The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
69
|
sequence length |
250
|
structure length |
245
|
Chain Sequence |
MKICLIDETGAGDGALSVLAARWGLEHDEDNLMALVLTPEHLELRKRDEPKLGGIFVDFVGGAMAHRRKFGGGRGEAVAKAVGIKGDYLPDVVDATAGLGRDAFVLASVGCRVRMLERNPVVAALLDDGLARGYADAEIGGWLQERLQLIHASSLTALTDITPRPQVVYLDPMFPHKQKKEMRVFQSLVGPDLDADGLLEPARLLATKRVVVKRPDYAPPLANVATPNAVVTKGHRFDIYAGTPV
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Crystal Structure of UPF0341 Protein (yhiQ) from Shigella flexneri in complex with S-Adenosyl Homocysteine, Northeast Structural Genomics Target SfR275
rcsb |
molecule tags |
Structural genomics, unknown function
|
source organism |
Shigella flexneri 2a
|
molecule keywords |
UPF0341 protein yhiQ
|
total genus |
69
|
structure length |
245
|
sequence length |
250
|
ec nomenclature |
ec
2.1.1.242: 16S rRNA (guanine(1516)-N(2))-methyltransferase. |
pdb deposition date | 2007-02-22 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF04445 | SAM_MT | Putative SAM-dependent methyltransferase |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | 3-Layer(aba) Sandwich | Rossmann fold | Vaccinia Virus protein VP39 | ||
Alpha Beta | 3-Layer(aba) Sandwich | S-adenosyl-L-methionine-dependent methyltransferases | YhiQ-like domain |