2OYHB

Crystal structure of fragment d of gammad298,301a fibrinogen with the peptide ligand gly-his-arg-pro-amide
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
298
structure length
298
Chain Sequence
IPTNLRVLRSILENLRSKIQKLESDVSAQMEYCRTPCTVSCNIPVVSGKECEEIIRKGGETSEMYLIQPDSSVKPYRVYCDMNTENGGWTVIQNRQDGSVDFGRKWDPYKQGFGNVATNTDGKNYCGLPGEYWLGNDKISQLTRMGPTELLIEMEDWKGDKVKAHYGGFTVQNEANKYQISVNKYRGTAGNALMDGASQLMGENRTMTIHNGMFFSTYDRDNDGWLTSDPRKQCSKEDGGGWWYNRCHAANPNGRYYWGGQYTWDMAKHGTDDGVVWMNWKGSWYSMRKMSMKIRPFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fibrinogen alpha chain
publication title Probing the gamma2 Calcium-Binding Site: Studies with gammaD298,301A Fibrinogen Reveal Changes in the gamma294-301 Loop that Alter the Integrity of the "a" Polymerization Site.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Blood clotting
total genus 93
structure length 298
sequence length 298
chains with identical sequence E
ec nomenclature
pdb deposition date 2007-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00147 Fibrinogen_C Fibrinogen beta and gamma chains, C-terminal globular domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2oyhB01
3.90.215.10 Alpha Beta Alpha-Beta Complex Gamma Fibrinogen; Chain A, domain 1 Gamma Fibrinogen, chain A, domain 1 2oyhB02
4.10.530.10 Few Secondary Structures Irregular Gamma-fibrinogen Carboxyl Terminal Fragment; domain 2 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2 2oyhB03
1LTJC 1LT9C 1FZEC 1FIBA 2HODC 2J3FA 2J5ZA 2OYIC 2J64A 2XNXC 1FZCB 1M1JB 1FZCA 3BVHA 2FFDC 2FIBA 1FZFB 1FZFA 4R9JA 2HLOB 2HLOA 1JC9A 1N86C 2Z4EB 2Z4EA 1JY2O 4M7FA 2J61A 2J60A 1FIDA 1JY2P 2J3OA 3GHGC 4NYTA 3E1IB 3E1IA 3HUSB 3HUSA 2JHKF 2WNPF 1N73C 1RF0B 1RF0A 2OYHC 1LWUB 1W2EA 1LWUA 1RF1C 1FZGC 3FIBA 1FICA 1M1JA 2J0HA 1RE3B 2HPCB 1RE3A 2HPCA 1FZAC 1LT9B 1FZEB 4EPUA 1RE4B 1JY2N 1RE4A 3H32B 3H32A 2OYIB 1FZCC 2XNXB 3BVHC 1FZFC 2GY7A 2JHMF 2HLOC 2Z4EC 1JY3O 1FZDA 1FZBC 4JYOX 1JY3P 3GHGB 1T3UA 2J1GA 2Q9IB 2Q9IA 4JZCA 3HUSC 2J3FD 2H43B 2H43A 2J0GA 1N73B 2J3UA 2JHHC 1LTJB 1LTJA 1LT9A 1FZEA 1LWUC 1RF1B 1RF1A 2HODB 2HODA 1FZGB 1FZGA 2OYIA 2XNXA 1M1JC 2D39A 2FFDB 2FFDA 2HPCC 1FZAB 1N86B 1N86A 1Z3SA 4M7HA 1RE4C 4ZFGA 2A45G 2J3GA 1JY3N 3H32C 3GHGA 3BVHB 2A45H 2J0YA 3E1IC 2A45I 2J61B 1FZBB 1FZBA 2JHIF 1RF0C 1N73A 2Q9IC 2OYHB 2OYHA 2J2PA 1RE3C 1Z3UA 4R9TA 2H43C 2JHLF 1FZAA
chains in the Genus database with same CATH superfamily
5B5EH 3OAKA 5BU8B 2WTYA 2J3FA 4I7ZC 3V4WA 5GTHE 4PV1D 2KZIA 3GHGC 2B89A 2OYOA 3H1KE 2YKPA 1PZQA 1FS0E 2N1TB 1QVFO 1T6AA 2E5YA 2KLVA 2Y9ZA 1M1JA 3RL0C 3AE9C 1VQ8P 2HPCA 1KORA 1DEEG 1VQMP 1P84H 3L74D 3CX5I 2KOGA 4Z1MH 3RK2C 2GY7A 1SQXG 4GT1A 2E74B 2FYNC 3KHUA 4PD4H 1JY3P 2N9YB 1T3UA 3TGUG 2JJLA 2KI7B 5AW0B 4H44B 5CBNA 1URQA 5AW6B 1Q90D 1SLQA 3HUSC 1BDDA 3AE1C 3GF3A 1LTJB 1SQVG 3Q1MA 1BGYJ 3C9IA 1FZGB 3NTNA 1L4AA 4M7HA 5KAFH 4WVZA 2WT7B 3HD7A 2H88C 5APSA 3MD0A 5CCHC 2W6AA 1MUUA 1JUNA 3L71D 3AEBC 1JTHB 2J2PA 1N7SA 4IL6X 5EFWB 3L75G 2Y0DA 4DT0A 2J64A 4U3FG 2FIBA 3AEFC 2O1JA 1T3JA 1AQTA 2ITAA 2CPBA 2J61A 5AVVB 4NYTA 1BGYE 3CCJP 1KC8Q 1UIIA 1KYOH 1J2JB 1NYHA 3PLNA 4AUWA 1NTZK 2Z5HA 1EDIA 1NTMG 3OJAB 2FYUD 2QRXA 2AXTH 1JOCA 3VP8A 1LT9B 4NPFX 1LNQA 1HGVA 1K05A 1SFCC 3H1LJ 3RK3B 3V5BA 3U59A 3H1HG 3TSIA 3KPEA 3P8CE 3AE2C 2J3UA 3L72G 2XKMA 2WSCJ 4BRYB 1PP9J 2ZT9D 4KJMA 4H0LC 1ZRTE 1BE3G 5KLVJ 3H1IJ 2PAJA 3HE5B 5CCGA 3CCLP 1JY3N 4B86A 5APVA 1QLED 2V7QJ 2YMYA 5AW2B 3L37A 2C0WA 1OW6A 3CWBE 2Y0CA 3AEDC 2Q9IC 3CCRP 4RO0A 3CXHE 2O01H 2GUVA 3S4RA 3VTPC 2QJYC 3IR9A 3L4FA 3RBZA 2QA4P 3H1LE 1PGPA 3JCUH 1JM0A 3BVHA 2HLOA 2Z4EA 2KIKA 3L74G 1FIDA 1PP9E 2LR2A 1GL2C 2KS1A 1OVRA 3E1IA 1H89A 3Q5PA 5KLVE 1HJ0A 2E75B 3H1IE 1RF0B 1W2EA 1S1CX 1SQQG 3S1KA 4XE5B 1RE3B 1NTZJ 1FZAC 3FWNA 1MFTA 3O6QA 4L75A 5CCGC 2YKOA 4HB1A 2V4HA 2R5DA 4I7ZB 3M0DA 1LP1A 5AVQB 2QJKB 3GHGB 2PRRA 3M0AA 4JZCA 4GDOA 1P84D 5KAIE 2A06D 2C9NY 1OXZA 1XTGB 1LWUC 3L71G 1NHLA 3BASA 2Z5IA 1RY3A 1GMJA 4PD4D 2QM8A 2G8YA 3WU2H 1MFZA 2WITA 2BEZF 1RQVA 3HRNA 1R8EA 3E1IC 1IK7A 1NTZE 3CCEP 1URQD 2E76B 3RGUA 3AE8C 1NU1J 1KILA 1IK9A 2KYVA 3FGAD 1HGZA 4D6TJ 1GW4A 2JHLF 2GA1A 1L4AD 2O01N 2FY8A 1JNMA 3HD7D 3M0DC 4R9JA 3B5NA 1JY2P 2J3OA 4ZNCA 1JTHA 4WY4C 1EDLA 1N7SD 2OYHC 3M9QA 2IZ0A 4PD4I 3VN0A 3PRJA 2HPCB 1KB9D 2WWWA 3F89A 1NU1E 1RE4A 3H32A 4IL6H 4XFJA 3BCCD 4BXLA 2KUBA 2Q7CA 3L73D 4D6TE 2HG5D 3USSA 3L35A 1BCCJ 1OW8A 1SQBD 1SQPD 4LGDE 5KJ7A 4R4LA 3GF7A 2IYPA 4YTPC 1T8ZA 1NTMJ 3CD6P 2YMKA 1LT9A 3D70A 1RF1A 1KQFB 2HR3A 3MUDC 1FJKA 2H8PD 2M3EA 2J0YA 4HKZH 2JEEA 5TJHA 1NOHA 4ASVA 3M9BA 3V2NA 2E5TA 2K37A 1KB9I 3T97A 4I6MC 2BCCD 4EDFA 3AEEC 2B88A 3CC4P 1BCCE 3ITKA 3VMXA 3HE5A 2KP8A 2XNXC 1FZCA 5GTHH 3VMZA 2KZJA 1NTME 2JP3A 4TLFA 1G2CA 2XNDH 2J59M 3CCSP 1RF1C 4KHXA 4JYBA 1X8YA 2WSEH 1YYCA 3FX0A 2A06G 2QM7A 2QJYB 3PH0A 2BASA 4DOJA 1PGJA 1Z56A 1JY2N 2NPSD 1J1EC 1KTMA 3L74J 1OIPA 1KQGB 5APQA 4O9BA 4NPDA 3L75D 1HUCA 1VF5C 2MKVA 1NTKJ 4RKUJ 4UB6E 1FOSF 2QIWA 1FDOA 2WSFH 3CI9A 4N78D 1PPJD 1FZAB 3SFDC 2ZYAA 4OGQB 2AXCA 2H89C 3GHGA 1M57D 2N1TD 3JC22 3VYIA 1QGKB 3O8ZA 3L74E 1A02J 1PV3A 4N6JA 2M3BA 1ZXGA 2FXPA 3Q2YA 2HODC 2E74D 2OYIC 2ZJSE 1NTKE 1L0LD 2HLOB 1JC9A 1N86C 2Z4EB 4H44D 2C9LY 4KT0J 3AECC 1J1DB 2WSEJ 1NAFA 4GOFA 2VRSA 3E1IB 3BCCG 1CSBA 4EOTA 1ZLLA 3HUSA 2WNPF 3KXDA 3L73G 4A7PA 2GUSA 2M8RA 4IFMA 2W83C 1LGHB 1SQBG 1SQPG 1X0TA 2WPRA 1FICA 1YTZT 1YBKA 3O6QB 4RJTA 1DX7A 1K04A 2FYUJ 2D2CB 5CCHA 5CMZA 1L0NK 1DEBA 1EZVE 1LP1B 2ZT9C 3HE4A 4JYOX 2IZ1A 3M06A 5E79E 2WSFJ 4C46A 3D6YA 1IZNB 4WY4B 3MP7B 3A7OA 1H8AA 1RH5B 5APXA 1S9KD 2BCCG 2B9BA 1WT6A 3R2PA 5KLIC 1SQQD 3W67A 1USDA 3CXHH 2JHIF 5AVTB 2FYUE 3TF5A 1KILB 5KLVK 4H13B 3D6ZA 3ZDMA 1Y9BA 1S4XA 3KZIE 3NXSA 1VQOP 3CC7P 1CZQA 1EDKA 1JCDA 2QEXP 2K9JB 1U57A 2FKWB 1FIBA 4C7RA 3V4QA 2J5ZA 3F5HA 2WSCH 3B5NB 3RK3D 1SFCA 1KN7A 4M7FA 3P32A 5C39A 4NPEA 5APWA 3V2QA 3MIWA 2V7QH 3SWFA 3CL3D 2P67A 2WMMA 1NGMB 3H1KD 4GIFA 1S3JA 2YIUC 3OA7A 1RE4B 3H32B 2XNXB 1G1IA 4JBZA 1PPJG 1L0NJ 5GTIE 5KAIH 2Q9IA 1KMIZ 4JPZB 2QJPC 1NJIQ 1KFNA 3CWBJ 2JHHC 3U1AA 1M1KQ 1RF1B 1R5LA 4L73A 3L36A 3C8VA 4QMAA 4Y99C 2E75D 1J1EB 2A45H 4L74A 1GL2A 2IBZG 3H1JG 3UIAA 1L0LG 2IX7C 2YKQA 1OW7A 1U7JA 2YO3A 1VF5B 3C1LA 1OX3A 3T97B 2K9YA 3NFQA 2H43C 2WSSH 1NKNA 1FZAA 1L0NE 5K5GB 3MZWB 1FZCB 2FFDC 4GODA 1YQ4C 1NU1K 2MJZA 2FBWC 1IFPA 1FDMA 5CJ0A 1SQVK 2W90A 1EXJA 2L91A 1G2CB 1VL2A 3AE7C 2K3RA 3V2RA 3PJSK 1LWUA 2P2UA 1VDFA 1BGYD 1OZHA 2QSIA 2JKVA 2E76D 2OYIB 1FZFC 5AW3B 1N2DC 1IFJA 1K9MQ 1GK6A 5KKZC 1PGQA 3QWOC 2J1GA 2KNCA 2J3FD 1ZP0C 2IDBA 3FXDA 1T2KD 3CC2P 3PP5A 4U7JA 2C0XA 5AW5B 3P8CD 3TNUB 1JEKA 3TK1A 5H2FE 3B4SA 3TDKA 1NTMK 2RN0A 4JQ0D 1IFNA 3EFFK 4WY4A 3AEAC 1ZRTD 5AW4B 4YXDC 2E43A 2QG4A 4DCKA 1IO4A 1GK4A 3G6EP 2OYHA 1ZMEC 1FBMA 1KB9E 1SVFA 2Y9YA 1IFMA 4K3AA 1IJDB 3RL0B 1LTBC 1HBWA 5CHXA 1SQXJ 1S5LE 1CI6A 3L73E 2E42A 3RK2B 3H1KG 3E7KA 4C7NA 4OVNF 1M90Q 3TGUJ 1AV1A 2FYNB 4HJGH 1RHZB 3H1LD 3L70D 2NPSC 1N7LA 3HUSB 1SQVJ 3CCVP 2O3JA 2QVAA 2K9JA 4OWFA 1M8OB 3Q5SA 1PP9D 3AE6C 4WB4A 3MUDA 3H1ID 3TYYA 2ZYGA 2W8ZA 1P84I 4YXWH 2XDJA 3VP9A 5B66E 2OTJP 3HE4B 3K5BA 4EI2A 4UB6H 3IF4A 1SQXE 1H0TA 4HH2A 1VQKP 1OVVA 3L75J 2N1TC 3TGUE 2Q3EA 2ZFCA 4U3FJ 2R3CA 2XNXA 2D39A 1KYOD 1YJ9P 5APYA 2KK7A 3CCQP 1QEXA 3PTZA 1SQVE 1NTKK 1HVVA 4UB8E 2E74C 2B87A 3U1CA 4H44C 2WPSA 2QJPB 3CCMP 1NTZD 1LTJC 4CPGA 1FZEC 2OQQA 3G4SP 1SP4A 1BGYG 1SFCB 3L75E 2NRGA 1YQ3C 1Q2NA 4U3FE 3H1HJ 4Y99B 1LTIC 1TU3F 4PV1C 3L72J 2ZXXA 3A0HH 1KYOI 4LLHA 5TISE 1BE3J 5AW9B 4OGQD 4H0LB 5CCGD 2CK3H 1LTAC 4WWIA 2OTKE 4EPUA 1RQUA 1HTLC 3R4YA 5E79H 3Q3DA 3GG2A 2Q9IB 1S5LX 1NU1D 1NWQA 2FYUK 1YI2P 2P58A 2P7JA 1X79B 4D6TD 1CW5A 1KZUB 3H1HE 3CX5E 2P1JA 2HODA 2OYIA 4ZKUA 2KSEA 3L72E 4EYYQ 1N86A 2N9BA 3CLQA 1BSHA 4HYTB 1PIXA 1BE3E 1GL2B 1UIXA 4IFDK 1EQ7A 2R3SA 3MTUE 1LTTC 1FZBA 1SQQJ 3KZIH 2H7HA 1YITP 3H1LG 3L70G 1QL1A 1HH0A 2D2CD 2W6JH 2IPPA 2WVRA 3WUTA 3P7KA 1KV4A 1PL5A 1VQ5P 3TNUA 1JCCA 2O1KA 1PP9G 1AJYA 2FXOA 2Y0EA 4WY4D 2J60A 5KLVG 1EC5A 3H1IG 1BCCD 2KSJA 2CPSA 3L71J 1YTZI 3W68A 1AQ5A 1N73C 1AVOA 1LWUB 2PGDA 2IBZD 3H1JD 1JB0J 4AQRD 1GD2E 3A5TA 1SQQE 1LJ2A 3EFGA 2J58A 4I2LC 5GTIH 1KILD 4H13D 2P10A 2ZAEB 1FZBC 4N3YB 2KNCB 1FDIA 1NH4A 5DJUB 3A0HE 2E75C 2PFXA 3G71P 3B5ND 2R5BA 3FWLA 2OGUA 3CMAP 3GW6A 5AW7B 4TT3H 3L71E 1NTZG 4ZFGA 2BEQD 2A45G 2XU6A 1VQLP 1KQSO 1QVGO 4W7YA 1ZW0A 3M9HA 2QJKC 2GM4A 2IBZI 2OYHB 2RKLA 2KXPB 5DJTB 1JMMA 1Z3UA 1CI6B 4C7NB 1W2BO 4R4MA 5KJ7D 4W80A 4ASWA 1X22A 3B8EB 1NTKD 2E76C 2JHKF 3E1RA 2RMZA 3PHLA 3A0BE 1OFCX 1NU1G 4ZMDA 1K73Q 3ABVC 4JYCA 4ZKPA 4Y28J 2FXMA 1USEA 4D6TG 1FZEB 1E5WA 4PJ0E 3KDPB 1JMBA 2G3AA 3B71A 1BSNA 2M5AA 1GTWA 1VF5D 1T2KC 1A02F 1JY3O 1LTSC 1Q7YQ 1H0TB 3II6A 4PV1B 1EZVD 2H43A 1DH3A 3V6IA 1ZV8A 1FJPA 3LW5H 1E79H 1X9VA 1M1JC 2FFDA 5L8RJ 2HPCC 1DD3A 5H2FH 3M91A 1Z3SA 1K8AQ 1M56D 3SWYA 1SQBK 1SQPK 1W5CE 2Q1KA 3I55P 2B87B 5AVYB 1KB9H 1URQC 1BCCG 3Q5RA 1S5LH 1EXIA 2WPQA 4BWNA 1GU4A 3LIDA 1FZFA 3BATA 5B5EE 1L4AC 2JWAA 1VQ6P 3HD7C 1NO4A 1Y8AA 2LXBA 5CBOA 1EZVI 2ZXEB 1SQXK 3WUUA 3L70J 4IOIH 1FAVA 5AW1B 1N7SC 2KLUA 4DZOA 1OMIA 5B66H 1AA0A 1VPCA 1ZR4A 1P84E 2JHMF 2A06E 3LW5J 3GLMA 1Q86Q 4IFFA 3RL0D 3V2PA 5AVWB 4PD4E 1VQ4P 3IN6A 2PP6A 5APTA 1MV8A 3RK2D 1N73B 1HWTC 5CJ4A 1BDCA 1OVUA 2HODB 3CCUP 2ZVNB 1VQ9P 2POHA 3SFEC 1AVYA 2R32A 4UB8H 1N86B 2LXCB 1KFMA 3H6PA 1S2EA 3L70E 1YJNP 3I56P 3BCCJ 5AVXB 5KAFE 3L73J 1H88A 2NPSA 2WZ7A 1FZBB 2XZRA 1EDJA 1QL2A 1SQBJ 1SQPJ 4AYCA 1YJWP 3SWKA 1IFDA 1NTKG 5CCHD 1PFIA 2IYOA 1N8RQ 1DD4A 2M0BA 5APUA 3IFMA 2WQYC 1Q82Q 2ZT9B 4OGQC 1M7LA 1L0ND 3NMDA 1KD1Q 3HTKB 2Q3IA 2AEJA 3N4XA 5TISH 2JR8A 2N1TA 1GDTA 3LIEA 1KYOE 3CWBD 3BCCE 2OTLP 5AVZB 1VQNP 2I8DA 1D7MA 2BCCJ 3FIBA 2SPZA 1YIJP 1L0LK 3CXHD 1EZVG 1SQBE 1SQPE 4M3LA 2AXTE 3GMAA 5KLIB 3BVHC 3S9OA 3BRVB 4OH8B 2HLOC 2NZ2A 2Z4EC 5BVZA 4LC1A 1J1DC 1WRGA 2O01J 4W7ZA 2K1AA 3FXEA 2RH0A 3CX5H 3RBXA 5AW8B 2UWJE 2J0GA 5KLVD 1LTJA 1FZEA 2ZYDA 1SFCD 1S72P 1HF9A 1FZGA 1FU1A 4GOEA 5KTBA 2AEFA 4GKGA 2WT7A 2D2CC 2IFNA 2ZVOB 2BCCE 2FYUG 3KQGA 3RL0g 3VMAA 1GZLA 2J5UA 4H0LD 1MKMA 2AEMA 1OWAA 3I5CA 1ZN5A 1GU5A 3MGNA 1Y47A 3A3YB 3CXHI 4I1LA 5AVRB 5M1BA 1XTCC 4JF7A 1SS1A 2YIUB 5AVSB 2WPVB 1M1JB 3A2AA 1U7MA 1SQQK 3VMYA 1LT1A 3JCUE 1JY2O 1JO5A 4DJGA 3IAOA 3G3ZA 5AVUB 1NVOA 1KILC 4H13C 1URQB 1FZGC 2J0HA 1PGOA 2HYNA 1GL2D 2YNYA 3H1JJ 4XA4A 1L0LJ 1L4AB 2M5AB 3B5NC 2L5GB 2Q5UA 3HD7B 2JO1A 3AE5C 1L2PA 4EIJA 4N78E 1FOSE 1PPJE 3VOPA 1FE6A 3EQ2A 2H43B 3QH9A 4L76A 4BRYA 2IFMA 1SQXD 2FFDB 1N7SB 1NAYA 2W27A 1NKZB 2XV5A 2R44A 3CPWO 3SSUA 3TGUD 1RE4C 3H32C 3N7NA 1WMKA 4MN4C 3WU2E 2JDIH 2A45I 2J61B 1YHQP 1SQVD 1IC2A 5BU5A 1N73A 2IBZE 3H1JE 3MHVA 1L0NG 5KJ7C 1L0LE 2I1KA 4R9TA 2YXRB 3P8MC 2OARA 1LT9C 2W6BA 1Q81Q 3CWBG 1KILE 1FZFB 2FYZA 3OW2O 1G1JA 3KYQA 5KKZB 3H25A 3RK3C 2DW3A 3A0BH 1DIPA 2QE7H 1R5SA 1RF0A 1AFOA 4U3FD 1ZR2A 1HJBA 1RE3A 4PJ0H 2Q6QA 4WBAA 3BRTB 2JWDA 2HFED 3D71A 1FZCC 3EWKA 3HTKA 4IL6E 1MZ9A 1FZDA 1FC2C 1NTMD 2K88A 1QX8A 1VQPP 4YPCA 1S9KE 3CMEP 1IFIA 3G9RA 3H1KJ 2YO2A 1LTGC 2YXQB 3AE4C 3AE3C 3JSVC 2J3GA 3AEGC 3BVHB 3H1HD 3CX5D 3WUVA 1VQ7P 2NPSB 4RESB 1GW3A 3L72D 2I1JA 1KQLA 1RF0C 2KS1B 4K35A 2LKMA 2KB7P 3RK3E 1BE3D 1RE3C 3WMM0 1ZOYC
chains in the Genus database with same CATH topology
1LTBC 1HBWA 5CHXA 3OAKA 1GU4A 3VMXA 3HE5A 2KP8A 5BU8B 2WTYA 2J3FA 2XNXC 1CI6A 1FZCA 3LIDA 2E42A 1FZFA 3BATA 3RK2B 1L4AC 3VMZA 4C7NA 3V4WA 3HD7C 1NO4A 3GHGC 1G2CA 2YKPA 2NPSC 1N7LA 2ZXEB 3HUSB 1SQXK 2J59M 2N1TB 1FAVA 5AW1B 1RF1C 2KLVA 4KHXA 1M1JA 3RL0C 1N7SC 4JYBA 4DZOA 2HPCA 1X8YA 2WSEH 1YYCA 2QM7A 3MUDA 4WB4A 2BASA 4DOJA 1Z56A 2NPSD 1JY2N 1VPCA 3TYYA 1ZR4A 2KOGA 1J1EC 2XDJA 3RK2C 2GY7A 3VP9A 4GT1A 2JHMF 5APQA 4O9BA 3HE4B 4IFFA 1JY3P 3RL0D 1T3UA 1HUCA 2JJLA 5AW0B 3V2PA 1URQA 5AVWB 5AW6B 4HH2A 1SLQA 3HUSC 1FOSF 2N1TC 2PP6A 5APTA 1MV8A 3RK2D 2ZFCA 1N73B 1LTJB 1HWTC 2R3CA 3C9IA 5CJ4A 2HODB 1FZGB 2XNXA 3NTNA 2D39A 5APYA 2WSFH 2POHA 3CI9A 1L4AA 2R32A 4N78D 1FZAB 1N86B 1NTKK 1KFMA 1HVVA 3H6PA 4M7HA 2WT7B 3HD7A 5APSA 3MD0A 5CCHC 3GHGA 5AVXB 2N1TD 2W6AA 1H88A 1MUUA 1JUNA 2NPSA 2WZ7A 1FZBB 2XZRA 3U1CA 1QL2A 4AYCA 2WPSA 3VYIA 1JTHB 1IFDA 3O8ZA 2J2PA 1N7SA 5CCHD 1A02J 4N6JA 2M3BA 1PFIA 1LTJC 1FZEC 2HODC 2OYIC 2J64A 2FIBA 1SP4A 2O1JA 5APUA 1T3JA 2HLOB 3IFMA 1JC9A 1N86C 1SFCB 2Z4EB 2C9LY 2CPBA 2J61A 1M7LA 1J1DB 5AVVB 3NMDA 4Y99B 4NYTA 1LTIC 1NAFA 2VRSA 3HTKB 3E1IB 1CSBA 2Q3IA 4EOTA 1J2JB 1ZLLA 3HUSA 3N4XA 2WNPF 2N1TA 2GUSA 2M8RA 1NTZK 2Z5HA 1GDTA 4AUWA 3LIEA 4LLHA 4IFMA 1LGHB 5AVZB 3OJAB 5AW9B 3FIBA 2WPRA 1FICA 5CCGD 1YTZT 1LTAC 1L0LK 1JOCA 3VP8A 1LT9B 1DX7A 4EPUA 1HTLC 4M3LA 5CCHA 5CMZA 1L0NK 3BVHC 1DEBA 3BRVB 1HGVA 4OH8B 2HLOC 1SFCC 2Z4EC 5BVZA 3HE4A 4JYOX 4LC1A 1J1DC 1WRGA 3M06A 4W7ZA 2Q9IB 4C46A 3RK3B 3V5BA 3U59A 4WY4B 1NWQA 2FYUK 3TSIA 3KPEA 3A7OA 2P7JA 5AW8B 3P8CE 1X79B 2J0GA 1H8AA 1CW5A 2J3UA 1KZUB 1LTJA 2XKMA 5APXA 1FZEA 1SFCD 2P1JA 2HODA 1FZGA 2OYIA 4ZKUA 1FU1A 5KTBA 1S9KD 1N86A 4GKGA 2N9BA 1WT6A 2PAJA 2WT7A 3R2PA 3HE5B 5CCGA 1JY3N 2IFNA 3CLQA 4HYTB 4B86A 5APVA 1GL2B 2YMYA 4IFDK 5AW2B 3KQGA 1EQ7A 3L37A 2C0WA 3MTUE 1LTTC 1GZLA 1FZBA 2JHIF 5AVTB 3I5CA 1OWAA 1ZN5A 1GU5A 2Q9IC 1KILB 2H7HA 5KLVK 3MGNA 3A3YB 1QL1A 2O01H 3NXSA 4I1LA 1HH0A 1CZQA 5AVRB 2GUVA 1XTCC 1JCDA 2IPPA 3P7KA 4JF7A 3VTPC 3IR9A 3L4FA 5AVSB 2FKWB 1FIBA 3TNUA 4C7RA 3V4QA 2J5ZA 1M1JB 1JCCA 3A2AA 3BVHA 2O1KA 1SQQK 3VMYA 2WSCH 2HLOA 3B5NB 3RK3D 1SFCA 2Z4EA 1JY2O 4M7FA 3P32A 4WY4D 2J60A 1FIDA 5APWA 1JO5A 1GL2C 3V2QA 3E1IA 1H89A 2KSJA 3G3ZA 2CPSA 3MIWA 5AVUB 1YTZI 3SWFA 1AQ5A 1N73C 1RF0B 1KILC 1LWUB 1W2EA 1URQB 3CL3D 2P67A 1FZGC 4XE5B 2J0HA 4GIFA 1RE3B 2HYNA 1FZAC 4AQRD 1GL2D 2YNYA 3OA7A 3A5TA 1GD2E 5CCGC 1RE4B 2YKOA 3H32B 4XA4A 2XNXB 1G1IA 2R5DA 3EFGA 3M0DA 2J58A 1L4AB 4I2LC 1KILD 3B5NC 5AVQB 2L5GB 2Q5UA 3HD7B 1FZBC 4N3YB 3GHGB 2Q9IA 3M0AA 4JZCA 1NH4A 4EIJA 4N78E 1FOSE 3VOPA 3EQ2A 1KFNA 2H43B 2C9NY 1OXZA 2JHHC 1XTGB 1LWUC 3U1AA 3B5ND 1RF1B 2IFMA 1NHLA 2R5BA 3BASA 2Z5IA 2FFDB 1N7SB 1RY3A 5AW7B 2W27A 3L36A 1NKZB 2QM8A 2XV5A 1MFZA 1RE4C 4ZFGA 2WITA 2A45G 2XU6A 3N7NA 4Y99C 3H32C 1J1EB 2A45H 3HRNA 4W7YA 1GL2A 3E1IC 3UIAA 3M9HA 1URQD 2A45I 2J61B 1IC2A 2IX7C 2GM4A 2YKQA 5BU5A 1N73A 2OYHB 1KILA 5KJ7C 2YO3A 1IK9A 2KYVA 2I1KA 3NFQA 1JMMA 1Z3UA 4R9TA 2H43C 1HGZA 1GW4A 1NKNA 3P8MC 2JHLF 1FZAA 1L4AD 2OARA 1LT9C 1JNMA 2W6BA 1CI6B 1FZCB 3HD7D 2FFDC 1FZFB 3M0DC 2FYZA 4C7NB 4R9JA 1NU1K 2MJZA 3B5NA 5KJ7D 1G1JA 4W80A 3KYQA 1FDMA 1JY2P 5CJ0A 1SQVK 2J3OA 3RK3C 1G2CB 3B8EB 1JTHA 4WY4C 2JHKF 3V2RA 1N7SD 1RF0A 2OYHC 1AFOA 3M9QA 1LWUA 2P2UA 1VDFA 1ZR2A 1HJBA 3VN0A 2HPCB 1RE3A 2WWWA 4JYCA 4ZKPA 4WBAA 2FXMA 3BRTB 1FZEB 1E5WA 1RE4A 2HFED 3H32A 2OYIB 1FZCC 3KDPB 1FZFC 5AW3B 2Q7CA 1N2DC 1IFJA 3HTKA 1GK6A 1GTWA 2HG5D 1T2KC 1MZ9A 1A02F 1JY3O 1FZDA 1LTSC 3L35A 2J1GA 3II6A 4LGDE 5KJ7A 1S9KE 1IFIA 2J3FD 1T8ZA 2H43A 1DH3A 1ZV8A 1FJPA 3LW5H 1LT9A 1X9VA 1RF1A 2YO2A 1T2KD 1M1JC 1LTGC 2FFDA 2HPCC 3PP5A 3M91A 1Z3SA 2C0XA 5AW5B 3P8CD 1FJKA 3TNUB 3SWYA 3TK1A 2J3GA 3BVHB 1NTMK 2H8PD 1IFNA 1SQBK 1SQPK 2J0YA 2JEEA 4WY4A 2NPSB 1NOHA 4RESB 5AW4B 3M9BA 3V2NA 2E43A 5AVYB 1GW3A 2I1JA 1IO4A 1KQLA 1RF0C 1GK4A 2OYHA 1URQC 1FBMA 2LKMA 1SVFA 2KB7P 3T97A 1IFMA 4I6MC 1IJDB 3RL0B 1RE3C 3WMM0 2WPQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LTJ C;  1LT9 C;  1FZE C;  1FIB A;  2HOD C;  2J3F A;  2J5Z A;  2OYI C;  2J64 A;  2XNX C;  1FZC B;  1M1J B;  1FZC A;  3BVH A;  2FFD C;  2FIB A;  1FZF B;  1FZF A;  4R9J A;  2HLO B;  2HLO A;  1JC9 A;  1N86 C;  2Z4E B;  2Z4E A;  1JY2 O;  4M7F A;  2J61 A;  2J60 A;  1FID A;  1JY2 P;  2J3O A;  3GHG C;  4NYT A;  3E1I B;  3E1I A;  3HUS B;  3HUS A;  2JHK F;  2WNP F;  1N73 C;  1RF0 B;  1RF0 A;  2OYH C;  1LWU B;  1W2E A;  1LWU A;  1RF1 C;  1FZG C;  3FIB A;  1FIC A;  1M1J A;  2J0H A;  1RE3 B;  2HPC B;  1RE3 A;  2HPC A;  1FZA C;  1LT9 B;  1FZE B;  4EPU A;  1RE4 B;  1JY2 N;  1RE4 A;  3H32 B;  3H32 A;  2OYI B;  1FZC C;  2XNX B;  3BVH C;  1FZF C;  2GY7 A;  2JHM F;  2HLO C;  2Z4E C;  1JY3 O;  1FZD A;  1FZB C;  4JYO X;  1JY3 P;  3GHG B;  1T3U A;  2J1G A;  2Q9I B;  2Q9I A;  4JZC A;  3HUS C;  2J3F D;  2H43 B;  2H43 A;  2J0G A;  1N73 B;  2J3U A;  2JHH C;  1LTJ B;  1LTJ A;  1LT9 A;  1FZE A;  1LWU C;  1RF1 B;  1RF1 A;  2HOD B;  2HOD A;  1FZG B;  1FZG A;  2OYI A;  2XNX A;  1M1J C;  2D39 A;  2FFD B;  2FFD A;  2HPC C;  1FZA B;  1N86 B;  1N86 A;  1Z3S A;  4M7H A;  1RE4 C;  4ZFG A;  2A45 G;  2J3G A;  1JY3 N;  3H32 C;  3GHG A;  3BVH B;  2A45 H;  2J0Y A;  3E1I C;  2A45 I;  2J61 B;  1FZB B;  1FZB A;  2JHI F;  1RF0 C;  1N73 A;  2Q9I C;  2OYH B;  2OYH A;  2J2P A;  1RE3 C;  1Z3U A;  4R9T A;  2H43 C;  2JHL F;  1FZA A; 
#chains in the Genus database with same CATH topology
 5B5E H;  3OAK A;  5BU8 B;  2WTY A;  2J3F A;  4I7Z C;  3V4W A;  5GTH E;  4PV1 D;  2KZI A;  3GHG C;  2B89 A;  2OYO A;  3H1K E;  2YKP A;  1PZQ A;  1FS0 E;  2N1T B;  1QVF O;  1T6A A;  2E5Y A;  2KLV A;  2Y9Z A;  1M1J A;  3RL0 C;  3AE9 C;  1VQ8 P;  2HPC A;  1KOR A;  1DEE G;  1VQM P;  1P84 H;  3L74 D;  3CX5 I;  2KOG A;  4Z1M H;  3RK2 C;  2GY7 A;  1SQX G;  4GT1 A;  2E74 B;  2FYN C;  3KHU A;  4PD4 H;  1JY3 P;  2N9Y B;  1T3U A;  3TGU G;  2JJL A;  2KI7 B;  5AW0 B;  4H44 B;  5CBN A;  1URQ A;  5AW6 B;  1Q90 D;  1SLQ A;  3HUS C;  1BDD A;  3AE1 C;  3GF3 A;  1LTJ B;  1SQV G;  3Q1M A;  1BGY J;  3C9I A;  1FZG B;  3NTN A;  1L4A A;  4M7H A;  5KAF H;  4WVZ A;  2WT7 B;  3HD7 A;  2H88 C;  5APS A;  3MD0 A;  5CCH C;  2W6A A;  1MUU A;  1JUN A;  3L71 D;  3AEB C;  1JTH B;  2J2P A;  1N7S A;  4IL6 X;  5EFW B;  3L75 G;  2Y0D A;  4DT0 A;  2J64 A;  4U3F G;  2FIB A;  3AEF C;  2O1J A;  1T3J A;  1AQT A;  2ITA A;  2CPB A;  2J61 A;  5AVV B;  4NYT A;  1BGY E;  3CCJ P;  1KC8 Q;  1UII A;  1KYO H;  1J2J B;  1NYH A;  3PLN A;  4AUW A;  1NTZ K;  2Z5H A;  1EDI A;  1NTM G;  3OJA B;  2FYU D;  2QRX A;  2AXT H;  1JOC A;  3VP8 A;  1LT9 B;  4NPF X;  1LNQ A;  1HGV A;  1K05 A;  1SFC C;  3H1L J;  3RK3 B;  3V5B A;  3U59 A;  3H1H G;  3TSI A;  3KPE A;  3P8C E;  3AE2 C;  2J3U A;  3L72 G;  2XKM A;  2WSC J;  4BRY B;  1PP9 J;  2ZT9 D;  4KJM A;  4H0L C;  1ZRT E;  1BE3 G;  5KLV J;  3H1I J;  2PAJ A;  3HE5 B;  5CCG A;  3CCL P;  1JY3 N;  4B86 A;  5APV A;  1QLE D;  2V7Q J;  2YMY A;  5AW2 B;  3L37 A;  2C0W A;  1OW6 A;  3CWB E;  2Y0C A;  3AED C;  2Q9I C;  3CCR P;  4RO0 A;  3CXH E;  2O01 H;  2GUV A;  3S4R A;  3VTP C;  2QJY C;  3IR9 A;  3L4F A;  3RBZ A;  2QA4 P;  3H1L E;  1PGP A;  3JCU H;  1JM0 A;  3BVH A;  2HLO A;  2Z4E A;  2KIK A;  3L74 G;  1FID A;  1PP9 E;  2LR2 A;  1GL2 C;  2KS1 A;  1OVR A;  3E1I A;  1H89 A;  3Q5P A;  5KLV E;  1HJ0 A;  2E75 B;  3H1I E;  1RF0 B;  1W2E A;  1S1C X;  1SQQ G;  3S1K A;  4XE5 B;  1RE3 B;  1NTZ J;  1FZA C;  3FWN A;  1MFT A;  3O6Q A;  4L75 A;  5CCG C;  2YKO A;  4HB1 A;  2V4H A;  2R5D A;  4I7Z B;  3M0D A;  1LP1 A;  5AVQ B;  2QJK B;  3GHG B;  2PRR A;  3M0A A;  4JZC A;  4GDO A;  1P84 D;  5KAI E;  2A06 D;  2C9N Y;  1OXZ A;  1XTG B;  1LWU C;  3L71 G;  1NHL A;  3BAS A;  2Z5I A;  1RY3 A;  1GMJ A;  4PD4 D;  2QM8 A;  2G8Y A;  3WU2 H;  1MFZ A;  2WIT A;  2BEZ F;  1RQV A;  3HRN A;  1R8E A;  3E1I C;  1IK7 A;  1NTZ E;  3CCE P;  1URQ D;  2E76 B;  3RGU A;  3AE8 C;  1NU1 J;  1KIL A;  1IK9 A;  2KYV A;  3FGA D;  1HGZ A;  4D6T J;  1GW4 A;  2JHL F;  2GA1 A;  1L4A D;  2O01 N;  2FY8 A;  1JNM A;  3HD7 D;  3M0D C;  4R9J A;  3B5N A;  1JY2 P;  2J3O A;  4ZNC A;  1JTH A;  4WY4 C;  1EDL A;  1N7S D;  2OYH C;  3M9Q A;  2IZ0 A;  4PD4 I;  3VN0 A;  3PRJ A;  2HPC B;  1KB9 D;  2WWW A;  3F89 A;  1NU1 E;  1RE4 A;  3H32 A;  4IL6 H;  4XFJ A;  3BCC D;  4BXL A;  2KUB A;  2Q7C A;  3L73 D;  4D6T E;  2HG5 D;  3USS A;  3L35 A;  1BCC J;  1OW8 A;  1SQB D;  1SQP D;  4LGD E;  5KJ7 A;  4R4L A;  3GF7 A;  2IYP A;  4YTP C;  1T8Z A;  1NTM J;  3CD6 P;  2YMK A;  1LT9 A;  3D70 A;  1RF1 A;  1KQF B;  2HR3 A;  3MUD C;  1FJK A;  2H8P D;  2M3E A;  2J0Y A;  4HKZ H;  2JEE A;  5TJH A;  1NOH A;  4ASV A;  3M9B A;  3V2N A;  2E5T A;  2K37 A;  1KB9 I;  3T97 A;  4I6M C;  2BCC D;  4EDF A;  3AEE C;  2B88 A;  3CC4 P;  1BCC E;  3ITK A;  3VMX A;  3HE5 A;  2KP8 A;  2XNX C;  1FZC A;  5GTH H;  3VMZ A;  2KZJ A;  1NTM E;  2JP3 A;  4TLF A;  1G2C A;  2XND H;  2J59 M;  3CCS P;  1RF1 C;  4KHX A;  4JYB A;  1X8Y A;  2WSE H;  1YYC A;  3FX0 A;  2A06 G;  2QM7 A;  2QJY B;  3PH0 A;  2BAS A;  4DOJ A;  1PGJ A;  1Z56 A;  1JY2 N;  2NPS D;  1J1E C;  1KTM A;  3L74 J;  1OIP A;  1KQG B;  5APQ A;  4O9B A;  4NPD A;  3L75 D;  1HUC A;  1VF5 C;  2MKV A;  1NTK J;  4RKU J;  4UB6 E;  1FOS F;  2QIW A;  1FDO A;  2WSF H;  3CI9 A;  4N78 D;  1PPJ D;  1FZA B;  3SFD C;  2ZYA A;  4OGQ B;  2AXC A;  2H89 C;  3GHG A;  1M57 D;  2N1T D;  3JC2 2;  3VYI A;  1QGK B;  3O8Z A;  3L74 E;  1A02 J;  1PV3 A;  4N6J A;  2M3B A;  1ZXG A;  2FXP A;  3Q2Y A;  2HOD C;  2E74 D;  2OYI C;  2ZJS E;  1NTK E;  1L0L D;  2HLO B;  1JC9 A;  1N86 C;  2Z4E B;  4H44 D;  2C9L Y;  4KT0 J;  3AEC C;  1J1D B;  2WSE J;  1NAF A;  4GOF A;  2VRS A;  3E1I B;  3BCC G;  1CSB A;  4EOT A;  1ZLL A;  3HUS A;  2WNP F;  3KXD A;  3L73 G;  4A7P A;  2GUS A;  2M8R A;  4IFM A;  2W83 C;  1LGH B;  1SQB G;  1SQP G;  1X0T A;  2WPR A;  1FIC A;  1YTZ T;  1YBK A;  3O6Q B;  4RJT A;  1DX7 A;  1K04 A;  2FYU J;  2D2C B;  5CCH A;  5CMZ A;  1L0N K;  1DEB A;  1EZV E;  1LP1 B;  2ZT9 C;  3HE4 A;  4JYO X;  2IZ1 A;  3M06 A;  5E79 E;  2WSF J;  4C46 A;  3D6Y A;  1IZN B;  4WY4 B;  3MP7 B;  3A7O A;  1H8A A;  1RH5 B;  5APX A;  1S9K D;  2BCC G;  2B9B A;  1WT6 A;  3R2P A;  5KLI C;  1SQQ D;  3W67 A;  1USD A;  3CXH H;  2JHI F;  5AVT B;  2FYU E;  3TF5 A;  1KIL B;  5KLV K;  4H13 B;  3D6Z A;  3ZDM A;  1Y9B A;  1S4X A;  3KZI E;  3NXS A;  1VQO P;  3CC7 P;  1CZQ A;  1EDK A;  1JCD A;  2QEX P;  2K9J B;  1U57 A;  2FKW B;  1FIB A;  4C7R A;  3V4Q A;  2J5Z A;  3F5H A;  2WSC H;  3B5N B;  3RK3 D;  1SFC A;  1KN7 A;  4M7F A;  3P32 A;  5C39 A;  4NPE A;  5APW A;  3V2Q A;  3MIW A;  2V7Q H;  3SWF A;  3CL3 D;  2P67 A;  2WMM A;  1NGM B;  3H1K D;  4GIF A;  1S3J A;  2YIU C;  3OA7 A;  1RE4 B;  3H32 B;  2XNX B;  1G1I A;  4JBZ A;  1PPJ G;  1L0N J;  5GTI E;  5KAI H;  2Q9I A;  1KMI Z;  4JPZ B;  2QJP C;  1NJI Q;  1KFN A;  3CWB J;  2JHH C;  3U1A A;  1M1K Q;  1RF1 B;  1R5L A;  4L73 A;  3L36 A;  3C8V A;  4QMA A;  4Y99 C;  2E75 D;  1J1E B;  2A45 H;  4L74 A;  1GL2 A;  2IBZ G;  3H1J G;  3UIA A;  1L0L G;  2IX7 C;  2YKQ A;  1OW7 A;  1U7J A;  2YO3 A;  1VF5 B;  3C1L A;  1OX3 A;  3T97 B;  2K9Y A;  3NFQ A;  2H43 C;  2WSS H;  1NKN A;  1FZA A;  1L0N E;  5K5G B;  3MZW B;  1FZC B;  2FFD C;  4GOD A;  1YQ4 C;  1NU1 K;  2MJZ A;  2FBW C;  1IFP A;  1FDM A;  5CJ0 A;  1SQV K;  2W90 A;  1EXJ A;  2L91 A;  1G2C B;  1VL2 A;  3AE7 C;  2K3R A;  3V2R A;  3PJS K;  1LWU A;  2P2U A;  1VDF A;  1BGY D;  1OZH A;  2QSI A;  2JKV A;  2E76 D;  2OYI B;  1FZF C;  5AW3 B;  1N2D C;  1IFJ A;  1K9M Q;  1GK6 A;  5KKZ C;  1PGQ A;  3QWO C;  2J1G A;  2KNC A;  2J3F D;  1ZP0 C;  2IDB A;  3FXD A;  1T2K D;  3CC2 P;  3PP5 A;  4U7J A;  2C0X A;  5AW5 B;  3P8C D;  3TNU B;  1JEK A;  3TK1 A;  5H2F E;  3B4S A;  3TDK A;  1NTM K;  2RN0 A;  4JQ0 D;  1IFN A;  3EFF K;  4WY4 A;  3AEA C;  1ZRT D;  5AW4 B;  4YXD C;  2E43 A;  2QG4 A;  4DCK A;  1IO4 A;  1GK4 A;  3G6E P;  2OYH A;  1ZME C;  1FBM A;  1KB9 E;  1SVF A;  2Y9Y A;  1IFM A;  4K3A A;  1IJD B;  3RL0 B;  1LTB C;  1HBW A;  5CHX A;  1SQX J;  1S5L E;  1CI6 A;  3L73 E;  2E42 A;  3RK2 B;  3H1K G;  3E7K A;  4C7N A;  4OVN F;  1M90 Q;  3TGU J;  1AV1 A;  2FYN B;  4HJG H;  1RHZ B;  3H1L D;  3L70 D;  2NPS C;  1N7L A;  3HUS B;  1SQV J;  3CCV P;  2O3J A;  2QVA A;  2K9J A;  4OWF A;  1M8O B;  3Q5S A;  1PP9 D;  3AE6 C;  4WB4 A;  3MUD A;  3H1I D;  3TYY A;  2ZYG A;  2W8Z A;  1P84 I;  4YXW H;  2XDJ A;  3VP9 A;  5B66 E;  2OTJ P;  3HE4 B;  3K5B A;  4EI2 A;  4UB6 H;  3IF4 A;  1SQX E;  1H0T A;  4HH2 A;  1VQK P;  1OVV A;  3L75 J;  2N1T C;  3TGU E;  2Q3E A;  2ZFC A;  4U3F J;  2R3C A;  2XNX A;  2D39 A;  1KYO D;  1YJ9 P;  5APY A;  2KK7 A;  3CCQ P;  1QEX A;  3PTZ A;  1SQV E;  1NTK K;  1HVV A;  4UB8 E;  2E74 C;  2B87 A;  3U1C A;  4H44 C;  2WPS A;  2QJP B;  3CCM P;  1NTZ D;  1LTJ C;  4CPG A;  1FZE C;  2OQQ A;  3G4S P;  1SP4 A;  1BGY G;  1SFC B;  3L75 E;  2NRG A;  1YQ3 C;  1Q2N A;  4U3F E;  3H1H J;  4Y99 B;  1LTI C;  1TU3 F;  4PV1 C;  3L72 J;  2ZXX A;  3A0H H;  1KYO I;  4LLH A;  5TIS E;  1BE3 J;  5AW9 B;  4OGQ D;  4H0L B;  5CCG D;  2CK3 H;  1LTA C;  4WWI A;  2OTK E;  4EPU A;  1RQU A;  1HTL C;  3R4Y A;  5E79 H;  3Q3D A;  3GG2 A;  2Q9I B;  1S5L X;  1NU1 D;  1NWQ A;  2FYU K;  1YI2 P;  2P58 A;  2P7J A;  1X79 B;  4D6T D;  1CW5 A;  1KZU B;  3H1H E;  3CX5 E;  2P1J A;  2HOD A;  2OYI A;  4ZKU A;  2KSE A;  3L72 E;  4EYY Q;  1N86 A;  2N9B A;  3CLQ A;  1BSH A;  4HYT B;  1PIX A;  1BE3 E;  1GL2 B;  1UIX A;  4IFD K;  1EQ7 A;  2R3S A;  3MTU E;  1LTT C;  1FZB A;  1SQQ J;  3KZI H;  2H7H A;  1YIT P;  3H1L G;  3L70 G;  1QL1 A;  1HH0 A;  2D2C D;  2W6J H;  2IPP A;  2WVR A;  3WUT A;  3P7K A;  1KV4 A;  1PL5 A;  1VQ5 P;  3TNU A;  1JCC A;  2O1K A;  1PP9 G;  1AJY A;  2FXO A;  2Y0E A;  4WY4 D;  2J60 A;  5KLV G;  1EC5 A;  3H1I G;  1BCC D;  2KSJ A;  2CPS A;  3L71 J;  1YTZ I;  3W68 A;  1AQ5 A;  1N73 C;  1AVO A;  1LWU B;  2PGD A;  2IBZ D;  3H1J D;  1JB0 J;  4AQR D;  1GD2 E;  3A5T A;  1SQQ E;  1LJ2 A;  3EFG A;  2J58 A;  4I2L C;  5GTI H;  1KIL D;  4H13 D;  2P10 A;  2ZAE B;  1FZB C;  4N3Y B;  2KNC B;  1FDI A;  1NH4 A;  5DJU B;  3A0H E;  2E75 C;  2PFX A;  3G71 P;  3B5N D;  2R5B A;  3FWL A;  2OGU A;  3CMA P;  3GW6 A;  5AW7 B;  4TT3 H;  3L71 E;  1NTZ G;  4ZFG A;  2BEQ D;  2A45 G;  2XU6 A;  1VQL P;  1KQS O;  1QVG O;  4W7Y A;  1ZW0 A;  3M9H A;  2QJK C;  2GM4 A;  2IBZ I;  2OYH B;  2RKL A;  2KXP B;  5DJT B;  1JMM A;  1Z3U A;  1CI6 B;  4C7N B;  1W2B O;  4R4M A;  5KJ7 D;  4W80 A;  4ASW A;  1X22 A;  3B8E B;  1NTK D;  2E76 C;  2JHK F;  3E1R A;  2RMZ A;  3PHL A;  3A0B E;  1OFC X;  1NU1 G;  4ZMD A;  1K73 Q;  3ABV C;  4JYC A;  4ZKP A;  4Y28 J;  2FXM A;  1USE A;  4D6T G;  1FZE B;  1E5W A;  4PJ0 E;  3KDP B;  1JMB A;  2G3A A;  3B71 A;  1BSN A;  2M5A A;  1GTW A;  1VF5 D;  1T2K C;  1A02 F;  1JY3 O;  1LTS C;  1Q7Y Q;  1H0T B;  3II6 A;  4PV1 B;  1EZV D;  2H43 A;  1DH3 A;  3V6I A;  1ZV8 A;  1FJP A;  3LW5 H;  1E79 H;  1X9V A;  1M1J C;  2FFD A;  5L8R J;  2HPC C;  1DD3 A;  5H2F H;  3M91 A;  1Z3S A;  1K8A Q;  1M56 D;  3SWY A;  1SQB K;  1SQP K;  1W5C E;  2Q1K A;  3I55 P;  2B87 B;  5AVY B;  1KB9 H;  1URQ C;  1BCC G;  3Q5R A;  1S5L H;  1EXI A;  2WPQ A;  4BWN A;  1GU4 A;  3LID A;  1FZF A;  3BAT A;  5B5E E;  1L4A C;  2JWA A;  1VQ6 P;  3HD7 C;  1NO4 A;  1Y8A A;  2LXB A;  5CBO A;  1EZV I;  2ZXE B;  1SQX K;  3WUU A;  3L70 J;  4IOI H;  1FAV A;  5AW1 B;  1N7S C;  2KLU A;  4DZO A;  1OMI A;  5B66 H;  1AA0 A;  1VPC A;  1ZR4 A;  1P84 E;  2JHM F;  2A06 E;  3LW5 J;  3GLM A;  1Q86 Q;  4IFF A;  3RL0 D;  3V2P A;  5AVW B;  4PD4 E;  1VQ4 P;  3IN6 A;  2PP6 A;  5APT A;  1MV8 A;  3RK2 D;  1N73 B;  1HWT C;  5CJ4 A;  1BDC A;  1OVU A;  2HOD B;  3CCU P;  2ZVN B;  1VQ9 P;  2POH A;  3SFE C;  1AVY A;  2R32 A;  4UB8 H;  1N86 B;  2LXC B;  1KFM A;  3H6P A;  1S2E A;  3L70 E;  1YJN P;  3I56 P;  3BCC J;  5AVX B;  5KAF E;  3L73 J;  1H88 A;  2NPS A;  2WZ7 A;  1FZB B;  2XZR A;  1EDJ A;  1QL2 A;  1SQB J;  1SQP J;  4AYC A;  1YJW P;  3SWK A;  1IFD A;  1NTK G;  5CCH D;  1PFI A;  2IYO A;  1N8R Q;  1DD4 A;  2M0B A;  5APU A;  3IFM A;  2WQY C;  1Q82 Q;  2ZT9 B;  4OGQ C;  1M7L A;  1L0N D;  3NMD A;  1KD1 Q;  3HTK B;  2Q3I A;  2AEJ A;  3N4X A;  5TIS H;  2JR8 A;  2N1T A;  1GDT A;  3LIE A;  1KYO E;  3CWB D;  3BCC E;  2OTL P;  5AVZ B;  1VQN P;  2I8D A;  1D7M A;  2BCC J;  3FIB A;  2SPZ A;  1YIJ P;  1L0L K;  3CXH D;  1EZV G;  1SQB E;  1SQP E;  4M3L A;  2AXT E;  3GMA A;  5KLI B;  3BVH C;  3S9O A;  3BRV B;  4OH8 B;  2HLO C;  2NZ2 A;  2Z4E C;  5BVZ A;  4LC1 A;  1J1D C;  1WRG A;  2O01 J;  4W7Z A;  2K1A A;  3FXE A;  2RH0 A;  3CX5 H;  3RBX A;  5AW8 B;  2UWJ E;  2J0G A;  5KLV D;  1LTJ A;  1FZE A;  2ZYD A;  1SFC D;  1S72 P;  1HF9 A;  1FZG A;  1FU1 A;  4GOE A;  5KTB A;  2AEF A;  4GKG A;  2WT7 A;  2D2C C;  2IFN A;  2ZVO B;  2BCC E;  2FYU G;  3KQG A;  3RL0 g;  3VMA A;  1GZL A;  2J5U A;  4H0L D;  1MKM A;  2AEM A;  1OWA A;  3I5C A;  1ZN5 A;  1GU5 A;  3MGN A;  1Y47 A;  3A3Y B;  3CXH I;  4I1L A;  5AVR B;  5M1B A;  1XTC C;  4JF7 A;  1SS1 A;  2YIU B;  5AVS B;  2WPV B;  1M1J B;  3A2A A;  1U7M A;  1SQQ K;  3VMY A;  1LT1 A;  3JCU E;  1JY2 O;  1JO5 A;  4DJG A;  3IAO A;  3G3Z A;  5AVU B;  1NVO A;  1KIL C;  4H13 C;  1URQ B;  1FZG C;  2J0H A;  1PGO A;  2HYN A;  1GL2 D;  2YNY A;  3H1J J;  4XA4 A;  1L0L J;  1L4A B;  2M5A B;  3B5N C;  2L5G B;  2Q5U A;  3HD7 B;  2JO1 A;  3AE5 C;  1L2P A;  4EIJ A;  4N78 E;  1FOS E;  1PPJ E;  3VOP A;  1FE6 A;  3EQ2 A;  2H43 B;  3QH9 A;  4L76 A;  4BRY A;  2IFM A;  1SQX D;  2FFD B;  1N7S B;  1NAY A;  2W27 A;  1NKZ B;  2XV5 A;  2R44 A;  3CPW O;  3SSU A;  3TGU D;  1RE4 C;  3H32 C;  3N7N A;  1WMK A;  4MN4 C;  3WU2 E;  2JDI H;  2A45 I;  2J61 B;  1YHQ P;  1SQV D;  1IC2 A;  5BU5 A;  1N73 A;  2IBZ E;  3H1J E;  3MHV A;  1L0N G;  5KJ7 C;  1L0L E;  2I1K A;  4R9T A;  2YXR B;  3P8M C;  2OAR A;  1LT9 C;  2W6B A;  1Q81 Q;  3CWB G;  1KIL E;  1FZF B;  2FYZ A;  3OW2 O;  1G1J A;  3KYQ A;  5KKZ B;  3H25 A;  3RK3 C;  2DW3 A;  3A0B H;  1DIP A;  2QE7 H;  1R5S A;  1RF0 A;  1AFO A;  4U3F D;  1ZR2 A;  1HJB A;  1RE3 A;  4PJ0 H;  2Q6Q A;  4WBA A;  3BRT B;  2JWD A;  2HFE D;  3D71 A;  1FZC C;  3EWK A;  3HTK A;  4IL6 E;  1MZ9 A;  1FZD A;  1FC2 C;  1NTM D;  2K88 A;  1QX8 A;  1VQP P;  4YPC A;  1S9K E;  3CME P;  1IFI A;  3G9R A;  3H1K J;  2YO2 A;  1LTG C;  2YXQ B;  3AE4 C;  3AE3 C;  3JSV C;  2J3G A;  3AEG C;  3BVH B;  3H1H D;  3CX5 D;  3WUV A;  1VQ7 P;  2NPS B;  4RES B;  1GW3 A;  3L72 D;  2I1J A;  1KQL A;  1RF0 C;  2KS1 B;  4K35 A;  2LKM A;  2KB7 P;  3RK3 E;  1BE3 D;  1RE3 C;  3WMM 0;  1ZOY C; 
#chains in the Genus database with same CATH homology
 1LTB C;  1HBW A;  5CHX A;  3OAK A;  1GU4 A;  3VMX A;  3HE5 A;  2KP8 A;  5BU8 B;  2WTY A;  2J3F A;  2XNX C;  1CI6 A;  1FZC A;  3LID A;  2E42 A;  1FZF A;  3BAT A;  3RK2 B;  1L4A C;  3VMZ A;  4C7N A;  3V4W A;  3HD7 C;  1NO4 A;  3GHG C;  1G2C A;  2YKP A;  2NPS C;  1N7L A;  2ZXE B;  3HUS B;  1SQX K;  2J59 M;  2N1T B;  1FAV A;  5AW1 B;  1RF1 C;  2KLV A;  4KHX A;  1M1J A;  3RL0 C;  1N7S C;  4JYB A;  4DZO A;  2HPC A;  1X8Y A;  2WSE H;  1YYC A;  2QM7 A;  3MUD A;  4WB4 A;  2BAS A;  4DOJ A;  1Z56 A;  2NPS D;  1JY2 N;  1VPC A;  3TYY A;  1ZR4 A;  2KOG A;  1J1E C;  2XDJ A;  3RK2 C;  2GY7 A;  3VP9 A;  4GT1 A;  2JHM F;  5APQ A;  4O9B A;  3HE4 B;  4IFF A;  1JY3 P;  3RL0 D;  1T3U A;  1HUC A;  2JJL A;  5AW0 B;  3V2P A;  1URQ A;  5AVW B;  5AW6 B;  4HH2 A;  1SLQ A;  3HUS C;  1FOS F;  2N1T C;  2PP6 A;  5APT A;  1MV8 A;  3RK2 D;  2ZFC A;  1N73 B;  1LTJ B;  1HWT C;  2R3C A;  3C9I A;  5CJ4 A;  2HOD B;  1FZG B;  2XNX A;  3NTN A;  2D39 A;  5APY A;  2WSF H;  2POH A;  3CI9 A;  1L4A A;  2R32 A;  4N78 D;  1FZA B;  1N86 B;  1NTK K;  1KFM A;  1HVV A;  3H6P A;  4M7H A;  2WT7 B;  3HD7 A;  5APS A;  3MD0 A;  5CCH C;  3GHG A;  5AVX B;  2N1T D;  2W6A A;  1H88 A;  1MUU A;  1JUN A;  2NPS A;  2WZ7 A;  1FZB B;  2XZR A;  3U1C A;  1QL2 A;  4AYC A;  2WPS A;  3VYI A;  1JTH B;  1IFD A;  3O8Z A;  2J2P A;  1N7S A;  5CCH D;  1A02 J;  4N6J A;  2M3B A;  1PFI A;  1LTJ C;  1FZE C;  2HOD C;  2OYI C;  2J64 A;  2FIB A;  1SP4 A;  2O1J A;  5APU A;  1T3J A;  2HLO B;  3IFM A;  1JC9 A;  1N86 C;  1SFC B;  2Z4E B;  2C9L Y;  2CPB A;  2J61 A;  1M7L A;  1J1D B;  5AVV B;  3NMD A;  4Y99 B;  4NYT A;  1LTI C;  1NAF A;  2VRS A;  3HTK B;  3E1I B;  1CSB A;  2Q3I A;  4EOT A;  1J2J B;  1ZLL A;  3HUS A;  3N4X A;  2WNP F;  2N1T A;  2GUS A;  2M8R A;  1NTZ K;  2Z5H A;  1GDT A;  4AUW A;  3LIE A;  4LLH A;  4IFM A;  1LGH B;  5AVZ B;  3OJA B;  5AW9 B;  3FIB A;  2WPR A;  1FIC A;  5CCG D;  1YTZ T;  1LTA C;  1L0L K;  1JOC A;  3VP8 A;  1LT9 B;  1DX7 A;  4EPU A;  1HTL C;  4M3L A;  5CCH A;  5CMZ A;  1L0N K;  3BVH C;  1DEB A;  3BRV B;  1HGV A;  4OH8 B;  2HLO C;  1SFC C;  2Z4E C;  5BVZ A;  3HE4 A;  4JYO X;  4LC1 A;  1J1D C;  1WRG A;  3M06 A;  4W7Z A;  2Q9I B;  4C46 A;  3RK3 B;  3V5B A;  3U59 A;  4WY4 B;  1NWQ A;  2FYU K;  3TSI A;  3KPE A;  3A7O A;  2P7J A;  5AW8 B;  3P8C E;  1X79 B;  2J0G A;  1H8A A;  1CW5 A;  2J3U A;  1KZU B;  1LTJ A;  2XKM A;  5APX A;  1FZE A;  1SFC D;  2P1J A;  2HOD A;  1FZG A;  2OYI A;  4ZKU A;  1FU1 A;  5KTB A;  1S9K D;  1N86 A;  4GKG A;  2N9B A;  1WT6 A;  2PAJ A;  2WT7 A;  3R2P A;  3HE5 B;  5CCG A;  1JY3 N;  2IFN A;  3CLQ A;  4HYT B;  4B86 A;  5APV A;  1GL2 B;  2YMY A;  4IFD K;  5AW2 B;  3KQG A;  1EQ7 A;  3L37 A;  2C0W A;  3MTU E;  1LTT C;  1GZL A;  1FZB A;  2JHI F;  5AVT B;  3I5C A;  1OWA A;  1ZN5 A;  1GU5 A;  2Q9I C;  1KIL B;  2H7H A;  5KLV K;  3MGN A;  3A3Y B;  1QL1 A;  2O01 H;  3NXS A;  4I1L A;  1HH0 A;  1CZQ A;  5AVR B;  2GUV A;  1XTC C;  1JCD A;  2IPP A;  3P7K A;  4JF7 A;  3VTP C;  3IR9 A;  3L4F A;  5AVS B;  2FKW B;  1FIB A;  3TNU A;  4C7R A;  3V4Q A;  2J5Z A;  1M1J B;  1JCC A;  3A2A A;  3BVH A;  2O1K A;  1SQQ K;  3VMY A;  2WSC H;  2HLO A;  3B5N B;  3RK3 D;  1SFC A;  2Z4E A;  1JY2 O;  4M7F A;  3P32 A;  4WY4 D;  2J60 A;  1FID A;  5APW A;  1JO5 A;  1GL2 C;  3V2Q A;  3E1I A;  1H89 A;  2KSJ A;  3G3Z A;  2CPS A;  3MIW A;  5AVU B;  1YTZ I;  3SWF A;  1AQ5 A;  1N73 C;  1RF0 B;  1KIL C;  1LWU B;  1W2E A;  1URQ B;  3CL3 D;  2P67 A;  1FZG C;  4XE5 B;  2J0H A;  4GIF A;  1RE3 B;  2HYN A;  1FZA C;  4AQR D;  1GL2 D;  2YNY A;  3OA7 A;  3A5T A;  1GD2 E;  5CCG C;  1RE4 B;  2YKO A;  3H32 B;  4XA4 A;  2XNX B;  1G1I A;  2R5D A;  3EFG A;  3M0D A;  2J58 A;  1L4A B;  4I2L C;  1KIL D;  3B5N C;  5AVQ B;  2L5G B;  2Q5U A;  3HD7 B;  1FZB C;  4N3Y B;  3GHG B;  2Q9I A;  3M0A A;  4JZC A;  1NH4 A;  4EIJ A;  4N78 E;  1FOS E;  3VOP A;  3EQ2 A;  1KFN A;  2H43 B;  2C9N Y;  1OXZ A;  2JHH C;  1XTG B;  1LWU C;  3U1A A;  3B5N D;  1RF1 B;  2IFM A;  1NHL A;  2R5B A;  3BAS A;  2Z5I A;  2FFD B;  1N7S B;  1RY3 A;  5AW7 B;  2W27 A;  3L36 A;  1NKZ B;  2QM8 A;  2XV5 A;  1MFZ A;  1RE4 C;  4ZFG A;  2WIT A;  2A45 G;  2XU6 A;  3N7N A;  4Y99 C;  3H32 C;  1J1E B;  2A45 H;  3HRN A;  4W7Y A;  1GL2 A;  3E1I C;  3UIA A;  3M9H A;  1URQ D;  2A45 I;  2J61 B;  1IC2 A;  2IX7 C;  2GM4 A;  2YKQ A;  5BU5 A;  1N73 A;  2OYH B;  1KIL A;  5KJ7 C;  2YO3 A;  1IK9 A;  2KYV A;  2I1K A;  3NFQ A;  1JMM A;  1Z3U A;  4R9T A;  2H43 C;  1HGZ A;  1GW4 A;  1NKN A;  3P8M C;  2JHL F;  1FZA A;  1L4A D;  2OAR A;  1LT9 C;  1JNM A;  2W6B A;  1CI6 B;  1FZC B;  3HD7 D;  2FFD C;  1FZF B;  3M0D C;  2FYZ A;  4C7N B;  4R9J A;  1NU1 K;  2MJZ A;  3B5N A;  5KJ7 D;  1G1J A;  4W80 A;  3KYQ A;  1FDM A;  1JY2 P;  5CJ0 A;  1SQV K;  2J3O A;  3RK3 C;  1G2C B;  3B8E B;  1JTH A;  4WY4 C;  2JHK F;  3V2R A;  1N7S D;  1RF0 A;  2OYH C;  1AFO A;  3M9Q A;  1LWU A;  2P2U A;  1VDF A;  1ZR2 A;  1HJB A;  3VN0 A;  2HPC B;  1RE3 A;  2WWW A;  4JYC A;  4ZKP A;  4WBA A;  2FXM A;  3BRT B;  1FZE B;  1E5W A;  1RE4 A;  2HFE D;  3H32 A;  2OYI B;  1FZC C;  3KDP B;  1FZF C;  5AW3 B;  2Q7C A;  1N2D C;  1IFJ A;  3HTK A;  1GK6 A;  1GTW A;  2HG5 D;  1T2K C;  1MZ9 A;  1A02 F;  1JY3 O;  1FZD A;  1LTS C;  3L35 A;  2J1G A;  3II6 A;  4LGD E;  5KJ7 A;  1S9K E;  1IFI A;  2J3F D;  1T8Z A;  2H43 A;  1DH3 A;  1ZV8 A;  1FJP A;  3LW5 H;  1LT9 A;  1X9V A;  1RF1 A;  2YO2 A;  1T2K D;  1M1J C;  1LTG C;  2FFD A;  2HPC C;  3PP5 A;  3M91 A;  1Z3S A;  2C0X A;  5AW5 B;  3P8C D;  1FJK A;  3TNU B;  3SWY A;  3TK1 A;  2J3G A;  3BVH B;  1NTM K;  2H8P D;  1IFN A;  1SQB K;  1SQP K;  2J0Y A;  2JEE A;  4WY4 A;  2NPS B;  1NOH A;  4RES B;  5AW4 B;  3M9B A;  3V2N A;  2E43 A;  5AVY B;  1GW3 A;  2I1J A;  1IO4 A;  1KQL A;  1RF0 C;  1GK4 A;  2OYH A;  1URQ C;  1FBM A;  2LKM A;  1SVF A;  2KB7 P;  3T97 A;  1IFM A;  4I6M C;  1IJD B;  3RL0 B;  1RE3 C;  3WMM 0;  2WPQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...