2OYRA

Crystal structure of upf0341 protein (yhiq) from shigella flexneri in complex with s-adenosyl homocysteine, northeast structural genomics target sfr275
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
250
structure length
245
Chain Sequence
b'MKICLIDETGAGDGALSVLAARWGLEHDEDNLMALVLTPEHLELRKRDEPKLGGIFVDFVGGAMAHRRKFGGGRGEAVAKAVGIKGDYLPDVVDATAGLGRDAFVLASVGCRVRMLERNPVVAALLDDGLARGYADAEIGGWLQERLQLIHASSLTALTDITPRPQVVYLDPMFPHKQKKEMRVFQSLVGPDLDADGLLEPARLLATKRVVVKRPDYAPPLANVATPNAVVTKGHRFDIYAGTPV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UPF0341 protein yhiQ
molecule tags Structural genomics, unknown function
source organism Shigella flexneri 2a
publication title Crystal Structure of UPF0341 Protein (yhiQ) from Shigella flexneri in complex with S-Adenosyl Homocysteine, Northeast Structural Genomics Target SfR275
rcsb
total genus 69
structure length 245
sequence length 250
ec nomenclature ec 2.1.1.242: 16S rRNA (guanine(1516)-N(2))-methyltransferase.
pdb deposition date 2007-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04445 SAM_MT Putative SAM-dependent methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2oyrA02
3.40.1630.10 Alpha Beta 3-Layer(aba) Sandwich S-adenosyl-L-methionine-dependent methyltransferases YhiQ-like domain 2oyrA01
3OZRA 1L3IA 3TFWA 3P9NA 2PXXA 3V8VA 3A26A 4E32A 5LQKA 2AN4A 1DCTA 1M0EA 2PT9A 3EEYA 5E1BA 4RTRA 2BR3A 3PB3A 4R05A 2YQZA 3UFBA 5IH3A 5HOQA 2B3TA 5K8VA 3GRYA 3P2KA 3BGDA 2XYRA 5LSAA 3TR6A 1P1BA 2FHPA 3PVCA 2BH2A 3V97A 5CUQA 1PRYA 4X1OA 4AZSA 4KDCA 5C1IA 1IY9A 3HM2A 3G89A 4M7RA 3U81A 3I5UA 4YMHA 1RJGA 1VLMA 3EVZA 5BW4A 5K0JA 3DXZA 5CVVA 5FULA 1XTPA 5DWQA 5G02A 4CTKA 2NP7A 3JWJA 2P7HA 2FK7A 4X63A 4F84A 1ORIA 4H0NA 5EMMA 3GRUA 5GP1A 4YV2A 5CIYA 5GWXA 2ZLBA 4GUAA 3ERCA 3KU1A 4QQKA 3OE5A 4PYKA 4DQ0A 5EKXA 2Z6UA 4AUKA 2YXDA 3KQSA 4PONA 5CVEA 5HIMA 1D2HA 4MWZA 3ELUA 4GC9A 1Z3CA 4RTJA 5DLYA 2HNKA 2XYVA 3ELWA 5EEHA 1PJZA 3RW9A 3GXOA 4E30A 1XCJA 1VIDA 2EG5A 3UJDA 4C07A 1BC5A 2GB4A 3KPJA 2I62A 5DM4A 3NDIA 5GIOE 4PNEA 4P58A 2OB1A 1UWVA 1RI4A 3MB5A 2OBFA 3DXYA 4LWPA 3BT7A 3EVCA 4HGZA 3OZSA 2NXJA 1OR8A 5LQUA 1G6Q1 1X1CA 2PVCA 1BKYA 5EKUA 5HIIA 4RTQA 4F85A 2WA1A 2LD4A 5C0OE 3KQPA 5DM0A 3GDHA 5E2AA 1KR5A 1F3LA 2IIPA 4EQZA 2O06A 2FPOA 3KQYA 4NECA 1FJXA 5FQNA 4OBWA 1XDUA 4E33A 5FA8A 5FTWA 4DA4A 10MHA 3I58A 1JTEA 2Y1XA 3EMDA 1BHJA 1T43A 5K0GA 5KS2A 5HILA 4PYOA 1I4WA 1QANA 4QTUB 4CKBA 3TRKA 3E05A 4CTJA 1FP2A 2AZTA 3PFGA 4RYLA 1F38A 3IYLW 1Y8CA 3UJBA 1G8SA 3SMQA 5EZSA 3HVIA 4FZVA 4QDKA 1AV6A 2QY6A 2G1PA 1KYZA 3HA3A 3L8DA 3TQSA 3DOUA 4OBXA 1M6EX 3GRZA 3HVJA 3G2PA 4RTNA 1R74A 3LL7A 4PGHA 3NWEA 5FCDA 2PX5A 3MHTA 1D2CA 1JQEA 4GOMD 4HRAA 5D1HA 2ZBPA 4YUVA 3FPEA 5DSXA 2AOXA 3BWCA 3DTNA 3EGVA 2PJDA 3BGVA 4C05A 2AVDA 2O05A 3EVAA 3LBYA 4IWNA 1TW3A 3BWMA 1QZZA 4GF5A 4WXHA 4IKPA 2P35A 3UJ9A 3FTCA 2UYHA 1INLA 3EVEA 1JG3A 2E5WA 5U4XA 1JSXA 1ZKDA 4AZWA 3C0KA 5E2BA 5ICGA 1XXLA 3NTVA 1FPQA 5F2KA 2JHPA 1JQ3A 3AY0A 2NYUA 2XYQA 1AQJA 2Q41A 4MIKA 3G7UA 3ER8A 1DUSA 2IBTA 3LPMA 3QOWA 2JJQA 3LCCA 1RJFA 1KXZA 1L3BA 2IFTA 1RI1A 2IPXA 3ORHA 5EHIA 1B42A 4P7JA 4DMGA 4ER6A 5FA5A 2PY6A 3B3FA 3LCVB 3LX6A 4U7TB 1O9GA 3PFHA 5DRYA 5K0LA 3D2LA 1HNNA 3UWPA 4U7PB 4A6EA 3A4TA 1AF7A 1YUBA 2ZIGA 3HVKA 4BY9E 1G60A 2PWPA 3HA7A 1ZGAA 4HSGA 5CCBA 4BP3A 3SR4A 1NKVA 3T0IA 3SVZA 1UIRA 2P3OA 1NW5A 2AOWA 3M4XA 4QTTB 3TKYA 4V0QA 3DULA 4RVHA 2IP2A 3NW9A 3SXJA 5H02A 3T7SA 4BLUA 5DXAA 3NVMB 3ER9A 3SSNA 3KR1A 3WSTA 2B2CA 3DMGA 1L9KA 1XDZA 3QV2A 2P7IA 4IV8A 4DM3A 3OU7A 4CKCA 2V7EA 5CVJA 4BLVA 2YXEA 5K01A 3KR2A 3EPPA 2B25A 3AWIA 2VP3A 5CVUA 3REOA 3R6TA 4WVLA 3GCZA 2GS9A 4HTFB 3KR9A 4M38A 5HEKA 4ATNA 2QYOA 4C06A 2AS0A 2P1DA 1VPTA 2YVLA 3A25A 2YXLA 2H00A 5K05A 2PLWA 2BR4A 2GH1A 3E23A 3EVGA 3KHKA 5DRTA 1QAMA 5EC8A 5C9ZA 1RJEA 5EEGA 1O54A 2GPYA 3NJRA 3LHDA 4P7KA 1WZNA 2PGXA 5IKMA 1ZHFA 5EQJB 3M6WA 1X1BA 2QRVA 1JSZA 2XBMA 4ISCA 2PSSA 2JHCA 3FUVA 3FZGA 2CL5A 4QPPA 4RTMA 1NT2A 2UYCA 1EQAA 4R8RA 4OX9Y 4UOEA 1N2XA 2JHAA 3R24A 2IBSA 3B3GA 3ELDA 2HWKA 2K4MA 4KIGA 2O57A 4E2YA 1L1EA 4FR0A 4C04A 2IDJA 2OZVA 3KQQA 3NWBA 3O7WA 4YUZA 2FRXA 3E7PA 1NW7A 3FYCA 4OQEA 4E31A 5DXJA 2PX8A 3CKKA 4RTLA 3OPNA 4C03A 2IH5A 2ZZKA 4DCMA 3GJYA 2JH9A 4B17A 3EVBA 2O0LA 3A7EA 3G8AA 5CCXA 3ME5A 1KYWA 1G8AA 4QDJA 4Z2YA 3NVKI 4RTOA 4HG2A 4PIPA 5T6BA 1VBFA 3CJTA 4P7GA 4XCXA 3UJCA 2YTZA 4LECA 1WXWA 4XUEA 5LQCA 8MHTA 3G2QA 4Y2HA 5EIWA 3VSEA 5FWDA 2Y1WA 3GRRA 3P71T 4YV0A 3ID6C 3QOXA 3IHTA 5LR6A 3FUWA 3Q7EA 3G2MA 4DCGA 3DR5A 4YUYA 4KWCA 2PBFA 2PXAA 5EHGA 5DTRA 2C7OA 4RVFA 2WA2A 2ZFUA 3CGGA 4PYIA 1VE3A 3HVHA 2WK1A 2ZIEA 1QAQA 2OB2A 3B3JA 3GIWA 2AOUB 2B9EA 2P3LA 5CD1A 1ORHA 3IV6A 3HTXA 5K0BA 5EGSA 1I1NA 4FP9A 2C7QA 2P3QA 2P41A 2GAFA 2ZBRA 4E2WA 4E2XA 3DUWA 3TKAA 3EMBA 2ONYA 2ZWVA 5EPEA 4G56A 3MGGA 5E9WA 5GINE 5DSTA 5DPMA 5KQRA 4IV0A 3KQMA 5EIFA 3VYWA 1O9HA 4GBED 1IM8A 3BWYA 3FPJA 3SGLA 4F86A 3G2OA 3FTFA 3FTEA 4PYMA 2EFJA 5GM1A 3TM4A 4PCAA 1G55A 4PGGA 2ONZA 2PKWA 4EKGA 3BXOA 3JWHA 3RIEA 5DTMA 2I9KA 1QAOA 1NW6A 3GNLA 2R6ZA 5EVJA 4PYNA 3R9XB 1ZG3A 3NDJA 5EMKA 1EJ0A 1D2GA 2BM9A 4X61A 5DX0A 4RV9A 4R6XA 2NP6A 3M6XA 3FTDA 3T7RA 3TM5A 1R00A 3M70A 3OE4A 2AOTA 3KPUA 4FT2A 4AZTA 5LQAA 2P40A 5JR3A 1NV9A 5E8RA 3O4FA 1EIZA 4AX8A 1SQFA 3FUXA 3P8ZA 4FSXA 3AJDA 5ERGB 5HIJA 3SSOA 3P9CA 5GIPE 2OYRA 1G38A 5ICEA 3R3HA 3JWIA 3HCEA 1AQIA 4PYJA 5E1OA 5MHTA 3LGAA 2EJUA 2HR1A 2G70A 1XDSA 5E8JA 3OZTA 5EG5A 2ORED 2H11A 1QYRA 1YZHA 1NV8A 2ZSUA 4XUCA 3F4KA 3I9FA 4C08A 1IXKA 3LDFA 2BM8A 1Q0TA 2UYOA 3FPGA 5DX8A 4RTKA 3THSA 5EOVA 3DH0A 5DM1A 4YUWA 5P8WA 4LG1A 2AN5A 3MQ2A 4EKIA 3UA4A 1VQ1A 4RSRA 2JH8A 2Z6AA 5LQJA 3DP7A 1KP9A 4QVKA 3FRIA 4A6DA 3UZUA 4XUDA 2C7PA 2H1RA 1JR4A 1NE2A 2AOVA 2R3SA 3I64A 4E2ZA 1WS6A 3CC8A 3DXXA 5K0NA 3EGEA 1NW3A 4KW7A 3MAGA 1KPHA 1JTFA 2IH4A 1JG4A 1XVAA 1P39A 2G72A 2G8NA 2NXCA 3LDGA 5BXYA 3PT9A 4GOLD 3FUUA 2AR0A 2JG3A 2ERCA 2FYTA 4DF3A 3TOSA 3X0DA 1KPGA 3FPHA 4RVGA 3KPWA 2IH2A 4LWOA 4ER7A 4GOND 3LSTA 3KQWA 4RTSA 4POOA 5HZMA 1EG2A 2EX4A 2B78A 5KVAA 3IEIA 5B1SA 2IDKA 3BKXA 5FADA 1ZQ9A 2AOUA 5GOZA 3AXSA 3B89A 1EAMA 4YV1A 2CMHA 4PINA 5E9JA 3O31A 5FQOA 3CBGA 4K6MA 3THRA 5HIKA 1VL5A 5T67A 2KW5A 1TPYA 1X1AA 4OQDA 2F8LA 5LQNA 3G5TA 1MHTA 4R6WA 2G71A 3CJQA 5F2OA 2DPMA 3OU6A 3G5LA 3KKZA 4O29A 5FHRA 5DX1A 4EVIA 3LCUA 5ICFA 7MHTA 4M36A 5CM2Z 1YFJA 3PS9A 2ZIFA 3CVOA 1XJ5A 2ZBQA 3FUTA 4JXJA 5FUBA 3HA5A 1N7JA 3KQOA 3HCBA 3HEMA 2BR5A 2VZ9A 4OA8A 1X19A 3TPZA 3UJ6A 3K0BA 1L3CA 2P8JA 3VC2A 1KHHA 2EJTA 2O07A 4FGZA 2I6GA 1SQGA 2BZGA 2FCAA 3TLJA 4CKEA 1R8XA 3EGIA 3H2BA 4RX1A 4V0RA 2AN3A 1VP3A 3UJ8A 3KQTA 1R18A 1P91A 2YR0A 4E70A 4QPNA 1SUSA 3DMHA 4YUXA 3ELYA 2PT6A 3FPFA 4PCLA 4M37A 3UBTA 1JG2A 2FK8A 2HTEA 2C7RA 4PYQA 3K6RA 5LQRA 4Y30A 2I7CA 1I9GA 3PX2A 2OXTA 3P97A 2ZWAA 4X60A 4BP1A 3KPYA 5EMJA 3ANXA 1N7IA 2PV0A 5BW5A 1H1DA 3GO4A 2OY0A 3EEOA 3M33A 3GWZA 5CVDA 3G88A 1NBHA 2DULA 3M6UA 2ZTHA 3GGDA 3MTEA 1X1DA 2VDUE 4OA5A 4PIMA 1TW2A 3C6KA 3BKWA 3B7PA 3BUSA 3VC1A 2ZW9A 2QM3A 1R8YA 4ER3A 5EZQA 2QRVB 4L7VA 5E1DA 1SUIA 3HCDA 3KR0A 4GC5A 3FRHA 3OCJA 2GLUA 4RWZA 3SX0A 2N47A 5EMLA 1M6YA 3A27A 3PX3A 2GA9A 2XVAA 5E9QA 5E1MA 1NW8A 2HV9A 3CJRA 3OU2A 4GQBA 4ZTBA 1V39A 1RI2A 2V74B 3DMFA 4KRGA 3HP7A 3P9IA 4FT4A 4ER0A 3UJ7A 5DM2A 5K09A 5KQSA 2VDWA 5ICCA 3HNRA 4HTFA 3MERA 3UJAA 2AOTB 3NMUF 5JUWA 4RTPA 2ZULA 4RVDA 2YUIA 3C3PA 2A14A 1FBNA 5D1NA 1KPIA 2ESRA 3C3YA 2VS1A 2ADMA 3C6MA 1YZ3A 2OO3A 5FWAA 3BGIA 3MCZA 3P2IA 3TMAA 3UA3A 3MCTA 1WG8A 3OFJA 3EVDA 2PWYA 3LDUA 2CWWA 3DLCA 3MTIA 3P9KA 4BLWA 5K0EA 2PXCA 1XCLA 1KIAA 1Q0SA 1P1CA 2OKCA 3KQVA 4KDRA 4DZRA 2ZCJA 9MHTA 1FP1D 3SSMA 4MTLA 5F2NA 2VDVE 4GOOD 5K0FA 2NXNA 1DL5A 1JG1A 4HH4A 1U2ZA 2AVNA 4HGYA 3RODA 3AXTA 2ZZMA 2HMYB 1RJDA 2PX2A 5M5BA 4FS8A 1R6AA 1MJFA 3SM3A 4YMGA 3B5IA 3DLIA 3CCFA 1BOOA 3HCCA 3HCAA 3LBFA 1YB2A 3GRVA 3EVFA 3HCFA 5T64A 3I53A 4KVZA 1HMYA 3LKZA 3JWGA 3G8BA 1YFLA 4GEKA 3KPVA 2ZVJA 4C4AA 1SKMA 1SVUA 4QQNA 1UFKA 4KIFA 1RI5A 1RI3A 3BZBA 2OPBA 4AZVA 1ZGJA 1WXXA 4DKJA 2CMGA 5FHQA 2Z6QA 4R8SA 3M6VA 1VP9A 4MQ4A 2NXEA 3R0QA 1JQDA 4HC4A 4P7FA 4CWAA 4CXMA 4FSDA 1WY7A 3GU3A 3LECA 2UZ4A 2ZZNA 5GM2A 4EK9A 2QE6A 4PWYA 3LKDA 3S68A 3Q87B 5K0CA 3P2EA 3E8SA 3FYDA 5K03A 2CKDA 1EJ6A 3T7TA 3PLAE 4QVGA 3BWBA 4EMSA 5DTQA 3PTAA 1NBIA 3OFKA 2YX1A 2UYQA 5HFJA 5BP7A 4MHTA 3A7DA 5DT2A 4ER5A 1YF3A 5KYGA 4PYLA 1SG9A 2XVMA 2IGTA 4X41A 2PX4A 2NNWB
chains in the Genus database with same CATH superfamily
1SVOA 2GN1A 2DERA 2IHVA 1Z6XA 2QPLA 2RJOA 1QVWA 1XTVA 1U1CA 2HA3A 3HP4A 4C43A 5FAKA 5LQKA 2OCIA 4C4XA 3MMSA 1T36A 1P0CA 2BR3A 2H4WA 2XMZA 3O82A 5DVZA 2A7XA 1KVUA 4PVDA 3UW1A 2J3QA 5EN4A 1CEYA 2XXJA 3NKVA 5DTIA 5AVJA 4DEXA 1JLLA 2R6DA 1G1MA 3F46A 1J07A 3VFDA 4FWTA 1B8UA 4FILA 2GZRA 2UUBB 2RGNA 1V5WA 2A9QA 3KUKA 3GDFA 3K5HA 3FYUB 1BH6A 4GP6A 3NONA 1CUZA 4AF8A 5K0JA 3NBMA 3E2PA 1FYDA 5DWQA 4DLNA 2VUIB 4EHBA 5F21A 5K6TA 4W5WA 1Q12A 2NACA 2AQHA 5EIHA 3LXXA 3HDQA 1HNZB 5IW8A 3ERCA 5DT9A 4MTCA 1E89A 1ZD4A 1SBQA 2QG6A 1AK2A 4G1MB 5EKXA 3DHYA 2RGWA 4CM5A 4WN9A 5FOTA 4C0BA 5HIMA 4KYIB 1WCIA 2IS1A 3ZHQA 1EX6A 2OCBA 1CRQA 3ELWA 2ZYUX 2W4IA 3DS8A 4DMFA 1ECCA 4JA2A 1KEKA 1WSWA 4J43A 1T1RA 1PTJC 4G5GA 1E63A 1RWNA 2IELA 5GOTA 2XLBA 4FFVA 3RNLA 2ZJ5A 4QJBA 1I51A 2VUSA 3KE9A 1KJYA 3QVGA 1WL8A 4X94A 5A7GA 1NKSA 2RAFA 4D3YA 1UBEA 1T5BA 1O96A 5EXPA 3TYXA 3UT0A 4G2NA 2V5UA 3VKFA 1DKOA 5J5VA 1L4UA 2JAHA 3KSBC 3WXMA 5COBA 1JQKA 1KFJB 3I9LA 4KWCA 3HYCA 3KSUA 1A27A 1S6YA 5F7XA 1DQZA 2P9QA 4E7OA 4PZLA 2FF7A 4DW8A 1XK7A 3PXBA 3L9WA 4JR2A 3VDQA 4EPRA 3WRYC 4EYKA 1PL6A 4L95C 4UE6A 1Z8HA 2VDOB 3KSMA 5T57A 3AV0B 5TQVA 5G40A 5K0GA 3IS3A 3MJFA 1DGQA 4QTUB 1R88A 2VJKA 4DGQA 1AOXA 3IBFA 1DWPA 2Q46A 1A8QA 2HNBA 3D54D 3MTQA 1F7VA 1NU6A 3PUXA 1T8UA 1AQYA 2ZAIA 2ZRFA 4EDHA 2YKGA 1E99A 5EY5B 1SOMA 2P4SA 1I2ZA 3IBGA 4X9XA 1R0YA 1QF6A 3WLKX 1THGA 4U02A 1MIHA 3ETCA 4OBXA 4GYYA 4X00A 1P77A 4Q02A 2EGUA 1YXMA 4LDZA 4GMKA 1X8JA 4QYMA 5FCDA 5HF9A 2XWSA 2WD8A 4QSHA 3C8HA 1FX0A 3UV6A 1LPNA 1SOVA 4EUFA 5D1HA 2DPHA 3WKAA 2BFCA 1S8AA 4MLPA 2GSDA 3OIGA 3EGVA 4H6PA 3F0TA 5IAGA 3T0GA 4C7MA 5JRZA 2MR5A 2O05A 3GGPA 1U7TA 3NT5A 3BMCA 1KJWA 2WG1A 2P35A 2VSNA 3CLVA 1NJGA 3FTCA 3D6AA 1S8FA 4RF2A 3QWBA 4Q7LA 2IYNA 2GXAA 2FZEA 1SJ9A 2AQ8A 3IP7A 3NFYA 4M1OA 5CT6A 1NL3A 5AI5A 2XDQA 5ALIA 2Z4SA 3N2IA 3E58A 4Q4HB 3W06A 1ORDA 2NYUA 4GGPA 3KYIB 3L8ZA 3ESQA 3K94A 2UZ1B 4ND4A 2AW5A 2QLJA 3MRVA 4TLBA 3C3CA 3SZRA 4EJFA 1H0KA 3EZ7A 4LF8B 3A10A 1SPBS 3ORHA 4MIEA 5CLLA 5EHIA 5BOSB 5JXHA 2ATVA 1DXYA 5DRYA 5C51B 3CUEF 3UH1A 5TS3A 4AQ7A 3UWPA 4DSZA 3TKLA 2GZSA 3EARA 3H1FA 2ZSBA 5ENZA 5F1PA 2HFJA 1MP0A 3AP2A 3G9ZA 3LK6A 2UVPA 1ISGA 3PXUA 5CH3A 1Z16A 1N0WA 1RPAA 3M4XA 1RXWA 2JFXA 3EZFA 3PTZA 3T7SA 1Y1QA 2AB0A 2HMAA 1KNQA 4NR0A 4TYQA 1SBTA 2DPYA 1R16A 3H3XA 3ZLVA 5KB3A 4G0VA 1A04A 2OCXA 4RULA 3GNQA 1OT5A 1V8ZA 3OJ0A 3X1ZA 1JFFB 5ALSA 1PR3A 2W2KB 1VSBA 3MW8A 3UATA 1GR0A 1T1SA 1VCOA 1O0CA 4GL4A 4MWBA 4PSKA 4IMIB 5FUWA 5CK5A 5B57C 4ZPJA 3MWEA 4HTFB 4ATNA 1RP1A 5HMLA 2NV6A 4AIIA 4EY8A 5BN1A 3NGLA 5TSDA 4EBBA 3RIXA 1AF4A 1N8NA 5EQTA 5IM4A 1BVRA 4MKIA 4MUHA 3EPKA 1QTQA 1J09A 1WAMA 2VT3A 4B3HA 5IDXA 4U3JA 3J81A 3FVRA 1PSZA 2YHIB 2VK1A 1T8PA 3HGTA 1H2AS 1RLTA 4NULA 5I48A 2OBMA 1Z2CA 2GCGA 5EHXA 1OQAA 5AKXA 3X2FA 1CZOA 3GZNA 2EF0A 1GL3A 2H3EA 2MIIA 3Q3VA 3LS2A 1Z2AA 2IZZA 4HNAA 5WRFA 4YT8A 1P74A 2OMEA 3PIDA 5JRJA 5LMCA 5ADHA 2VSOA 1OH7A 4BRUA 1K5DA 2P78A 4U1RA 3KTAA 9ABPA 4ZTUB 2HXGA 1B15A 3TTXA 4LF9B 3ISJA 2PX8A 1ZA2A 2QUIA 3OPNA 5LKAA 2Q4DA 4MH0R 3IIEA 4L5IA 3IBSA 5K9ZA 1PZXA 2IH5A 1QLHA 4Z53A 2C5HA 2CD7A 4K9RA 2X2OA 4HQ6A 4M21A 1FTWA 4JGGA 4UPDA 3RC9A 2E37A 3QXGA 4HSEA 4RJLA 3A7EA 4JLKA 4R2IA 1Z7WA 4QDJA 4BU0A 3LWNA 2J32A 3MJDA 4D8YA 1XP8A 3Q3CA 4BP9A 1P5HA 1E4EA 1Z0FA 4HDMB 4UBJA 1WSDA 4C0HA 3W5JA 1P29A 4NYMR 4ZDWA 2WJVA 5LN1A 4GWKA 3VSEA 4JL6A 5I7HA 3DO6A 5A6SB 1QFYA 1UQRA 2IE0A 2B1RA 2ENWA 1JPUA 2CXSA 4K9LA 1RAIA 3TSOA 3JSXA 3QE3A 3K30A 3VSBA 2IXGA 2Z5GA 3O0DA 5BMVF 2P6UA 2HIHA 4RK7A 5JPMA 1WTAA 2ZFUA 3OFVA 1TI7A 3E5MA 3VAYA 4B9AA 2WWGA 1WCWA 3N75A 2L69A 3LTEA 4Z51A 5FUQA 1NYQA 2ALJA 4DLRA 4DLYA 1KBZA 4IS3A 1ORHA 1YNOA 4Q9HA 2DQKA 4AS1A 3BMCB 3JQ9C 4YREA 4FP9A 5K0BA 2F8SA 3U3KA 3VKHA 4EF6A 5HF8A 2B34A 2BEWB 2OPHA 4BYMA 2IPMA 3RS2A 3V1NA 4IJQA 3MGGA 4Y2VA 4XVQA 2QVBA 2J9FA 4NPAA 3VYSB 2WF9A 3GOQA 1N6KA 4Q9JA 4EA9A 3BWYA 5AR1A 3ONVA 4PX9A 5TB5A 1WLSA 5DNAA 1WUIS 2WUVA 3RUDA 3G7SA 5B3LA 5CDUA 3GQVA 2ZBGA 1H2EA 3USCS 2IHBA 3AI7A 3J7TA 3RYIA 1ID8A 3CEHA 2VRCD 3LPAA 1RSZA 4H35A 3OTIA 4OJTA 4WCFC 3NDJA 1G3UA 3HMKA 4DJFC 4CF3A 1EJ0A 4M1TA 3HNOA 3QLTA 3RVNA 4RV9A 3KZXA 5DYWA 2C7BA 3TJMA 5TARA 4CMIB 3HB9A 2W4MA 1NSFA 1QE5A 2IEZA 4ZZ1A 1NBMD 3FTDA 1QPBA 5A04A 1J5EB 2RGYA 1OXXK 2YXNA 4JENA 2BGTA 3QI2A 1L5HA 4IKEA 4BNTA 3H16A 1H9AA 4EPTA 1TOAA 1YS6A 2V7QD 5JDCC 2C2XA 3I32A 3HL0A 4LF6B 5FNVF 1QB8A 3B3AA 4P84A 3WDKA 2X8JA 4DDTA 2ST1A 3B13B 1C1HA 1RWXA 1ECBA 3BIFA 2Z4TA 3BFKA 1A9SA 1HFWA 3QM1A 3C43A 3R3HA 2HH9A 2XHZA 2EJUA 5K2MA 5EA2A 4D82A 3L5OA 3A2KA 1N6LA 3EFBA 4PV7A 1O87A 4F2DA 1FDRA 1VXRA 2HLNA 3PQ2A 3CX7A 4Y9SA 5HG0A 4CG1A 2X14A 2ZUBA 1DB3A 1G8PA 2XMQA 4MA4A 3HH8A 2HUNA 4XUCA 3ST7A 3MPOA 4C08A 7REQB 2RONA 3TJRA 1RQGA 2WZCA 3GFQA 4MUAA 1V3VA 1YB7A 5JMPA 4CKCB 1AKMA 4B7AA 2NZ2A 3KHTA 4IDEA 3QEBZ 1AKUA 1T9HA 3QIAA 4B34A 1H4SA 2J4CA 2JBAA 1FOEB 2C07A 2A9JA 4AY6A 4EJSC 1PK8A 4HYTA 4URZR 2Z6AA 1EYZA 1BJKA 2JRLA 1BRTA 4DV3B 1CFJA 2A3NA 5ESDA 4AN4A 4B79A 1M7HA 4ZA2A 1FPMA 1I4LD 1N1MA 5CFMA 1KZ9A 2OBXA 2QN3A 3GLGE 5LXTB 3CLRD 4DCUA 1JG4A 2HBZA 1XLVA 4POAA 3VJKA 4KACA 3ZGLA 1UQTA 4PX5A 4CMCA 4ZYXA 1XZCA 4DA4A 3OOJA 2PH5A 4GPD1 2OVBA 4RXTA 3GNTA 5EP1A 3EGOA 1ODSA 2I4RA 2FYTA 3DFKA 1COWA 3UQYS 3ZUPA 4C14A 5DO9A 2ROQA 2NV2B 3QU9A 4QEDA 3UCEA 1FFDA 4PHGA 1KOLA 1OILA 1NLFA 5IJ9B 1IQUA 5ERXA 1K0FA 2AOUA 3GRCA 2FEWB 4KXQA 4KQIA 1C3XA 1QQAA 3IOBA 4JUDX 2A9PA 4LHXA 4LMAA 4PF1A 5FQOA 1V0JA 3PUJA 3A1FA 3TNYA 1WP4A 3VSAA 5HQ3B 4GDFA 1YRAA 5TIIA 1M9NA 3U48A 3GPCA 1FVHA 1GU0A 1BX3A 4L4YA 1G5QA 4GBJA 5FUBA 4JXJA 1XWFA 3KQOA 3HCBA 1VJCA 2IH4A 2QVGA 1X19A 3AI2A 1L3CA 2O07A 3GT0A 4Q6WA 3HN6A 2N0SA 4Z1MA 5I3CA 3IAM1 3FKSD 3VTZA 1T9DA 4IOMA 2PT6A 1WUHS 5KNBH 4R1SA 3WZMA 4AQYB 3RASA 3PC4A 3PDIB 1EUCB 1FYEA 2OYCA 3D4LA 4YQZA 4B0PA 1B43A 4D41A 1GZHB 4D4KA 4QWMA 4RKQA 2QIOA 3PXAA 4BO7A 1E8NA 4W63A 1W4BA 1D2RA 3W5UA 3EXAA 1H8HA 2Q62A 3R6LA 3R8XA 4MLDA 2J6BA 2ACWA 4LRTB 4HLNA 2B61A 5BW5A 3DBHB 1IBCA 1UK7A 4NYIQ 1QR6A 1RLMA 5C46F 3M33A 3G2JA 4G81A 2QMYA 1RCFA 3TUZC 3NNSA 5J4YA 3GGDA 1RHJA 4ZVUA 2FEMA 2IEDA 3Q3EA 3KYCA 1E2FA 3DKKA 3O47A 4O4HA 5AM4A 3P27A 4D5EA 1QQTA 3HV2A 4MDFA 2XWJB 3C6KA 2GK3A 1UKCA 4NC9A 2DAPA 1AKTA 1LTHR 2R8EA 6NULA 4M9ZA 2G9NA 3INTA 1LRJA 3KR0A 5AW4A 2FPIB 4MOWA 1CW2B 1P3JA 1K08A 1QYVA 2F9LA 4PZAA 4RXUA 5HJ5A 4U0KA 5FA8A 4B3GA 1QTRA 2MINA 3CWCA 3T94A 3HVUA 1KJ8A 1VL0A 3DMFA 5IN5A 5KSWB 4CMKA 4IO0A 3IL2A 4IDAA 1LV7A 3DL4A 4H7DA 3HFRA 4NICA 4D97A 4AZ3A 3MERA 5KMGA 3ZV3A 3H0CA 1DCFA 4NMMA 3VH4A 1H5NA 4OHOA 4MR8A 1H5UA 2JH3A 2CF5A 3GLHA 4HLCA 1ZNXA 4RTPA 3N7TA 4BNVA 3ONEA 5JSQA 3C3PA 3QEKA 1CF4A 5FPPA 2HL6A 4GZMA 3SZLA 2QG4A 2WYVA 1W0CA 3K6SA 4UCWA 3WNVA 3O8RA 1YO6A 2HK7A 3OFJA 2OQVA 3EVDA 4JDUA 2VTBB 2OL4A 5E6RA 1R6DA 1CQJB 4FFSA 3MINB 4KLCA 3ZEAA 5K0EA 3WA7A 5C5EA 3GUYA 4UQOA 3GT7A 1CD5A 4MR7B 1LSUA 4MKFA 4RH1A 1FP1D 4F5DA 1A9RA 5CW1A 3VR2D 1KWGA 4G67A 4EKEA 5JXGA 1TMGE 4Y9DA 3DCNA 3F67A 4KG7A 4N0MA 4CM9A 1OZAA 1T9CA 3TSCA 5JWRA 5DE3A 2ZDQA 1VG9B 4HMOA 4GXNA 1FS4A 3H4MA 3FHCB 1II0A 1KOFA 2PT5A 2V97A 4GLLA 5L3ZA 3Q3HA 1WABA 3B5IA 2OHGA 2AX3A 3DLIA 4JXKA 2B1IA 4JC5A 3S99A 4DPMA 5HCUA 1USWA 1O89A 1NF3A 3TD9A 2ZI5A 1U2EA 2PBRA 4TLMB 1RS0A 3RS8A 3ONWA 1S2DA 3GT3A 4FBGA 4GL2A 3IE2A 3QXSA 4TLDA 3BFVA 5KNDD 4HQNA 1KEVA 5B37A 4R9UC 2ZBDA 2Z6QA 1SHLA 2Q1SA 4KUHA 3M6VA 4QU9A 2YJ5A 1LU9A 2R25B 4B2IA 4ZVLA 4CMHA 2CCJA 4V2UA 4LHSA 3IE1A 1CRLA 4MUMA 4YCLA 4PWYA 2I7TA 2DTEA 1VPEA 2R5NA 1CUVA 3FSRA 3UN1A 4E5PA 4ZVSA 1GGFA 2WKPA 5HQJA 4AT1A 2GAAA 2GKOA 5K03A 4AF7A 1EJ6A 2FZGA 2JAPA 5TQ2B 4MQLA 3B3QA 2I55A 4EGQA 3K6KA 5I9MA 5JIBA 3WWPA 1VXOA 3HUUA 1J2EA 4O4LF 4EG7A 2XCTB 4J0KA 2W2MA 4IQFA 1SB9A 1VJDA 3FNEA 5DT2A 2IUYA 1YF3A 3QLEA 5BORA 1NYLA 2XVMA 1BCRB 3JX9A 3TM4A 2PX4A 3AVWA 2HO5A 2GDZA 4RHTA 5D5PA 4YRGA 1JB1A 1PU2A 3W1EA 2I3ZA 2QU7A 3U0BA 1FJHA 3PB3A 2FWNA 1P1HA 2BWJA 4Q9DA 3O21A 4NATA 4DJAA 4CG2A 2YWHA 4YP5A 5J2TF 5AVRA 1NI5A 3QPBA 4AJKA 1I7QB 4PPYA 3WGQA 4EKDA 2VJCA 1HBJA 4D9CA 4K9PA 4J49A 5AUPB 4G1VA 3ADOA 2UV8A 4HDSB 5I9LA 1P3DA 1RMQA 3ZOZA 1ZGHA 3SHTA 1E2LA 4NP6A 3AZOA 1T10A 1CDZA 2Q29A 2ZROA 3GRUA 1GGEA 4YRCA 5IC5A 2R1VA 3KU1A 4KRXA 4EUEA 1H69A 4M7PA 1DRWA 1PT5A 2VT6A 3R5FA 1YTLA 1Z45A 3KYDA 2Z6UA 4JKYA 3GUHA 4UU0A 5HCIA 5CFPA 1U3GA 1D2HA 4MWZA 2QE7A 4OJYA 4XDGA 4YMVA 1TEZA 4O63O 1JU4A 2O8VA 2OZKA 3OJEA 3TCKA 1JSCA 4CEHB 3CEAA 3A1DA 1Z4QA 4JJ4A 1J0EA 3DLAA 1BC5A 4TL9A 1WP9A 3L6OO 3NHZA 3NOXA 1RPJA 3QE0A 3VV3A 1IEQA 1C8BA 1ZZGA 3MB5A 1RI4A 5BUSA 1PT9A 1X1TA 3OQPA 5H5JA 2FSGA 1VTKA 6REQB 3E53A 3EVCA 3PE6A 2VRWA 2H4FA 3S3TA 1EE1A 1ZD8A 1N9GA 3BIOA 3KB1A 3B8HA 3OFND 4UFOA 2G4LA 2PVCA 3AUTA 1G2QA 3WBFA 4CF6A 1ITZA 1SIUA 5HIIA 5GZ3A 3BFJA 1JA9A 4J29A 1DWOA 1V8BA 3GVHA 3FGOA 2CSXA 3MXTA 4OP3A 2WM3A 3JTEA 3U62A 2P68A 2J31A 1YR2A 2BKLA 1F3LA 1GGVA 2O06A 3TNLA 2YWXA 3WJAA 4NECA 1FJXA 3CS3A 1GAXA 3DFZA 5LOVF 1LLQA 2G0AA 3BOSA 3EWIA 2PJRA 1P4SA 2V8OA 2XXAB 5FOBB 1BHJA 1M2VA 1ZVQA 4I1SA 2FDXA 2VFAA 3KZMA 1AE1A 4FZ3A 5K51A 4YCCA 1ZKMA 2NYVA 4M0FA 4H0CA 4L28A 4OJMX 1DRKA 1KAGA 1ZK2A 2QLMA 1A5BB 3F6EX 4MVYA 1OFUX 1XTTA 1BCRA 2E49A 1ECJA 4AG5A 3CUSA 4EJ0A 1SEPA 4DDKA 3HVIA 1XD8A 1PUXA 2C54A 3G0GA 2WKQA 3LBIA 5CA1B 2VBIA 2F59A 2D00A 2J3MA 4PLGA 1H65A 2AW3A 3HKEB 2WE8A 4K9KA 4ZO8A 5TQ2A 2EKDA 4COKA 5BQFA 1P7ZA 5EE1A 1GUDA 4KR6A 3MHTA 2HF8A 2ORWA 3CXRA 1L4EA 2CNKA 3PYXA 3VR6D 3SZOA 2KX7A 2OK8A 4BHTA 1YI1A 3GAAA 4AKGA 4WNIA 4BGDA 2XWBF 1ORRA 3LC0A 3MOGA 3L0PA 2PKXA 3LWBA 2X0DA 4HYQA 5AXAA 1M6HA 3GLKA 1OI2A 1KQFA 1KO8A 1Y0BA 1E2MA 1YFZA 4FGJA 4H1HA 3DF7A 1FPQA 2JJYA 4Y0AA 4HFMA 4LSGA 4EG5A 4QHTA 4N3GA 4BFVA 1X7ZB 3S8YA 1LBIA 2PD4A 4HTAA 3ZJ4A 16PKA 5IWCA 5DGDA 4PCVA 4A7PA 1MEOA 2NSLA 4TKMA 5F98A 1D3AA 2CZQA 2O7NA 1X80A 1WW3A 3A9VA 1FFSA 2I1WA 3MWDA 3PP8A 4M99A 5LP6F 5KNCH 3S2FA 2VHQA 3QBDA 1ZINA 4FQ7A 4DLLA 1C2YA 3A4TA 1BN7A 2OORC 4ZVQA 1XJWA 3KUUA 4CQJA 1KY4A 1V8FA 1W5SA 4JJ7A 3RVRA 1TUIA 1U5BA 2JFWA 1CJVC 3E18A 4GR5A 4V0QA 3S2GA 5FV4A 2HWXA 5H02A 3RANA 4DDVA 1V1RA 1AB6A 2ZVDA 4QEKA 1GCOA 2IITA 5CNKA 3DEAA 5ETJA 2XTMA 3KR1A 3I28A 4NTZA 1H66A 4X0EA 3LUFA 3H18A 4NRDA 3H1EA 2J3KA 3L0YA 4URVR 2P7IA 4E7PA 1PGQA 1Z8FA 4FEGA 5G0WA 2RGDA 3SQDA 5HNKA 1E92A 2OUIA 3COVA 5KKAA 3W3AD 1C7FA 4EBFA 1P1IA 2QYOA 2W2QA 3R3SA 2CJFA 2ZIZA 4OG2A 4Z8YA 1SHTX 3WGKA 1WMBA 4K9MA 3VAAA 3LUDA 4EZEA 5HKKD 3TW6A 2ZB8A 1LDEA 4A91A 5B6PA 5L53A 4CR6A 1CP3A 2I07B 5KWJA 4DQVA 3FFWA 2CVQA 4EO4A 1E9AA 2C3YA 3I04M 4FZJA 4IFEA 3M3PA 1K98A 3PR3A 2QQGA 4IMPA 3BB4A 5T4BA 4P80A 3CUTA 1FSFA 5LZ5A 1NX6A 3EBLA 1L8LA 3DE5X 4FN4A 2C20A 1VGVA 4ZODA 3LY9A 4CT5A 4DBLC 4HUTA 1TTTA 1T2UA 3T9BA 1T2NA 3PFBA 4PN3A 1GGHA 4AL4A 1IZ0A 3ONFA 4OP1A 3MJVA 4YUZA 3FYCA 3U5ZB 1R3DA 1Y8RB 2AC7A 2H63A 2ZPAA 3L6DA 2EFYA 4FKZA 1YAJA 3TGPA 3TO5A 3MUFA 2ZZKA 3AVUA 4JJEA 3C6ZA 4LX0A 3ICWA 3PEYA 3M1AA 2QORA 4Q3NA 4X8OA 2G09A 5CCXA 2I91A 4E46A 2FN4A 4JVLA 1C9KA 5JTWA 5LLDA 1QNFA 1XWIA 1W4RA 2XW6A 3H4VA 4KQHA 4NH0A 2X0NA 3ONDA 3HC7A 1YDGA 5I5EA 4EI7A 2Y1WA 3GRRA 3P71T 2PX0A 2WFZA 4XSHA 3V42A 4ACAA 2X6TA 4DFDA 3GEGA 1ZM4A 3Q7EA 3SVLA 4NXMB 2YMPA 3CW9A 1XK6A 1LGYA 1U2RA 1V37A 1CS0B 1ZIPA 2PR2A 1ELOA 1UJBA 1OAOA 2PXAA 2QZZA 1DFGA 1VIVA 2VSFA 4IILA 1SCJA 4MV6A 1RM3A 4RPLA 2RHWA 4PYIA 1VE3A 2XQFA 3CIOA 2C9OA 3HVHA 5EIBD 1QIDA 1QHHB 2B9EA 2BELA 2WPDA 2X5KO 3CN9A 4HDNB 4PO3X 3IP6A 3PJRA 3LM8A 3HTXA 1QG2A 5EGSA 4YDQA 1JHQA 4A1OA 2QTMA 1DS6A 4E2WA 3DT9A 3EC7A 4JC0A 4RK1A 5AKIA 4J4BA 5IJ9A 4URXR 1TZKA 4JR1A 3R5TA 5JISA 5L7WA 1WB9A 1EVKA 4Q9NA 3KQMA 5EIFA 5CA0B 4JEIA 4FI3F 4Q48A 4GBED 5KWSA 1GZVA 2QUAA 3FFXA 1F2UB 4FOLA 4ZVVA 2XOKA 1ACLA 3TAHA 2Q4EA 1R6VA 3QYFA 1T0JB 1PBTA 2IU3A 2VZ0A 2WF6A 4LMPA 1OJLA 4EX6A 2CUZA 2CC2A 3AR3A 2V7WA 3QPAA 3W1WA 3I8XA 4ARBA 4RLSA 1F60A 3PDWA 3PXDA 5IJZA 5LXTF 1VKRA 3DOHA 1BXGA 3O2SB 4FE3A 4G86A 3PRKE 1DIRA 4F93B 1FVFA 2NIPA 4V24A 3F6PA 3WNQA 1SBNE 1ZNWA 1CUYA 3IERA 4HNAB 4C0WA 2HIAA 4MGIR 1YVUA 4F56A 2EGGA 3M8KA 5BW8A 2A7QA 2FWPA 1I4DD 2I5PO 2JDIA 2ZB3A 4FMDF 4Z9FA 3RIGA 1Y5RA 1UZUA 1VYUA 2LR0A 5SYMA 1W4CA 2EBUA 3O8QB 5JALA 1A2QA 2Y1KA 1I94B 3RARA 5BPHA 1QHEA 2W43A 1EFPB 3Q0IA 3SKVA 4QUEA 3KKKA 2JF0A 5ERGB 1MVNA 3C5CA 3D7RA 4L1KA 5HIJA 4RD0A 4ARAA 3U49A 3I30X 3DA8A 1Q19A 1AHNA 4I5DA 4OAQA 3VNQA 4FQ5A 4TTQA 1GM5A 2XF8A 4HFRA 4RKYA 4F2GA 1FCJA 3S7TA 3IEMA 4RPJA 5EG5A 1VCNA 2SKDA 4QYTA 5JFOA 1C9YA 1KTVA 2ZWIA 1LY1A 1ADBA 3HDVA 3ZK7A 3VAZA 2WLTA 2QTVA 3B48A 2XY4A 3LDFA 4EVRA 2EWVA 3GPIA 4YLEA 3H5VA 2J5QA 1OU0A 3DH0A 5DM1A 3ES9A 3TMYA 3WP1B 4R3WA 4D3SA 4KPGA 4R2MA 3GFOA 4X66B 5JD3A 3UGQA 1TVKB 2JLQA 4LXYA 2C7RA 2WWIA 1U3TA 2VEDA 2ZRGA 2P6PA 3ETNA 5HKOA 1QKJA 4AP9A 4I55A 3HDJA 2MSDB 1TM1E 5AI6A 1U81A 1NW3A 4J7CA 1BSVA 3WBBA 2JA2A 721PA 1GPUA 1KJ9A 3VI4B 3HR7A 5EWJA 5EXTA 3CVUA 4GR4A 1I30A 1GSAA 4GOLD 1RPZA 10MHA 4WXEA 4PLYA 2OSVA 1Y1LA 3QF7A 5K3FA 5LB2A 4R83A 4HDAA 4UQLA 4WXYB 2I22A 4TMYA 3UB3A 4OGFA 1KVRA 3JQEA 2ZIXB 1VJGA 3RKSA 1EP2B 1FDUA 5ESXA 3IUBA 5FADA 4MGZR 1LK0A 2EZ9A 1P0FA 4YV1A 2DETA 3THRA 3QX8A 1MJGA 1TAHA 1Z5ZA 1XNJA 2FUNB 4G0UA 4OATA 4RH3A 1DG1G 2OZLA 4RD6A 4E11A 1AKQA 2JAUA 3CUWA 4YLYA 4EVIA 5IXSA 3DMDA 4J0CA 4CIBA 1T5TA 3LJKA 1W94A 3VPSA 1XJ5A 2ZBQA 3BD6A 3BIJA 5GONB 3TW8A 4M2LA 1PEKE 5L40A 2PBZA 2O1EA 4RPGA 2P4UA 4JI0B 5FTMA 4YXFA 3N0TA 2I6GA 3EODA 3R6GA 1D6NA 3PZRA 5K8CA 4I4TF 4KKVA 3QU2A 3P4XA 3QEMA 2IEBA 3GAZA 4HLQB 3WO1A 2PWAA 2WU8A 2P62A 5EXSA 3FPFA 1RWVA 2KJQA 2N1MA 2FW8A 2KMLA 3EVTA 3I2KA 4ZOLA 3G1TA 3IP9A 2XNSA 4B3XA 5C7YA 2VKTA 5BNWA 3VDRA 1T6YA 3J7AC 3JRWA 2WKWA 3ED1A 3NHAA 1D2NA 3MD9A 4I55B 4BJ5A 1DLJA 3LKBA 3AF1A 3GBVA 2CEKA 3EZYA 4X60A 2FMFA 1BFDA 1JDZA 5EMJA 2Q7DA 3SJAA 2Z57A 4CMEC 3IA2A 1GNRA 1UBCA 3N0RA 4QNRA 3UAXA 3VKUA 3VU8A 3ZCSA 4OYHA 1LC0A 1Z4OA 2QXUA 3U16A 5AW7A 1ZUWA 1SXJB 2QX8A 4JA0A 4CFYA 1Q0QA 3H4IA 4O4JA 5CAEA 2XR1A 4FXGB 2XUDA 3ZNPA 4DRXA 4MCAA 2RK6A 1U8AA 1GCGA 1KYVA 1P7WA 2H8KA 3OETA 5E1DA 1U5AA 3AL0C 2EAUA 2HWWA 3DDHA 1B0UA 2YWBA 4W5JA 5F9MA 4B4KA 3PI6A 5CFLA 2VP4A 1ZHOA 3SX0A 1DLIA 1KS9A 1SCAA 2NVUA 5HDBB 5BT9A 1GPJA 3BMQA 4NARA 4DZTA 3OU2A 2R47A 4N49A 4D56A 4BLTA 4F2WA 1RI2A 2V74B 1E3SA 3M9XA 3P9IA 4J8PA 4O3FA 2V98A 4TL7A 5DM2A 3EQ9A 4A4DA 4JODA 3HNRA 4LNVA 3DT8A 3KKLA 1A2BA 2D1RA 2IUEA 3MWEB 4HTFA 4MS1A 3WAKA 1R0ZA 1CUEA 5HGJA 2XJ9A 1US8B 3O9MA 2VDLB 3ROQA 1TO1E 1NXXA 2CE7A 4PEVA 1RM5A 4UHKA 1XMQB 3W5AA 1SULA 2PUDA 2H2WA 5D1NA 5ENVA 1YQ9A 1DNPA 4XM2A 1YVDA 1EWQA 1CY4A 1IWBB 1GHTA 2H4JA 2K6GA 1YI8A 4HL6A 3SICE 1I32A 1E2IA 2XSZD 4K03A 5CCEA 3QJ5A 4TLLB 2I6FA 2QX9A 2WT8A 3NRJA 3IIMA 3OC6A 3VHRA 3ABRB 2AZ4A 3KXPA 4MPJA 4QLAA 4RFSB 1I2DA 1ORVA 1PR4A 3R23A 5F2NA 2ATCA 1ZN7A 3A9TA 1PBNA 3NUQA 4EY7A 4YAWA 5I7FA 4PO8A 3HBJA 4I1OA 1JG1A 1UXKA 2HEGA 2B69A 4WGFA 5DF1A 4YONB 1RZRA 1THZA 1AT1A 1PZFA 5A4AA 4D44A 3IP5A 4UM9B 3AY6A 3NU1A 1DPGA 2JZNA 1ISSA 5JVDF 4XWWA 1P8JA 1LF0A 2D5BA 2RKOA 2IU6A 2Q3BA 5BN4B 1CUAA 4I2NA 3CB4A 3I8OA 1L7RA 2P5YA 2CB9A 1R15A 5A5GA 3B1KA 4NL4H 3IT3A 1SUWA 2FP4B 3JZMA 3PGVA 3RFUA 6YASA 1GDTA 3FVWA 1TA4A 2OR3A 4G41A 4FINA 3NCHA 4XOIA 3C24A 4PPNA 4QQNA 1T1IA 3H5WA 3PVZA 5K99A 3JALB 4TUYF 1UPUA 2J9XB 2DE0X 5DCUA 1PFGA 5EQFA 3UG6A 3P5BA 3ER9A 4CXMA 1TCVA 1VZ2A 3R0QA 4EHHA 5BNFA 1BS1A 5BSEA 2BEVB 4LZWA 4N5LA 3ZIAD 4PLVA 3LT1A 4IO1A 2PSDA 4MXDA 4NCBA 1K6MA 3CX3A 4HFJA 4A8TA 4BWGA 3E8SA 3O92A 4O0MA 4F5ZA 1HYBA 1Q7RA 4I1RA 3FFTA 1GN8A 1YQTA 3E03A 3VBEA 2OGSA 3RTCA 4NDAA 4YMTA 5DTQA 3PGA1 3D4NA 4P3KA 2W7TA 4U9HS 1HE1C 4TZ0A 2IUFA 3BMNB 5DJ5A 3VH3A 1XIVA 3VDNB 2GFQA 2RCYA 3AG5A 2GM3A 1TYCA 2XITA 3C45A 1GEEA 3EXHC 1BD4A 2Y3IA 3AEQB 1BQEA 2GCEA 3D7LA 4UBLA 3BXEA 2X8WA 4PX3A 1L4LA 1Z12A 3DE6X 3OJFA 3OJWA 3P9PA 4X84A 1K3UB 2H7YA 1P8AA 4R05A 2WIAA 3TLBA 4LZZA 4NU5A 3UK2A 1PLJA 4KTVE 1UWKA 2CK3A 2PS0A 3R4VA 3VM6A 4OMFG 4HDRB 3BSSA 3DYIA 3IDAA 2QJTA 1JGTA 3DMNA 4HVTA 4KOAA 4PTZA 4V0OA 4M9RA 2G6BA 4KDCA 4ZKDA 5A5VA 3VR5H 1JLKA 3BIXA 1R0WA 2CMDA 3VYRB 2P9GA 1X42A 1T3ZA 4AY2A 2OP1A 5G02A 2MDTA 1XTPA 3QKSB 3W34A 5J4VA 2QT1A 1NR5A 4Q4CA 2CLDX 3H6HA 2D7JA 4F84A 5T7BA 3JQFC 4I14A 4E51A 3UGJA 4L4ZA 5IKOA 5JD4A 2NU8A 2IYSA 1RVDA 3IIKA 1NW9B 3U39A 4JJ6A 4WERA 1W49A 1MJ5A 1PR2A 3EQ6A 3VSCA 3DM9B 1HDOA 2WVAA 4FXOA 2ES4A 3VNBA 5CXUA 2A74B 2OBNA 4NJOA 4OL9A 4GZ5A 4PHTA 2OFXA 2V6BA 3ELUA 3E3MA 4MARA 4WD3A 3CGWA 3UK0A 1X14A 1Q7EA 3RTGA 4JB3A 4P22A 4FE4A 2V0CA 1E77A 5JMTA 1Y33E 5ELXA 4C07A 3ND9A 1UT6A 4B4OA 4CIDA 4YP9A 1N2JA 5JWHA 2WWXA 4WA7A 2OENG 3FNIA 1O6CA 1JU3A 1G2OA 1JPNA 2J9ZB 1L8XA 5K0SA 2FJ0A 1DQYA 1VSQA 1QG6A 3MWJA 4H17A 4OUDA 3WISA 1FIUA 4RD2A 3BHIA 4INPA 1R0BA 4B3JA 2BL4A 4FBMA 3SJZA 1XBTA 2WA1A 1W2WB 3SXPA 1U0RA 2LW7A 3NC4A 1YT5A 4HX2A 5LA6A 2VWPA 4EQZA 3K96A 3KQYA 4TXJA 1TZMA 3SIPA 1L1RA 2YFQA 1GCIA 3FZQA 3GP3A 2R48A 2VBGA 1OIVA 5E7QA 3Q15C 4YRZA 1FRNA 2Y1XA 2B35A 2FWJA 5HW0A 3ETDA 2XRZA 2GXQA 5F9FA 2GEJA 3DT6A 3ZBUA 1I4WA 3F6YA 3VJRA 2FW7A 1FP2A 2UAGA 4UARA 4JYMA 3MWKA 5EZYF 2Y1GA 3P9XA 1ZONA 2R44A 4QFBA 3TLEA 5EJ4A 4FYIA 4JCCA 4Z9XA 3L18A 3UV7A 1U2TA 4PLFA 2QY6A 3GHHA 4ALNA 2O2XA 3DOUA 1JV3A 1K7FB 3NV9A 3NATA 3CH6A 1GNVA 2C8JA 3F4BA 4IVNA 2PZJA 5DOZA 5IM5A 5REQA 4E0BA 2C2OA 4GMFA 4ONEA 1JE1A 1FRZA 3MF4A 4GOMD 4YUVA 3V8QA 4B83A 4I4IA 3T1HB 2W2LD 3V8NA 1T4BA 1MQAA 2KPOA 1XHEA 3RADC 1JEJA 1T2CA 4TRJA 4HNTA 1YDEA 4ESHA 4X93A 1DBIA 3X43A 4DMRA 5CYFA 4B09A 3PF9A 3OLWA 5CFNA 1G9TA 2IYXA 3LYAA 1UMBB 1Z5GA 4RA9A 1XXLA 2OTCA 2Q49A 4LGMA 2X2EA 1HV8A 1ZI8A 3O83A 3KV3O 3EZ2A 3M83A 3T06B 1AMOA 1R2QA 2RI1A 3CISA 2ZRQA 2ZSIA 3BYZA 4HD8A 4AJIA 3LUJA 2XYQA 4P3XA 4XVUA 1SXQA 5C1OA 1L6RA 3HU2A 2Q5QA 1NURA 4NV1A 2DFVA 5JY6A 4JX9A 3QOWA 3VZPA 2K2QB 4IRXA 2VXBA 3Q0TA 4TTPA 1CPYA 1V11B 3NVKI 3LCVB 1O9GA 5IP5A 5CNIA 2TMKA 1WCXA 5K0LA 2WWRA 5GTDA 1BKSB 4GP9A 2B37A 1AB5A 2C82A 3NOVA 3EG5A 2Y0EA 1LA2A 1QK3A 1CHDA 3JVEA 3O95A 1HFEL 3ESRA 2IXEA 4I50B 1I7DA 4QEZA 3SKYA 3SR4A 2QVYX 1UODA 4IXMA 1FLAA 4QPCA 5FFMA 2ISCA 2WFLB 5CFOA 2X0KA 1KJQA 2G1AA 3QTBA 3T5TA 4UEOA 1R4ZA 4EIWA 3TXAA 4PG8A 4FDUA 3JATB 2B2CA 3D3WA 4QT4A 1H05A 1EXWA 4U2CA 4YCNA 3BJEA 1GNTA 5HJEA 3UV3A 2JBHA 3LE8A 4WVFA 2XCSB 5HEKA 2CV0A 1SKAA 2D4HA 4LK2A 5LDDC 5K3BA 2R79A 3QHAA 1QQ7A 4Y6PA 1R9NA 2Y8EA 1L8QA 4RCZA 3ISTA 4WCVA 1DT3A 3VJMA 5FI3A 5DRTA 1CZHA 4BECA 4F4IA 2PO7A 4TRMA 5E7MA 4N5MA 4Z5XA 1EDBA 2JGIA 1QO0A 5F2EA 3MUNA 4P7KA 2GYWA 2VSYA 4FCTA 4MUFA 1KRWA 2HCBA 1R0RE 2ZTSA 3KWJA 2FUG6 1EU1A 3QE2A 3TI7A 3ZXYA 3MWFA 4NAHA 1NE7A 2V1XA 2VOEA 4KUGA 2XGSA 3NKFA 1IN4A 4EYQA 1OIWA 2OXCA 2HX1A 2TS1A 1F4PA 4PY2A 2HHLA 3ZLJA 1A50B 4ZAFA 4LRXA 3U3RA 1VRWA 4ALLA 2NUPA 4LCEA 3MCAA 1Q83A 5F7JA 1M54A 1GDDA 1UZAA 1YMUA 3TQRA 5H1YA 4BEJA 2JD0A 3K70C 4EG8A 1MKYA 2REQB 3IE0A 1TVMA 4I1UA 4JLSA 5C7LO 3VPAA 1DQRA 1OREA 1D7OA 1G4HA 3A11A 1JR3E 1J8DA 1KYYA 3MGAA 3LRTA 1XZBA 3RWMB 5M2QA 3X1YA 3C2QA 3V00A 1JA1A 2P67A 4LV6A 4OJKA 2Q4TA 4J9VA 2JJ2D 1PS9A 2A1UA 4Q7KA 2FPGA 2XLCA 2RAVA 1XQXA 3RV3A 1KH2A 3IHTA 4NJEA 1G7TA 1VYVA 3KT3A 3IUNA 2RGBA 1OHHA 1WMAA 2DPGA 2GBFA 3MK31 5JZBA 5EE5B 3ZTYA 4EB6B 1YBHA 1JEYB 5B2EA 2C57A 1SC1A 3LPCA 3VPGA 2JANA 2YRWA 3RS9A 2GRAA 3CZ9A 4G84A 2ZIEA 1RXSA 2FMHA 2QM0A 3D5TA 3ZX4A 4EHKA 4ZICA 4C6TB 3WMGA 5GONF 9LDBA 1QIJA 5KTTA 1OHHD 1LDNA 3UOAB 4ZYZA 1OOEA 4NZYA 2IC5A 2R85A 3MB8A 4MWGA 2P9JA 4Q18A 4XUGB 4PAMA 5GINE 3PR1A 4GOJA 3Q85A 4IV0A 4BZWA 1TD9A 4JT2A 5IKPA 2PUBA 3DD5A 3DEJA 3H1PA 3O8OA 2EQAA 3QWAA 1Z56C 2LWIA 1ZDMA 4R5MA 1CJUC 1AMNA 5LXTA 1MX3A 4C89A 4US0R 2ZWPA 1WPGA 5IS2A 4NSNA 3REGA 1N75A 2VPTA 1E61A 3BXOA 4J03A 5DBFA 1NW6A 1PWHA 1RIFA 1QFXA 1GXSB 1JI3A 3LQ1A 2PG3A 1AX9A 3O93A 3QPCA 4IF4A 5F7ZA 2FTKE 1KMHB 4TLEA 4D0GA 5KWIA 5ALGA 1BOFA 4R6XA 4OLJA 2PRYA 1JWAB 1AXEA 3L06A 5DEIA 3UAZA 1BFKA 1WZCA 5FBQB 5CT9A 3T7RA 4N41A 4BX8A 5BQOA 3TEFA 5CNMA 1MB9A 3T9AA 5LNK6 1U8EA 4D0NA 4AZTA 1RYNA 3PYMA 2Q2WA 5EKTA 3W90A 1DJOA 3UOWA 3UMSA 1ZMXA 4D2IA 5C4IA 3ZE6A 2BUAA 4URUR 5DNCA 1TAUA 4QOHA 1EHCA 1BXZA 1G2IA 1H93A 2NSJA 3G9QA 3R5JA 4GRDA 1JP7A 2CNWD 2X4LA 3UOGA 3N70A 1J6UA 2X22A 1WETA 3K9QO 2Y2VA 1YQGA 2GX6A 2BJWA 1PQ4A 5E8JA 2HKIA 1YV9A 3E84A 4NJMB 5J47A 3PGMA 2G9RA 5CGZA 1AHHA 2P8SA 3JD3A 4CF4A 5SYNA 3HO6A 4D6YA 1GV0A 2Q3CA 5CYPA 3PUIA 5KOYA 5G0TA 3JV7A 1TJNA 2CLFB 1CHNA 5HR5A 3OF3A 4CIYA 4HGQA 3MJCA 1LV8A 3UA4A 1WB6A 4NNOA 3VYVA 4O5AA 4PE5B 1KP2A 4BAUA 4U7WA 2DBYA 1I6LA 2KM1A 2WVGA 3B6JA 2PX6A 4YRJA 2LPMA 2XT9A 3CC8A 1LH0A 2RKBA 1GTRA 4TKVB 5G1OA 3BIWA 2Q4RA 3QHQA 4UUBA 2X15A 4TGLA 2DB3A 5M04A 1N6RA 2QI9F 3WK8A 2GEFA 3CUYA 3LNTA 4WLEA 1PN3A 1T35A 2F3SA 1B8NA 2PUVA 1I5OA 4DREA 2NUTA 4CNBA 5JTUA 3LSTA 3NBYC 4JQSA 5DI9A 4L9WA 4HQFA 4EY6A 2B78A 5IVPA 2EVWX 4B3IA 4H3KB 4UMDA 4DUYB 4XYMA 4MW2A 4CQLA 1POXA 1NI3A 4WDQA 2HZ7A 2FQ1A 1N57A 2VK4A 2W4QA 4CDGA 1VL5A 3ZXXA 4UAVA 1PFWA 3DLPX 3E5NA 2FP4A 3DZFA 1QG0A 1KSJA 2X77A 3KCQA 3T5GA 1RKXA 4C5BA 2XI4A 2QWXA 5C1BA 1T4CB 2DPMA 2CBXA 4UHJA 5DI3A 5AW2A 1N0IA 1AURA 3LX5A 1EUDB 1ACMA 2D3TA 3RJMA 2C2GA 1BDHA 2GXSA 1M2JA 4F7WA 4NCAA 2O3UA 5KINB 4JJAA 4ZOLB 1IONA 2QRGA 4G1EB 3EQZA 4RZSA 3B7WA 2FCAA 3N58A 3SD7A 4BMXA 4ZDIA 3NTOA 3R44A 4J91A 4IJ5A 1RLOA 1Z0ZA 3DTTA 3C3DA 3DMHA 3RLIA 4C88A 1G3IA 4CPDA 3DCIA 5L6LB 1YCHA 2ZRBA 1QWOA 3GLVA 1ZBQA 1U8YA 4DYHA 2PVSA 4HNQA 4BFYA 1HE4A 3WB2A 1GPAA 2WD7B 1AQLA 2RGRA 1HQDA 1IHUA 1GQFA 1SPXA 1YRWA 1Z6ZA 2IEIA 3DSRA 4HB4A 4MCJA 4Z4EA 1B41A 4XVCA 1C4OA 1PW5A 4RM3A 1NSYA 2YZ7A 3AKCA 1V3UA 1P0QA 3PSAA 1N1EA 2DULA 5DLDA 4V03A 2QJWA 3U2QA 2VL7A 2NAFA 1XYVA 1SHUX 3G68A 4AYWA 3IT1A 5BSRA 2R6GA 1N9ZA 1Z17A 3OPVA 1WCV1 3BMQB 4M9XA 4AKEA 2VJPA 1OXBB 1Z06A 5JYEA 1I6KA 2BFBA 2E6UX 4B82A 4FNAA 1B26A 2PZBA 4UHDA 1C8VB 1G19A 4RY0A 1ZICA 1CYDA 3C87A 3I3OA 3KU4A 3WJ7A 5BY2A 1NZDA 3IAXA 4I9FA 5E9QA 6Q21A 5IFLA 1UIMA 2HV9A 3CJRA 3JR3A 2FPPB 3PL1A 5CJ2A 4BQIA 5FPKA 1OH6A 4XVRA 3PYLA 3TQFA 1PFUA 2OXEA 3A6DA 1ISMA 3G49A 3H87A 3ZHCA 3UM9A 4D25A 4WJZA 2AYXA 4LGYA 4DR3B 4F11A 4ARCA 3W6UA 4E2FA 4MVJG 3WLMA 4UXHA 1JU9A 3WYBA 2N1BA 4BFCA 2IDMA 3HMQA 4ZCQA 3TXYA 4RTLA 4OLAA 3TMAA 1EZ1A 4AFNA 2GPJA 5EUBA 3KLPX 1T2DA 1QQ6A 2C2HA 3QELA 1P1KA 3RYIB 4LA4A 4TMKA 2F1KA 1VE9A 5A3VA 1ULSA 3GVCA 1GRNA 5TDHA 4AD8A 1NXOA 4DZRA 1ZJJA 5I7UA 4HPXB 4ACBA 3P5SA 5B4VA 3SSMA 3DDSA 3U60B 3IKTA 2MHGA 2DUMA 1S3GA 1I4EB 1TK2A 1KH1A 1O0SA 2RMKA 4WXRA 3R7FA 1PZEA 5FO8B 2EDAA 1R8SA 1P7CA 2CMFA 2QTCA 1MQ8B 3UK1A 2HMYB 3U17A 1TFUA 1MDFA 2B20A 1E9CA 3EWAA 5L4LA 2G77B 5T64A 3AERB 1EG7A 2CFRA 2OZLB 2PQ6A 3FNBA 4DNFA 3DBLB 2BONA 2GBLC 1GCAA 3KOOA 3P0IA 2P2LA 1UFOA 3HWSA 5BWBA 4AYTA 3BWVA 4NBSA 5JPMB 2JLBA 2XYHA 5JJIA 2ZI7A 2DVMA 1WUYA 3HWX1 3D7KA 2BJVA 4CW7A 1N2ZA 5AHRA 2Q5CA 5KAPA 1L5MA 4R71A 4FSDA 1S01A 2PKEA 4FN5A 4IEEA 3CHYA 2FWBA 3GAMA 2JFPA 4NFHA 2BFAA 1CUDA 4OM8A 4RM2A 4XQCA 1YJ8A 3Q87B 3VHXA 4OQMA 2X9QA 1DKNA 1L5OA 1F2UA 1HSZA 1R5JA 4U7FA 1YDWA 2O52A 3PUVA 3CH4B 5CA0A 5KOJA 1EAYA 4JLPA 4RVUA 4BMPB 1E2JA 2AI2A 2I2DA 3IQWA 3CW2A 3O1LA 2BLLA 3SM9A 3FZEA 3T5PA 1IBRA 1P6XA 1UOPA 2EX0A 2FCRA 3D7MA 4ZOLF 3EXFA 4EARA 3VA7A 1MNQA 2XUJA 5MGBA 3EYWA 2YIVX 3H2JA 3NBQA 5IFKA 2VQ3A 3A1EA 4ZQGA 4INOA 2B4QA 1CNEA 3LYLA 3PCXA 2PV7A 5LM3A 2QVXX 3NG1A 1RYYA 2B7LA 3E2MA 4N7BA 4NCIA 4X8LA 3TIGA 2C83A 4WTOA 2SKEA 1P1BA 3FHOA 3ZCRA 5KSYA 2BH2A 3IEUA 4X1OA 4RY8A 1W1IA 3DZKA 4Q9IA 2JLYA 2IYVA 4YMHA 4JP5A 4RZXA 1OH5A 1A97A 4PFQA 4ETNA 1V8PA 3HZOA 2GPAA 1KMCA 2I87A 2I3DA 2OEPA 1P4HA 1XOIA 3PIRA 4JU8A 1L5LA 3WHIA 4NHOA 3O9ZA 1XMIA 4DB4A 4H4CA 1S2MA 3FSEA 1XDGA 3FH0A 2EEZA 5MN4A 1OWMA 5CIYA 4A6XA 3F9IA 1KU0A 3URMA 3K1TA 4ARUA 5IXJA 1I7NA 2O50A 2YY7A 2B9VA 1O5TA 4IQGA 1P7YA 4UCQA 5FLKA 4EO7A 2E4ZA 3EFHA 3LI2A 3WWEA 1WQ1R 3UCFA 4AUKA 4KREA 2Q3HA 4H59A 1G16A 1EDOA 2H0QA 3P2YA 3TOXA 3WKEA 1WX1A 4CHTA 3TLYA 3K20A 2Q6TA 2YRXA 3TPCA 3THWA 1EZZA 1FSZA 4OI0A 1P61B 2FN8A 1QKKA 1SC3A 3KEGA 3L9XA 3QFCA 4YIHA 1E1MA 3MJSA 4EGCB 4HAOA 4WX2B 4N3BA 4E3ZA 3KPJA 4G0OA 5GV7A 1IN7A 1E64A 4U8GA 3VH1A 5AQ1A 1J0AA 1G41A 3TBKA 3ZQJA 1NWCA 3LT5A 1JF8A 3RSGA 2OBFA 1L7PA 1BHSA 3TR5A 5C35A 2ZUEA 4MW5A 3G6KA 2BGRA 4PGFA 3IEPA 3VPFA 2NXJA 4L2IA 1B16A 4PO9A 3ZCVA 3U6BA 3IRVA 3ROZA 1BKYA 1LSSA 1KS2A 1T6BY 3CZ4A 4CMAA 3N2GA 1UF9A 3NHWA 2HOQA 5DYYA 5JOQA 3QBTA 2II6A 3PQ4A 3O1JC 4HDKA 5B1YA 4ANFA 2ZUDA 3CA8A 4RKWA 1QRAA 3OICA 2IIPA 2P6RA 3IUEA 4O2LA 3WWYA 4YT2A 1XDUA 1K63A 3D0KA 1U2PA 3BRSA 4WESA 3A6ZA 3RWBA 3WC4A 5FOVA 3AETB 5I7EA 4RZIA 5H9VA 3IAAA 3PVSA 2EW2A 3WE7A 2IHKA 1HH4A 3VR4A 3IDQA 2FQWA 3E05A 3PQ8A 4MPTA 4NBNA 4RYLA 4WASA 4N40A 4CMGA 3HDTA 1HKUA 3A1CA 1QFSA 5E3IA 4NE2A 4X85A 3N2KB 2BGIA 4DDWA 4J6FA 1CT9A 4QGHA 5GAJA 4X20B 5KQLA 2B39A 1Y4DE 3T38A 3FB4A 2VF4X 1BWSA 2W2PA 5C31A 2CV1A 1PAUA 4J4HA 5JCOA 3EAGA 3GJ0A 3GVIA 5CB4A 3LL7A 5CLQA 5THQA 3KX2A 1KSFX 2JFFA 3K0FA 3OQ1A 3H9QA 3T61A 5LOVA 4A9AA 1D2CA 3FG9A 4ZJUA 3THOA 2AEJA 4HRAA 2D1TA 4HY3A 4JNKA 3N2EA 4PANA 1JJVA 1YRQA 1X1QA 2PSEA 3L7CA 2O8FB 5JCJA 4UUPA 4TWBA 3IQGX 3F5QA 3BDIA 2AZXA 5FL7A 4C2AA 1FUEA 2HADA 2C59A 3T54A 3ADDA 5DP1A 1E1LA 3PFNA 5F2KA 3SC4A 4AF6A 2GBGA 3NBFA 2EKLA 1LRKA 2HCJB 1Y48E 3EA4A 4QM6A 4EQ6B 2BD0A 2JI6A 2LDXA 4UD2A 4BZPA 1E6UA 2PKCA 1V4VA 2ZAGA 1TJYA 1OXKB 1IJEA 3C98A 1Y6RA 3G7UA 3ODGA 5CLGA 1CR0A 1O77A 2A78A 4MRRA 4OMCA 1LX7A 1FRFS 3A4MA 3IURA 5L3QB 1KETA 4P7JA 2P9CA 1AKYA 1H1LB 5JPIA 2Z2JA 1CE8A 4NV3A 3QLVC 2MYUA 2ZREA 5C3MA 1O0BA 2DOKA 1DHRA 1TX4B 2VA9A 2VCEA 2RH5A 2ZVPX 4PN7A 3OPMA 1NKVA 3ZDDA 3L0OA 1XXHB 3H1TA 1Z2DA 4RVHA 1ZL0A 3NW9A 4WKOA 4EYSA 2NUPB 2A4KA 4I4LA 4BLUA 2YWRA 5L8VA 1FLDA 1XEWY 4QPJC 3UC5A 4CFZA 1FRVA 4WA8A 1NM5A 2G3YA 4MDYA 2IYFA 1N5DA 3OZEA 5K3CA 4YYZA 2BFFB 4R0VA 2ASVA 2ZB2A 3OU7A 4B5LA 4Z3OA 2FUCA 4F4HA 1US8A 3F4LA 3A3NA 4KV7A 2VP3A 1C14A 2R00C 2JRCA 3BSWA 4RUKA 3HNPA 3W6NA 5MDHA 1E2GA 1M3SA 3U19A 2ZJAA 1CQXA 3AVQA 1E7SA 1WZUA 3ND8A 5IKXA 4ZVNA 5EPUA 1SBYA 2G9VA 2HK6A 3EAQA 5K05A 4I36A 2JI8A 3OHXB 1KZ4A 4AW9A 1I3NA 2P0EA 2GZ2A 4Y6OA 3CRMA 1PR5A 3UKDA 2HHCA 2PGOA 5T5QA 1HEYA 3ZY3A 2VJLA 4LTDA 1N9GB 2CXOA 3E0XA 4FGUA 4CDNA 1Z47A 4UULA 1OLUB 4ISCA 3L4JA 2WU0A 2I65A 2AFHA 4DRXB 5K6AA 1WHSB 2VYFA 1G6KA 4G1FA 3AB8A 3DE0X 1RAGA 3FYSA 4KPUB 3KFXA 3RM3A 2C4UA 3EDOA 2XUPA 4O4JB 2FSVC 1Y9EA 4AKIA 2YVQA 3LC7O 4QJ5A 3IAHA 5LZ8A 2AUNA 2NW6A 5ALNA 3ZK8A 4KX3A 3SK0A 1C3EA 2C8VA 3IPCA 4LJYA 2DRIA 2JJ2A 2DUWA 1NW7A 4E31A 5LIRA 3M7IA 4KXYA 4W5RA 3K73O 3HR8A 1JVDA 4ZGWA 3GLIA 2R6CA 3PC8C 3QKIA 1J2JA 3GLHE 1J9ZA 3IOMA 2YY6A 1MLDA 1TT5B 3RIHA 2B1JA 2FZVA 1M1NA 2ZS9A 4HXFB 4DLXA 4BO6A 5D6NA 4CMEA 2UXCB 1XTIA 3CU7A 4FLFA 1LPBB 1MO5A 1IVSA 5B1HA 4JQYA 1UPXA 3KAQA 5AM3A 1OVGA 1JDBC 2XCUA 3ID6C 3NQ41 3MOIA 3ZG6A 4OU4A 2MMGA 3CH7A 3DPUA 5E4FA 4Q9KA 3PGKA 1PKXA 5F78A 5L9AA 3LLCA 1QYXA 2W6JD 5COQA 4O2AF 1NFFA 3EIFA 2ADFA 2GESA 1OASA 4B45A 3ZDCA 2XXAA 1ZMTA 3QLJA 5J59A 5L95A 4E03A 5CBPB 2R96A 3CNLA 3UB4A 4NMLA 4LY3A 4C0XA 1DC6A 1ZD5A 3F74A 3FPLA 4C4OA 5JNWA 3K9FC 1V96A 3T5BA 4Z54A 1HL3A 4UCFA 5DB4A 3NGXA 3I01M 2V55B 2FSSA 2GJ4A 3AR8A 3FLMA 4HX5A 5KQRA 2E4AA 3O8LA 1NPTO 4U7GA 2K7ZA 1G17A 3C14C 3G2NA 4C76A 3OEYA 5EWMA 4JI8B 5JMOA 1UDWA 2EFJA 4OYRA 5FIUA 1ZK4A 2NO4A 3W9UA 5EWJB 4RDXA 2AMLA 3QJYA 3OZVA 4YI3A 1M1UA 4QUJA 2NZXA 1RFLA 2P90A 1EK5A 4YMWA 4QUBA 1BRMA 2I2FA 3ITEA 4EI9A 4ERXA 3H2IA 2WWYA 2G5PA 4QUHA 3IV9A 2X7JA 2P9BA 1K88A 3K0AB 4WPGA 3T95A 3SHFA 2PUHA 3I37X 5EVCA 4OXRA 3IFSA 2P40A 2HHAA 3CZPA 2HRZA 3JQ8B 4JJKA 3NIGB 4J3JA 4D99A 4CGZA 2QTVB 4AX8A 1Y3BE 4ZFNA 4MVXA 1ZCZA 2I3BA 4XCQA 2IYPA 4O1IA 1HFJA 3I3SR 3P9CA 3T35A 4A0FA 3COPA 4BQOA 3GCXA 4NMWA 4JJGA 3VNAA 2FLWA 2ASEA 1NVFA 2QAGC 3EK2A 3PCTA 4FYMA 4HPJB 4NYMQ 4OHFA 1KK0A 2JD2A 2NYRA 1F17A 3GFSA 4UHBA 3SX4A 3A14A 3GNSA 1QYRA 3MINA 2ZUCA 3QH4A 2XCQA 3WIVA 5T6MA 2GZMA 4CQMD 4E12A 4HXEB 3A1NA 1W5EA 2E3JA 5CBKA 3STXA 3GFFA 5EOVA 1YCDA 4Q5IA 1G20E 4PG7A 3PWKA 1ADCA 4Y9RA 3LF1A 4NEQA 5CT5A 1NVUQ 2E0IA 3D4PA 4ID3A 4OUKX 5DCWA 3W6PA 4WKBA 3V7NA 5HRUA 1Z34A 4ZQHA 3WFZA 4DT1B 3ZIDA 1MPXA 4W7IA 3WL3A 3L4BA 5KHLB 1JR4A 3QNMA 4H0FA 2PQMA 4D4GA 3DDWA 3BEDA 4WXMA 4B76A 4M4SA 3ML1A 4JNCA 5AICA 3OQBA 1DADA 4E1BA 5D7NA 2IF0A 5TT1A 1ZMBA 3IQEA 4IKOA 5BNZA 4KQGA 2JLRA 3QE4A 3GLSA 3EGCA 3MCWA 1HFKA 2Y0BA 1O94A 1ECPA 3QW4B 2YHAA 1JIQA 3L7JA 3OM0A 3OUUA 5IK2A 3VUEA 1GZSA 3H2KA 1DCKA 2VWGA 2W2TA 3I9V6 1K0UA 1P5JA 5KVAA 3T7EA 1JJFA 3B60A 4OGLA 1ZGCA 1OI4A 4DKXA 1ISIA 4OK5A 5AVYA 2G08A 5KYWB 4GSKA 4HCJA 1NF9A 3DFMA 4F9FA 5IKEA 3I45A 2D2FA 2QRNA 3V9PA 1TPYA 1U9IA 2H2DA 1Y8QA 1P3Y1 4R6WA 5FOSA 3KVYA 1UJ4A 1J2UA 4OHRA 3A04A 4HRXA 2PMFA 1UEIA 3HEMA 4RD4A 2P6NA 1QIIA 3IMCA 4C7XA 3P4UA 4KDFA 1KJJA 1YRHA 3MC1A 1N0VC 1R8XA 1UKVY 4K28A 3T3HA 1PWEA 1U2DA 2Q1YA 3OT4A 4URHA 1XTKA 2QPAA 1PR9A 4Q15A 3ECSA 2X3UA 4M37A 4BO4A 2RGCA 2V4UA 2ZJZA 4MYUA 1K86A 2O7VA 4PRZA 3TSZA 4YPVA 3TDMA 1QX3A 3GRFA 1X7GA 2ORIA 2XWQA 1L5VA 2OXTA 3UHFA 3GB9A 4FR2A 5KTRA 1OZGA 1AK1A 2J1LA 5JJ5A 2HA0A 1ZH8A 4L08A 1K97A 1E7QA 4NCNA 4TS4A 3YASA 2CBZA 1H1DA 5JQWA 1IC6A 4G4IA 2J5BA 4KQ6A 3VGPA 4Q03A 1XCBA 2VJAA 3ZTWA 1NBHA 4Z3DA 5KMGB 2P77A 4UNSA 3WLHA 1KTIA 3L40A 3O8BA 4GPAA 2YFHA 2QTHA 3ZOKA 4C3OB 2O1WA 3N7AA 4Q3AA 3OI7A 5TEVA 1GPLA 3M81A 4DS3A 4EG3A 3B7PA 3I34X 1KDPA 2ZW9A 1MW9X 1R8YA 3DE3X 4TMTA 1AVTA 4WKCA 4A8HA 3N05A 5BR4A 1ZAYA 1J7JA 2QT0A 1N77A 1BGXT 1B6TA 4IDQA 1BVYF 4JAVC 3UK6A 1DHTA 3TTVA 2O8EB 1SVKA 2CL0X 3IP8A 4P8RA 3BA1A 3D6VA 4ER0A 4PGMA 4FT4A 2IHJA 3UPUA 2I66A 2Z43A 3OQIA 3W3AH 1Q74A 1RBQA 1U1GA 1HNWB 4JLMA 2EJVA 1RW4A 1YH3A 2XD9A 1Q50A 2ZJBA 4L9AA 3PFCA 4UTNA 4H3VA 3K4PA 5FJJA 3C3EA 4XWYA 2BSQA 1JB9A 3QBEA 4TUYB 2J33A 4UBNA 4D4HA 1UKZA 4PSAA 2J6IA 1VJRA 4X71A 1FU7A 1U1EA 3MTBA 1XNRB 3DBRB 1FNCA 1TF7A 3BDVA 3N86A 5H59A 3WG9A 4BLWA 3SZMA 3MWYW 1BA3A 4ZQIA 4B6OA 5L4SA 2VP0A 1XZGA 3JYLA 4IJUA 3WWDA 3D6HA 4UNIA 5I9NA 3D4BA 2W6IA 1QPZA 4TZTA 2XIQA 4UKDA 3I9V1 2OCLA 4Q01A 1HTBA 3G3EA 2J5XA 4MW1A 1C9NA 2H54A 1U2ZA 4KC0A 2AV6A 1VYTA 2IXDA 4C4PA 5BSWA 2QL9A 2GLXA 4ZC1A 4BRWA 3TIFA 3UMRA 3SM3A 1ZXLA 3AP3A 4OI2A 4A8PA 3NJ4A 3GC6A 4BFUA 5B4TA 4KI0A 4BBAA 3O8DA 2YS7A 3WO0A 1EK6A 1ECGA 1L5HB 2PJZA 1MW8X 2GOYA 4P86A 3HB0A 4L5AA 2NNLD 1BXRB 4F0JA 5KKCA 1OFIA 2FWIA 4K0KB 2Z3WA 3RSLA 1VMEA 2QN1A 1RZRD 5JDCA 1WXXA 1A4XA 1Y5MA 3UVEA 2QP3A 3LHFA 4MV7A 4OSEA 3MT8A 4FFRA 4JVMA 4TS1A 5DASA 2Z9DA 1WY7A 2ZS7A 2X1LA 3OIUA 3VU9A 4FC6A 2FRDA 1ZA1A 2WHRA 3CKLA 4FMPA 1DEXA 4NG4A 1DAGA 1XUOA 3TRHA 3W4KA 2G4VA 4KPYA 3MAJA 1CVIA 2YWGA 2GN2A 3H11A 2AMFA 4QVGA 2QQ5A 2ZPUA 4YMUA 4D26A 3L0CA 4I4TB 1Z5PA 4XX0A 3JD4A 2RI6A 2SCUB 2G9ZA 4PYLA 1SBZA 3I2YX 2VJMB 1GWNA 1EFDN 5H80A 4DJJA 5EE0A 1A82A 1CVRA 1SXJE 2HRBA 1Z5VA 5BNIA 2ZJYA 3IPYA 4I5EA 3ZDRA 1BE8A 5K8VA 3QVWA 3P2KA 1CIVA 4L8VA 3KB8A 4P5DA 2V5VA 3PVCA 3S7ZA 1UBKS 2XMRA 2PN1A 1PRYA 2I2AA 1L4FA 2GEDA 1RYFA 2WNIA 4HVCA 2AJTA 5IUNC 4RJTA 3BXPA 4LX8A 1JFLA 1RJGA 4ZHQF 1ZCAA 3OLYA 5A4MS 8AT1A 1PZNA 3QNUA 3JWJA 4CTMA 2C5FA 2OAQ1 4B2LA 3RHZA 1EK0A 1Y34E 2RC5A 3CMMA 4W9MC 5J23A 1SXJA 1I2MA 1EVZA 1K2WA 1N2SA 1QUFA 3GP8A 3MGBA 2VEOA 3KXIA 1TRHA 2OO5A 3L7IA 3RG2A 4YB8A 1Z73A 4HFNA 4CMIA 4LE2A 5F64A 1EVEA 2OCKA 2PRJA 3S8MA 5IANA 3Q3JB 5KNCA 5FBVB 2YYSA 3BD8A 5I9TA 4D5GA 3AKDA 3HFGA 3D0RA 1WW2A 3Q7IA 2I9PA 5GVRA 3KQNA 1EM8B 2FPPA 1ZUNB 1S96A 4UQPA 3W9BA 2EZ8A 4X6XA 4BFTA 4B80A 3UMVA 2JAXA 4ZJZA 5LD2C 4HXYA 1O58A 4OB8A 4RKEA 4U3JB 4JL8A 2YFYA 1HEIA 3BSYA 1XF9A 3B36A 1W93A 2NTVA 3PL5A 5ALEA 5LQUA 3IGFA 3HBMA 3LUHA 1E2EA 2BZSA 3OOEA 4IH4A 5A3SA 3VR5A 2WB2A 4KFSA 1KZ6A 4KEAA 1YQWA 5IC6A 5C8YF 3S2SA 2CUKA 4HT3B 1WMDA 2IHYA 3MD0A 3QK7A 4XARA 2X9VA 1XJQA 5KYYA 4H6XA 1JR6A 2WSBA 3NM5A 2QRJA 3WK6A 3ZWYA 1U0OC 1JLSA 1NBOA 5FQNA 4KQ2A 4OAOA 2RAPA 3ZDXB 4QRHA 2UZ0A 3KXLA 5EQDA 3PQ6A 1A96A 1TTHA 4CR8A 1Y3CE 3BTUA 2VAWA 4I1VA 3ZQ4A 3VBCA 1XHLA 1IRIA 2JKVA 1JHZA 4HDOB 2C9YA 3NAGA 3MRXA 3NVAA 4KE6A 4UUMA 1LF5A 3R7WA 3WLEA 2WQZA 4D81A 1R4NA 3IYLW 2IV7A 1PGJA 1XQWA 3AFIA 3MTGA 4PM4A 1SHJA 2DR0A 2IQ5A 3DWFA 4QDKA 3NYIA 1I0IA 3B70A 4ZT7A 2GWHA 3TLKA 4HQ0A 1M6EX 4QFDA 2PRIA 4LYAA 4D02A 3LO5A 3DUFA 1GTJ1 1M1NB 2ZP1A 1XRJA 3D3QA 3DG9A 5B1IA 4A0SA 1SR8A 5EIXA 3X3HA 2WIBA 1VSVA 2WWHA 2LIVA 2PZMA 2ZBPA 4ZAZA 5BOSA 1YBFA 4PC1A 1SXJC 4CEJA 1ZIOA 4ESVA 1BQ3A 1XU4A 4Y2PA 1CERA 2Y0PA 2IL1A 3KVVA 3WGVA 5ALHA 3BJRA 1J5XA 4LDPA 3ZD9A 2B2XA 4CKBB 1JSXA 1D6JA 1VOTA 4Z7OB 2UZ3A 1AS0A 4MWTA 5JV5A 1B2RA 2WJIA 2YH2A 3V1TC 2HQ1A 1IXSB 4US1R 1XZ8A 1UXHA 4WNAA 1EPUA 5KI6A 1IJFA 2EX1A 4XLTA 3EY4A 5TLSA 2CXTA 2HJRA 3N76A 2CXQA 1NKTA 3IMFA 5AW6A 1E6CA 2FPSA 1O1YA 1Y89A 1DC3A 4TS3A 4HNVA 1A2KC 2OK7A 1OBCA 1MABB 5FO0A 2PYDA 3L8EA 4L72A 1FDIA 1A9OA 1EK2A 4DUZB 4DR5B 3VVMA 1KF0A 2QBYA 1AF7A 2V7UA 5DLEA 3OSUA 4U6QA 1C81A 2M1XA 2PWPA 1XCGB 3QGMA 1EJ2A 4HSGA 5FT9A 3RJTA 1KJZA 2DFLA 3O8QA 1PT8A 4BMZA 4BP3A 1X0XA 3BF8A 2JB9A 4BTVA 1NIPA 3MN1A 4ZJPA 2QIPA 4HI0E 3V2UA 3WYEA 5IHXA 5EJ9A 4LHEA 4OHCA 1JZSA 4S1OA 3DMGA 3SZGA 4FFDA 5CXSA 3Q7QA 3H9EO 1BXGB 5KTNA 2F9FA 2JAWA 4LZJA 4OFZA 5EJ8A 4MCIA 3PHGA 3PSHA 3RK0A 5JNRA 2Q5OA 1V25A 1BD3A 1U3UA 1D2AA 4M38A 1O5OA 4AXXA 3QX3A 3KTFA 1Q1NA 1DOZA 5ECYA 4CMBA 4N3CA 1AGXA 1CSEE 1G2PA 1UBLS 3A25A 3B9BA 1YI0A