2OYRA

Crystal structure of upf0341 protein (yhiq) from shigella flexneri in complex with s-adenosyl homocysteine, northeast structural genomics target sfr275
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
250
structure length
245
Chain Sequence
MKICLIDETGAGDGALSVLAARWGLEHDEDNLMALVLTPEHLELRKRDEPKLGGIFVDFVGGAMAHRRKFGGGRGEAVAKAVGIKGDYLPDVVDATAGLGRDAFVLASVGCRVRMLERNPVVAALLDDGLARGYADAEIGGWLQERLQLIHASSLTALTDITPRPQVVYLDPMFPHKQKKEMRVFQSLVGPDLDADGLLEPARLLATKRVVVKRPDYAPPLANVATPNAVVTKGHRFDIYAGTPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UPF0341 protein yhiQ
publication title Crystal Structure of UPF0341 Protein (yhiQ) from Shigella flexneri in complex with S-Adenosyl Homocysteine, Northeast Structural Genomics Target SfR275
rcsb
source organism Shigella flexneri 2a
molecule tags Structural genomics, unknown function
total genus 69
structure length 245
sequence length 250
ec nomenclature ec 2.1.1.242: 16S rRNA (guanine(1516)-N(2))-methyltransferase.
pdb deposition date 2007-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04445 SAM_MT Putative SAM-dependent methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2oyrA02
3.40.1630.10 Alpha Beta 3-Layer(aba) Sandwich S-adenosyl-L-methionine-dependent methyltransferases YhiQ-like domain 2oyrA01
2PXAA 3C3YA 3UJCA 2Z6QA 1QZZA 3UFBA 1RJFA 3REOA 3FTFA 4E70A 5GIPE 3PFGA 1XDUA 3AWIA 3NDIA 2OKCA 3NWBA 1ORIA 2C7PA 2IH2A 5FUBA 5K0NA 4ER6A 5JUWA 1KHHA 4HC4A 4R6XA 3FTEA 3HCEA 3LDUA 2IGTA 3A26A 2ZZMA 3JWGA 5H02A 1YF3A 2PJDA 2O06A 1JG2A 3CJQA 1QANA 3DOUA 3FTCA 1JR4A 3FUTA 4FSDA 1YZHA 2JG3A 3R9XB 4R05A 3QOXA 3QOWA 5KQRA 2ERCA 5E1DA 1R8YA 2PX2A 2G70A 2H1RA 3O7WA 5K0BA 4PYLA 2ZLBA 4WVLA 2FYTA 3ID6C 4IV8A 3B3GA 1PRYA 2ZSUA 5E9QA 3BGIA 3G7UA 1X1BA 3KQWA 2GS9A 4MIKA 5FADA 3MCTA 3SXJA 2PV0A 2HTEA 2YVLA 4ATNA 4MHTA 4HSGA 3T0IA 5CCXA 4V0RA 5DM0A 4QQKA 3LBYA 5CVDA 5FA5A 3T7SA 3PS9A 3LCCA 2AOUA 4QTTB 2ZBRA 1JTEA 2JH9A 1XDZA 4IKPA 4F84A 4OA5A 1NBIA 3F4KA 3ORHA 3TMAA 3LDFA 2VZ9A 4QPPA 2FK7A 3LSTA 3GRRA 3LCVB 1NT2A 3P97A 5E1BA 4RTJA 2WA1A 2I62A 3A7EA 3FPJA 2QRVB 5EMLA 3TRKA 3GU3A 3P9KA 4RVGA 1ZGJA 4E33A 1V39A 3EPPA 3R6TA 2AOWA 2PXCA 4QQNA 2AOTB 3FUXA 2JH8A 2R6ZA 1RI3A 4PYQA 3HNRA 5LR6A 3V97A 2IFTA 5GWXA 4DA4A 2G1PA 1ORHA 3CVOA 4XUCA 4OBXA 3LGAA 3G2OA 3NW9A 4HGYA 4OQEA 3BXOA 3UWPA 3GRVA 3JWJA 5HIJA 4ER5A 7MHTA 3PX3A 2V74B 3G8BA 2UZ4A 3KQMA 4RVHA 4E2WA 5EMMA 5DXAA 3X0DA 2IPXA 4EQZA 2FHPA 2P1DA 4CXMA 4M7RA 4LECA 3SGLA 5E2AA 3E23A 1XXLA 4GC9A 5E2BA 3HVKA 2B3TA 2KW5A 2PVCA 4H0NA 5CM2Z 4E30A 1WG8A 4KVZA 3EMDA 3IYLW 2ZBQA 3AXSA 5DPMA 3SMQA 1SUIA 3VC1A 4DMGA 3KR9A 1P1CA 3AJDA 2QM3A 4EVIA 5EOVA 4CTKA 3HA7A 5HZMA 3M6VA 5DM2A 2CWWA 1KIAA 3NMUF 3EGVA 5D1HA 4RVFA 2G72A 3R3HA 5GP1A 2XYQA 1NE2A 5FHQA 3DP7A 3D2LA 2ZWAA 4LG1A 2QY6A 2O57A 4EK9A 4KDRA 1RI5A 1Q0TA 1UWVA 1VP3A 4GOMD 5BXYA 1R18A 1R6AA 1L3BA 3KQTA 4PYJA 3BWBA 1G55A 1KP9A 1ZKDA 3CJRA 4RTKA 3DLIA 4M38A 1YFJA 2DULA 3P2IA 5KS2A 1QYRA 1X1AA 1YZ3A 4BP3A 4QPNA 5P8WA 3GO4A 3CKKA 3HCBA 5DLYA 5E1MA 4HTFA 1KPIA 3PVCA 1KYWA 1NW7A 1X1CA 3FUVA 3CGGA 3UBTA 2Z6AA 4AUKA 4YUXA 5LQCA 1INLA 2AOVA 3JWHA 3SR4A 1WXXA 2AN3A 1O9HA 1EG2A 3DR5A 5DTMA 3A4TA 4BLWA 5HIKA 2P35A 1RJGA 1NBHA 4ER7A 2EJTA 3PFHA 2DPMA 4M37A 4MTLA 5CVEA 2NP7A 5FQNA 2PSSA 4K6MA 3TM4A 1AV6A 1WY7A 4XUEA 5G02A 4E2YA 4YV2A 3EEOA 5T64A 4FS8A 1R00A 2HNKA 4AX8A 1D2GA 1NW8A 4C06A 4U7TB 1WXWA 5DRTA 4P7FA 2AZTA 2NXJA 5EIFA 4GEKA 3VYWA 3EGEA 2VS1A 2BR3A 5ICFA 1G6Q1 3OPNA 1JG3A 4GOOD 3IEIA 5EMKA 3KQOA 5EGSA 1OR8A 2O07A 1G38A 2WK1A 3G88A 8MHTA 1VLMA 2B25A 2C7RA 3A7DA 4RTSA 4DKJA 3CJTA 3EGIA 3M6WA 1KXZA 1Q0SA 1EIZA 3GGDA 3P9CA 5HEKA 3B3FA 3UZUA 4DCMA 2ZZNA 5FWAA 5HIIA 4F85A 3MCZA 5B1SA 1YB2A 2OY0A 2NYUA 3GXOA 3G89A 3G2PA 2ZZKA 1YFLA 3FYDA 2OXTA 2ZIFA 3U81A 4L7VA 2PX4A 5CD1A 1DL5A 1WZNA 3FPHA 4P58A 3OCJA 3OU6A 4CTJA 1PJZA 2HV9A 2AVNA 2XVAA 1AQIA 4GUAA 3P9NA 2PY6A 3B3JA 1BKYA 4X41A 5DM1A 4E2ZA 3LX6A 4RTLA 2BR5A 3C0KA 2ESRA 1R8XA 4RTQA 3C6MA 4RTPA 3GDHA 3EVEA 5CVJA 1JSXA 3EMBA 4YV1A 4HRAA 5GINE 3LECA 1VP9A 2P3LA 4EMSA 1N2XA 4CWAA 3PT9A 2AVDA 4GOND 1EJ0A 4MWZA 3KPUA 3TM5A 4X60A 4PGHA 1SQGA 2OB1A 5LQNA 1D2CA 4M36A 4YV0A 3RW9A 1SUSA 4PIPA 4X63A 3PB3A 4QVKA 2ZCJA 1JTFA 2NXNA 1G60A 2Y1XA 4U7PB 5BW5A 1QAOA 3O4FA 5E8RA 1B42A 3PLAE 2IIPA 5C9ZA 3OU7A 2CMHA 3P9IA 3BKXA 3GRYA 3P2KA 4AZWA 3LL7A 1JQDA 5LQRA 3KHKA 2IBTA 2FCAA 4BP1A 1NV8A 1R74A 3HTXA 4LWPA 3M70A 2N47A 2YXLA 4B17A 5EMJA 2I9KA 5K0FA 3UJAA 1FP2A 3FYCA 4GBED 1RJDA 3TFWA 1FP1D 1HMYA 4RWZA 5CVUA 4GF5A 3OFJA 2ZIEA 4GOLD 3ELUA 2UYCA 5ICGA 3ER8A 3NVKI 2IH5A 3EVBA 1MJFA 1TW3A 5EZSA 3JWIA 1KYZA 2NP6A 3MAGA 1U2ZA 3DXZA 1EJ6A 1Z3CA 3GCZA 4A6DA 4FR0A 5LQJA 2VDWA 3FTDA 2ZBPA 1L9KA 2H11A 1KPGA 1VIDA 3KPWA 1DCTA 2QRVA 4OX9Y 3NJRA 1F3LA 3VSEA 1ZG3A 1N7JA 4RV9A 2UYHA 5C1IA 4PYOA 5E9JA 5HFJA 2AN4A 2AOTA 2NXCA 5CUQA 4RTMA 5E1OA 1XTPA 3MTEA 4WXHA 1VE3A 3KPYA 1UFKA 3MERA 3R24A 4FT4A 4PWYA 5EHGA 1ZHFA 5KYGA 3E05A 2R3SA 3DULA 3GWZA 5F2OA 3MHTA 3LBFA 4QDKA 2YUIA 3LKDA 1QAMA 3HCCA 3HP7A 5DSXA 1G8SA 5EQJB 1XJ5A 4RVDA 4X1OA 2B78A 3E8SA 3DH0A 3KR1A 3TLJA 4RTRA 2P3OA 3I53A 5FA8A 5HIMA 1IM8A 2IH4A 1X1DA 4R8SA 3OE4A 3UJ7A 1FBNA 3HVHA 4YMGA 5M5BA 1EAMA 4OQDA 3K6RA 1NV9A 4KRGA 4C08A 4DM3A 2ONYA 3HEMA 3K0BA 1O9GA 3VC2A 3G5TA 4Y2HA 4ER3A 5EEHA 4YUYA 2PT9A 2C7QA 4FP9A 2YX1A 2ORED 2YTZA 1BOOA 1I4WA 3TKAA 5CCBA 4A6EA 1L1EA 5GM1A 5IH3A 3HA3A 3T7TA 2YR0A 3O31A 4ER0A 3G2MA 3OU2A 5LQAA 2C7OA 1AF7A 5CIYA 1UIRA 4PGGA 2PT6A 4YUWA 3MGGA 5EKUA 3LPMA 4P7JA 1T43A 2OB2A 3B7PA 3FPEA 2OPBA 3TOSA 2OZVA 4E31A 2ZWVA 3FRIA 3OZRA 1X19A 3HA5A 4RX1A 5KQSA 3FRHA 5DXJA 1JG4A 4KIFA 3G8AA 2OYRA 3DMFA 3UJDA 2PWYA 1F38A 3OZTA 3P8ZA 5DX0A 4EKIA 2E5WA 5DSTA 3HM2A 4PINA 2ZVJA 4FSXA 1FJXA 1P1BA 3BWCA 3LHDA 1JG1A 2NXEA 5K0EA 4BY9E 4QVGA 3LCUA 4F86A 4X61A 5D1NA 3SVZA 3THRA 3AXTA 2XVMA 1JSZA 3OE5A 4V0QA 1YUBA 1RI2A 5T6BA 4C4AA 1SQFA 2PXXA 5JR3A 4PYIA 2P3QA 1XVAA 4PCLA 4XUDA 1WS6A 3P71T 2ZFUA 5EIWA 4CKCA 5EC8A 2PKWA 5EKXA 2UYOA 5K01A 3TQSA 3EVFA 2ADMA 2FRXA 4ISCA 3OZSA 5DT2A 2UYQA 5GM2A 3MQ2A 2XYRA 3Q87B 4R8RA 3TKYA 3FZGA 1M6YA 5U4XA 3IHTA 4PCAA 4AZVA 2YXEA 4CKBA 1RI1A 4Y30A 3NTVA 3A27A 2PBFA 4PNEA 4DZRA 3V8VA 3KQQA 3BWYA 2PWPA 5K03A 4FGZA 2ZTHA 2B2CA 3DMHA 3R0QA 5EG5A 1MHTA 4IWNA 3EVGA 3M4XA 4PYKA 2OBFA 5E8JA 5BW4A 5ICEA 3BGDA 4E32A 9MHTA 1N7IA 2P7IA 4UOEA 1P91A 5LQKA 1JQEA 2AOUB 4KW7A 5KVAA 2PGXA 1XCJA 4HG2A 5FTWA 2O05A 3KU1A 3ER9A 3LDGA 5MHTA 1XDSA 1I1NA 2JJQA 3UA3A 2ZIGA 3HVIA 3GRZA 2CL5A 1NW5A 1KR5A 4HH4A 3NVMB 3AY0A 1SG9A 3T7RA 5HOQA 1RI4A 1JQ3A 2B9EA 3M6UA 4XCXA 4C05A 4DQ0A 4NECA 4EKGA 3DMGA 3S68A 3A25A 2I7CA 1IXKA 3ANXA 4C07A 1BC5A 4QDJA 2YXDA 3MB5A 5EPEA 5EVJA 2GLUA 5BP7A 3BZBA 3EVCA 2V7EA 2GB4A 2VDUE 3ME5A 4IV0A 5K0JA 3LKZA 2OO3A 3CCFA 3ELDA 1VBFA 3DXXA 4O29A 2F8LA 1DUSA 3KR0A 4YMHA 3WSTA 2CMGA 4PONA 4DCGA 5K8VA 4OA8A 3UJ9A 3UJ8A 1HNNA 5GIOE 3OFKA 2P7HA 4R6WA 5IKMA 2YQZA 4QTUB 2EX4A 4AZTA 3SSNA 2VDVE 3EEYA 1M6EX 2PX5A 2HWKA 3CBGA 3I64A 4FZVA 1NW3A 2GAFA 5K0GA 2O0LA 2VP3A 3EVDA 4RTNA 3DXYA 3MTIA 2GA9A 5DX8A 1P39A 5DTQA 3KKZA 4BLVA 4C03A 3PX2A 4MQ4A 3M33A 3HCDA 3DLCA 1VPTA 5DX1A 1G8AA 4P7GA 3SX0A 2IBSA 3Q7EA 3UJ6A 1KPHA 3BGVA 2P40A 5C0OE 3E7PA 3EVAA 3CC8A 3GRUA 5CVVA 2IP2A 4E2XA 1RJEA 4KWCA 1SVUA 2FPOA 2EFJA 2H00A 3SSMA 3KPJA 1BHJA 2QYOA 3C6KA 2NNWB 3B5IA 2BR4A 4KDCA 3ELWA 5HILA 1M0EA 5GOZA 2FK8A 3GJYA 3KQYA 3KR2A 4PIMA 3SSOA 4PYMA 2Q41A 4GC5A 3I9FA 3TPZA 2I6GA 1D2HA 2ZULA 3B89A 4Z2YA 3UA4A 5LQUA 1XCLA 5T67A 4BLUA 2G71A 3GNLA 2LD4A 10MHA 3FUUA 2K4MA 5F2NA 2BM9A 4HTFB 3RODA 2WA2A 2JHCA 3UJBA 2G8NA 5ICCA 3TR6A 2AN5A 2P41A 3G5LA 3FPFA 2CKDA 4C04A 3FUWA 3G2QA 2BM8A 3DTNA 2HR1A 3C3PA 4FT2A 4PYNA 2AOXA 3I58A 2JHAA 2XYVA 2ZW9A 3HCAA 3KQPA 4POOA 2A14A 4DF3A 2JHPA 3DUWA 1L3IA 5LSAA 3ELYA 5EEGA 2AR0A 5K0LA 3RIEA 1NKVA 2BZGA 3THSA 3P2EA 4RYLA 2XBMA 2Y1WA 3ERCA 3BT7A 2EG5A 2HMYB 3I5UA 1FPQA 5FHRA 1EQAA 2GH1A 2Z6UA 2BH2A 4KIGA 4YUVA 2PX8A 5FULA 4LWOA 5K05A 4P7KA 4RSRA 5E9WA 3HVJA 1ZGAA 5FQOA 1TW2A 2P8JA 1SKMA 1VQ1A 1QAQA 2PLWA 2GPYA 3IV6A 4RTOA 1H1DA 1L3CA 5FCDA 4JXJA 1Y8CA 1NW6A 5DM4A 1I9GA 5DRYA 2IDKA 2IDJA 3BWMA 3HCFA 1IY9A 3L8DA 3BKWA 3GIWA 1ZQ9A 1VL5A 3BUSA 3H2BA 5DWQA 4AZSA 3KQSA 4YUZA 3KQVA 4HGZA 3QV2A 4GQBA 3FPGA 5DTRA 2AS0A 4G56A 2ONZA 3EVZA 3KPVA 3NWEA 5EHIA 5K0CA 3PTAA 3SM3A 5EZQA 4CKEA 4ZTBA 1AQJA 4OBWA 1O54A 5ERGB 5FWDA 2QE6A 5K09A 5F2KA 1TPYA 3M6XA 3NDJA 2EJUA
chains in the Genus database with same CATH superfamily
4O2AF 2GZMA 3AR6A 1P81A 1DEXA 5A0VA 2VJDA 2FHSA 3CE6A 3ADBA 4QHYA 4WV3A 3T54A 1PZFA 4Q37A 4KFTA 1M6NA 3L0SA 1JB9A 4KQKA 5A71A 4M1ZA 3ISTA 1KZHA 1YL5A 4IILA 4MWCA 2WYOA 1SC6A 2R79A 4OXKA 4FR2A 4PHHA 4PRLA 4PVDA 3SX4A 2CNBA 1Y4SA 4MZXA 5I8ZA 3VSBA 5JSZA 3LU1A 1NQTA 2VWHA 5ADWA 4F9GA 1Z2AA 3QYFA 2GK4A 5LBUA 3VXKA 1N1DA 2FW9A 3O84A 4BCCA 1C3OA 4ILKA 3A06A 5HJ5A 2QAIA 1SUEA 4HWOA 1CRPA 4WNAB 1C9MA 3QNMA 1P1FA 1PLJA 1WX1A 4DR6B 3D8RA 1GPH1 4JJEA 4JP2A 4ACBA 2IYZA 4AXXA 4BEBA 1U7TA 3ID6C 4IV8A 4LV6A 4QUGA 2ZSUA 1SBYA 1YA8A 4B71A 3SF0A 3AL0C 3PWTA 3UUGA 2FP4B 1PD1A 2EGUA 1B6GA 2PA3A 3MCTA 1SBIA 2CE2X 5CYGA 3IP6A 1Y80A 2AUTA 4RF4A 2BI4A 4ZWNA 1FUIA 4EAAA 2QLMA 2VPZA 3E5MA 3KKOA 5IKEA 3QEAZ 5A02A 3C6QA 1WV1A 1AO0A 2JL1A 2FEWB 2RB5A 2O0HA 2ZB2A 3ZE9A 5TQ2A 4LTDA 4RXMA 4AJ9A 3UMMA 4DR1B 3ZJ4A 2O5CA 5A9RA 3DOIA 4PG8A 2NTEA 3OT1A 3SI7A 2FK7A 5FI1B 2OZLB 3FSGA 3SG0A 2QPTA 1IAQA 3V8NA 4AJJA 2ZI7A 3WHKA 3JALB 1IRXA 2WHRA 3C4QA 4LOJA 2F9MA 3H9UA 4LXGA 2IA5A 4DCOA 2O1XA 4KR7A 1GZ6A 3BMNB 3GU3A 4Q01A 5AVSA 5JZMA 3MWFA 2XRZA 1G4UR 1K2VN 3P32A 3ZHXA 1NJFA 4DLLA 3UBMA 2OORC 2Q3DA 4O2BB 4DSUA 2JJ2A 1F8XA 4QPCA 3DEZA 2JARA 4ZOCA 1O9BA 1Z7BA 4IM7A 1OYVA 4I8IA 4N48A 2D0PB 2BEWA 2HA4A 4P3KA 3GGPA 1PD0A 5IJ9B 2J31A 3N2GB 3RE1A 3C1TA 1HE5A 4YJ3B 1TYDE 2PVPA 2BTEA 3THWB 1RJ9A 1WXIA 1YCDA 2G0AA 3K8QA 4BV9A 3ACCA 2B4AA 2ZRIA 4ZV4A 3ZWVA 1V9SA 2VT6A 4QM7A 4KVZA 1FFXB 4YASA 2OXFA 3RIHA 3VR5H 2XH8A 1N7HA 1G2IA 2GESA 3EA5A 3OLXA 4UHBA 4B8ZA 2BGJA 2R84A 3D4NA 3F7NA 5FO8B 1WMFA 3KB6A 4U9UA 5BSWA 4WK0B 4MUIA 2HRBA 5CT6A 3L4JA 5IX8A 2NQTA 3QNUA 4RNDB 1GTRA 1KYTA 3NS7A 2C03A 4RVFA 4PC3A 3KV1A 4XD7D 2ZWAA 1IFXA 3EG5A 5EQFA 4QDUA 3PXCX 1Q0TA 3GY0A 5BXYA 1FTNA 2PGLA 1G55A 1QHHA 3BWBA 3T1NA 3T1QA 4G09A 4LYGA 1E2MA 3AEKB 2ISCA 2VZEA 3QF7A 3QTBA 1EFVB 5ALHA 1ZI9A 5KDLA 2H1CA 4A0SA 3HO1A 1I7NA 3M81A 3C7CB 5AM0A 3V1NA 5DBFA 5AOCA 3GO4A 4AAYA 3WLKX 4ND2A 1G8KA 3C8UA 2FX5A 4KTVE 2QTCA 5IN4A 3VYRB 5F4BA 2WYWA 2AOVA 3EYAA 1GLGA 4X90A 2WUWE 1JAYA 4ZQGA 1P77A 3Q12A 3M4ZA 5FOUA 4WINA 4GO1A 1E58A 4OB6A 3SF8A 1IC6A 4JZKA 3JXEA 4BNIA 1RQ2A 2HCJB 4WKNA 1E3TA 3MSCA 2IV3A 5KWSA 4L07A 5KPJA 3K4PA 5JV5A 3SDZA 1TC2A 5GONA 2NYRA 1MLDA 1G2QA 1BX1A 4DRZA 3WMFA 4G0XA 3OCCA 1CY2A 2OBMA 1OX4A 3IP8A 3FMFA 4QPZA 4U7TB 5EJEA 2V03A 2FW1A 1A4UA 1OU0A 1W1UA 1R4MB 1CNMA 1VMAA 2W2TA 1EU1A 1I01A 1QHYA 1ZMRA 3L7OA 4KQ1A 2IYLD 1Y5NA 2O23A 3JYNA 3LKBA 3OKFA 2XGSA 3BB4A 3R40A 3IPXA 4XB6B 5EMKA 2ZUEA 2ZRNA 1GV0A 3G88A 2CK3A 2CVQA 2AIRA 4Y6QA 2ODAA 1C9YA 4IUCS 5FNVB 1TJ4A 1OYOA 1RM5A 2KYRA 2WE7A 3EF0A 4AKTA 5JNUA 4J0HA 2BDUA 1M2KA 4RZUA 4L2IA 2QRUA 3IDOA 2Q0SA 1JHYA 1Y8QA 1N9ZA 2GN1A 3WL4A 2XOKD 1PWEA 2YZNA 4GWGA 1H8ED 1NASA 1UFRA 1VZ2A 2Y1EA 2Y9PB 2AFHE 2DPGA 3IAFA 3B8EA 4IBOA 3UENA 1M1ZA 4F85A 1YAJA 3AP3A 1DFHA 4OX9B 1YV9A 2O8DA 2V5VA 2IK8A 2Q9CA 3OOHA 4FQ5A 2OTCA 1Z0UA 2EAUA 3DE5X 1EX7A 3BCSA 4L9SA 1P7VA 5KWIA 4ZT3A 4DLAA 3FTPA 5C8YA 1C8LA 2OK7A 3A14A 4ZU3A 4C4PA 2XSZD 4MWTA 4ETNA 2PY6A 3JZMA 5BN5A 2O1WA 3CRQA 4OKNA 2C9OA 1GL7A 2HA0A 5A7GA 4RTQA 2NUTA 3KJZA 4E88A 2RHMA 3S2SA 1TQ4A 4PAMA 2G7MC 3PRHA 1RC0A 4OQ4A 3ZVNA 2PGOA 4NMWA 2CL0X 2Q2WA 4GOND 1MOQA 1YUMA 2B1GA 2JIDA 2VF7A 2YWHA 3PUWA 1HQDA 3C7KA 2G9QA 1ZO8A 2RHRA 3O1HB 3QXXA 4JT8A 4GG1A 3EGWA 1HT0A 3OO1A 4NYIR 4ZGWA 2ZYAA 4RPGA 5B5SA 2YNMA 2FTKE 4ZDIA 4FFOA 2YICA 4KB5A 3TEFA 1HZZC 3UO8B 4KPUA 2IJGX 1PS0A 4TROA 2R9VA 1QAOA 1RMQA 4REQA 4BO7A 1F0YA 2YXBA 2PHZA 3H75A 2CMHA 5D85A 4NQRA 1BA3A 4Q4AB 3LL7A 2IHTA 4CF4A 2QBYA 2XZDA 2AF3C 2OR3A 2EYUA 3SWWA 2VRBA 3WYFA 3EUFA 3OIUA 1DC6A 1U3UA 4F6RA 1G16A 1PDOA 1NU6A 3HR8A 1BDBA 1GPJA 3MZ0A 2UYCA 3DAGA 4BGDA 1SCQA 2QLFA 3TRIA 1RXUA 1QH0A 4C0LA 2GM4A 1R6UA 2FZWA 4JLOA 4LJAA 4BMZA 1R15A 4ZJZA 1KKLA 3USCS 4A6DA 2NIPA 2QXUA 3SQNA 4MWDA 3WGIA 2UUAB 2QJTA 3IXQA 3L8FA 1D1PA 3NIFB 3QGMA 4G0QA 4U6NA 4RPHA 5HF8A 3VH4A 3VNAA 3ZXIA 1E3QA 2F1KA 3L0YA 2P79A 5IG2A 4LXYA 2NXCA 1RDFA 3EEBA 2J0VA 2IS2A 4YRTA 5CTJA 4RLHA 1KMCA 1UFKA 1WCWA 1YZGA 1XKXA 1T0UA 1TFRA 1TEVA 2LW7A 2P9FA 2COKA 2W2KB 3E05A 4B4VA 1D4FA 4LMPA 5KZMB 1GZ4A 2HWUA 4YXWA 4GYKA 3T3OA 5FTNA 1B15A 1Z18A 1QIJA 1X1DA 4YMGA 4M9XA 3UGJA 1XLUA 2P9JA 4XPIA 2FRDA 1N3LA 2QR5A 1ADGA 4R0NA 1QVWA 2Z9BA 2Y0EA 1SUFA 2LXNA 2P69A 2X3YA 3ORRA 4L1KA 3VC2A 3EQZA 3OEHA 4JL8A 3D7NA 1E1CA 2MIIA 3KTOA 2ZBEA 1MQ8B 1PUIA 3S2EA 1C7EA 4HCJA 4PE5B 2JLBA 3GCDA 3HWX1 4L16A 4TSKA 2FFRA 4R51A 1BOOA 2O2JA 3Q11A 1BWRA 2Q6VA 3GJ0A 2P6OA 4XW2A 3FA2A 5SY4A 1U7DA 3OU2A 4NLLA 2PCLA 1DKPA 3QZUA 4BRWA 4K6KA 1XI2A 2NV2B 2IZ7A 1XTBA 2OKGA 4AD8A 2AR9A 3EPKA 4U8HA 1VJ1A 3FPEA 2FW7A 4NP6A 1GKKA 2OHXA 2OZVA 3C87A 3DZKA 1FTSA 2GZRA 2I2AA 3IOEA 1BDIA 2ZBFA 4MLZA 1XKTA 3TTUA 1IN1A 3E7FA 3C3EA 1PGQA 4MPDA 5IPFA 2AYYA 4LZLA 1E2LA 3O8OA 5D3ZA 1ZVQA 4NENA 4XSGA 5LN1A 3H8VA 4UBNA 1IOWA 1RU3A 4H27A 2XE8A 2OBXA 1GVHA 1ZIDA 2IYOA 2Q9AA 3FBWA 4OQLA 2YIMA 2H4FA 2GNPA 4PINA 2VJYA 5WRFA 3SZGA 4YJFA 3VYTB 4BNVA 4KPEC 2HQOA 3QXSA 4HX9A 4OQYA 1GV1A 1GNQA 1EXMA 1SCJA 1SUAA 4JMLA 1F7VA 2P9QA 2K2WA 3N2ZB 1QDUA 3RC3A 4XVQA 1L5KA 4NG4A 3URKA 1DI0A 3GMDA 4Z0HO 5CHEA 3KQLA 2C5FA 4UHCA 1XRLA 4PCUA 4JKOA 1Q17A 2UDPA 4K9RA 3OX4A 2X23A 1PEAA 3ZWMA 3K3PA 1H05A 4E13A 2ODBA 5F33A 4ZHQA 1I1OA 1XXHE 4CKCA 1Z88A 2FE1A 2MMGA 2RHWA 2ZFUA 1N6PA 3QLVC 3QVWA 4W82A 5EIWA 5EKXA 4Z4EA 1U3FA 3C45A 2ADMA 2NO7A 4K6FA 4LNVA 4WZAE 1J0CA 2WF6A 2YJ4A 3MQ2A 3Q87B 1RHQA 2CFTA 3LBAA 4GDMA 4QXQA 4WJKB 4PCAA 4OGKA 4ZCLA 3VAYA 5FUMA 4Y30A 2CHEA 3NTVA 1RKUA 1J2TA 1I2BA 3A27A 3K0HA 3OC6A 4KO1S 5C5IA 4DZRA 5CVTA 3V8VA 3KQQA 1EWRA 1U65A 1SCKA 3VU9B 1IK6A 1W96A 4X20B 3M4XA 4OF4A 2OBFA 1DDOA 3DWGA 4NJMA 1V5WA 1STOA 3N74A 3D81A 2IVFA 4AROA 2LV8A 1Z4LA 5JHHB 2AOUB 2QRHA 4MV5A 4OAQA 1CUDA 1Q2UA 4D0GA 2WKWA 1N9GB 1J90A 5A05A 2AYXA 5LBTA 2RB4A 4BZQA 1IULA 4ZA2A 3FPKA 2HU8A 2X0NA 4G2NA 3BQNB 4Z9BA 5BUQA 1SZCA 1W25A 4JKYA 5DWVA 2XQIA 3T7RA 3ZGYA 4QUEA 1FMCA 1Q0LA 1X1QA 4FGUA 4TV8F 2GXUA 4EHNA 2GPJA 5LA6F 1GQYA 1U2RA 4UAGA 4KYUA 3MQ4A 4W63A 2FPXA 3GLTA 4ZYLA 3G9ZA 1XNGA 3ZH9B 2GB4A 2CXRA 3EZNA 1NY6A 3TIXB 3UHJA 3QEBZ 3HXPA 2OO3A 3DZGA 3IKVA 3DXXA 4TLEA 3SY8A 4C1NA 4F04A 4HNQA 4LMBA 1AXGA 4DJFC 2WJ6A 2I1WA 3EARA 2HMAA 1JMYA 3IQXA 4WERA 2IYEA 4OL9A 5CLGA 3IEMA 4FYPA 1R0RE 2Q4DA 3QRWA 1BE6A 1DBSA 4DCPA 5IKMA 1YDMA 4K1XA 2YXPX 3RAJA 1C9KA 5DYIA 4BMOB 1AGRA 2PX5A 3CBGA 4RY2A 3I6MA 1E7WA 4Y1FA 3DKRA 5BWMA 3HCRA 3R5XA 4DG9A 4B7UA 4QAJA 3RRMA 1UOEA 1JR6A 3FOEC 4BQFA 5KB3A 2XCTB 2I1VB 3LPNA 1XPRA 4IR7A 4WSOA 3I9NA 2JEOA 1LK7A 3HCDA 4V0LA 5IBCA 4P7GA 1S2DA 3HGTA 4MRSA 2A9KA 4CM1A 1K6JA 2C1ZA 4M76B 2FX2A 1S6YA 4WN9B 5J5VA 4EYQA 1TO2E 1MORA 2RH8A 4J03A 1YRLA 3KQHA 2Q50A 4EJ6A 1AY0A 4QBFA 3MBOA 1E7RA 4DQDA 1M0EA 2V6BA 1UQRA 5LB2A 2Q8PA 3D02A 3WKEA 4U3JA 1E7QA 3MD0A 2JRCA 2OV6A 5D8DA 1ZSVA 2VHXA 3AVPA 4LZJA 1N5DA 5HGJA 4BVGA 1YQQA 3GFBA 4KG7A 1MKYA 2PA0A 3E9RA 2P6RA 2W0MA 13PKA 1AF4A 2UVPB 3AR9A 3GNLA 3UMJA 1KEEA 1ZXXA 2XUKA 2WF9A 4HTFB 2IXTA 1GR0A 3DTYA 3MK31 3O3OB 3OQPA 4UQPA 3UAVA 3VPHA 2EBWA 3H5VA 1HDIA 3H2KA 1OI7A 2WJ3A 3DNMA 4MQEA 3IJ5A 2P41A 4ZZ0A 5JBQA 3AILA 1IZ9A 2QMUA 3KALA 4UKDA 3LZDA 5JOQA 2JFWA 3RTEA 4WBNB 4Q66C 1SOMA 3IILA 3I58A 5E4TA 2NO9A 4DQKA 4POOA 3C39A 2AK2A 4WZ6A 2YMQA 1Y1SA 1T5LA 3LFTA 3SZ3A 4ZI7A 4BAZA 5FT9A 2AR0A 1ZWLA 1FVHA 1UBSB 1NJ1A 1WMEA 2B83A 2I4RA 2OORA 3P2YA 1DPFA 3P0JA 1DKMA 3OLYA 4WADA 5CYFA 4ZZ1A 3OA2A 1XPUA 1JDBB 2WT8A 4EYOA 1NBWB 5T4FA 1P7ZA 3SKXA 2I2CA 3OQOA 3QJ5A 1YASA 2FQYA 4FKMA 2UUBB 4TKVB 2F62A 4ND1A 3QMPA 3OQVA 4PFQA 1OB2A 3E35A 5L4SA 4EG4A 5AOAA 4M0UA 4DOMA 1Y8CA 1UDBA 3AZQA 2GLTA 3HCFA 3MELA 2WSMA 3K35A 721PA 3KOWA 4KN9S 1LBQA 1BFUA 4FS3A 3W7BA 2B6NA 3GVCA 3IXLA 2WFZA 3FNIA 3AZOA 2D1FA 4H3SA 5D00A 4B34A 5ITZA 2C9MA 1DRVA 4FPXA 1EVJA 2II6A 3EVZA 3AW9A 3MOIA 4MAAA 4WZBB 5DNYB 4YONB 1NT4A 1LLDA 2ZDQA 1ZEMA 3GBVA 3I28A 1PS8A 2VNIA 5TMBA 1C3XA 3BIWA 2XQFA 3E22B 3H8JA 1YOVB 4N3AA 1N2BA 2WICA 3K0SA 1F2VA 3QVMA 4J43A 3KYCB 3WDKA 2RGWA 4BVHA 1QQTA 4M0MA 1R6TA 3UJCA 3VYVA 4IW3B 1EEXB 3O91A 5I48A 5JCXA 3PGVA 3REOA 2QQ5A 4ZVTA 3T61A 4G5OA 3AFOA 4F2PA 5BNFA 2OE2A 2WHQA 1ZGCA 1Z4IA 1SB8A 4P4SB 3G7SA 3PGXA 1XAHA 3VOBA 2PS1A 5J5CA 4AW9A 4OQFA 2FF7A 5KOJA 2O4CA 4J2OA 3A26A 1K6IA 3AFHA 4ZMBA 3T1TA 1JPJA 2BKLA 3DOEA 1MQ9A 4LQCA 1A2BA 1W49A 2XEDA 3V7NA 4XB2A 2AT1A 3Q8KA 3LBNA 5JS8A 5EJIA 1ID1A 4FSHA 5AVRA 1BD3A 4O5OA 1RM3A 1JT9A 4PSCA 4Y7CA 1L7QA 3WGZA 5KNCA 2VWPA 4N9QA 4PICA 4MW4A 1RYNA 2POQX 3EWSA 6REQB 1KZ4A 3L0DA 4PYLA 1L7RA 4PGHA 5CNKA 4D3FA 5A4MS 1PYOA 4EHFA 1B73A 2PKQO 4FYKA 1ECFA 1SO8A 1IBSA 3FKSA 4H31A 4KPGA 4S0ZA 4UBLA 1VZ3A 4MHTA 4Q4HA 4BNXA 4ZAXA 5K51A 4HSGA 2F3QA 1PQUA 1IVSA 2FWRA 1Q1ZA 3H6HA 1ENPA 1MHPA 2BLLA 4ZHQB 1FYDA 1W48A 2H1VA 5D7NA 2X1LA 1H23A 4S12A 1NF8A 1CUJA 1TU0A 3T3NA 4YMIA 1EBFA 4MV3A 3TNLA 3ZEAA 3MNFA 2D2XA 1DOAA 3DFMA 4J1TC 3V46A 3C85A 4O4HB 4EB6B 4OLFA 4F7WA 3P97A 2FW0A 2A0UA 3FCEA 5CK5A 2D54A 1Y37A 5EESA 4U0JA 3ZX5A 5KU7A 3K9GA 4N5DA 2MYPA 3RVKA 3T9CA 1LQUA 1P3DA 3PHCA 1N75A 4GPBA 4LHYA 4DM4A 4ODIA 3DEFA 1A4IA 3JZFA 3I30X 2NUAA 1K8QA 1KJQA 3C6ZA 4CL2A 1RI3A 3W5VA 1JPVA 4MGIR 4N8DA 4F12A 2J0SA 4F5YA 4ABTA 1RXWA 4F6CA 3HL0A 1UM8A 4WLVA 5J4VA 2G1PA 1DU4A 4FFBA 4CDRA 2I7VA 2AXEA 2WBLC 4RF5A 4ER5A 3MJTA 1II9A 2HJ9A 3Q0EA 3T5GA 3PUHA 1CQXA 1L7AA 1Q15A 2IT1A 1RBQA 4D98A 8AT1A 1WW2A 2IF2A 5LJIA 4V02A 1E5DA 4EY4A 3MXTA 4BOYA 2FPMA 2G1AA 4PQGA 3OE7D 3HY4A 5JAZA 3NG1A 2DR3A 3HVKA 4IZ6A 2EL9A 1XTKA 2APJA 3TLBA 4F21A 4KAAA 2CLHB 5G53C 1FZTA 2WQ6A 2VPPA 1M3SA 2EQAA 3AKDA 4MRRA 2HU2A 1N78A 1CS0A 3ZS9A 5FTMA 5KYTA 3ZDQA 4CCYB 1FFHA 2P0EA 1N1MA 3ZBQA 4ENUA 3OZFA 1HZZA 3HYSA 1HDOA 4LXQA 4FMCF 2AW5A 5IC4A 4KDRA 4II2A 1UDWA 2R5FA 4G5HA 4QBTA 3W3AH 4F9FA 4IEIA 4RJJA 2QM0A 1C4KA 3QHPA 4I5IA 3SJAA 3DLIA 4GWLA 3MM4A 1VGRA 3AEXA 4MS4A 1Y4ZA 4AP9A 1VLQA 1J0AA 1EFTA 1YZ3A 2R8ZA 2WJIA 3LLSA 2FH5B 4LS3A 3TXAA 1FUYB 1XCGB 3LZCA 3PA6A 3PU6A 4I36A 4K46A 4QJBA 3U31A 3ZDCA 2HYIC 2QUZA 5T4HA 2Q21A 2Z95A 3A1EA 3NALA 1IZYA 3O2NA 1THTA 2XNSA 2CN1A 4LF9B 3N2YA 3GLFE 4R1OA 1QE3A 4YGXB 1RAEA 1A77A 2CJWB 3HKBA 4JVMA 4L50A 2YV2A 3L7LA 4UNNA 4W5QA 2GR9A 3FGZA 1GU0A 4YQZA 3MT7A 2G3YA 2A4KA 4R01A 1DQRA 2YWRA 1ZOLA 1QH8B 5KYYB 4UCQA 1XQWA 3FCAA 2IYAA 2A5DA 2K2QB 4D46A 5FOQA 1WY7A 2JFQA 3AHIA 4GR5A 3CZ4A 1F6WA 4LRUA 1DELA 1HRKA 2P4SA 2VSNA 4KXWA 4XTCS 3ZKAA 3K53A 3PPVA 3QVKA 1WXWA 4OCZA 1CIPA 1JWAB 1O2DA 1W6RA 3GJZA 3WTBA 1P1JA 5EIFA 3S1SA 5IW8A 3T9DA 3IVGA 1JG3A 1NURA 1THGA 1JV1A 1K75A 2O07A 4NTZA 3I05A 1CHNA 4X92A 3Q3EA 1NU8A 3KT8A 1E2FA 4G4SP 5SZIA 2RBKA 4UMVA 1CLEA 2HK6A 3LM8A 1Y3BE 1H4VB 3UZUA 1X7WB 4Q82A 3I6ZA 3IAS6 3TAUA 2UV8A 3N0WA 3KZOA 4HZUB 5HIIA 3R8XA 4CM3A 5C5DA 2Y1CA 4Q9DA 3CR3C 3G2PA 5E6SA 3U4MA 4BNDA 3QEMA 2PS0A 5E7QA 4ZOLB 1QVRA 4YP9A 2A84A 2PX4A 2WUVA 2OSVA 1AUVA 1GPNA 2Y76A 4HMPA 5UKDA 1S1MA 4QTYA 1VE7A 2QENA 2XOXA 3ROZA 2I4MA 4Y8VA 3K16A 3QITA 5JAUA 1YMVA 1H65A 3BICA 3B3JA 2JFHA 1FQOA 4UBMA 3ZCRA 3HFGA 1VPEA 3MBKA 1JHXA 3TGWA 4EUNA 3KSUA 4XYEA 1L1RA 3K1AB 3C6MA 1TZKA 3O95A 4J76A 3DPSA 1I1QB 4BFXA 4ZD6A 1AQNA 4DV2B 3UHFA 4I1PA 2AWNA 1VP9A 4Y6RA 3TNYA 3IOYA 5LQSA 3M1AA 2YFYA 1B3BA 1DT5A 1E94E 1ORTA 2QJFA 4CETA 2OB1A 4RZ3A 5GZ3A 3QSYA 1J0XO 1AB5A 1JF8A 2ZOSA 3ICVA 3R9XA 1M8GA 1ZICA 2WJHA 4RPCA 4DY4A 5LYJF 1C4OA 1O6BA 1LV7A 4X63A 3PFNA 1PL7A 2ZIVB 3PYLA 4QOJA 4BX8A 3EMKA 1FUKA 3AG5A 3DC7A 3HUEA 4NULA 1UJBA 2DHQA 3R0VA 5JSYA 3T94A 3THYB 5C9ZA 1IBRA 3NAZA 4XXHA 4MVCA 5HG0A 3ZUGA 5GY7A 3QLVA 5IASA 2QTAA 5AKIA 1AC5A 1WNTA 3FKJA 3KVYA 9ABPA 1Z47A 4WDQA 3RGGA 5JMWA 4PZLA 3W05A 1FP2A 5DM70 1JILA 4TZ6A 3QUQA 1DIHA 2B35A 2B8JA 4MJ3A 1COWD 2FG6C 2OO5C 4IIGA 3CPEA 4DIMA 3U7HB 1LPSA 3ER8A 3P52A 4QNMA 1GZSA 1M2VB 1X8JA 3A3PA 3VH3A 4HS9A 1KDVA 1ZD1A 3I32A 1KYZA 1PV2A 2F59A 4WLOA 4JGBA 3KHSA 3EXHC 1T2CA 3CIFA 4FZ3A 3TZBA 3UG6A 1L5YA 1VE9A 2GEKA 3OIVA 4HX5A 3DGEC 4A3SA 2XTZA 1XU7A 4A73A 1IHUA 3CIOA 1UPFA 4L0QA 3ZU2A 4DWVA 4AMZA 1MJHA 1C0LA 5DE3A 2MR6A 1E1KA 2YZKA 4JLAA 2ZUBA 1BVYF 5A5EA 2C29D 1G5TA 1U0JA 5CR9A 2Z5FA 4LZNA 2O0KA 5JXGA 3MJ4A 3GGGA 3R7DA 5HW0A 4NZMA 1N34B 3EH2A 3A3NA 3H2JA 4RZ2A 3DB2A 4HUQA 1Z0AA 3JSXA 4HY3A 4Q9AA 5G4KA 3SXUA 4BVJA 1YRYE 3H04A 1SIBE 1LTKA 2P2CA 1YRBA 4RGYA 2IH4A 2HLDA 5MGBA 2J6HA 3KJEA 1DKUA 4X45A 1EAMA 5DCWA 4FYHA 4WCFB 4DSTA 4R1LA 1IWBB 3QP9A 4B6OA 3OZBA 3SNHA 4B6GA 4L7QA 5CDYA 1XROA 2ZR9A 2XY4A 4ARCA 4FP9A 3KFLA 1TXGA 5JYEA 1A9SA 1P2SA 1EXVA 1BWQA 3W8NA 2HA7A 2ANBA 3RJTA 3EJWA 5DMXA 3O31A 2HHJA 3ZOZA 1LWNA 4DG5A 1CUCA 1P1RA 1OIVA 1W5SA 3QPVA 3DYIA 4YRFA 4BQSA 1R12A 2OPBA 5FFNA 1Z34A 3GJSA 4MB2A 3EBOA 3L1KA 4ND8B 2W8ZA 3H8SA 4O4JB 1S2NA 2QSYA 4EW6A 2QX4A 4P4UA 5T7BA 2AC4A 1L7BA 4CEHA 3KUDA 2X1MA 5I7WA 2B82A 1PWXA 3REQA 3QBVA 1OJ7A 2QKIB 3HM2A 4ZYZA 1YBMA 1EVLA 3CT4A 2PTGA 3HJTA 1E3JA 3C70A 3WGOA 1NATA 4HDCA 2Q4BA 1WUIS 4JLPA 4L0CA 1NM5C 1TMKA 3LL4A 2GF2A 4AURA 5KSZA 1Y3CE 4L6IA 4TMXA 5TEWA 1MIHA 5JIBA 1SBTA 1WHTB 5JFTA 1D03A 3ZE8A 4IRUB 4Z53A 3FVVA 1BEZA 3DL0A 4JUBA 4KIUA 1U3CA 3EWNA 1L8LA 4DR4B 3D8UA 1ML3A 4PHGA 1K7XB 4INPA 5AJUA 4XM0A 2Z8YM 3GN1A 4DLTA 2QX6A 2ZS8A 2PKWA 2E55A 1RQRA 4IGFA 1W29A 1X7ZB 4UC0A 1OLSA 3AI2A 3E1GA 3ONFA 5JXWA 3FM9A 4JLUA 2OCPA 1NSFA 4OVKA 5C1BA 4MEAA 1AK1A 2ZRDA 3U4CA 4FGZA 4LK2A 1ETUA 1Q1GA 3CX7A 1TT5B 1QWOA 1A7JA 2VN8A 4C6TB 5BW4A 4RH0A 4F1WA 2ZJAA 9MHTA 1ZKMA 4WKCA 3RRZA 2VSQA 4ZAFA 2J59A 2XB4A 3BRWD 3R5TA 4TQGA 4JCCA 5CG2A 3LDHA 3SC3A 1RWPA 3N07A 3O3MB 3T7EA 4OG2A 2CUNA 4HG2A 1QRUA 3AY6A 1JAZA 4YQEA 2AZXA 2O3SA 2ZIGA 5F51A 4DR7B 3T7CA 4KBYA 4QFMA 5EJ9A 1RQ7A 4LCJA 1A76A 3HSYA 4HGQA 5ICMA 1OB5A 4C05A 5JH7F 1K4YA 1ZIOA 5JCJD 2I7CA 2CJPA 2RGDA 3BMOA 5F76A 3GLGA 2YXDA 3FZNA 1OZ0A 4G5SA 1I24A 3EODA 3EVCA 4IEFB 3RUPA 2AGVA 2JNWA 4YPOA 3LQFA 3FNRA 3ELDA 1SU8A 3M8KA 5H5JA 1GP2A 4KMSA 4M2LA 4OO3A 5I4CA 5HYVA 1ZD4A 1X9HA 4WXRA 4Q1EA 3AF1A 3SZLA 3WSTA 2DUNA 3GLIA 4Y2RA 2GN8A 3O6VA 4DCGA 3UPTA 4GL2A 1DS6A 4B81A 2J3EA 4R6WA 1E0JA 5TQ0B 3UTDA 3ZY4A 5JHGB 1KFEB 4I3FA 3AVYA 2ZGVA 3K6SB 2I4IA 3D5EA 4DGQA 1PLLA 2FSVC 3HUUA 2ZSAA 4QBIA 3O8LA 2QMOA 1I13A 4IF4A 2I3AA 2JLQA 2GA9A 1KOLA 4BB5A 1P6XA 2BGTA 3IGFA 2NU9A 3IMGA 2K6GA 3INYA 3R09A 5DX1A 4ARVA 2EL7A 3OJLA 3ZDAA 3KOYA 3Q7EA 1T6XA 4NE2A 5EZYF 4BFYA 2G07A 1UBFA 3G82C 3WDMA 1VRVA 2BGLA 1M0WA 4HXEB 4YAWA 1TZJA 2W6OA 2WNSA 5IT0A 3VDMA 1XTQA 2QYOA 2XKBA 4D4MA 1FMJA 4BHTA 2WNIA 4IIHA 3TZEA 4PLVA 1FP4A 2EKQA 3H97A 3ETNA 2KLHA 4FE3A 4H1TA 4I1RA 4I50F 5H59A 1LY1A 3SJZA 1OAOC 4IJ5A 2Q41A 3TOZA 3C5HA 3FYTA 3RIMA 4CG0A 2ZG6A 5ITVA 4QFDA 3MHPA 5GTDA 5EKSA 3K2BA 4LJRA 2C59A 4JB0A 1PZEA 2JAWA 3FUUA 1BEUB 5BSTA 2O8CB 5K45A 3INRA 2H5EA 3VHLB 3WJ2A 3TSAA 4UFPA 3GEGA 4RK4A 1CX9B 2Q1TA 4KNWA 1XTJA 4IIDA 2GF9A 1VI6A 2K5UA 2ZTUA 3IBFA 3TR6A 4J1TA 3L05A 4EG1A 1OKKA 4OBBA 3V2IA 3C3PA 2FFQA 2GETA 4UD2A 2AI3A 2AOXA 2YHBA 1XO1A 4K2AA 4PHTA 5HFAA 1NBME 1MRZA 2GWHA 2WUDA 1GY8A 3B12A 3K9LA 1PQWA 4FCWA 4PIVA 5EWJB 2C2KA 3RUCA 2BBOA 3ELYA 4Z3OA 4WT7A 4DUPA 4MV8A 1P33A 1Z5VA 5EHXA 1Y42X 1VA4A 3LA8A 4Q48A 1G2PA 3R2JA 4U2BA 3WK6A 3FLEA 5GAJA 1USVA 4S1PA 4RA9A 5ARBA 1FPQA 2BH2A 1UBUS 2EERA 2VC2B 3IP5A 2F3TA 3ZR4B 2GSWA 4DIBA 2CZQA 1GZDA 3PD0A 4BX3A 5K05A 2C2BA 4BLQA 4JQOA 1IHOA 3K7EA 4XOUA 4NOJA 4YAFA 3BL5A 3LK7A 2QL5A 2I4LA 4OHWA 3HVUA 1Q74A 3PUVA 1AGXA 4CM6A 3WWYA 1E4EB 4IJVA 3PC8C 3GIWA 4BWYA 1AS3A 2E49A 2H3EA 1C8BA 3HU2A 3MPUA 3JPYA 1H6BA 3ILYA 3PHHA 4I6GA 4C0HA 5IBQA 1HNXB 4HXYA 3BEDA 5B12A 5D3KA 1DV1A 3DG9A 2A0FA 4IX1A 5LZ5A 4C3VA 1SUBA 1QCDA 2AA3A 4CKEA 3RRXA 1ZLYA 1XHEA 2WR8A 4YRSA 3BD6A 3SDSA 2YYYA 2J6CA 1DQSA 3R3JA 3OQIB 1DO8A 1C2YA 1V43A 2FMUA 2QGNA 2OFWA 2ZJ7A 4WACA 3WVNA 2Z6QA 5JPCA 1KZ9A 3DTTA 2WKRA 5LC1A 1IBLB 1WHSB 1JFLA 3RF6A 3RFCA 1NNLA 3NDIA 4IFIA 2VDQB 3D59A 3W6UA 4QPJC 1WR8A 2WIFA 1XA0A 3HADA 3GP8A 1T1IA 3MF4A 4EWLA 3OUTA 2DBRA 2HBQA 2VRCD 5H02A 5BSEA 1UDAA 3VR4D 3CJQA 1C9NA 3MG9A 3TD9A 2FMTA 3H5NA 1FUUA 2RE8A 1VB5A 5CNJA 4RXUA 3CKLA 4IPTA 1T2EA 2JFNA 3C74A 4XX0B 2G70A 3B9PA 4OKIA 4DWOA 1K7EB 3MGBA 4PHCA 2JI8A 4XCVA 2W37A 4LSMA 5CGQB 1JIXA 3SS7X 1T9HA 2XAAA 3R6LA 1PRYA 2P2YA 2IEGA 1N2HA 1WCXA 3AEYA 4I1IA 4YP5A 4ATNA 3AI1A 4JL5A 3UM9A 4N7JA 4QU8A 4ARIA 4M0LA 1VTKA 4ZZIA 5HOEA 5KVVA 4BC0A 2G9VA 3N1UA 4D4LA 1YHYA 5ENZA 4DPLA 2QMQA 2HCTA 5JXHA 3H5LA 5IJWA 5JC8A 5KJCA 3QHAA 2CFIA 4IKPA 2CBXA 4OHCA 3NCTA 2YQ5A 4GXRA 3RSCA 3T7AA 1TDJA 1JI3A 3ENKA 3GA7A 2WAYA 3H18A 4YT5A 5JFGA 3A6HA 2ZRMA 3KEFA 3KTFA 4YJGA 1MC4A 2DWPA 5EXSA 1Z6QA 1N8KA 2AFIA 5E1BA 1XTVA 3UQYS 1V3QE 1LBIA 3A7EA 5ER9A 3T4UA 5G0WA 3IESA 2QRVB 1GN9A 3RIGA 3BE4A 3MMPA 4XVUA 4I1OA 4ZJYA 1IXZA 2HIMA 2A5FA 4TPKA 3OP1A 1T3ZA 4P4TA 1H2BA 1TYEB 1MW9X 1D2EA 1V1RA 2H1FA 1TD1A 4RFSB 2IFTA 5FL3A 4EECA 5HKOA 1OBOA 3EZYA 1EB8A 4HAOA 3NW9A 1CB0A 2ZR0A 4L8GA 4OQEA 4EJSC 2P5TB 2Q6KA 1D8AA 4KPYA 5FO9B 1SY7A 1TIKA 5H68A 4YMLA 3DEAA 3GVPA 2O7VA 1FEZA 4KCGA 1H4TA 2I03A 4PRYA 2OPHA 1F8YA 3TQTA 3Q85A 4CN9A 3IH5A 1SCNE 1IRIA 4DMFA 5CD9A 3L82B 5CH3A 2BF7A 1NXWA 1A9RA 5CMLA 1CU1A 1LS1A 2YJ5A 5L3QB 4AJEA 1Z9BA 2WD7B 3RK4A 3OF2A 4E30A 1N5IA 1HV8A 3FOCA 5ALFA 5C37A 3U3JA 1BN6A 1RZVA 4KLCA 2CXNA 1N7GA 1T5OA 3EJ6A 4PRKA 2WEKA 4TMKA 2W4MA 2ZRGA 4I4TB 4RKYA 5COQA 5EL0A 5EP1A 3Q7QA 4NFYA 2GBLC 1SVOA 2D74A 5K3AA 3ROTA 5G1PA 4DMGA 4B8YA 4YDQA 2CDCA 2OBNA 2XIJA 3MAJA 4TWJA 1UMBB 2BBTA 1KIAA 1ODKA 4XIJA 1BYIA 3JQPA 5AJVB 1NE2A 3DYBA 1U81A 1ATIA 4ICIA 4OJNA 5HJ7A 1DJOA 1HPLA 1RVDA 1THZA 4KTTE 1QXSA 1R6AA 3CH6A 4P22A 1Q0PA 1WKCA 2PL9A 2PL1A 3G0GA 2HO5A 3IV7A 1RZ3A 2GFHA 1FNNA 1E6CA 4F8YA 5DYNA 1ZN8A 5F5LA 3P2IA 1KARA 1I8TA 4Q1AA 1NYQA 1QYRA 4JELA 1C30A 1V6SA 2EEZA 5LLDA 2OO5A 1T1GA 2QLTA 3Q5EA 1Q83A 4MLCA 3RVNA 5BUCA 2PWBA 1LVUA 4GZ5A 4Q00A 3V1KA 3CNLA 3X2SA 3ZE2B 1KYWA 3NBFA 4MW5A 2GD2A 4V1CB 3L04A 3UBTA 3STUA 4W1SA 1AKYA 3IUMA 3H11A 4BLWA 4TV8B 1EG2A 1QZTA 3AM4A 3FTQA 3EXHA 1KTIA 2P35A 1RWKA 2Z98A 3IAUA 1M1NA 4ER7A 4EHBA 1FW6A 2ZAOA 4EUFA 1TYAE 4Y6GB 3ILXA 2IRWA 2W11A 4KXQA 2X14A 4K6MA 3BJMA 5JBNA 5JJBA 1MJNA 3LT4A 1C1XA 2EJBA 3EEOA 1R00A 1USIA 1AE1A 1D2GA 4QRIA 3DCYA 4N65A 3UYLA 2FW8A 4CKBB 4X44A 3GN2A 4MS1A 2AK3A 3QXCA 1W19A 1SBHA 1GJRA 2OFXA 4BVEA 3DOHA 3LHIA 4X8LA 4Z49A 2IXFA 2D1TA 1W2HA 3HEAA 5FPPA 3N8IA 4L27A 3U7JA 2Q4EA 3AMVA 5LIRA 3CJTA 5LB4A 3EGIA 1P0MA 2IHYA 2EXXA 2OXRA 2YIJA 2BGUA 3AK4A 3DYVA 2IY9A 5DN6A 2YMMA 5G3YA 2R6HA 4BNUA 2GZSA 3ACBA 2HTFA 1B74A 4LRWA 2FLVA 4DHWA 1DRUA 4Q4JB 4XDZA 1TB4A 3Q6MA 1ND5A 3E4DA 3W6ZA 5GJVC 2VYNA 3VGPA 4L7VA 1DAHA 4MYTA 4RK6A 4A03A 3OD5A 4DRXB 1YULA 5KNDA 5CD1A 3P5BA 4MHSA 4ZI5A 2H6EA 2ICAA 1MMFB 3A4IA 2R8PA 4Q3OA 2QRZA 4UHFA 1E9SA 4X41A 2B1RA 4E2ZA 1RQPA 3LX6A 3VNUA 2WV7A 2Q62A 1GQQA 3P0EA 4A0QA 1XTZA 3CZRA 2YQ4A 2CFOA 5DK6A 7AT1A 3FMOB 2IIQA 1XRRA 5GVRA 2A9PA 1SURA 4O0LA 3THXB 1Q0UA 3QX3A 1S3SA 4N5LA 4QUJA 1P74A 4JQZA 3ZTYA 1NM5A 1K5DA 3DAYA 4M89A 4YJHA 3KB1A 1RWBA 1KO8A 2PWZA 3SFVA 3ZD7A 4GZMA 3HZHA 2JFGA 5JVDA 2JW5A 4BFLA 3W5AA 5CCDA 2IUEA 2G09A 4Y9DA 1M5TA 1Y1QA 2NXNA 3UV3A 1DHRA 4ZIRB 1VL1A 5BWBA 2OVBA 1XEWX 3B2EA 2HSDA 4YNBA 1E3WB 2DQSA 2GBFA 4YIKA 3TBFA 1TA0A 2KX7A 3OWOA 4N6NA 4IQ8A 1AURA 2DFDA 4ZJPA 1U0RA 4PLFA 1UBMS 4BWVA 1H0RA 4DV6B 4TL8A 3U4HA 2I8CA 3UXMA 1EFRA 3IHWA 1HX7A 4YP1A 5IDXA 2Q5OA 2Q0QA 3LUHA 3RC2A 1O96B 1LQ2A 4B7XA 1VYTA 2C1XA 2LGJA 3UWDA 3F67A 4GOLD 5GOTA 5H70A 3FCYA 1VE1A 1DEOA 4M4SA 1JI0A 3DBHA 1F3OA 1T4CA 2GD6A 3EVBA 2RDMA 3SSAA 4TRNA 2WMDA 2IC5A 4XJTA 2QROA 1XMSA 2BHNA 3GCZA 2HXYA 4RD6A 2BN4A 1JHDA 1GADO 2QZJA 4RK5A 1W47A 1YS1X 3K8ZA 1L9KA 4FFSA 4RQTA 2Q5HA 1D04A 2XIQA 4KR0A 4CIXA 1J0EA 4O63O 3IAEA 4JLVA 3AVVA 1F9AA 5GGXA 1U0EA 4DCCA 2YJNA 3LBIA 2C7VA 4P5EA 3O1JC 4B45A 4UTZA 1VMKA 2OWEA 4KQ9A 5LXTF 3TTTA 3KNZA 3RS7A 4LXIA 3TOCA 2AW3A 1LNSA 2PSFA 3H84A 5AWFC 2FFJA 4QXRA 3T7JA 3PJRA 2P4QA 1LBTA 2AXPA 1VMEA 4G1BA 4IZIA 4XGKA 4CHGA 4RVDA 4MUJA 3CRVA 3E8SA 2WIJA 3EXAA 1UXKA 4MJ7A 1KDOA 4RHTA 5DASA 3T3GA 2QVZX 4DWWA 1L4EA 1R0YA 2C57A 4TWRA 1DCMA 4EO4A 3CEJA 4OQDA 2YHIA 4DJEC 3UB4A 3LCMA 4GM4A 4C6SA 3EIFA 3KDAA 1JZQA 3WB9A 2DAPA 4RV5A 4JYCA 1P9WA 4D3ZA 4LF4B 2CW5A 5H3LA 4GP6A 3SJBA 1TQDA 1SNYA 3N9IA 2GJ4A 4QUDA 1SZPA 5E9AA 1RYMA 2D3TA 1R88A 3BZWA 3CEMA 1CBUA 4X3OA 1IATA 4NYMQ 3VZDA 3OECA 2X9GA 5DHTA 1ULHA 1XRSB 5EKUA 1QV6A 2CYAA 2WD8A 2OB2A 2ZJBA 3QUSA 1AUOA 4Z6KA 2NQ2C 3G0HA 1U1IA 3V9AA 3DGFC 4PN3A 5MDHA 1T5IA 1OXBB 3V42A 5LQDA 4JJKA 2E21A 3BGOS 3UJDA 1ZWKA 3IHLA 2FDCA 3O1LA 2JVKA 2VSFA 3GD5A 4RK7A 3SD7A 1PG5A 1P1BA 1DTWA 1T10A 2A5GA 3BWCA 3TDMA 3NT2A 4ZYTA 5K0EA 4UU1A 4LJYA 4B6RA 4XQEA 2W2OA 4KQEA 3CKMA 1Q12A 3Q5GA 1G4AE 1OAOA 3GCWA 2QNBA 1IE3A 3L7KA 5EXDA 3S28A 3AXTA 3U1BA 1JSZA 4Q24A 1GUDA 2VF2A 1PFQA 4NOKA 3BULA 1K98A 2ZJ4A 3GFRA 4GXNA 3JQAA 3NTLA 4C4AA 3OSUA 4LJ7A 3CE9A 4EA7A 1RD4A 2CCGA 2X2EA 2QP9X 4N3GA 3Q8LA 3R3UA 4I8XA 1WJGA 4NFHA 2UYOA 3FLAA 4A8TA 3VNRA 3PWZA 1C3OB 1CNEA 1N6OA 1S96A 1XZEA 2E4ZA 2FRXA 4ISCA 4XPZA 2WVGA 1WB9A 3PUYA 1RRGA 4ECEA 1FB5A 1V0JA 1YJAA 1XL1A 1K3TA 1TEXA 1U1EA 1MFZA 4PLCA 1ZESA 1B41A 2HHLA 4MS3A 1VKJA 3AGPA 3C8MA 1T5BA 2BUCA 3PIRA 4TTRA 2YWBA 4U00A 5AKEA 1YJCA 4DBLE 3D6UA 4UM9B 5JZSA 2ZTHA 3KP1A 1XJWA 1U2EA 4CLHA 2NO0A 2Z2JA 4ZCIA 2H7XA 2CNDA 3A6PC 1V25A 2H54A 4X66B 1GAQA 1QU3A 1LGYA 1OI2A 3CR7A 4I2NA 4ESEA 4LMRA 3DOCA 5B6IA 2D1YA 5TQ2B 4D5EA 4DMLA 1XCJA 5EYPA 2A6PA 1EWVA 3I34X 3VHXA 4B6QA 5KINB 2AN9A 4PN7A 1KAEA 2KE5A 3I2YX 2ZJ5A 3OT1B 4ZRNA 3BZUA 1XPOA 1WPQA 3TNFA 2XZPA 3KYIB 3WZLA 3FUCA 4NDZA 1U4OA 1OFIA 4MV6A 3PC8A 3M6UA 5TE9A 4PNHA 3LS2A 1TF5A 2OGSA 2PLAA 4M1QA 2RGXA 1OH5A 3ZZUA 3OCXA 1Y8ZA 1UODA 1GNLA 1W0JD 2ODPA 2XEXA 2Z2ZA 4U7JA 5HM6A 1A2QA 1HLDA 5ED4A 1PJSA 4ZTZB 3QVSA 5IU6A 2V7EA 1VMIA 2VDUE 1T25A 2KS6A 3ME5A 5EY5B 5A6VA 1XVTA 3O38A 4HVAA 3E5NA 1CZLA 1KC3A 3TS1A 3F6EX 3P0HA 4LNAA 1Z4OA 1A69A 4XSHA 2BEWB 3WMEA 3U4QA 3AUKA 3Q7PA 4M0PA 5K8VA 3LRPA 2HPAA 2Y77A 4ZDWA 3COWA 3F1LA 1P29A 3U9TA 2VDOB 5ALOA 1KFBB 2HWKA 2WYVA 2WMNB 3BPSA 3GZNA 1YT5A 4OFZA 5AI6A 2GBPA 2VP3A 3HRKA 4G0MA 4E0BA 5GZ1A 5K0GA 4TYWA 2BEKA 4DJDC 1V9CA 2C99A 1QIDA 2B8WA 2F3RA 3GGCA 4R3NA 1G18A 1Q6ZA 1G5QA 4I81A 4BQQA 3PX2A 4HYYA 2ZVDA 1C0IA 1G7RA 1JDPA 2QW1A 2IQ5A 1WEKA 4JLJA 1KJYA 3P4XA 4UHEA 3CLRD 5T4EA 5F5NA 4K3UA 4FKZA 5IDVA 1PUJA 2WWWA 3AC0A 3GRUA 4K88A 5JATA 2ZVPX 4JLMA 2HK7A 2Q6OA 3LQQA 3TD6A 1IOZA 4RM2A 3UB3A 4ZEXA 1YMQA 1NDHA 5I4IA 3GW8A 5FWNA 1MVOA 5ALIA 4C30A 5TF0A 1Y5MA 4XKJA 5FPSA 3G9XA 1QHHB 1DNPA 2BZ1A 2PR2A 2PZGA 1JR3A 3OLQA 2V55B 4L5YA 4A6PA 4D9JA 5BMVF 1XVIA 2H2GA 3KDSE 2IYVA 2GZ3A 2JAQA 3WRXC 4QOEA 2HQSA 4BFTA 1SZJG 4MMZB 1T2AA 3TFOA 3F4LA 2JLRA 4JP3A 3WGVA 2I3DA 1K3UB 2P30A 1EVEA 3BMCB 2X0DA 3EUWA 5E4YA 1OC4A 3U39A 4IJQA 3S27A 2J3DA 5IHXA 8ATCA 4MR7A 2BM8A 5DGXA 1WXFA 4DEYA 1OA0A 1WUTA 5TMEA 3G3EA 3OEWA 1PTJC 3ANTA 3DBRA 2ZW9A 2XKAA 3HCAA 4IKEA 1L6RA 4P31A 4ARZA 4KE7A 1H1TA 3UAWA 3OTWA 3T0GA 5F5XA 5LSAA 2G82A 3HXMA 1M9NA 2XUGA 4ZANA 5GONB 2Q5EA 4BRUA 1OI3A 3LUDA 1QP7A 1VCNA 1OX4B 2VHVA 3D4PA 3HRIA 2QE7D 3W5HA 4L85A 5AH0A 1M67A 3DS8A 5ERXA 4L02A 4EJSA 1G6KA 4K86A 1CQZA 2BMDA 1JDZA 2WSLA 4UOQA 4AMYA 3RC1A 1G20B 4PO8A 4D7AA 1E5VA 1HK7A 3R5HA 3TNJA 3NBQA 2GT1A 5LYJA 4O33A 1MQAA 2PN1A 1I9GA 4AZ3A 2OOKA 3K70C 3C24A 3ZWQA 4L2IB 4PU0A 3T34A 1NJ6A 4HMQA 1Y8QB 2QY9A 1QGYA 1EI9A 2QV7A 4R8MA 4WOKA 5HF6A 5CDFA 4L9AA 2G9ZA 3GEMA 1N5OX 4XUGB 1XTRA 1WXHA 3TIIA 2PMBA 1CF2O 1EXWA 1Y9ZA 2BISA 2LPMA 4IJMA 3KO8A 1IHPA 4X6XA 3NHFA 2AV6A 4ASUA 5G4LA 5IAOA 1UBJS 1NN3A 3GAZA 3S2GA 2CWDA 5KSWB 4MA5A 1LFAA 5JD4A 2JLVA 2O5EA 5C8YB 2G25A 1EGAA 4ARSA 2PXAA 5BN5B 3GDOA 1NE7A 1QZZA 4EY6A 3A9TA 2HQBA 3FTFA 4D4HA 1MABA 1UK7A 2OBYA 4R2WA 3U3DA 5GIPE 2V6MA 4MEBA 3VZQA 3GJ4A 2NUTB 3OMXA 4COOA 2PBZA 4LRXA 4NDNE 3EGDB 3EVTA 5IC5A 3NOXA 3WY9A 3O5AA 3TUIC 2ZUSA 3OD1A 3D7LA 1VHWA 3LDUA 3FTEA 2UUPA 2XTNA 1UUFA 2H3HA 3E9YA 2ZTVA 1U02A 1YKSA 1JG2A 2CHUA 3VJMA 5JNLA 3Q3JB 4KI7A 4BTVA 4C06A 3C4JA 2LCFA 2FX3A 1Q0RA 3EISA 4MB6A 4JVOA 3KJGA 4LY6A 1KI8A 2JCYA 3KKPA 2JJ1D 4PV7A 4R16A 1ML4A 3RARA 3C1OA 4DXDA 4KPUB 1K68A 3O7WA 1KNXA 1ZGGA 3H2IA 5JJKA 4YCJA 4X00A 2DQZA 2X4DA 4OYHA 2A2ZA 3WNZA 4BNGA 3VX4A 2QBYB 4N4AA 5FKJA 1URPA 4BQIA 1MU0A 2BFAA 1GTMA 1WDMA 2NXWA 3I37X 4IIEA 1GRRA 2AKYA 5AI5A 4ZO7A 4RU1A 2X8WA 5AUPB 4FHEA 3ASVA 4F6RB 2PUGA 4K8OA 1MBZA 3L6EA 1PEDA 1Y4UA 1VRCA 2JH9A 2QTVA 2ZBUA 4F4FA 7YASA 1PJ4A 4F84A 1XJQA 3TXYA 1OBFO 2VP4A 3CEPB 2DZDA 3BXFA 3WBJA 5AVWA 1HUQA 2D1RA 2I78A 5TARA 4BFCA 4M0EA 1XSEA 2Q5FA 3KHTA 1KC1A 4PPQA 5T57A 3UOAB 3K70D 3DCIA 5AOVA 1P0FA 3INGA 4RH1A 1CUEA 3ANYB 4UM8B 2AFRA 4LBZA 1FXWA 4NZPA 1V39A 4V3BA 2FPKA 5KHAA 4UEWA 3LMKA 4YJDA 5A3QA 3QE9Y 1PT6A 3FGNA 2R6ZA 2Q2QA 1UT8A 1EDBA 1WZIA 4HZGA 2O5RA 3EF1A 2X0IA 4L4UA 4Q9HA 2Z3VA 1ZVVA 3RS0A 3G2OA 2UVDA 1QS0A 4REOA 3DHNA 3NIBA 3NGXA 4QUBA 2EJWA 4YR7A 3D6VA 1NP6A 5CBPA 1JDUA 5JYBA 5EMMA 5I3ZA 3X0DA 1HE2A 4UHJA 4XPIB 3CMCO 1DKLA 1SA0B 3GMIA 3HDJA 4MLDA 4OJYA 4Y2SA 4J07A 4YRAA 3QEJA 1E6UA 1NXOA 2RHBA 3KJHA 5HQJA 3IT1A 3M4YA 3OPVA 2ASVA 1NBOA 4PPNA 4UXJA 3SYRA 4Z1MD 4RGVA 5EJFA 5YASA 1QRAA 3MUEA 3FXAA 2Z8ZA 2LZ0A 2BKUA 3OZDA 3SCZA 4MUEA 1CJUC 5BYKA 3A32A 1HXHA 2B98A 5COAA 1J2RA 2BFWA 2HCRA 1PK9A 3AJDA 4DPMA 1WZCA 5D6NA 2FZEA 3SIWA 3SLKA 4L8LA 5KYWA 3B9RA 5AW4A 1ECLA 3W6OA 5LP6F 4DYHA 5ALSA 2Q1XA 2XV1A 3QPUA 1A72A 5JDCC 4GLLA 3STYA 3CF4A 3VTKA 2G4CA 2IEIA 1RYBA 1DWUA 4V0ME 2WIGA 3H4MA 4Q0MA 4HYTA 4HD8A 3HZRA 3CLKA 3O8OB 1HTBA 4NENB 4MGHA 3V2GA 1KVSA 5KS2A 3TK1A 4X7MA 1ST2A 4KWIA 4X5OA 4Q1DA 4R3WA 1NMZA 1KQPA 4I9HA 4YJFB 5P8WA 1Y8RA 3F6PA 1CE8B 4MI3A 3ZWWA 3HFRA 3ESCA 3F5SA 3FWHA 3FUVA 1QYVA 3DQQA 4N9WA 5JH7B 2ZWIA 3TTWA 3EULA 3O4RA 1P2VA 3A4TA 5H4GA 1DCKA 3Q9LA 4YI3A 1O95D 4D8UA 3AOEC 1JQLB 1XEXA 2VT2A 3I9V6 3O93A 3QYAA 3ZZ1A 4L74A 4RCVA 3OTQA 1NPTO 1CQJA 5HCUA 5D3MA 4BPRA 4CKCB 1MTOA 1AV6A 4HNTA 4XUEA 2DFNA 4YRMA 3KRTA 4OP2A 2X0KA 4HLNA 421PA 2O8BB 3B6IA 2JIZA 2XNKA 1AHIA 2DUWA 1G1MA 1RACA 4IRXA 1YR2A 4WAUA 1XU9A 3UCXA 3WOVA 3NORA 2X86A 2VZ0A 3SM9A 4TZTA 5SYNA 2RH4A 3CUTA 3P45A 4PZPA 3K9BA 5AQEA 1B2LA 3FIUA 3AX6A 1JEJA 2A94A 3FFTA 1OV4A 1XIVA 2H2FA 2HJSA 4C7KA 3NDPA 3RS8A 3HM9A 2OY0A 3AIKA 5GVSA 1NQXA 1Y8AA 3G0IA 2W22A 4FFVA 1QHGA 5KI6A 1M5UA 5BN3A 1SVLA 2MYTA 1CUXA 3T4XA 5BOSB 3VGJA 4CTJA 1LPAB 4BPBA 1NIPA 4LYDA 2IS6A 1WCV1 3ZY2A 3GBSA 1U11A 2VHJA 1RABA 4QRHA 4QYSA 2AEMA 2ESRA 3OQ6A 1W34A 3PK0A 4IDNA 1QO0A 2DY1A 3EBLA 1PR9A 1U04A 2QN8A 1J8DA 2ZKIA 4EI8A 3WIEA 5AFSA 3RYFA 3LECA 4ZYUA 1N32B 1OWNA 3HKDB 1DXHA 1L0BA 3HS0B 3A3KA 5AKXA 1N3IA 1U7UA 4LOKA 1JW9B 2A59A 3G17A 4X94A 3RDPA 3F9IA 1NVKA 5CVCA 1RYYA 5LQNA 4PGMA 5J2UA 4RVUA 1JA0A 1NBAA 3EFOA 2HC9A 4O02B 2GAOA 3KUKA 4BTLA 4TXLA 1GFSA 1SC3A 2V7QA 3GOQA 4PIPA 3TI9A 1RR6A 3GLHB 2CZGA 2CBZA 3PL1A 4DM7A 1W1WA 5A03A 2FW6A 2P62A 3L79A 1ZH6A 2QW8A 4Y2QA 4WE3A 1T4BA 2NTJA 1RRKA 3MIZA 3OU7A 2VAPA 3Q98A 3X43A 4TT8A 4YK7A 2V7XA 4BP1A 1Z7GA 3HTXA 2Q1UA 4JLWA 4UULA 3VUFA 1I36A 3E53A 1GL3A 3WBKA 4OXXA 4EO9A 3WL8A 2G1KA 2PFKA 2ZSJA 4J1NA 5CVUA 4Y18A 1K88A 4FEAA 4DSOA 1OTYA 1V37A 4EI7A 3EQ9A 5ICSA 2MSLA 5KHOC 4U3JB 3L0PA 3B9QA 3V4VB 5LDHA 1LSJA 2X0FA 4D81A 4TV9A 4CTNA 2PSEA 2O3JA 3DBOB 1EJ6A 1QWSA 3RB8A 3D1VA 1YBVA 1SELA 2FUNB 4FR0A 4GMHA 3F71A 3FF1A 4A10A 3FWKA 1KEEB 2IU0A 4XFKA 4BYMA 2C04A 4OX9Y 2VCYA 1F3LA 1WL8A 5TS3A 1IM5A 5B36A 4BN4A 1QVVA 2M32A 4MQEB 3FCOA 5DYTA 2GCEA 3PYMA 5BWCA 2ZYGA 5L45A 1TI7A 4MIOA 3D6TB 4Q4LA 3G0OA 2I67A 1L4YA 3QWBA 4RHYA 5DNWA 2NZ8A 3MHTA 1PHRA 2KB0A 5JRDS 1DAEA 4BB6A 1XMOB 4ZDKA 3PSAA 4ZI7B 2NQ8A 4NPHA 3E48A 2AXQA 3MWYW 2QRPA 1SCUA 3EZGA 1V35A 4WFQA 5AO9A 5SICE 2VQ6A 3AYXB 1M5RA 1N33B 1I3MA 3UHPA 4CEIA 3MPOA 3CV3A 3LNTA 4EZIA 3QENA 1ELOA 3NEJA 4ZCSA 1NQVA 4KL8S 4Y2PA 5IH3A 4OM7A 3FDFA 4M1KA 3RVMA 3M83A 3UWSA 2C0PA 4OUKX 2A67A 4JR0A 1IPFA 1P8AA 3TTVA 3JYPA 4FFDA 4S24A 1GARA 2NZYA 1I33A 1RE1A 2D5AA 2VHZA 3FDZA 3GELA 3O3CA 4N0DA 4WUTA 4ENSA 4O4LA 1TM1E 3FWNA 4JNCA 1R1DA 3FRIA 4PC1A 5KQSA 1G3MA 1I4EB 1USKA 1FFGA 1R9GA 1OOEA 4BNYA 4EF4A 1NMYA 5E3IA 1CNFA 1U2QA 4G1EB 3DL4A 3NBAA 3P8ZA 3PHLA 4GSLA 1L5OA 3WGYA 4F96A 5K3DA 4MPPA 1KQNA 5L8VA 2QNIA 2ATXA 1FJXA 1G0OA 4YTEA 2XD4A 3IMKA 1ECBA 4G4SO 3EOAI 3ZVKA 4RQBA 4C29A 3WXMA 2AMYA 4Q93A 1FQKA 3H2SA 3U62A 1TJ3A 2B37A 3V48A 4ZICA 5DF1A 3RVRA 3RRYA 1PJ8A 2PAAA 4P83A 4DCUA 3WRXA 2XT6A 3GFGA 3RJ5A 2QIOA 3G9UA 1T0HB 4WY8A 2AG8A 2JFVA 5KOJB 2I7TA 1P7CA 2QTLA 3ITEA 4CJXA 1HDYA 1A82A 5MN5A 4EABA 2R00C 2BH9A 4B3DA 4LV5B 3WWOA 1D9XA 1VA5A 5FYQA 2KPOA 2Q1WA 2V3CC 3UG7A 3BM5A 4DT1A 3EVFA 2VA8A 5DT2A 1XMJA 4FOSA 3QI2A 4TXJA 2XYRA 2XBLA 1CY4A 4EHDA 1NPYA 1RKXA 3QKUA 5U4XA 1B1AA 2NU8A 1HQYE 2OMKA 2QM8A 2WSSA 4HVTA 2C4HA 1SRRA 2GGSA 2GEBA 2CMDA 2GLXA 2PV7A 2FPPA 2B2CA 2B4TO 4CIDA 1JFVA 1LDBA 1WSWA 2WHEA 3JX9A 4Q4HB 1E20A 1J56A 1WUJS 1EFLA 3C3WA 4U6SA 1GYPA 3WLPA 3UKJA 1AV7A 3G5AA 1CVIA 1LK0A 1DKOA 3UANA 4YEDA 2LBPA 3O0DA 3OPYA 2XQKA 4E07A 2R6CA 4E5VA 2OM6A 1A8PA 2A73B 3HSSA 3JQCA 1E1RD 2PH3A 1H2ZA 4HDOB 4C0BA 4CLRA 1UJ4A 2TECE 5HX7A 4I0WB 4HH4A 1KR5A 2GAAA 4MYSA 4R2XA 3LYUA 5KJ6A 1R8QA 1OAAA 2Q4OA 1TKAA 2RH9B 3OJXA 3KB2A 2HFJA 4ML3A 3U44A 3BXGA 2CXUA 2W6NA 3N70A 3ANXA 4MW6A 1BC5A 5K3BA 2N1MA 4BBPA 2NUAB 3QU5A 2B8TA 4PSKA 4BNTA 4BO4A 4AS3A 1N2CB 1G6OA 3R3YA 4ZMRA 2EIXA 2RHCA 2X15A 3H3FA 1UQUA 5CLLA 1E1QD 1I6WA 1I7PA 4OI0A 1HNNA 1J6UA 3S44A 1RFGE 4JL6A 1XDBA 4QYIA 3N8HA 4YO8A 4DG8A 3G8CA 1BGWA 1FTWA 2I3GA 2X8AA 3HHEA 3D1JA 4FZVA 5HF5A 3TE7A 1CF9A 2CB0A 2GJKA 1H2FA 3ZBUA 3U3ZA 2B9VA 3C3XA 4Z9XA 2IHNA 5CT4A 4BV3A 4NE9A 4WNIA 4OTZA 4RW0A 5FO1A 3AOGA 3WHLA 1LBHA 4FD2A 3F96A 4L3OA 2JGLA 5JNVA 1XZAA 4CNQA 2WLSA 1CS0B 1OLUA 1T8WA 4A2PA 4JB3A 2Q2NA 2TMDA 4BJHB 3E7PA 2XCIA 2OP0A 3I42A 1SVNA 4UBOA 2BE7A 1SVUA 4NH4A 3N2LA 4I55F 3C7AA 1IUPA 2H00A 2QZZA 4UDYX 1UEIA 1US8A 5JJCA 3QX8A 3AR8A 5FTLA 1NVBA 4R7TA 4X7BA 2WFLA 1U0BB 1JPUA 2JDIA 3ZGVA 2VRNA 4RE5A 3SSOA 5DNEA 4MS4B 1LLUA 4G1MB 4DLPA 4H1VA 3IPRA 2O7RA 3I9FA 5LQRA 2DT8A 5I45A 2XHZA 1KHTA 4M87A 3IBYA 3QKRB 4FJ1A 3ORQA 1QC5A 1OA1A 2JHCA 3DLBA 1X9GA 1KJNA 3UB2A 5AK3A 1CK4A 1BYUA 1MH9A 4BASA 1FXUA 4WOCA 1UBOS 2VNSA 1NDQA 3HKBB 1JHMA 1LPBB 2C2MA 4W5OA 2DUMA 1N8NA 4FT2A 4EM6A 1BS9A 4C88A 3KVOA 3KXPA 1U9IA 3QPDA 4XIYA 2PZBA 1Z28A 3W0LB 4DF3A 1TF2A 3MC1A 1CR4A 1E0DA 1PL6A 3SQWA 2Q4RA 5D01A 3NDBB 1UKVY 4RM3A 1HDXA 3BYZA 2JCSA 3P2EA 4KN5A 5J23A 3GJTA 1UJ6A 1W93A 3B1YA 2F9LA 4QSMA 3VO8A 2PX8A 1JA9A 1B93A 5FULA 3WYCA 3VQTA 1LS6A 1Y3FE 1QUFA 4G2TA 4R5HA 2IU4A 3R7WA 3ADPA 3F49S 4PS0A 3TXXA 3ZDFA 2YC2C 3D4IA 2IDKA 3EN0A 4L9WA 4LDPA 1G8PA 2C4NA 4Y6OA 3L8DA 3TH5A 4C21A 4YX9A 2ZB8A 3EW9A 1IYZA 4JBXA 4JI5B 4G0YA 3A1FA 4YJ2F 7ADHA 5JANA 2UZ3A 1JVSA 3BH6A 5E6SB 5LBIA 1BE8A 2C9ZA 4BNDB 4IQGA 1XJ0A 3PTAA 3GL9A 5EE9A 2FEXA 2QL7A 5ERGB 4AWBA 4LXHA 4TKMA 2CFSA 2IYPA 3ZWDA 1D07A 3B6EA 1GCAA 2O2DA 5JDCA 4HX2A 2XB6A 1DXYA 5I9BA 3SOPA 2PUAA 3ADDA 1Z73A 1W6UA 2ZCUA 3VKFA 2X7HA 1UP4A 4NPAA 5CRIA 2G5TA 2QUHA 3NWBA 4GIBA 5AM3A 1KSFX 1QGZA 2WSIA 2WYUA 4KC0A 2ZROA 2GHQA 2GVDC 2IGTA 2GD0A 3EVNA 4J1SA 4ZC8A 2YOGA 3A3OA 2FGKA 4DTIA 4YRRA 1ZL0A 1YQGA 1B0ZA 1RZUA 2QPOA 3FUTA 1HNWB 2G67A 1E2UA 4B48A 3CZQA 1I9CA 3R9XB 4BFUA 4YCNA 4CTOA 4CKZA 3D8BA 2RHLA 1S3IA 4QQ8A 4RA6A 3ICEA 2O0MA 3AOEA 3ANLA 3B20A 2IXDA 2WJGA 3PCXA 4LXUA 2VH2A 5E95A 5FUXA 5IT5A 3K32A 3G9TA 3RUAA 5HUQA 5J1SB 1MEJA 2UUCB 1VRWA 3KVNA 1UBEA 2NU6B 1Z12A 3QFTA 2PV0A 3E9NA 5E7JA 4OLHA 1IWOA 2PEZA 4EL0A 3X1YA 2LVBA 3MYYA 3LCCA 4ESVA 4ZKEA 4PFSA 1QHNA 1TECE 3FOWA 1VYUA 3MFYA 3WR5A 1GHTA 3F4KA 4E1AA 3CF2A 4B47A 1ZH2A 3HYNA 1PFGA 2Z1DA 3JVUA 1NT2A 1V4NA 5D5PA 4YPFA 4D96A 3RU9A 4P0PB 2J3KA 5ECYA 3F73A 3F8TA 3NTOA 3O3NB 3F7OA 1YQWA 2A7QA 2CF6A 2WUFA 1DQYA 5EI5A 2GBIA 1SXGA 1U2PA 1ILWA 1PO7A 2H0QA 3NLLA 4ZVOA 1OX6A 1OTHA 1PK7A 4KGVA 3OLCX 2RGNA 3NHSA 2H8KA 3D43A 2V65A 1HKUA 4D6YA 1AMOA 4UUQA 1X9IA 4R9RA 3VOSA 1PFVA 4B2PA 5CDTA 3SJCA 1L7NA 2ASEA 4XUCA 3HXTA 3K4HA 4MI9A 2VDJA 4HUQB 3OOSA 5HIJA 4NCIA 4R1SA 5CFRA 4Q3AA 3SXUB 4X97A 5MGNA 3WP0A 2B4QA 2OHJA 2I2BA 1T15A 1E9AA 3E9DA 4OHUA 5C7OO 4XRGA 1OHHD 2VVTA 3TD2A 1TCAA 5J5AA 4CXMA 4PSAA 5JEEA 1D9ZA 2SKCA 3TO5A 2BYTA 5E2AA 3LUCA 3FRJA 1PR4A 4N5HX 5E2BA 1TUBA 4OSEA 2BVNA 3DEHA 2GUWA 3A1NA 3MWDA 2B4RO 4JC8A 4QLOA 1RM4A 2OSBA 4KVAA 1MR3F 5DK4A 2YV4A 3OCUA 1Q22A 1MO2A 4ARBA 3V32A 4ZCTA 5AYVA 2A88A 2Y05A 3UC9A 3RJ9A 4JP1A 3U17A 5H8WA 3CLTD 2WTEA 1OFVA 1IMJA 3UK0A 3OHXB 2Q2VA 1AKVA 1Y9AA 2DCUA 3LIIA 3OLVA 3VR2D 4CTKA 1XGKA 3EXG2 2G72A 4LHSA 1N5LA 4B35A 4RHFA 4GS5A 3VDRA 5CX4A 1MX9A 2I6XA 4G8JA 3V1TC 1UWVA 1V8FA 3G23A 1J23A 1ONBA 5LMNB 1EXDA 1TCCA 2E6UX 4DIOA 4FDUA 1Z2DA 1DRWA 3LOPA 3E3LA 4CEHB 3L92A 5KCMA 4M38A 3REQB 4CQLA 4INJA 5L3QA 1C2TA 4D80A 2HSEA 2V5UA 1Q50A 2QRQA 2J45A 2H9AA 3LQ2A 1JHVA 2WVHA 3P7MA 2CMKA 3HKCB 4CR6A 3QEOA 4PVCA 2Y99A 3KSBC 4UVHA 4JQYA 3FPAA 1KK3A 2O2GA 3LUKA 4NNOA 4DQUA 5JQGF 1A8SA 3I5MA 3KWJA 2VSOA 1RJGA 1DUIA 1NZFA 1ZMOA 2UYYA 3NUQA 3OLWA 4EFMA 4MTLA 1FX1A 3UUWA 4NU8X 1U6KA 1HOXA 2UZ1A 1TO6A 1AGYA 2VNJA 3DAPA 3OHSX 4RE6A 4BZXA 2NSJA 5GQSA 2RAUA 1EK2A 2FG5A 4YRQA 4HWRA 3KUCA 3S1LA 4MCIA 1OLSB 1K6EA 4N5IX 4ND5A 4XWGA 4W4TA 3DO5A 4EB3A 1M2FA 3LQ1A 5F35