  2A45 I;  3H1I E;  3M9Q A;  3A5T A;  4H0L D;  1ZV8 A;  2QJY B;  2E5T A;  3E1I C;  4KHX A;  1LTI C;  1ZW0 A;  3HUS B;  3HRN A;  3LIE A;  1HGZ A;  2E75 C;  3V2P A;  3IF4 A;  1VQO P;  5KTB A;  3GG2 A;  2K1A A;  3L36 A;  3RL0 B;  2W83 C;  2FBW C;  1URQ A;  2YKO A;  4XA4 A;  1JO5 A;  2J3O A;  2GA1 A;  1NTK D;  1L4A B;  1BGY G;  1L0N G;  2NPS D;  2BCC D;  3H25 A;  5E79 H;  5CCH A;  1N86 A;  3P8C D;  3TK1 A;  1SFC B;  5CBN A;  1VL2 A;  2FYU K;  1RF0 B;  3KQG A;  4N6J A;  1AQ5 A;  1FZB C;  5TJH A;  2AEJ A;  1CW5 A;  4EDF A;  1KN7 A;  2WSF J;  2J61 A;  1SQX G;  1NTZ J;  2H8P D;  3ZDM A;  1SFC C;  2K88 A;  3FXE A;  4IL6 H;  1M57 D;  3OJA B;  4WY4 D;  1N8R Q;  2PGD A;  2C0W A;  3BCC E;  2W6J H;  1FIB A;  3L70 D;  3L74 G;  2Z4E B;  2QA4 P;  2ITA A;  4L76 A;  2O1J A;  1USE A;  2HOD B;  1KV4 A;  2RMZ A;  4R9T A;  1LTJ C;  1ZR4 A;  1IFJ A;  1J1D B;  1MUU A;  3VMZ A;  4H44 C;  2UWJ E;  3H32 B;  1LTJ A;  1AFO A;  1NTZ G;  2QEX P;  2WTY A;  2QE7 H;  3U59 A;  1OXZ A;  1YHQ P;  4I6M C;  1RE3 B;  2JHM F;  1WT6 A;  2FYU J;  1KZU B;  1SQQ G;  2FFD A;  2B89 A;  1AQT A;  3U1A A;  4M7F A;  3KPE A;  3L72 G;  1NTK G;  4PD4 D;  1FJP A;  1ZOY C;  1U7J A;  5AW7 B;  1JNM A;  1Z3S A;  3W67 A;  1SQV J;  5GTI H;  2BCC G;  1JY3 O;  2RN0 A;  4UB6 E;  1OVU A;  2N1T A;  3FIB A;  1PPJ E;  3S9O A;  1NAY A;  2V4H A;  3FXD A;  1FZA B;  2XNX C;  1FC2 C;  1L2P A;  2HPC A;  4GOF A;  2ZXX A;  3ITK A;  2SPZ A;  5CMZ A;  1RF1 B;  2BAS A;  3L74 D;  3OAK A;  5AVS B;  4Z1M H;  4N78 E;  2OYI B;  1Q81 Q;  1ZRT E;  1JY2 O;  2QJP C;  2JKV A;  1N2D C;  2FFD B;  3V2Q A;  3LW5 H;  2O01 N;  1URQ C;  2FXO A;  2CK3 H;  2HYN A;  1SQB K;  2KK7 A;  4DCK A;  1DH3 A;  4ZKU A;  4Y28 J;  3D6Y A;  3Q5S A;  1FZC A;  1FZC B;  5AVR B;  1EXJ A;  1NJI Q;  1T2K C;  1SQQ D;  1SQP E;  2PAJ A;  2R3C A;  2J0H A;  1L4A A;  2YIU B;  1OWA A;  1VQ8 P;  1KFN A;  3R4Y A;  4RO0 A;  3TGU J;  2J60 A;  2J64 A;  5CCG D;  4C7N A;  3AE7 C;  3L72 E;  1MZ9 A;  4W7Y A;  1RF0 A;  2R3S A;  2J59 M;  1G2C B;  1T6A A;  4HYT B;  3V2R A;  4AUW A;  2KXP B;  1SQP K;  4U7J A;  2HLO B;  1NTK E;  1HUC A;  2WMM A;  5GTH E;  1LTT C;  5B5E H;  3GW6 A;  2W27 A;  2AXT H;  4HH2 A;  4Y99 C;  2KSJ A;  2I8D A;  5CCG A;  4C46 A;  2ZFC A;  3L35 A;  4EIJ A;  1ZXG A;  1NVO A;  1PP9 D;  3CC2 P;  1KFM A;  2OYH B;  4N78 D;  1VQK P;  3HD7 C;  1NU1 E;  5C39 A;  1L4A D;  1S9K E;  1BSN A;  2Q3I A;  1RF1 C;  1EZV G;  1SS1 A;  3L74 J;  1IFP A;  3CXH D;  2J61 B;  1NTZ K;  1RQV A;  1OFC X;  1T3J A;  3K5B A;  3HE4 A;  3KXD A;  1HWT C;  3MIW A;  4EPU A;  3CX5 D;  2E75 B;  1RE4 A;  2OYI C;  3JC2 2;  5DJT B;  2FYN B;  1VQP P;  3PTZ A;  4U3F D;  3V6I A;  1LT9 C;  1NKN A;  1KB9 E;  5TIS E;  4W7Z A;  2IYO A;  1EDK A;  3AED C;  1FU1 A;  1Z56 A;  1KB9 H;  3TYY A;  1NTM E;  1RE3 C;  1YJN P;  1S2E A;  2KZI A;  2YO3 A;  4H13 C;  2YMK A;  2B87 B;  5KAI E;  1L0N J;  4OH8 B;  2ZT9 D;  2N9Y B;  3CD6 P;  3QH9 A;  2E42 A;  3G6E P;  2FYU E;  3C8V A;  3LID A;  1FS0 E;  3PP5 A;  1EZV E;  4IFM A;  3WUV A;  1L4A C;  5AW2 B;  1LTA C;  1PP9 G;  1HH0 A;  4D6T G;  2BEZ F;  1BCC E;  3B5N A;  2ZT9 B;  1EQ7 A;  1EDJ A;  4BRY B;  4NYT A;  4KT0 J;  3TGU E;  5KJ7 A;  1NTM D;  3IFM A;  1ZRT D;  1BE3 D;  4OGQ C;  1FE6 A;  2C0X A;  1S4X A;  1IK9 A;  1GK6 A;  2KYV A;  2IX7 C;  3RK2 B;  1FZB B;  4HB1 A;  4JPZ B;  4XE5 B;  1J2J B;  1NTM J;  1KQS O;  4KJM A;  3G4S P;  4C7R A;  4LLH A;  1PPJ D;  2KZJ A;  5AVY B;  3VP8 A;  2R5B A;  1RE4 B;  2O1K A;  2MKV A;  1SQB J;  1IO4 A;  3H1K J;  2V7Q J;  1SQP G;  2O3J A;  2H43 A;  1QL1 A;  2JHH C;  2ZVO B;  2JEE A;  1N86 C;  1S5L H;  2RH0 A;  3HUS C;  2B87 A;  3SWF A;  2ZYG A;  1JC9 A;  1KIL D;  2WWW A;  3H1H D;  5KJ7 C;  4H0L B;  2YKQ A;  2J0G A;  4GOD A;  1SP4 A;  4UB6 H;  2KS1 A;  1FJK A;  3RK2 C;  3F5H A;  2HOD A;  3A2A A;  3E1I A;  5KLV K;  3H1L G;  4YTP C;  3AEF C;  4DOJ A;  1FIC A;  1LTG C;  1PPJ G;  5KLV D;  1FZB A;  3CX5 H;  2GUS A;  1PFI A;  3P7K A;  1KYO D;  1XTC C;  4BWN A;  4O9B A;  3BVH C;  1U7M A;  2I1J A;  1VF5 D;  2WSC H;  1CI6 A;  3AE8 C;  2A45 G;  1PGQ A;  2LXB A;  4U3F E;  1YQ3 C;  2YXQ B;  3C9I A;  3FGA D;  4OWF A;  1FDO A;  1AA0 A;  2ZAE B;  4YPC A;  5BU8 B;  4AYC A;  2QM8 A;  1SQB E;  2JHL F;  2OAR A;  1YYC A;  1DIP A;  4RES B;  1RE3 A;  1W2B O;  2QVA A;  2JDI H;  1JOC A;  5KLV J;  1MV8 A;  1LP1 B;  2A45 H;  2JJL A;  4EOT A;  2J58 A;  3HUS A;  5AW5 B;  3HE5 A;  4HJG H;  1WRG A;  4GKG A;  2K9J A;  5CCG C;  5AVW B;  1S72 P;  2KOG A;  3H1I J;  3VTP C;  2A06 G;  3MGN A;  1SQX E;  2P2U A;  3C1L A;  2PP6 A;  1RF0 C;  1BGY E;  4H0L C;  1R8E A;  1FZF A;  4ASW A;  2AEF A;  2J5U A;  3H1J J;  3HD7 D;  1JTH A;  2QJP B;  1VQ4 P;  3AEA C;  1LTJ B;  3AE6 C;  3L73 G;  2Y0D A;  1LJ2 A;  3Q5R A;  3CWB E;  5CBO A;  4H44 B;  3SWY A;  1L0N K;  3UIA A;  2CPS A;  2E5Y A;  1GZL A;  3A3Y B;  1SQP J;  3D70 A;  2Z5H A;  5AVZ B;  1OVV A;  5DJU B;  1D7M A;  2QG4 A;  4ZMD A;  5KJ7 D;  4R4L A;  2E74 B;  4B86 A;  3H1I G;  3IN6 A;  1L0L E;  3B4S A;  3V5B A;  2Q9I A;  2IDB A;  4EI2 A;  2J3G A;  3CC7 P;  4K3A A;  1T2K D;  1X8Y A;  1FZG C;  1KB9 I;  1GU4 A;  3GF3 A;  4JYB A;  1BE3 J;  3L75 J;  5APY A;  1GW4 A;  1Q90 D;  1SVF A;  4H13 D;  2BCC E;  2N1T D;  3PRJ A;  3M0A A;  1HJ0 A;  2ZT9 C;  3HTK B;  1NU1 J;  1ZN5 A;  2W6A A;  1K73 Q;  1NOH A;  2M0B A;  1EC5 A;  3S4R A;  4JF7 A;  1W5C E;  1FID A;  3NXS A;  1DD3 A;  5AVX B;  3GHG A;  3EWK A;  2FFD C;  2WSE H;  4I7Z B;  1KYO E;  4D6T E;  3CLQ A;  3RK3 D;  1FZA C;  2FYZ A;  2FYU D;  1RF1 A;  4PD4 E;  5AVV B;  2E74 C;  1AJY A;  1PP9 J;  2JR8 A;  2WPQ A;  3CX5 E;  4I7Z C;  3VP9 A;  2ZXE B;  1QVG O;  1S3J A;  2ZYA A;  2DW3 A;  1CZQ A;  2K9J B;  2K37 A;  2XDJ A;  5AW8 B;  2JHI F;  1L0L K;  1U57 A;  3MUD C;  1KQG B;  4GDO A;  1P84 I;  1L0N E;  1FOS E;  2NPS A;  3MTU E;  2KSE A;  1Q2N A;  2OYH A;  3KHU A;  3AEE C;  4WWI A;  4W80 A;  4IFD K;  3T97 B;  1Y8A A;  1BSH A;  2OTK E;  1NU1 K;  5KLI B;  4EYY Q;  3A0H H;  1URQ D;  3B71 A;  3HTK A;  1GTW A;  2QRX A;  1X79 B;  4DJG A;  3JCU E;  2QJK B;  3A0B E;  2Q7C A;  4JYO X;  1FAV A;  3WU2 H;  2LR2 A;  3RK2 D;  1H88 A;  2XZR A;  3QWO C;  5AVQ B;  1J1E C;  1EZV I;  4QMA A;  3U1C A;  3L37 A;  4PV1 C;  1A02 J;  1R5S A;  1XTG B;  4WVZ A;  2W90 A;  4OGQ B;  4JQ0 D;  4HKZ H;  1BCC G;  4M3L A;  3EQ2 A;  4A7P A;  3L71 D;  4L74 A;  1KIL E;  3BVH A;  4D6T D;  5APU A;  5APV A;  3H32 C;  4TT3 H;  3H1J G;  5M1B A;  3CCJ P;  5KAI H;  3HD7 B;  4UB8 H;  3CWB G;  2JO1 A;  2QJY C;  4IOI H;  4GIF A;  2WZ7 A;  3IR9 A;  3BAS A;  3BRT B;  1NTM G;  3AE2 C;  3FWN A;  2Z4E A;  1BCC J;  1H8A A;  1SLQ A;  4JYC A;  1QLE D;  2P67 A;  3PH0 A;  2HFE D;  2YXR B;  3GHG B;  4MN4 C;  4RKU J;  1VQ5 P;  2A06 E;  3L71 E;  1ZP0 C;  1KIL A;  3H1K D;  2WSF H;  2M5A A;  2AEM A;  1BE3 G;  3CXH I;  3VN0 A;  4TLF A;  1Q86 Q;  2IZ0 A;  2J3U A;  3MUD A;  2N1T B;  2ZYD A;  1YTZ I;  3CX5 I;  2Q1K A;  1VQ6 P;  2BEQ D;  1SQV D;  2K9Y A;  3H1H J;  1NTZ D;  4L75 A;  2IBZ D;  3JCU H;  1PV3 A;  1PGJ A;  1JTH B;  1SFC D;  3L72 D;  1S5L X;  3L74 E;  4LC1 A;  3CCL P;  4WY4 A;  5B66 H;  1S5L E;  3H1K E;  3D6Z A;  3M91 A;  1KB9 D;  2D2C B;  4ASV A;  3D71 A;  1SQB D;  1RE4 C;  2P7J A;  2WIT A;  2B88 A;  2VRS A;  3HE4 B;  1VDF A;  4N3Y B;  2GUV A;  2Q6Q A;  1Y9B A;  1SQQ K;  2KLU A;  2E76 D;  2OGU A;  3B5N D;  1OZH A;  2K3R A;  3L73 J;  2CPB A;  3WUT A;  2WNP F;  2L91 A;  2HPC B;  1K04 A;  1IJD B;  2JHK F;  3H1L D;  2WT7 B;  4PV1 D;  1N86 B;  2Y0E A;  1M1J B;  3V4Q A;  1NWQ A;  1N73 C;  2LXC B;  1LT1 A;  1FZG B;  5KLV G;  1M7L A;  4I1L A;  2J5Z A;  2IBZ G;  1ZME C;  2KS1 B;  3VYI A;  3SFD C;  3L72 J;  1URQ B;  5AVU B;  2AXC A;  2KLV A;  2J0Y A;  2H88 C;  2IPP A;  3R2P A;  1VQ9 P;  4UB8 E;  5APQ A;  1X0T A;  5EFW B;  1VPC A;  4L73 A;  1FDI A;  4IL6 X;  3M9B A;  3Q3D A;  5KAF E;  1MKM A;  3RK3 C;  2P10 A;  2ZJS E;  3CI9 A;  1P84 D;  5E79 E;  3JSV C;  2E74 D;  3AE1 C;  1GDT A;  5AW1 B;  3VOP A;  1M1J A;  1G1J A;  1JMB A;  2WPR A;  1IFM A;  3AEB C;  2KP8 A;  1PL5 A;  3SFE C;  5AW9 B;  3USS A;  3W68 A;  2G3A A;  3L73 E;  1N7S B;  1DEE G;  1GD2 E;  2J3F A;  3E7K A;  2WSE J;  1KTM A;  1NAF A;  3L75 E;  1L0L D;  1GU5 A;  2A06 D;  1IFD A;  3H6P A;  3L4F A;  5KLI C;  2NPS B;  5GTI E;  3RK3 E;  3VMA A;  1J1D C;  1NHL A;  2PRR A;  5CCH C;  3E1R A;  1UII A;  2HPC C;  1LWU B;  1LWU C;  1KQL A;  3H32 A;  2YNY A;  1SQQ J;  1KYO H;  3AEC C;  2OYH C;  1YIT P;  1KIL B;  3FX0 A;  1KQF B;  3H1I D;  3RK3 B;  3RL0 D;  5APW A;  1IZN B;  1CI6 B;  2N1T C;  2POH A;  2G8Y A;  2WSS H;  1AVO A;  1HTL C;  3I5C A;  3RGU A;  3CWB J;  1BDD A;  2E75 D;  2Q9I B;  3BCC D;  1PGP A;  2KB7 P;  1IC2 A;  1L0L J;  1E5W A;  4PD4 H;  1Q7Y Q;  1ZLL A;  2YO2 A;  1P84 E;  4LGD E;  1M8O B;  1FZD A;  2H7H A;  1FZE A;  3I55 P;  3S1K A;  3P8C E;  2NPS C;  3HE5 B;  2V7Q H;  3PJS K;  3AE4 C;  1KC8 Q;  3L75 D;  2C9N Y;  2J1G A;  2HOD C;  4RJT A;  1NTZ E;  2HLO A;  2L5G B;  2O01 J;  3TDK A;  1YI2 P;  2WPS A;  2XU6 A;  1KOR A;  2JWA A;  3ABV C;  2IFN A;  1PIX A;  1JY3 N;  3CXH E;  3TGU G;  1FZA A;  1Q82 Q;  1JM0 A;  3CCM P;  1JMM A;  1IFI A;  5KKZ B;  2YKP A;  1LTB C;  1HJB A;  3NTN A;  3Q2Y A;  4IFF A;  4WB4 A;  3GHG C;  1NU1 D;  2Z5I A;  5APT A;  2M5A B;  5KKZ C;  2P58 A;  1E79 H;  5APS A;  4H44 D;  5KLV E;  3V4W A;  3CCV P;  1WMK A;  3GMA A;  3CL3 D;  2NRG A;  2J2P A;  2QJK C;  1BGY D;  2OYO A;  3CXH H;  1H0T B;  1L0N D;  2KI7 B;  1N7S A;  1NYH A;  1GW3 A;  4R9J A;  1NO4 A;  1SQV K;  3BRV B;  3AEG C;  2Q3E A;  3H1H E;  1FBM A;  1K8A Q;  1OX3 A;  3MZW B;  4U3F J;  1SFC A;  3LW5 J;  3CMA P;  1GL2 B;  2NZ2 A;  1QGK B;  1GMJ A;  1YJ9 P;  1FZG A;  1G1I A;  2LKM A;  5CCH D;  4XFJ A;  4GT1 A;  5APX A;  2E43 A;  1N7S C;  1JY3 P;  1LT9 A;  4PJ0 H;  2FKW B;  2E76 C;  2O01 H;  3B5N C;  2KNC A;  1HVV A;  3BAT A;  2KNC B;  2FIB A;  2XND H;  3H1J D;  1JY2 N;  2N9B A;  3RL0 C;  1KIL C;  2RKL A;  3EFG A;  1UIX A;  4BRY A;  3AE9 C;  2FY8 A;  2XKM A;  1FZF B;  1CSB A;  3P32 A;  3KZI H;  3FWL A;  4JZC A;  3Q5P A;  3M0D A;  1OW6 A;  4DT0 A;  3PLN A;  1RH5 B;  4NPF X;  2WT7 A;  1SQP D;  1NTM K;  1PP9 E;  1M1J C;  1N7L A;  2WPV B;  1SQQ E;  1MFZ A;  1FZE B;  3G71 P;  1YJW P;  1PGO A;  4D6T J;  3CCU P;  1PZQ A;  3RL0 g;  3GLM A;  2IBZ E;  2IFM A;  1VF5 B;  1K9M Q;  1H0T A;  1SQV E;  3AE5 C;  3CWB D;  1S1C X;  3RBZ A;  2QSI A;  1VQ7 P;  3CPW O;  3GF7 A;  3I56 P;  1LTS C;  5L8R J;  1S9K D;  1RHZ B;  1LGH B;  1GL2 A;  2E76 B;  4ZNC A;  2OQQ A;  2JP3 A;  4WY4 B;  1Z3U A;  1SQX K;  1SQV G;  1VQM P;  3CC4 P;  2M8R A;  5CHX A;  4YXD C;  1M1K Q;  3F89 A;  3L71 J;  4R4M A;  1EDI A;  1Y47 A;  3H1K G;  3BCC J;  1FZC C;  1T8Z A;  1VQN P;  1K05 A;  3MD0 A;  1H89 A;  3MHV A;  2W8Z A;  1VQL P;  2GY7 A;  2Q5U A;  2R5D A;  2PFX A;  1JUN A;  1SQB G;  3E1I B;  3PHL A;  2QM7 A;  2OTJ P;  3MP7 B;  3N4X A;  3O6Q A;  1N73 B;  1LWU A;  2D39 A;  1M90 Q;  2ZVN B;  1LP1 A;  2Y0C A;  1YIJ P;  4JBZ A;  1X9V A;  4PV1 B;  2QIW A;  2XNX B;  1USD A;  1JEK A;  1IK7 A;  2XNX A;  1BGY J;  2FXP A;  1ZR2 A;  3G9R A;  2WSC J;  3A7O A;  3H1L E;  1DEB A;  1N7S D;  1EZV D;  1A02 F;  2IZ1 A;  3CCS P;  1GL2 C;  3V2N A;  3NFQ A;  2D2C C;  3B8E B;  3H1L J;  5AW0 B;  3G3Z A;  1P84 H;  5AW3 B;  3SWK A;  3L70 J;  1AV1 A;  3KYQ A;  4H13 B;  2R32 A;  1JY2 P;  3CCE P;  1KD1 Q;  3Q1M A;  4BXL A;  3NMD A;  5B66 E;  2H43 C;  1MFT A;  1BDC A;  3TNU B;  3L73 D;  1RQU A;  3SSU A;  3TNU A;  4WBA A;  3A0B H;  4I2L C;  3N7N A;  1R5L A;  4YXW H;  5K5G B;  2HLO C;  5H2F E;  5CJ0 A;  2H89 C;  2R44 A;  1HBW A;  2KUB A;  2IBZ I;  2OTL P;  2Y9Y A;  2YMY A;  1KYO I;  3M0D C;  1OMI A;  1NTK J;  2WQY C;  3O8Z A;  5BVZ A;  2M3E A;  1FZE C;  2Q9I C;  4PD4 I;  1DX7 A;  1EXI A;  5KAF H;  3M06 A;  4U3F G;  5H2F H;  1G2C A;  1J1E B;  1DD4 A;  1QVF O;  3OW2 O;  1M56 D;  2D2C D;  3M9H A;  2HR3 A;  2IYP A;  1FDM A;  1YBK A;  2FXM A;  3KZI E;  1RY3 A;  3TF5 A;  1NKZ B;  1TU3 F;  1JCC A;  4GOE A;  2XV5 A;  1W2E A;  1OIP A;  3B5N B;  2Y9Z A;  2M3B A;  3CCR P;  3IAO A;  4PJ0 E;  1GK4 A;  3VMX A;  1L0L G; 
#chains in the Genus database with same CATH homology
 3P8C E;  2NPS C;  2XDJ A;  3HE5 B;  5AW8 B;  4WY4 C;  1FOS F;  3HD7 A;  3KDP B;  2JHI F;  1L0L K;  1LT9 C;  1NKN A;  2I1K A;  1FZF C;  4ZFG A;  2MJZ A;  4W7Z A;  2C9N Y;  2J1G A;  3VMY A;  2HOD C;  1FU1 A;  1Z56 A;  2HLO A;  2L5G B;  4C7N B;  3TYY A;  4M7H A;  2OYI A;  1RE3 C;  2WPS A;  2XU6 A;  2YO3 A;  4Y99 B;  1FOS E;  2NPS A;  1LT9 B;  3MTU E;  1JCD A;  2IFN A;  2OYH A;  4OH8 B;  1JY3 N;  1IFN A;  4W80 A;  1NTK K;  2E42 A;  4IFD K;  1T3U A;  3LID A;  1NU1 K;  1FZA A;  3II6 A;  3PP5 A;  4IFM A;  1L4A C;  5AW2 B;  1JMM A;  1IFI A;  1LTA C;  1YTZ T;  1HH0 A;  2YKP A;  1URQ D;  3HTK A;  1LTB C;  1HJB A;  2H43 B;  3NTN A;  1GTW A;  4IFF A;  4WB4 A;  1X79 B;  3GHG C;  1N73 A;  2J3F D;  2Z5I A;  3B5N A;  5APT A;  1EQ7 A;  2Q7C A;  2C9L Y;  1FAV A;  3T97 A;  4JYO X;  4NYT A;  3RK2 D;  1H88 A;  2XZR A;  5AVQ B;  1J1E C;  5APS A;  5KJ7 A;  3U1C A;  3BVH B;  3IFM A;  3V4W A;  3L37 A;  1A02 J;  3CL3 D;  2J2P A;  1XTG B;  3WMM 0;  2C0X A;  1GL2 D;  2P1J A;  1N7S A;  5AW4 B;  1IK9 A;  1GK6 A;  1GW3 A;  4M3L A;  2KYV A;  4R9J A;  2IX7 C;  1NO4 A;  3EQ2 A;  1SQV K;  3RK2 B;  2W6B A;  1FZB B;  4ZKP A;  5BU5 A;  4XE5 B;  2Z4E C;  3BRV B;  1J2J B;  3BVH A;  5APU A;  5APV A;  3H32 C;  4C7R A;  4LLH A;  5AVY B;  1FBM A;  4AQR D;  5CJ4 A;  2GM4 A;  5AW6 B;  3VP8 A;  2R5B A;  4DZO A;  1RE4 B;  3HD7 B;  1SFC A;  3OA7 A;  3P8M C;  1NH4 A;  2O1K A;  1GL2 B;  1HGV A;  4GIF A;  2WZ7 A;  1IO4 A;  3IR9 A;  2HG5 D;  3TSI A;  3BAS A;  1QL2 A;  3BRT B;  1FZG A;  1G1I A;  2LKM A;  5AVT B;  2A45 I;  2H43 A;  1QL1 A;  3M9Q A;  2Z4E A;  3A5T A;  5CCH D;  2JHH C;  4GT1 A;  5APX A;  2E43 A;  1H8A A;  1ZV8 A;  1SLQ A;  1N7S C;  1JY3 P;  2JEE A;  4JYC A;  4KHX A;  1N86 C;  3E1I C;  3HUS C;  1LTI C;  1LT9 A;  2P67 A;  3HUS B;  2FKW B;  3HRN A;  2O01 H;  3B5N C;  3LIE A;  3SWF A;  1HVV A;  1HGZ A;  2HFE D;  3BAT A;  3GHG B;  1JC9 A;  3V2P A;  1KIL D;  2WWW A;  2FIB A;  5KTB A;  1JY2 N;  2N9B A;  5KJ7 C;  3RL0 C;  3L36 A;  1KIL C;  3RL0 B;  3EFG A;  1URQ A;  2YKO A;  4XA4 A;  2XKM A;  2YKQ A;  1FZF B;  1CSB A;  2J0G A;  3P32 A;  1JO5 A;  2J3O A;  1SP4 A;  1KIL A;  4JZC A;  3M0D A;  2WSF H;  1L4A B;  1FJK A;  2WT7 A;  1NTM K;  3VN0 A;  3RK2 C;  2NPS D;  1M1J C;  1N7L A;  5CCH A;  2HOD A;  1N86 A;  3A2A A;  3E1I A;  2J3U A;  1MFZ A;  3P8C D;  1FZE B;  5KLV K;  3MUD A;  3TK1 A;  1SFC B;  2N1T B;  1YTZ I;  4DOJ A;  1FIC A;  1LTG C;  2IFM A;  2FYU K;  1RF0 B;  3KQG A;  4N6J A;  1AQ5 A;  1FZB C;  1CW5 A;  2J61 A;  1FZB A;  2H8P D;  1SFC C;  2GUS A;  1PFI A;  3P7K A;  1JTH B;  3OJA B;  4WY4 D;  1SFC D;  2C0W A;  1XTC C;  4LC1 A;  1FIB A;  1LTS C;  1S9K D;  4WY4 A;  4O9B A;  3M91 A;  3BVH C;  2Z4E B;  1LGH B;  2I1J A;  1GL2 A;  2WSC H;  1CI6 A;  2O1J A;  2A45 G;  2HOD B;  1RE4 C;  4R9T A;  3C9I A;  2P7J A;  2WIT A;  2VRS A;  4WY4 B;  1LTJ C;  1Z3U A;  1ZR4 A;  1SQX K;  1IFJ A;  3HE4 B;  1J1D B;  1MUU A;  3VMZ A;  1VDF A;  4N3Y B;  2GUV A;  3H32 B;  1LTJ A;  1AFO A;  5BU8 B;  2WTY A;  1SQQ K;  4AYC A;  2QM8 A;  2M8R A;  5CHX A;  3U59 A;  1OXZ A;  3B5N D;  2JHL F;  4I6M C;  1RE3 B;  2JHM F;  1WT6 A;  2OAR A;  1KZU B;  1YYC A;  2FFD A;  4RES B;  3U1A A;  1FZC C;  1T8Z A;  4M7F A;  2CPB A;  3KPE A;  3MD0 A;  1RE3 A;  2WNP F;  1FJP A;  1JOC A;  1H89 A;  1MV8 A;  5AW7 B;  1JNM A;  1Z3S A;  2HPC B;  2A45 H;  2JJL A;  4EOT A;  1JY3 O;  2J58 A;  3HUS A;  2GY7 A;  1IJD B;  2Q5U A;  2N1T A;  2R5D A;  5AW5 B;  3FIB A;  3HE5 A;  1JUN A;  2JHK F;  1WRG A;  2WT7 B;  4GKG A;  5CCG C;  5AVW B;  1N86 B;  3E1I B;  2KOG A;  3VTP C;  2QM7 A;  1M1J B;  3V4Q A;  1NWQ A;  3MGN A;  1N73 C;  3N4X A;  1N73 B;  1LWU A;  2P2U A;  2D39 A;  1FZG B;  1M7L A;  1FZA B;  4I1L A;  2XNX C;  2J5Z A;  2PP6 A;  2HPC A;  3VYI A;  1RF0 C;  1FZF A;  1X9V A;  5CMZ A;  1RF1 B;  1URQ B;  5AVU B;  2KLV A;  2J0Y A;  2BAS A;  3OAK A;  5AVS B;  2IPP A;  3HD7 D;  2XNX B;  3R2P A;  4N78 E;  2OYI B;  1JY2 O;  5APQ A;  1JTH A;  2XNX A;  1N2D C;  1VPC A;  2FFD B;  1LTJ B;  3M9B A;  3V2Q A;  1ZR2 A;  3LW5 H;  3RK3 C;  1URQ C;  3A7O A;  3CI9 A;  3SWY A;  1L0N K;  2HYN A;  1SQB K;  3UIA A;  1DEB A;  2CPS A;  1DH3 A;  4ZKU A;  1N7S D;  1GDT A;  1GZL A;  1FZC A;  5AW1 B;  1A02 F;  3A3Y B;  3VOP A;  1FZC B;  1M1J A;  2Z5H A;  1G1J A;  1GL2 C;  2WPR A;  5AVZ B;  5AVR B;  3V2N A;  3NFQ A;  1T2K C;  1IFM A;  3B8E B;  5AW0 B;  2KP8 A;  2PAJ A;  2R3C A;  5KJ7 D;  2J0H A;  1L4A A;  3G3Z A;  4B86 A;  5AW9 B;  5AW3 B;  3KYQ A;  1N7S B;  3V5B A;  2R32 A;  1JY2 P;  2Q9I A;  1GD2 E;  2J3F A;  3NMD A;  1OWA A;  1NAF A;  2H43 C;  1KFN A;  2J3G A;  3TNU B;  2J60 A;  1T2K D;  1X8Y A;  1GU5 A;  3TNU A;  1FZG C;  4WBA A;  2J64 A;  1IFD A;  3H6P A;  3N7N A;  4I2L C;  4C7N A;  5CCG D;  1GU4 A;  3L4F A;  1MZ9 A;  4W7Y A;  4JYB A;  1RF0 A;  2NPS B;  2J59 M;  1G2C B;  4HYT B;  3V2R A;  1J1D C;  5APY A;  1NHL A;  1GW4 A;  5CCH C;  2HLO C;  4AUW A;  1SQP K;  1SVF A;  2N1T D;  5CJ0 A;  2HLO B;  2HPC C;  1LWU B;  1HUC A;  1LWU C;  1KQL A;  1HBW A;  3H32 A;  2YNY A;  3M0A A;  1LTT C;  2OYH C;  2W27 A;  2YMY A;  3HTK B;  4HH2 A;  4Y99 C;  2KSJ A;  5CCG A;  1KIL B;  3M0D C;  1ZN5 A;  2W6A A;  4C46 A;  2ZFC A;  1NOH A;  3L35 A;  4EIJ A;  3O8Z A;  5BVZ A;  3RK3 B;  3RL0 D;  5APW A;  1FZE C;  2Q9I C;  4JF7 A;  2N1T C;  1CI6 B;  2POH A;  1KFM A;  1HTL C;  2OYH B;  3I5C A;  1DX7 A;  3M06 A;  4N78 D;  1FID A;  3HD7 C;  3NXS A;  1G2C A;  5AVX B;  3GHG A;  1J1E B;  1L4A D;  2WSE H;  1S9K E;  2FFD C;  2Q3I A;  3M9H A;  1RF1 C;  1FDM A;  2Q9I B;  2FXM A;  3CLQ A;  2KB7 P;  3RK3 D;  1IC2 A;  1RY3 A;  1FZA C;  2FYZ A;  1RF1 A;  2J61 B;  1E5W A;  1NKZ B;  5AVV B;  1NTZ K;  1JCC A;  1ZLL A;  1T3J A;  2WPQ A;  2YO2 A;  2XV5 A;  1W2E A;  3VP9 A;  2ZXE B;  3HE4 A;  4LGD E;  3B5N B;  2M3B A;  1HWT C;  3MIW A;  4EPU A;  1FZD A;  2H7H A;  1FZE A;  1RE4 A;  2OYI C;  1CZQ A;  1GK4 A;  3VMX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...