2OYRA

Crystal structure of upf0341 protein (yhiq) from shigella flexneri in complex with s-adenosyl homocysteine, northeast structural genomics target sfr275
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
250
structure length
245
Chain Sequence
MKICLIDETGAGDGALSVLAARWGLEHDEDNLMALVLTPEHLELRKRDEPKLGGIFVDFVGGAMAHRRKFGGGRGEAVAKAVGIKGDYLPDVVDATAGLGRDAFVLASVGCRVRMLERNPVVAALLDDGLARGYADAEIGGWLQERLQLIHASSLTALTDITPRPQVVYLDPMFPHKQKKEMRVFQSLVGPDLDADGLLEPARLLATKRVVVKRPDYAPPLANVATPNAVVTKGHRFDIYAGTPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of UPF0341 Protein (yhiQ) from Shigella flexneri in complex with S-Adenosyl Homocysteine, Northeast Structural Genomics Target SfR275
rcsb
source organism Shigella flexneri 2a
molecule tags Structural genomics, unknown function
molecule keywords UPF0341 protein yhiQ
total genus 69
structure length 245
sequence length 250
ec nomenclature ec 2.1.1.242: 16S rRNA (guanine(1516)-N(2))-methyltransferase.
pdb deposition date 2007-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04445 SAM_MT Putative SAM-dependent methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2oyrA02
3.40.1630.10 Alpha Beta 3-Layer(aba) Sandwich S-adenosyl-L-methionine-dependent methyltransferases YhiQ-like domain 2oyrA01
3B89A 3GXOA 3PX2A 3UJ6A 2AOVA 2AN3A 3R6TA 4PONA 3M6VA 5HOQA 1DCTA 8MHTA 4GC9A 3C6KA 2FHPA 5DTQA 1BKYA 2OZVA 4E2WA 5GWXA 3OZSA 4PYKA 5FULA 1VE3A 3EMBA 3Q87B 1NW3A 2P3QA 1AQIA 4KWCA 3G7UA 3UWPA 1KPIA 3GWZA 4FSXA 4E2ZA 4GBED 3T7RA 3UFBA 2AR0A 1UIRA 3FPFA 3CBGA 5LQCA 2UYCA 2ZCJA 5F2KA 4OX9Y 1VQ1A 1L1EA 3G2QA 3FTDA 4AUKA 1BHJA 3R0QA 1NV8A 5DSTA 1XDZA 3DLCA 5E1OA 4RTKA 3P9NA 5K0CA 2O06A 2BM9A 1I9GA 1BOOA 2R6ZA 4PGHA 1Q0TA 4BP1A 3E8SA 3ID6C 2G8NA 5LQKA 1QAMA 3DMFA 1NW6A 4E2YA 2IDKA 3FPHA 5K0FA 3E23A 2H1RA 2AZTA 1O9HA 2HWKA 2IIPA 9MHTA 1D2CA 1X1AA 2ZSUA 1VL5A 3MAGA 2B2CA 3EGIA 1XVAA 1D2HA 2NP7A 5CD1A 4RVGA 4MTLA 1M6EX 3NDJA 5DX8A 2HNKA 5EG5A 5KQRA 3BWMA 2C7RA 3BWBA 4U7TB 1RJGA 4RTJA 2PT9A 3QOWA 1EJ6A 2AOUB 3KPUA 3P9KA 3PT9A 1XCJA 3RODA 4RVHA 2CMHA 3DR5A 3LCCA 4O29A 4DZRA 2PX4A 4P7JA 2OYRA 3F4KA 3TRKA 3DUWA 3PX3A 4A6DA 1KYZA 1SUSA 4OBXA 4RTPA 2UZ4A 4FP9A 3ELWA 1JSXA 3DXXA 3VC2A 3BGIA 5E1BA 5JR3A 2NNWB 3NVMB 5DLYA 4FS8A 3UJBA 1JSZA 1DUSA 3ELUA 4E70A 3G2PA 5E9QA 3TFWA 4NECA 2GPYA 4F84A 5LR6A 3CJRA 3DH0A 3GRYA 1INLA 1BC5A 1F3LA 3KHKA 2P7IA 3LCUA 4ER6A 4AZSA 4KVZA 4H0NA 1EG2A 5IH3A 2IDJA 4OA5A 2VDWA 5ICCA 1R74A 4DA4A 4QQKA 3HEMA 5EGSA 1SVUA 3KQVA 4Y2HA 5GINE 5DRYA 5ICFA 5MHTA 5CVEA 3TM5A 2QM3A 1N7JA 3FRHA 4AZVA 4BLWA 1WY7A 2IGTA 5FADA 1WZNA 2PKWA 3LDGA 4FZVA 2OB1A 1YB2A 4C4AA 3TQSA 3M6WA 1NBHA 4HH4A 1JQEA 4IV8A 2YR0A 5K0BA 3R9XB 2XVMA 1JTEA 3NVKI 2JJQA 5E2AA 3I53A 3S68A 3KQWA 3M6UA 3PTAA 1UFKA 3KQYA 1VP9A 3OU6A 4RX1A 4WVLA 5IKMA 3G8BA 5KYGA 2VDVE 3B5IA 3D2LA 3FRIA 3BGDA 2BR5A 2AOWA 2JHCA 5EMJA 3HCAA 3SSOA 5GIOE 1XXLA 1H1DA 1YZ3A 4GOOD 3IV6A 5KQSA 4XCXA 1ZKDA 3GO4A 1NW5A 2E5WA 4XUDA 5EIFA 1NE2A 1VP3A 3FZGA 3HCFA 3HP7A 5B1SA 4OA8A 3GRVA 2FYTA 5D1HA 2BR4A 2FCAA 4FSDA 5EKXA 4GOMD 3IHTA 3QOXA 3A27A 3B3FA 5T67A 4C04A 4ER3A 3MTIA 2G70A 4IKPA 1RI3A 2ZBPA 1L3IA 2AOUA 3BUSA 3O4FA 4IWNA 3ELYA 4PCAA 3BXOA 4CWAA 5DWQA 2B3TA 1XDUA 1P91A 3FUVA 5HEKA 2I9KA 1WG8A 1RI5A 5D1NA 1I1NA 4B17A 3UJAA 4QTTB 3GCZA 5EHGA 1IXKA 2GB4A 4LECA 5K0LA 1PRYA 3B3JA 3UZUA 4KIFA 5LSAA 3OE5A 3HNRA 1M0EA 5F2OA 1SG9A 2JHAA 4P7KA 4R6XA 4ZTBA 3EGVA 4CXMA 2ONZA 1NBIA 5JUWA 1EQAA 5FQOA 2UYHA 3THRA 4PYNA 5DRTA 3DMGA 2AVNA 2EFJA 1R18A 4ER5A 3MHTA 5DTRA 1OR8A 3EVFA 3KQMA 4XUEA 4DM3A 2VP3A 1QAQA 4RVDA 4RV9A 4MWZA 3NW9A 3G5TA 3I9FA 2AN5A 2PV0A 3GRZA 5LQAA 2UYQA 4V0QA 2IH2A 1IM8A 5BXYA 2G1PA 1NT2A 1ORIA 2CKDA 2O57A 1O9GA 2PBFA 2ZULA 3FUXA 2VZ9A 4HSGA 4YUXA 5CUQA 5DPMA 3DULA 3HCDA 3OU7A 2R3SA 3PFHA 4U7PB 5CM2Z 5C1IA 4KDRA 3SVZA 2XYVA 3P97A 4M38A 5DM0A 4G56A 2H00A 4C06A 4GOLD 4CKCA 2NP6A 3KQOA 2IPXA 4YUYA 1L3CA 2G71A 3NWEA 4YMGA 5LQNA 2Q41A 5HZMA 4MHTA 5EKUA 5C0OE 5DM4A 3KPWA 1O54A 5K0JA 1Z3CA 4RSRA 3M4XA 5E8RA 5FTWA 4PGGA 3OZRA 4CKEA 4RTLA 3LKZA 3C6MA 4R8SA 2GS9A 3KQQA 3EEYA 3T7TA 2C7PA 1N2XA 4GC5A 3RW9A 3KR9A 1ZQ9A 5EMLA 4M37A 4HC4A 5ICEA 3TKAA 5K05A 2I7CA 2XBMA 5U4XA 2HTEA 2QRVA 2ZZNA 1YFLA 4BLVA 5DXJA 3RIEA 3EPPA 4QDJA 3UBTA 2NXNA 5M5BA 4M7RA 3MQ2A 1TW2A 1VIDA 3G8AA 5HILA 2ZFUA 4E32A 5DX0A 4EVIA 4YV1A 4RTSA 3O31A 5GM2A 1SQFA 2PXAA 2ZWVA 10MHA 4V0RA 5HFJA 2AN4A 1WXXA 2PXCA 4KDCA 1P1CA 3CC8A 2PSSA 5E8JA 4PYMA 5K0EA 2P41A 1MHTA 2IH4A 3P2EA 2PLWA 1ORHA 4Y30A 1FJXA 3G89A 1ZGJA 5EHIA 2OY0A 3KU1A 3E7PA 4YUVA 1JG2A 4FT4A 3LDFA 1HNNA 3IEIA 5CIYA 1L3BA 1RI2A 4GQBA 3BWYA 5E9WA 5EIWA 4A6EA 3IYLW 2HR1A 5BP7A 3A7DA 2IBSA 1KXZA 2ZBQA 5DX1A 2C7QA 1YUBA 5K09A 2V7EA 5T6BA 2ADMA 2JH9A 3BGVA 3SGLA 3M6XA 5F2NA 3OU2A 2PJDA 2YVLA 5GP1A 1XDSA 3DOUA 3FPGA 3PS9A 4BP3A 4QPPA 3UJCA 4MIKA 3SXJA 1VLMA 2H11A 4F86A 1IY9A 3JWHA 3HVIA 5CVDA 4CTJA 4EKGA 4RTRA 3BT7A 5DM2A 1R00A 2OO3A 3OE4A 4EQZA 5K0GA 4R6WA 2YQZA 3HVKA 5K0NA 5GIPE 1SUIA 3HA3A 1R8YA 5EPEA 4PWYA 4BY9E 2IP2A 3TMAA 2ERCA 4E30A 2O07A 2EX4A 5K01A 2O0LA 3P2KA 4BLUA 2EJUA 4RVFA 3UJDA 2P8JA 3OZTA 1NKVA 3C0KA 3EVCA 5HIJA 1D2GA 3HA7A 3LX6A 2PX2A 2N47A 2Z6UA 2YX1A 3FYDA 4YMHA 3KQTA 3KPJA 2IBTA 3LECA 3UJ7A 2K4MA 3UA4A 2ZIEA 5FUBA 2P7HA 2I6GA 5E1DA 2UYOA 4X41A 3TKYA 4AX8A 4E31A 1KR5A 2ZIGA 3DXYA 5EVJA 3UA3A 4C03A 2IH5A 2P3OA 1TW3A 5HIMA 1X19A 2QYOA 2B78A 2PY6A 2Z6AA 4RTMA 1WXWA 2BZGA 2I62A 3A7EA 3HA5A 1FPQA 3K6RA 2YUIA 1JG4A 2FPOA 4P7GA 3SSNA 3OCJA 4PYLA 3V8VA 3GNLA 1DL5A 3HVJA 4L7VA 5E2BA 4DF3A 2ZWAA 5K03A 3T7SA 1Y8CA 1X1DA 4PYQA 1RJFA 5HIKA 2PT6A 3ER8A 1UWVA 3DXZA 1FBNA 1G8SA 4DKJA 3T0IA 5FA5A 3HVHA 3LDUA 3MB5A 1R8XA 2OPBA 4HRAA 4HTFB 4X63A 5CVUA 1G8AA 3DMHA 5FA8A 1VBFA 2CL5A 4GOND 4PNEA 2ZBRA 1T43A 4QVGA 2P1DA 5CVVA 2BR3A 1G6Q1 3LL7A 3OPNA 5ICGA 3GRUA 4E2XA 3EVDA 1M6YA 5LQRA 4AZWA 1SKMA 1P1BA 3LCVB 1WS6A 3BKXA 3R24A 4X1OA 4P58A 2EJTA 2ZVJA 3A4TA 3FUUA 1JQ3A 2LD4A 2WA1A 2YXLA 2ONYA 3JWGA 2YXEA 3SM3A 2PXXA 2AOTA 4FGZA 3H2BA 4X60A 2Y1XA 3LSTA 4GEKA 3V97A 5BW5A 2HMYB 3EGEA 3NWBA 3FPJA 2GLUA 4AZTA 1AV6A 3FTFA 3EVZA 4YV0A 3O7WA 4LWPA 3LPMA 3A26A 4RWZA 1MJFA 4JXJA 5E1MA 3M70A 1RI4A 5FWDA 3SX0A 4WXHA 2HV9A 4E33A 4C08A 3ER9A 5EZSA 3CKKA 3JWIA 2ZIFA 1AF7A 2Y1WA 3KR1A 3NTVA 4IV0A 1L9KA 4XUCA 2IFTA 5DT2A 5EZQA 5T64A 4RTNA 3DLIA 3SMQA 3GRRA 3PLAE 3HCCA 3HCEA 3BKWA 1QYRA 3E05A 2KW5A 5GOZA 3FYCA 3TOSA 1EAMA 1TPYA 2ZZMA 3CJTA 5LQUA 3LBYA 5FWAA 1PJZA 1ZHFA 2CWWA 1R6AA 5HIIA 5CCBA 3I64A 4PYOA 2ORED 1NW7A 4UOEA 3HM2A 4CTKA 3EMDA 3AWIA 4EK9A 4RTOA 4DQ0A 1FP2A 5EEHA 4DMGA 2ZLBA 4PINA 2B9EA 2BM8A 4QPNA 5DM1A 3NMUF 2WK1A 1V39A 2VS1A 3TR6A 1KHHA 1N7IA 4PCLA 3HTXA 3ANXA 1YFJA 2OXTA 3OFKA 3GIWA 3AXTA 5E9JA 3KPYA 4PIPA 5G02A 5CCXA 1KPGA 2AS0A 3I58A 3R3HA 4QDKA 3UJ8A 4YV2A 3M33A 4CKBA 3ELDA 5C9ZA 2EG5A 5LQJA 3MTEA 1KPHA 1RJDA 2FK8A 2GA9A 3ME5A 4ER7A 5K8VA 1XTPA 3FTCA 3K0BA 4MQ4A 2C7OA 3Q7EA 4GF5A 3G2OA 5FCDA 2Z6QA 4R05A 3LBFA 5EEGA 1X1BA 2PGXA 2YTZA 3FUWA 1YF3A 1ZG3A 3X0DA 4HGZA 4YUWA 2OBFA 3AJDA 3VSEA 3PFGA 3EVGA 3B7PA 4QVKA 5EC8A 3ERCA 2PWYA 1YZHA 3KR0A 4RTQA 2NXCA 2XYRA 2QRVB 4QTUB 3G88A 3KQPA 4P7FA 4GUAA 3P2IA 4POOA 2OB2A 4QQNA 2NXEA 2YXDA 3GGDA 4K6MA 2VDUE 3VC1A 1SQGA 3VYWA 1G38A 3DP7A 3PB3A 2JG3A 4LWOA 1X1CA 1KP9A 3THSA 4HTFA 3LHDA 1KYWA 2GH1A 3CGGA 3GJYA 5DXAA 5BW4A 4KRGA 2A14A 2DULA 1U2ZA 1NW8A 2FK7A 1FP1D 2QE6A 2OKCA 3NJRA 4FR0A 4C07A 3TM4A 3MERA 5P8WA 3HCBA 4RYLA 1B42A 2F8LA 2WA2A 2XYQA 5H02A 2PWPA 1G55A 2G72A 4EMSA 3P8ZA 1I4WA 1NV9A 4ER0A 3G5LA 2ZTHA 1KIAA 1JR4A 1Q0SA 1JQDA 3KKZA 5KVAA 2DPMA 4C05A 1AQJA 5EQJB 3ORHA 1QANA 1QZZA 2CMGA 3I5UA 3CVOA 3KR2A 3JWJA 2PX5A 5GM1A 2V74B 3C3PA 1QAOA 3KQSA 2AOXA 1HMYA 3A25A 3SSMA 2P35A 2XVAA 3NDIA 3REOA 3LGAA 4Z2YA 3B3GA 4OBWA 3BWCA 5CVJA 4HG2A 4EKIA 4FT2A 1P39A 3BZBA 3DTNA 2PX8A 3MGGA 2P40A 4PIMA 3SR4A 1ZGAA 3P71T 2AVDA 4YUZA 3QV2A 1XJ5A 2JH8A 4OQEA 5ERGB 1RI1A 3P9CA 5DTMA 3MCZA 4DCGA 3CCFA 3GDHA 3FUTA 1VPTA 5FHQA 3TLJA 2GAFA 1EIZA 2ZW9A 5KS2A 1JG1A 2P3LA 4F85A 2JHPA 4LG1A 5EMKA 4R8RA 2ZZKA 3U81A 4ISCA 3P9IA 1RJEA 2B25A 1JG3A 2NXJA 5DSXA 2AOTB 2O05A 3CJQA 2FRXA 3EVEA 2QY6A 3EVBA 4PYJA 2ESRA 2NYUA 4PYIA 3WSTA 4ATNA 4KIGA 5EOVA 3LKDA 7MHTA 5FHRA 3TPZA 4OQDA 3PVCA 4DCMA 1XCLA 3UJ9A 3KPVA 5EMMA 4HGYA 3GU3A 1JTFA 3FTEA 3C3YA 3L8DA 1EJ0A 4M36A 4X61A 2BH2A 3G2MA 3EEOA 5FQNA 1G60A 1F38A 2PVCA 3MCTA 3AXSA 3FPEA 3AY0A 3EVAA 4KW7A 3OFJA
chains in the Genus database with same CATH superfamily
2W6QA 5LIRA 2XBLA 4X8LA 3LWDA 4FFDA 1T2NA 3FFWA 5JAIA 2FHPA 2PA3A 4JB0A 3I0MA 3K5IA 3LUPA 5G0VA 3UG6A 1MXFA 1RAFA 4H4CA 2CBZA 4YQEA 3ZV6A 5G1NA 4BQPA 1L7AA 1NW3A 1O1YA 2GT1A 4FDVA 2DH5A 2VHVA 4TL9A 3RWBA 3UWPA 2Z2YA 4FSXA 4LY3A 3WKAA 1EX9A 2C4TA 1UIRA 3FPFA 4QUJA 4D9KA 3ENVA 3CBGA 1QP0A 3RC8A 4Y8VA 4YLGA 2HEIA 4NMXB 4B3RB 5BR8B 1HXHA 3CXRA 4O0MA 1H4TA 1ODFA 1NV8A 4YP5A 1E1DA 3GB9A 4BWVA 2ZYVX 2PZJA 4B8ZA 5CBPA 3EMVA 3WLHA 3BIOA 4MWCA 3SX2A 4OO3A 1ULSA 1I9GA 1RXCA 4DKXA 2PZGA 2O8EB 4TRRA 3E8SA 2V8BA 4JYCA 4WCDA 2DFNA 4RETA 3JVVA 1QHNA 5H4GA 3EWNA 5B57C 1JIXA 3C3XA 4RAOA 2AXPA 2WTMA 5BOVA 3IMCA 1D1TA 3MC1A 4CF3A 3TSZA 1OFUA 1CS4C 3NC0C 1X1AA 3ICCA 2BGKA 2XMGA 4HZUA 4KXXA 3BB1A 2ZSUA 5AKXA 3MAGA 3A04A 3EGIA 2AB0A 5H9VA 2B5WA 4I50A 3WL7A 4IIJA 4YRGA 2WHQA 3CPEA 4TTIA 4MEAA 4M60A 5E3HA 4LVUA 4WNAB 3TVTA 4QJ3A 2OG1A 5BSHA 4QJIA 1QPGA 4QDOA 1D2MA 1SKBA 2P4EA 2AOUB 2GEVA 4QARA 4RIGA 4E12A 4B46A 3PT9A 2MINA 4Q1AA 3RODA 3DR5A 3JQ6A 1B16A 2EL9A 4KO3S 1SEPA 3OPMA 2DX7A 1V4NA 4IDCA 2WWGA 4TXJA 4Z7NB 1ZCFA 1QONA 3HA2A 3E1GA 4EJSC 6REQA 1GYQA 1QFSA 4I4IA 2JGDA 5KHAA 2QOEA 4ZVLA 4E70A 4EP1A 2GKOA 2GPYA 1P2BA 4AQDA 5F9HA 3GRYA 4YP6A 1U0EA 1H85A 1XZGA 3DONA 4LUCA 4NH0A 3B9RA 4KVZA 5JJLA 3IMGA 1EG2A 2E82A 2VQ3A 4G0UA 3SHOA 1BO6A 2XODA 2OZEA 1U1EA 3RBXA 3P52A 4CG2A 4ZYXA 4ARZB 5JARA 2FPIB 2K5UA 2WUFA 5MHTA 4I4NA 3SR0A 3HQ4O 1QK4A 2DPHA 4MCJA 5E6RA 2OCDA 4R2LA 3RF6A 1G42A 1PVDA 1GTMA 2R9VA 2WFLB 4NULA 1Q3HA 3KXIA 4FWIB 3L7MA 3RT1A 3RF7A 1YB2A 2VRBA 1CERA 2JEYA 3OJWA 4NZMA 4PQYA 1EM6A 3D2CA 3KB1A 4UHFA 1I6LA 3SZGA 4R83A 3TSAA 3DC2A 3L2OB 4AWBA 4GVLA 4XFKA 4CMIA 2W71A 4EF6A 2O59A 3V8QA 1L5GB 5HTKA 1MB9A 2WWIA 3ZCUA 4LOJA 2L2QA 4XRRA 4IDPA 4K46A 1Y1QA 3B5IA 3FRIA 3GVCA 5C34B 4D8VA 1C3XA 3RS2A 5DHFA 3SSOA 3O8BA 1S6YA 3DCJA 3FN4A 2MSCB 3GJ4A 1NN0A 2B30A 3PSHA 4X93A 4CU2A 1G16A 3GP8A 3UPUA 2UXDB 4YRZA 2FFQA 4HAZA 5GVSA 2BGGA 2OQ2A 4PFQA 2A1UB 3O8NA 4JITA 2W9XA 3SBOA 2V7QD 4OA8A 3GRVA 4PAWA 4EAAA 4EJ6A 5D1HA 4O1HA 1KI3A 5G4KA 4ZVUA 2M6RA 3OT5A 4GDMA 1KQGA 3AKZA 2HQRA 2R7NA 4UCXA 4CG3A 3WYNA 4ECAA 1XDUA 3BMOB 4L76A 4OHXA 3ZYCA 3E84A 1Y7TA 3A6LA 2FMTA 1RYZA 2AJDA 3B9PA 3NHYA 3OM0A 1B23P 3N3BC 4HDKB 1UQRA 3N58A 3TLGB 4NS1A 4AY2A 2CNDA 2CN1A 1NZJA 2GEJA 1Z26A 2JHAA 4P7KA 4PRZA 1DEOA 5EXPA 5C51B 3ZKWA 3MS7A 3ETDA 3PP8A 5LOVB 1LLQA 4L5YA 1QHHA 4UHJA 5JUWA 4EJSB 3A37A 4EY8A 1ZJYA 4X62B 1G0OA 1T2DA 2UUCB 5FH9A 2EFJA 3C39A 5JPCA 3JATA 2HPAA 1OR8A 3B20A 4F3CA 1K5DA 1QH9A 2ZSAA 4XWYA 3VTKA 4D94A 1Q1EA 1M6HA 4JB8A 4ZK2A 5BXQC 1RACA 1Y1SA 1SHZA 3MRSA 1GXSB 3KLOA 1M74A 2IUUA 1LLUA 2F7SA 3DEJA 1UR5A 3AU8A 4NY1A 4O2AA 4ZPXA 4RFLA 2VQDA 1CUCA 2V6FA 1M2EA 1ZIXA 2ZXFA 4XGQA 3N7TA 4RU1A 5DPMA 5H7XA 2ZR8A 3NGLA 1DC8A 4BZZA 3JD1A 4P3NA 2AUNA 3ED5A 3WSWA 5LJLA 4Y9UA 1R0XA 5DM0A 1CYEA 4MYRA 4R68A 1IVYA 3DG9A 4GOLD 4KQIA 4DFDA 2QZ4A 4YEDA 4IOJA 4REOA 4RIFA 4C0XA 4DV6B 2JFUA 3SJCA 4NJEB 4YUYA 1O57A 5B64A 3PYLA 4PE5B 5LQNA 4PN7A 2XR1A 3VNVA 1RLJA 2X86A 5ENZA 3DZKA 1TU3A 3THYA 2A86A 2CFSA 2YVQA 4JEUA 4C6TB 4EECA 4BKRA 2V7XA 3NG1A 5AJTA 1L4KA 1ZZEA 1HI9A 4M0EA 3UMJA 3ZZ1A 1ULTA 4HB2A 2GZDA 4X1KA 3VAZA 4ABYA 3MQFA 2GK7A 3KQQA 3LL4A 2C7PA 2NV2B 2BLLA 2JPDA 1RADA 3PX7A 1NC1A 2ECPA 2MOKA 1YSCA 4YCDA 5AW5A 4S0XA 2YFHA 4Y7CA 1QHGA 1ZP6A 1RKUA 4NCHA 2KS6A 4DE5A 3W8EA 1XKXA 3ITDA 2V9ZA 3K1YA 3AW8A 1YE3A 2E0IA 4M0UA 1TFUA 1XWFA 4Y9RA 4BNXA 1PZXA 4MUIA 4GBJA 2Y05A 1VIMA 4CV1A 1FQKA 1KK3A 3EGWA 5DNDA 1ZMBA 3FSGD 2AEJA 2W6ZA 1FXSA 3EQ9A 2PUFA 3ZOKA 4GIBA 3OM1A 4HWKA 4I7EA 4A92A 1ZCZA 4GI2A 1K06A 1P77A 5DF1A 1QP4A 5A3RA 5LP6B 1CQJB 3ROMA 5JJBA 1GGNA 4IGEA 1Z4IA 1FQOA 2QG4A 2ZITA 4EVRA 2FSPA 3E3LA 1HTTA 3PC7A 4Q9IA 1AK2A 1U7TA 5K3FA 5JPDA 1Z13A 1M83A 3ZNPA 3IEKA 3TCNA 1QHFA 1QDEA 2BONA 3COSA 3A3NA 3D02A 4MYSA 1J0DA 4UEWA 1YUBA 2O5VA 2V7EA 4OFXA 5CDYA 3VKHA 1F0PA 1Q1ZA 4WERA 3HN7A 3OU2A 1ZJZA 4CNQA 3ACBA 3R8XA 2CE2X 4IEEA 1H6DA 3HL0A 4DNPA 2CSXA 2F3SA 3R6WA 4RAQA 2Y1CA 4Y1GA 4EYQA 2X42A 4CEIB 1I14A 2IHTA 5CH3A 3CVXA 3D5EA 3TAUA 4MVJF 4CM7A 1ZNYA 1BDBA 4OCZA 3IXQA 3AVVA 1ANKA 4X64B 2Y1KA 1I5EA 3FTPA 3AH8A 1R8YA 1XJCA 2IP2A 4I4TF 4U00A 1U80A 6ABPA 1DKQA 2EJUA 3HYLA 2QQFA 3EXHC 4EY4A 4Q3BA 5HF8A 1IZ9A 5JJKA 2XV1A 4EF5A 3U4IA 1YQXA 4OMCA 3NASA 5CT5A 4IIUA 1O97C 2HI0A 1N25A 1L7PA 1YIOA 4M1MA 3KAQA 1YBAA 2Z4TA 4BX2A 5IKPA 3HY6A 3ZNQA 5BV8A 3KE9A 1WO8A 1B0AA 5E1DA 2EQBA 4YWJA 1WP9A 1YZYA 4BEWA 5LWHA 3HBMA 3EVTA 3SSAA 1XMSA 3UA3A 3ZZ0A 3ZWOA 2N46A 3L4SO 5EERA 4BCBA 2RGBA 1XCMA 1QQ6A 2HSDA 3L6EA 3KFLA 4P7GA 1P73A 4PYLA 2GEDA 1DTWB 2XQKA 1PSWA 4C6TA 4TUYB 1HL7A 4ZEVA 2EW8A 1XL1A 2JAPA 5AUQA 3WGLA 2A3NA 1E6KA 2WG0A 4IFBA 1D07A 1BE1A 2XT6A 1JHZA 4BVKA 2M98A 3AEKA 4HSEA 3NFRA 4WZBA 5DFAA 2XX3A 3MB5A 1EWTA 2E4VA 3IUMA 4PPQA 5B6JA 1UBGA 5J5VA 3GT0A 5JZVA 1ISPA 2ZBRA 5EZYF 4JXXA 4EARA 3IOCA 3RD5A 2X5NA 3O4RA 3R0ZA 2FGJA 1WV1A 1N8NA 3NAQA 4MW7A 5IXSA 3IUSA 1TZMA 1IOLA 1L5HB 2I1QA 3AMVA 4XVHA 4RPCA 2R2AA 4RJLA 4RY9A 2ROQA 4YX9A 2H0RA 1CWUA 3GA5A 3MM4A 3C3AA 1EXNA 1NVKA 3I1YA 1ZOOA 2XRZA 3SM3A 3JQEA 4CM8B 4Z49A 4BNVA 1PYOA 4J0KA 4EUNA 4DDUA 1PKXA 4MKXA 3V46A 3EEIA 3SYLA 2BKXA 4BV8A 2FF7A 1Y34E 4CV2A 2O3SA 4MIOA 4AQ7A 1Y5IA 2JFGA 2OBXA 1KU0A 3OFSA 4UDYX 1FVHA 3A70A 4YMTA 3BQ9A 5BWLA 4CLHA 3AVTA 4WXHA 2QAGB 1WCYA 2BEVA 2FZKA 1RRMA 2ZIFA 3KR1A 4JJAA 4KH1A 1D7AA 2HMSA 1L9KA 4GI1A 1EFUA 3P32A 4TLMB 5IEBA 4A4DA 3WSVA 4EVQA 1SK9A 4LCBA 2EEZA 1NE7A 1H65A 1OYVA 3BKWA 3PHBE 4G81A 4KEAA 4UD2A 4Y1RB 2YHSA 1JLLA 1URPA 5HF5A 3HRKA 3T1NA 5JMTA 5LQUA 5JJ5A 4UM7A 2WD8A 3DD5A 3TX2A 5K8TA 1T13A 2C5HA 2GPJA 1YR1A 2ZYSA 2CHVA 3E9RA 3IKMB 4JD5A 2NUAB 3TLXA 4AJHA 3PEUA 3RS8A 3NP7A 1OY1A 3H1EA 3HFSA 2B1GA 4O0LA 4RTOA 4PHCA 5KDOA 4PINA 1EUDB 2X0RA 3JQBC 3IR6A 4X1YB 2ZB3A 3RQSA 3JALA 3BK1A 2GZAA 4IQGA 1WDKA 3KV1A 2VL7A 4PIPA 5CFOA 1BN7A 1EVQA 2Q2NA 4PAGA 2IYLD 4TT8A 1Z6ZA 1WIWA 5ALHA 3NBMA 4MSUA 4MPRA 1SCDA 2NNLD 4LDZA 4AAYA 4NAVA 3BTVA 1W4BA 1P4HA 2Q3EA 2B36A 3LG2A 4LN1A 1Z2AA 4W7HA 3SF8B 1DIGA 4C0LA 1NOIA 1MJGA 3FUWA 4LJ8A 1F2TB 4M0MA 2IX9A 4MULA 1N8SA 2VAVA 2C7VA 3QGMA 2BKAA 4RMIA 1G5RA 1P6QA 1CB7A 2II6A 1KI7A 2V0CA 3PNMA 2JGDB 3IC5A 4E5UA 2QL5A 5BN4A 1FP4B 1K92A 3O8QA 1OTHA 2VEDA 2UVPA 4X66B 1EM8B 2OB2A 1G4UR 3DEYX 2YXDA 3DKKA 3IJ5A 3MCWA 4OQPA 1PQPA 3Q0IA 5CK5A 4C1NA 1U31A 4V24A 4D92A 1YL7A 5I01A 1AS0A 1NVXQ 1DI0A 1QHEA 3ND9A 4RZHA 4D41A 1QGUB 1TQ8A 3CT6A 7AT1A 2LE0A 1YB1A 2JANA 3KXPA 3A32A 1PE0A 3DT6A 2WA2A 2VF2A 4GZ3A 4WY5A 3QXGA 4D0SA 4I8DA 1XR3A 1YDEA 4EMSA 4US2R 5F78A 1KIAA 1RBMA 1UUFA 2I7DA 2NQTA 4IGIA 3RS3A 5CBKA 2D7CA 2WHXA 5EQJB 4DNOA 3EAGA 5B3LA 1QZZA 5AXBA 3F0TA 1GAWA 4NE2A 5AKYA 2JFPA 9LDTA 2WNSA 4ZCPA 5CYFA 1Z5NA 4PHTA 2E85A 5BV1A 3JRNA 5SZIA 1WABA 3DPUA 3JAKA 3LDHA 2DBQA 2PS3A 2GX6A 2AFVA 5FBKA 2O8EA 4BTLA 2WICA 4ZOLB 5ALGA 3T12A 2VBIA 1PJBA 4I8XA 3GLHA 4TYNA 2FMKA 4JC5A 3GVIA 4OAPA 3WI7A 1CJSA 1GDDA 1E6MA 4I5EA 1Q7GA 2GPTA 1A98A 2AE2A 2C03A 1YJBA 2P11A 3ORFA 3PWKA 5F52A 4EPVA 3PHCA 3B6JA 4NBNA 4ZI7F 3E8MA 4US1R 3K8QA 3N8HA 1U0TA 1TF2A 3BX1A 3ONVA 4X7PA 1CQXA 3G2HA 5FBLB 2ILVA 2BKUA 4MW1A 3A3PA 3MWLA 2P3LA 4UZSA 4PR3A 2WU4A 1M2VA 2ZS9A 2UUBB 4LG1A 1WEKA 3EDRA 3SKXA 4B6PA 1YFKA 1L7MA 5D5QA 3VVMA 2ILTA 3ZGOA 4FS3A 1J22A 1DKMA 1EFRD 3A9UA 4B6OA 4M22A 1VG1A 3CPJB 4NBWA 4ZQIA 3UMBA 1TAUA 1VB3A 1UZMA 3LUGA 4HDCA 4EKDA 2TMYA 1PYGA 1NONA 4QLAA 5HYVA 4TYYA 2W6JD 3K09C 3WWCA 2VP4A 1WP4A 1RQLA 3L8DA 4CKEB 5L6MB 1Y4ZA 3TPFA 2QLTA 5LWQA 3DKPA 3BK2A 3OQNA 2BELA 2UZ3A 3AF4A 2W43A 4FINA 5EXXA 4YCBA 1SVOA 5IUKC 3EVAA 3W90A 3J81A 4LJ9A 1V47A 1FLAA 1LSSA 3OFJA 4BO3A 3J80A 3UT6A 4EW1A 4OEHA 2AOVA 4BCDA 5B2EA 3M6VA 1DG1G 5BSFA 1WHSB 5F7JA 1K3TA 3C3KA 3IAM1 1X1EA 1II9A 3PI7A 1GGEA 2R96A 4PYKA 4MUBA 3VR4A 3BAZA 2P3QA 3QMMA 4HS4A 2EFYA 3AP2A 3DTTA 4DWVA 3GWZA 3RFUA 5IAAA 1CR1A 2FE1A 2JCYA 4QU9A 1T8UA 4EB6B 1YL6A 4NG4A 5CR9A 4PX5A 4DQKA 3SJBA 2YWJA 1W75A 1TNDA 5CYOA 1OI3A 2IQIA 3G49A 3TI9A 4F8EA 2MSDB 1XDZA 2PLRA 2Z58A 1SKUA 3KT0A 2IF0A 4RS4A 5ALIA 5DSTA 5IARA 5A9SA 4LFBB 4IIHA 4B6EA 3VNUA 2YZ7A 1CNMA 3FVVA 4PGHA 1N5JA 4D79A 4DM4A 3AW9A 1EDDA 1K6XA 2W0SA 1IZ0A 1KAMA 2A8YA 4R7ZA 1VYVA 4G09A 1CQIB 2DCUA 1WOYA 1X7XA 5TGZA 4F1KA 2BC9A 3H97A 1O9HA 2HWKA 2EXXA 2DFPA 3OHPA 4K6CA 2VHXA 2IV3A 5HF6A 3N87A 3VHXA 4TGLA 4AJ1A 1X8KA 3E61A 1ORWA 4X00A 1IBRA 5E4JA 3RAGA 2ZTUA 3DE4X 4OMUA 4RPJA 4OHRA 5ELXA 1M6EX 3LUCA 3LBHA 1UCFA 1EZ4A 5L8VA 3A6HA 1NU8A 4B79A 2CDRA 1LLDA 4W99A 2AXNA 2N0SA 3UK0A 1HORA 2JKYA 4XKJA 2HLDA 4RA9B 5DYYA 1GDHA 3B3AA 4AM8A 1C3EA 3LF1A 1K4YA 1H4VB 1C1DA 1YA4A 3K2QA 5C8YF 4F12A 3W2GA 3FZYA 4FUQA 3U9TA 4A6DA 6Q21A 2CLLB 2Y92A 3OE1A 4E4TA 1YZLA 2QZZA 1L6RA 4CMEC 4CCSA 1ZWKA 2XA9A 2QN6A 1WNTA 4QO7A 2YJ3A 3NGXA 2X0EA 2IEZA 2NV0A 5DBOA 3TKLA 2ENWA 4MB6A 1J8MF 3S29A 3ZUGA 5MGNA 5U4QA 1GQRA 2B92A 3H86A 2Z95A 2M2IA 3H9GA 3OPQA 3SEZA 3T5BA 2PSHA 2P7IA 2PKRA 4Y6OA 3A58B 3CW9A 4HXEB 4FQ5A 4L4YA 3GQVA 1YA6A 4QEZA 3BDAA 5KOJA 3QE2A 5AW6A 2R79A 1F1JA 1OFIA 1NAIA 1Z33A 3N0RA 5DI3B 5J40A 3C85A 5HOEA 3NBAA 4QDXA 3AJAA 3ZCXA 1RAIA 3CLHA 4HH3C 2CZQA 3FRHA 1GFZA 3W5UA 4IZ6A 4QM6A 3EARA 4E4RA 2FZLA 3S7TA 4I1PA 1K8QA 1YK1A 3O82A 5AJUA 1DC7A 1CUGA 3GDFA 2MR5A 5ECGC 3H16A 4WMLA 2XOXA 1XNJA 4HH4A 2WHEA 4PQEA 1AH2A 1P0MA 3EEBA 4K6GA 4ZQEA 5B30A 2YR0A 3NDRA 1N2IA 2SICE 3JD0A 4EFNA 3O8DA 3R09A 2JJQA 5JH7F 2HADA 5KPDA 3TBHA 1QP8A 1X7WB 4IX1A 2YY7A 3GZ4A 1QIKA 4M6WB 4EDFA 2A3RA 2Q1UA 2Y0CA 2D8AA 4RLFA 5EJIA 2JFHA 3QHPA 2VDVE 3HZOA 3D2LA 4RNDB 5L53A 2CFRA 1BQ4A 2YC2C 3JAKB 1EK5A 2O54A 4NJOA 4BQNA 5A02A 1NNEA 3OQJA 2R44A 2BCJQ 5I8PA 1GPUA 3C5WP 2OA0A 5EMHA 1CJMA 2J3QA 5FNVF 2E5WA 1P81A 2NW6A 4N54A 4F8JA 4EYGA 3IDZA 5CYGA 5JQGA 3U61B 3EEQA 2HU2A 1G9TA 2B4RO 5JSZA 4O3FA 2Z4RA 4Z3OA 3MTIA 4PO3X 4IKPA 2QYSA 3U4MA 1P1KA 1Q0PA 3MWDB 5D6OA 5DWQA 2B3TA 5ILQA 1P91A 2DAPA 1HDIA 3ECSA 2HW8A 5LMZA 3R44A 3T38A 2FZGA 4YRPA 3MAJA 5F2OA 1RYYA 2VHQA 1PT5A 4PRKA 5BN1A 2XCTB 3LDAA 4OAQA 4PNHA 1CVIA 1DS6A 3F4LA 4A36A 3E5NA 3IHLA 4QRHA 4CDRA 2H3HA 1NR7A 4DREA 2AW3A 4JVSB 3TQFA 2FSVC 2O3RA 3GMSA 2QXUA 3EVFA 4MYDA 2WLSA 3PFCA 4N40A 5DLEA 4NE9A 3OM8A 1JWAB 5FUVA 3G5TA 3NIDB 3WYAA 1HDOA 4FXPA 2CKDA 1QFJA 3KZXA 4I9UA 4YQYA 5EUMA 1BE6A 4EELA 4R1LA 2YIJA 4OMDA 4P4LA 3EIWA 5GJBA 4L7QA 5DJ5A 3RREA 3LUBA 1FP7A 3DHNA 1FTYA 4YVFA 1RXWA 1H3EA 1JLKA 2D2FA 1IHDA 2A0YA 2OXCA 5EP4A 5SY4A 5G0TA 2IPXA 3INTA 1J0BA 5TPWB 1Q0LA 3KKQA 2RDMA 3RSSA 3R7NA 1ONNA 4WCFB 2HQSA 2NUTA 2GCGA 3KPWA 3NTOA 3PF8A 4WK0B 3E5HA 1Y8AA 1RM3A 3M4XA 2H1WA 3QKRB 5E8RA 2FP4A 4PZYA 4B6GA 4L5CA 4DV2B 3TW8B 1K0UA 4BFCA 1Q0QA 4BRWA 5KIAA 1NMEA 4K0RA 1JPUA 4AVYA 3ZI7A 3Q2OA 5KMGA 5HG0A 2VDNB 1J2EA 1C1YA 3AF6A 1KARA 1V37A 1M2OA 1V71A 2BHNA 2I7CA 2RGNA 4LMRA 5U4XA 2R4QA 3FETA 1CG6A 3RGGA 3SEFA 1KQOA 3JQ9C 4A03A 5KZMB 4DA6A 2WTXA 3EG5A 3UB2A 4B0PA 1VCIA 2PFKA 3H0CA 5GM2A 3WR5A 2XDWA 1KMHB 2XVYA 2HEGA 1JL3A 3D7NA 5AM5A 3CC8A 1JU9A 1KRWA 1VIAA 2JIRA 3QY9A 4AZ0B 2EERA 2C5FA 1YQGA 1ZUNA 4Y98A 3W6NA 5LU9A 4KQHA 2NZUG 2DWCA 5CIQA 2XUOA 3ZH9B 3LW7A 4RLHA 1W4ZA 4GZ5A 4OY3A 4U6QA 2AJCA 1Q0RA 3VV2A 3RIHA 1KO4A 3Q9UA 1G64A 4AJ4A 1R8JA 2ZBDA 3LDFA 2NUTB 1SHKA 4GR4A 4IS3A 3AKYA 5CIYA 1EWQA 3QH4A 1QRAA 2KPOA 1K7SN 2FU5C 1QTRA 3HJNA 1N2CE 2Z5VA 1V9CA 4K3VA 1SJ9A 1L8LA 3DAHA 2CXQA 1UJNA 3ENWA 3NH6A 4I5GA 5AP9A 1V6CA 5IKOA 2OV8A 2JH9A 4CPDA 3R5SA 4URVR 2OM2A 4G89A 1AB6A 1JN0A 2RJNA 4EPRA 3FLAA 2WD7B 1AO3A 1DBRA 2EJWA 1VLMA 3F3KA 3PZBA 3J7TA 2NG1A 7ADHA 4H1WA 2PIDA 4Z9XA 3OOJA 5DM2A 1T3SA 1T5LA 2AFRA 1Z74A 5K0GA 2OAQ1 5IT9A 2FRVA 2YQZA 5TPZD 1GG9A 3UXMA 4DDWA 2XKKA 3QG5A 4UHEA 5CLJA 1Y9DA 4U2KA 2W7TA 3C4JA 5BYBA 3L6BA 4G3XA 1AO0A 1D6SA 4RVFA 4CCAA 3TINA 1WUTA 3D8BA 4FFWA 5ELMA 1KEKA 1JLMA 1GGJA 6NULA 1LDEA 3AGQA 2N47A 3WB1A 3CA8A 3ZYZA 1NLFA 1YRBA 3GPBA 3V4LA 5F7XA 2C2BA 3KPJA 3D59A 4O4LA 3LECA 1NQXA 3Q7TA 2XE7A 5FTLA 5MGBA 4MWGA 4ETIA 3UMCA 4BNMA 4GPZA 2P7HA 2C8LA 4EMUA 1Z75A 3SC2A 5ABPA 5CAEA 5JCZA 1YKSA 1JXAA 3EGCA 1G6KA 3DBVO 5ESWA 2B4KA 4GMXA 3RWOA 5HBRA 2AJ8A 4LYGA 1AOXA 3R3ZA 3UWOA 5EJ5A 1SZPA 3TK1A 3GCGA 1KH3A 3F96A 4X6UA 1PKEA 4F9EA 2QVZX 2R6CA 4C89A 1Z7WA 4RZIA 4MO2A 5KVSA 4F21A 3QUCA 5BW8A 1PW5A 1OU0A 1TUBA 2ZS8A 4EW2A 2VP6A 5C8XA 1V16B 1AF4A 1XRQA 4ZU6X 4KXQA 2GYWA 3HLYA 3KVYA 1GN9A 1SBNE 2WHPA 1AQLA 4J2TA 4MRVA 3RHTA 1X1RA 1ZINA 1ZVMA 2ZWIA 4NCAA 1ODTC 1RYHA 4W1QA 3BILA 4BO4A 2Q1WA 4HTFB 2QM8A 3LDUA 1KK1A 2BGTA 3VXKA 2ZWPA 1VJTA 4I5FA 1TLTA 3K1AB 1ETUA 2SNIE 3GRUA 3Q4GA 4Q7MB 2YBDA 3EODA 4GR9A 5TIIA 3KUCA 3R3YA 3LGSA 3FR8A 1MW9X 2HLHA 2QB5A 1TT5A 2G76A 2FFRA 4QA9A 1I8TA 1YS4A 4RHFA 2HMWA 4BEJA 2H3EA 1ZHOA 4FGZA 4Q9JA 5BURA 5E7MA 9ATCA 1YMQA 2QUBA 4PSUA 3AP3A 3P9QA 4ARUA 3KJFA 2CHQA 5FF9A 4QE3A 4EH1A 8GPBA 2R6DA 2AR9A 3DAFA 3G2KA 4X3PA 3SD7A 4B7UA 1QH1B 2QKIB 4JXJA 4QDUA 1XTKA 1PP4A 5KKAA 5I45A 5K8JB 1FDOA 2J7KA 1AF7A 3GFVA 2GMWA 2KYRA 4MVJD 5IJ0B 1ABBA 4RTNA 1RLOA 4EFLA 3GUZA 2XF8A 4G9EA 1B8OA 3FOBA 3PIDA 1D2RA 4CQMD 1E4EB 2LV8A 4EHAA 5ISMA 3CO5A 5KNDA 1WXDA 2OFXA 1QV9A 4J0JA 4V39A 1P2FA 3YASA 3FBGA 1PR6A 4L15A 4X92A 1JHXA 3TSWA 2B0CA 4M0DA 4B74A 5IK2A 2WM2A 1GT6A 3RVKA 4C0AC 1P3Y1 2F1JA 3L6RA 1AG9A 3ENKA 5AUNB 3GEGA 5AIBA 3ANMA 2AKEA 4RO0A 1LW6E 3CF4A 3VH2A 1WVIA 2I54A 1B43A 4EK9A 1QORA 2WAAA 3TW6A 3BIXA 1IQRA 1K3UB 1XZBA 5IF9A 4NYMR 3EPKA 1MDFA 2WWXA 4ZCLA 1YDGA 5JDCA 3G0DA 3K6KA 1JWLA 5LJIA 3PV0A 2XNKA 4WEQA 4EG4A 1BA3A 3I6YA 4RSGA 4Y2TA 4BC0A 4NZYA 4XGKA 3UG7A 1TDJA 2R65A 1RVV1 4YRKA 2ZJAA 2C31A 5LM3A 1I2BA 3F5SA 4EFKA 1JPNA 1QZXA 5BN5A 3M34A 5LQJA 2GHTA 4M87A 3RYCB 2PUGA 2HBZA 2OKGA 2HWXA 2JK1A 5D86A 1E7RA 4DMFA 3MOSA 3NOXA 2OG2A 1IEVA 4KO1S 2H48A 3E81A 4TTSA 4WK2B 1NRIA 1X2EA 5L7TA 3KHTA 1GCAA 4HGZA 2Z1DA 3AJDA 1E61A 1LWOA 4JN6B 4PS0A 5KI6A 3TTXA 4CUKA 1DAIA 4AG3A 1CXZA 3A6KA 3PFWO 3F73A 1W88A 1NVAA 3QIVA 2QLLA 3GVHA 3GEBA 4NQZA 1LRLA 3F8SA 2WU8A 1BXGA 1BWQA 4ROSA 4JH0A 2P62A 4QULA 4EYOA 1C5KA 1Q7TA 4QQNA 3QF4B 1DAMA 3OZIA 1W85B 2HK9A 3ZQ6A 1ECCA 3PNQA 4F9GA 2W2XA 1V2GA 5DXAA 2QP9X 3GJYA 4B3HA 1Q77A 2DULA 1KEEA 1WAMA 2FK7A 2MSKA 1FW6A 2GRJA 3ZE2B 3KCQA 5TMDA 4WJZA 4C7JA 3KJEA 5FLYA 4KP7A 3SQNA 1RXVA 2GM4A 4HWOA 1VECA 3H2ZA 1YWGO 4KWEA 4Q9NA 3HBAA 5P8WA 4RHCA 1ZMRA 3LLSA 5EA2A 4FTWA 5DHUA 3O3CA 3T3IA 3MUOA 3R2JA 4LY0A 1IUOA 1ONSA 4FOPA 4YJKA 2QU7A 4OQXA 3VR4D 2PO7A 3IELA 3HYCA 4UBOA 3NXSA 1PV4A 4UUMA 4DQVA 1PFKA 3G1WA 3ESDA 3OLXA 2E7ZA 4JCCA 4KWHA 3GH1A 1D6MA 1I33A 3A1CA 4XTRA 3UTCA 1Y42X 3UENA 3RNLA 2RARA 1WDMA 3IL2A 1MIHA 2A30A 5GADl 4DV4B 3KBBA 5FBHA 3SK0A 1DJPA 3LGAA 3N8DA 4ILKA 3L1HA 5I5GA 4HDMA 1NDQA 3KZVA 3NCHA 4E11A 1K86A 1IWOA 3MGGA 1S3SA 3T0FA 3RFFA 1QPZA 1AUQA 4LRWA 2JLAA 2B4TO 2AFIB 3I6BA 2JRCA 5BR4A 3KJIA 2WTNA 4D97A 1UT5A 4NP6A 3ANSA 1JFTA 5FT9A 3M6MD 3T61A 3QQ5A 5EIHA 2OHIA 2ZW9A 1DQPA 1Y37A 2C54A 2GN1A 3EQZA 4GUDA 3SHQA 5KJ6A 1I7QB 1WHTA 4Q4HA 3UUWA 4KFRA 2NT3A 4S2UA 4Y2GA 3FPBA 3MLAA 1JG3A 5GY7A 2QY6A 2SCUB 3OY7A 5AOCA 2QVYX 2GN2A 3IGFA 4M8LA 4LHXA 2HCFA 2Y0BA 1P33A 4OQZA 4UPDA 3ZDQA 3ELBA 4DV0B 3RIGA 7MHTA 3B1FA 1S2IA 4N7MA 4QSHA 1BOFA 3N0XA 4QBGB 3O90A 4DARA 2C95A 3KPVA 1EQ2A 2NMVA 3ZWXA 2PN5A 1R5BA 3VBEA 3G1TA 4DAEA 1FQWA 3NYQA 2BFBB 4Z3KA 3PKJA 1P9NA 2HWYA 1PT6A 2UAGA 2VCHA 5FPKA 1GTRA 2PQ2A 1F0NA 2PRKA 2XD9A 4FXOA 5KREA 4R2MA 3UJ6A 3TG8A 1V7CA 1QO0D 5CTJA 1A8HA 2UUAB 2JLWA 3WRVA 1U6IA 4O02B 3RJTA 2I6SA 5JHGB 1GU1A 1SCUB 3MWYW 3C1OA 1U3WA 3DZFA 4S2EA 4YT5A 4F3TA 3MSXA 4LKOA 3U48A 2FNAA 5BW6B 1CRZA 5MN6A 1LB1B 2O2CA 4Y18A 1FP4A 4YJHB 4F5DA 1ZITA 2ZCJA 2J3JA 2ODAA 3QEBZ 1M2KA 2X14A 2VTBA 2IU6A 3H5OA 2NX2A 3NGMA 2QMQA 3T7DA 2JGMA 3OLZA 4FN5A 3NJ4A 4BZWA 3H5AA 1ENOA 3GW8A 4U4AA 5TXGA 2WZQA 5AW7A 4PIVA 2FJ0A 1QP7A 1M1YB 3ABQB 1KVUA 2JA2A 2O0KA 3SM9A 3OBIA 4DC9A 3WMXA 3WYGA 1QCCA 1SHJA 1ZGBA 4HUJA 1ECGA 1NW6A 3WLOA 4BNGA 5TPZA 2LBPA 2QHXA 1KI8A 4KR9A 3Q5GA 3UWDA 1E3WB 3GLHE 1EJ2A 2R00C 3E23A 1D2NA 2IIPA 5ETJA 3LPAA 1D2CA 4AD8A 3KQUA 2YYZA 2BDEA 3TIIA 1FYFA 1KJ8A 3H42B 3PDIB 1BSVA 3W6UA 1BDIA 2F8TA 1PAUA 2VK2A 3HYSA 2WVHA 1PWHA 3B60A 2YXPX 1XZCA 5ALUA 4W9NA 4UFPA 1ZM3A 1JIVA 1GRVA 1JSRA 2E3JA 2XMZA 1OYOA 3KJNA 2P6MA 3QOWA 5C5DA 1QPBA 1XU9A 3NHJA 3P9KA 5JVDB 2PUTA 1JNYA 5ALOA 1BQ3A 4N7JA 3GK3A 1X15A 2OBLA 4YP7A 2FMUA 1T1EA 4HEQA 2RH5A 4Y1RA 2OYRA 1RTKA 2P9GA 3I6MA 3I01M 1KYZA 1R10A 1J7KA 1SGWA 2H1HA 2O1EA 3T54A 5MN5A 2EHJA 3DTYA 4COOA 3EDOA 3H9CA 4R3NA 5C52B 2O5EA 1OB2A 2J08A 3LSYA 1R4MB 3V4ZA 4JI0B 4PQRA 1G0NA 1TM1E 2RBEA 1U1DA 2OAGA 2OCIA 1DJNA 3OOSA 1SQ6A 3ZHBA 2I3GA 3G3EA 1UBHS 2WP0A 3ASVA 1IPHA 1EI9A 3SQLA 1SK8A 2BVNA 3MD9A 1U0SY 2UZ0A 3DEZA 2VPQA 4AS2A 1R74A 3WGOA 4QQKA 4KI7A 421PA 1R15A 3WQHA 4B85A 1LBSA 1VE9A 4O4HF 5H16A 1DAFA 3ABOB 3DC7A 3CUTA 4YASA 1US8A 3F49S 5J2TB 3EGXA 2IZ1A 2QM0A 1O89A 4PG6A 1MPTA 3AIMA 3ZV3A 3ZCSA 4EGFA 3CVWA 3IP1A 1XMXA 4EUHA 2C92A 3QE4A 1DU4A 4HP8A 5ICMA 5HMLA 4ARSA 4JFRA 4EMBA 2QUHA 2O14A 3E4DA 1IYZA 2ZQ5A 5KYVA 1FCJA 1TM5E 1FRFS 4JKIA 3ZGLA 4DLLA 4IP0A 2W83A 1PEYA 3ZWPA 5DNYB 3VKGA 1VKOA 5JCJA 4E7OA 2BJVA 1A5ZA 1NN5A 1H1DA 1S8OA 1DWQA 4GOOD 3O95A 1X80B 4OJNA 4Z51A 1XVUA 1FF9A 2CXUA 3EXEB 3WGJA 4Z4CA 4BIIA 1A4XA 4BYMA 1E99A 4FYJA 5JNWA 4P2GA 3CNLA 2FGKA 3N5KA 4KE8A 4MGZR 4I4CA 4YJ2A 5FO8B 2XBUA 2HSGA 4OL9A 1O5OA 2Z2IA 3JQ8B 1JEQA 5EE0A 4ZN6A 1QGDA 1QF6A 4C0HA 2E5FA 1C7ZA 2HWUA 3C8ZA 4AKHA 4FEEA 4CCYB 5TARA 4ZVTA 3P96A 1BTOA 4U8GA 4URWR 2G1AA 3OE5A 3ZJUA 1FTQA 1PS8A 2BEWB 2QE7D 1YACA 1RC8A 4RVOA 2AX4A 1P0CA 2I03A 1EFTA 1YRAA 3JD4A 3WKEA 5FDFA 1NBIA 3DNPA 3DFFA 4W9RA 3W9BA 1B8VA 4PPYA 3L7BA 3GFOA 2I2WA 1ECLA 2OMKA 3IXLA 3DZHA 2GEKA 1B00A 4C4TA 1AIPA 4X71A 4D2IA 2WIAA 4G5GA 5GV7A 2O1WA 3GCXA 1NRJB 4IJKA 2WSIA 4J75A 3EQ6A 2P0YA 1E9BA 1QIIA 4LNVA 3RYIA 5TPWA 3AC0A 2JL1A 3WIDA 1XE3A 1P7ZA 3OBBA 2Y8EA 1HRDA 4HGNA 1G2OA 3STUA 5JMPA 1XF9A 3FOCA 4HUQA 1WZEA 4G85A 4XWAA 3V7YA 4DCUA 2VVTA 1AHHA 3J7AC 1ATZA 1MN6A 2WYUA 2E4ZA 4IIGA 4OKNA 3WLJA 2XUQA 4KDRA 1XMOB 3P97A 4AY6A 4LE1A 2GCOA 2JCSA 3AIKA 3DGEC 4NX2A 3OEED 4U7JA 3DMNA 4ZYWA 4KN8A 3INRA 4E2FA 1J42A 2I6XA 3KWMA 2G71A 3A05A 1PEAA 1PFQA 3P94A 1YR2A 4ZAGA 5IASA 4C0SA 1N4DA 3Q6MA 1TMYA 4L4UA 2AZXA 3ZHYA 1AB5A 1QYVA 3KLMX 3SKVA 4ITUA 2D3TA 1KSGA 2GWHA 4BQFA 2F9FA 2WHPB 3NNNA 3MFYA 3TDMA 2IA5A 1F17A 4LRYA 4Y3UA 3F74A 4M37A 4UTOA 3WO0A 4CHTA 4AXXA 2A0XA 4QZVA 5ALQA 1KBZA 1C3VA 4UUPA 3MS4A 2X6RA 1FDIA 1JVBA 2RH9B 3AB7A 4GMHA 1WSAA 1UJCA 4OGGA 4TLAA 3W4IA 1MKYA 1TUIA 4MUEA 1QNLA 4WY2A 1G59A 4EVIA 5ARDA 1J00A 2XOEA 2ZI9A 1SCQA 1H6CA 1SQFA 4HN2A 2PXAA 1XD9A 4S1NA 4UBLA 4YNBA 3ZBUA 4B0OA 4FFBA 1CUWA 1QU2A 4OM7A 2QTCA 4ZAZA 1SWVA 2IYUA 3DQQA 1YGYA 2G9UA 1A82A 3IBGA 2PLWA 1MO2A 3O21A 5KBYA 1I2CA 5ALVA 3HKDB 4FJ1A 1ZXBA 1U98A 1EDBA 1T6NA 1ZM2A 4IO0A 1AGPA 1F2DA 1JKIA 3MXTA 3N70A 1W2GA 3VR0A 4ISBA 2QW1A 1NPDA 1E60A 4YRCA 1GQOA 1NKTA 2NUPB 3D6AA 3S1AA 3EX7C 3C3CA 1M2VB 2OGUA 1VLHA 1UJ2A 2PKQP 1OGYA 2R5WA 4E88A 4BNZA 3AFOA 1KJIA 3TD2A 1VZ3A 4NZOA 2AK2A 3BGVA 3SGLA 2JEZA 1R37A 3KU4A 4M9RA 1YTLA 2EVWX 2PJDA 2CEAA 3W3AA 4UMFA 5KJCA 5JU6A 2XE6A 2DPLA 5AVZA 1QG6A 1NMZA 1IY9A 3H5TA 5CVDA 4EKGA 3O2JA 1GG2A 1MBZA 1QH8A 2FPSA 1Z0ZA 2WDPA 3IVRA 4EFMA 1FLVA 2BFWA 2G3YA 2VHEA 3IBYA 1SZDA 3H11B 1RAGA 3K6JA 3TMKA 1STOA 2OOKA 1TAGA 2C9YA 1GLGA 2X0NA 3F4BA 3H1BA 4TLBA 4WNIA 1ZVVA 1NN1A 2QJWA 2W8ZA 1LPMA 2ZJ6A 2VHUA 3P2KA 5FJIA 4MIYA 4BLUA 2PH3A 3ADBA 4MA0A 2REQA 2ZUVA 4MRPA 5HIJA 1VSVA 1EVJA 2YX1A 4YRJA 5D01A 3OZBA 1E7MA 3KQTA 4YMHA 3QKUA 1QHSA 1BH2A 3HI6A 1XZIA 1NAHA 4FFLA 3AUAA 3W8NA 4ETNA 4GRDA 1LNSA 2A94A 3D8SA 2VUIB 3NXKA 3P2OA 3P9SA 5JXWA 1KU6A 3BMOA 4YRSA 1JXQA 1U65A 2WKWA 3MIIA 4X41A 3TKYA 3OUTA 1R0KA 1LXCA 1SCAA 2YASA 3IIKA 1HA3A 1ZISA 3ANTA 4AN0A 4KIUA 5HIMA 5AXDA 5AW9A 4JELA 3PRHA 4RTMA 4M8SA 3C7TA 1PU2A 5DM60 2PD3A 4Q3LA 3BXHA 1Z2DA 3ZD7A 2REXB 2A1UA 2OSBA 5JAPA 1XL0A 3FDZB 1U0NA 5EE5B 3GLGA 3FYUC 2OVBA 2XNHA 4JQZA 2ZB7A 2YJZA 5FOTA 4PYQA 3PR3A 1N2EA 3CF0A 3RUPA 4L9SA 1K6MA 3A3OA 4L8VA 5FWXA 3X2EA 5LNK1 1GKIA 2X22A 1XZNA 3L3BA 1G8SA 2Y71A 4B3IA 4KMSA 4LGVA 2E2WA 1ZNWA 4TZ6A 1UIMA 1ZFNA 1UAAA 5KYUA 1T43A 1BE0A 4LQCA 4GKJB 1JH9A 2J3DA 1KYYA 1R6DA 3P27A 3KV3O 4FJ2A 4WXYB 4YP0A 3TQOA 3IPAA 2FQQA 2RHCA 3B1YA 1P7WA 1K4MA 1OE0A 1FE8A 4XGRA 1Z6PA 4Y6PA 2I65A 5BUSA 5LIPA 2C77A 2P9TA 1Q22A 4WXMA 3C48A 4LJYA 1Z29A 4HNGA 4ZOBA 4B82A 2I3AA 2IOFK 4FYVA 3FSEA 2AI2A 4QXMA 3RTCA 3ZV4A 4X54A 1SIUA 4IW3B 4YFYA 4G1UC 2YMMA 1THZA 3DCNA 1E98A 1VJ5A 4BB6A 4V1CA 1KVTA 2YWBA 2JIPA 3U60B 3C98A 4PLCA 4CR8A 4Z4GA 4RWZA 2P9EA 4E5KA 1FFCA 3OOYA 5A5VA 2IP1A 3K8OE 3BXZA 1XEXA 1RI4A 2QMUA 5H59A 3ZWQA 1M1NB 4AKEA 3GFBA 1QHYA 2HCRA 4WLNA 3L7KA 4BFLA 2MWMA 1IFXA 1XTTA 4TSFA 1ECFA 3SMQA 3VSCA 1YS7A 4YY3B 1ZAYA 3HCEA 1PNOA 3RVLA 4N5DA 1HTBA 1JZSA 3S2UA 6CHYA 4F4DA 4CDMA 2B6NA 3TOSA 1EAMA 1T4DA 3CJTA 3NHZA 4FOSA 4I08A 3LBYA 1K8XB 2WHRA 3D0RA 2A35A 3EPLA 1Z3IX 4YMWA 5J9FA 1ZY2A 4JP2A 4JYBA 5IT5A 1NW7A 3K16A 4RW0A 1SRQA 4EYEA 5K4HA 2H29A 5LP6F 2DR0A 5A1TA 1IVNA 4DMGA 4RK1A 3K0FB 2Q0XA 3BFJA 2OORC 2FAXA 1ZD4A 2AFHA 2Z5GA 3BTSA 3PLNA 5EXEA 1GCIA 1N7IA 2ZI3A 3ANXA 4Z5XA 4B2YA 3BTOA 1YFJA 2AUMA 3AXTA 1E1MA 4B3DA 3BBLA 3Q9LA 5G3YA 3NBQA 3R3HA 5C4MA 1DFIA 4JI4B 3PPVA 1R9NA 2WMOB 1OWMA 2IYYA 3KALA 3M33A 4WZ6A 3IJEB 1PR1A 1W94A 1WB6A 3LJKA 1ORDA 3ZU5A 4D3SA 5KOIA 1HDZA 1G63A 2VYND 5FWNA 1LSJA 1NBMA 2W0MA 4A8TA 1ZG3A 4K1LA 4RK0A 1EDEA 1T4MA 4YUWA 4EHIA 3EIOA 1MZVA 1LLFA 5F4ZA 5REQA 3S2EA 3TW0A 4MGKR 5EC8A 3U37A 4DYHA 1NFQA 3KR0A 4TUYA 3QA9A 3G59A 3T7CA 2FOLA 1P7YA 4PAMA 5K4GA 3WYCA 1A9XA 2XSZA 2VLIA 1KP3A 3VC1A 3KTOA 1CUZA 3GAFA 1C9EA 1WD5A 3LZCA 3ROFA 5FLEX 3PGMA 3AF2A 3UMGA 3DF9A 2ZWMA 4RKEA 3O3OB 1YF3A 2FZEA 3T34A 1W5SA 2PCLA 2X3FA 2RHHA 3BE8A 4C0QC 4EHHA 1AKTA 1UEJA 2JBAB 1R6VA 2OBBA 4Z0PA 5TQ2B 4D57A 3FOAA 1Y1LA 1L7QA 4RYLA 1THGA 3QWIA 2AV6A 3R3JA 4OQFA 1G55A 3I8SA 3CEAA 3G5LA 4YB8A 3I2JA 1CEQA 1C8VB 1U2EA 3C6XA 4NABA 4GPIB 5CEFA 2Q99A 3H2KA 2C5EA 3DUFB 3LXMA 4JSRA 3WRXC 1A3CA 4BMOB 2DTDA 2J32A 1S9HA 3VSAA 5KOHB 2V96A 1GM5A 2XTZA 1FBTA 1JR3A 1MMFB 3DE7X 1NXWA 1Z5OA 2C4WA 2NUBA 2RHOA 3OP1A 1T29A 1KDVA 4MW5A 1MX5A 1IJKA 1VKZA 3EBOA 3F1LA 4TROA 4UAVA 3ZZUA 4FT2A 1W36D 3QW2A 2EF0A 1OFGA 1HGXA 4FOTA 4K40A 1YHNA 4R7GA 1OH8A 4FE7A 5DZSA 1ZGAA 4ASUD 3D5QA 1P45A 4L2IB 3F6YA 2WJ3A 3DMPA 4ZYUA 2AEMA 1MVLA 5A05A 3FUTA 3MJVA 4YRNA 4QFBA 2XRFA 2O3JA 4YMVA 4Y2SA 2RSLA 4B35A 5AHWA 1KYVA 1RPNA 1RJEA 1JE0A 2RHJA 3C6ZA 4JL6A 4AIIA 2HSJA 1ONBA 2O05A 1SN7A 3OQPA 3PZRA 3CCCA 3OZFA 2WI8A 3EVBA 2UYYA 3GAMA 2QPAA 3WSTA 2FR0A 2IYPA 3PNYA 3U49A 2ZJ7A 1ORRA 1R1DA 3AINA 1NSYA 2XA2A 4EPTA 3NHPA 2F55A 5EMMA 3NOVA 4CF7A 3G0CA 5IEJA 3C3YA 4PBSA 4U02A 1NZDA 1VPVA 1GTL1 1L7VC 5DTJA 1AQNA 1L1RA 4Z4FA 3MCTA 1R6BX 1YKGA 5EZ6B 4LYEA 3NKVA 3UTDA 3H3XA 3MLEA 4DR2B 4Z53A 4EM6A 3ZE0B 1ISFA 2WDZA 4TLDA 3B36A 3GFGA 3K9LA 5DBGA 3I1JA 2WAXA 1Y3IA 3DE5X 3JQFA 5FWYB 4BKMA 4JI3B 1B74A 5IC5A 3Q87B 1Y6RA 3V4VB 1WCXA 1Z45A 1SY7A 3D9QX 3QWBA 3IODA 1HOXA 3ITNA 2X9QA 3ONNA 1XYYA 4MNTA 1GA6A 4L51A 4QWMA 2AEFA 4JI7B 1DHTA 3R0VA 2HAEA 4MUJA 3VZSA 5DLDA 1ZK2A 4DB2A 1JW9B 1LEHA 1PS0A 3HUTA 3MTDA 1YVUA 3DLCA 3EFOA 4DGQA 2LKDA 2HF2A 1VPDA 1K2WA 1I32A 1N57A 5BMOA 1UFVA 3LQ1A 1KI1A 2HNBA 3CR8A 3EIEA 4BVHA 3WJ7A 4Y67A 4BP1A 4DDKA 3G2NA 1L7NA 5B37A 1QAMA 4NR0A 3LH5A 4ID3A 1FFDA 1G8PA 1JUDA 3R5FA 5K0FA 4W5HA 4QECA 5JVDF 4JLPA 1T5OA 2O6HA 4KVGA 4P36A 3CLTC 4GXQA 4DABA 3TUIC 2B2CA 3USCS 2XLCA 1XVAA 4LBYA 3VOBA 3FAKA 5BWCA 1HNXB 1QXSA 3G13A 1CUSA 1XDGA 3LIIA 4KTVE 4RMGA 1UBTS 3UT0A 1CLEA 4CF6A 3HXPA 4CLRA 2XZDA 1G8GA 2IITA 1HEYA 4E5MA 3CU7A 1U8YA 5PGMA 4ND8B 3SQOA 1TEZA 4C4YA 3R5KA 3OP4A 4GZMA 2CXNA 4LXUA 2LCFA 5CFMA 3U9SA 5BUQA 5KYYA 2HBRA 3T3OA 2YWHA 4FYPA 4B7AA 4Y6QA 4KX3A 1BVUA 2CMHA 2XH8A 3PKZA 4DZRA 4EJFA 5CH5A 3LTNC 4MV7A 4EPXA 1RCFA 1KVQA 4ZYTA 1AC5A 3PX3A 4WLVA 3SHWA 2EW2A 3ZR4B 2DBYA 1QKKA 2IYEA 3BGIA 1DV1A 1NHGA 1YS9A 4CL3A 5JR3A 1N0IA 3LUJA 4XCVA 1EP1B 3NQ41 2DYKA 2IUFA 4F4FA 5I8ZA 4CI0B 1BS1A 4DIUA 3WLPA 2KSQA 5KTYA 2H51A 2ZRGA 3AETA 4ER6A 1PV2A 1VHDA 2F3RA 2LIPA 4JDPA 5AH0A 1YK0A 2DVMA 5ICCA 5AI9A 4UM9B 4XVUA 3S99A 5EGSA 1BW9A 3BH6A 3CUSA 3L8ZA 4Y2HA 5FLXA 3K20A 4RIIA 5LDHA 2ZSKA 3FH0A 4JA0A 3TM5A 3UT5B 1OHHD 4E51A 3I6QA 4GMDA 4O2LA 1J0CA 2B94A 2B8WA 2NU7A 4PBTA 3IOEA 4FFOA 2XOKA 2ZJ2A 2QROA 4OK5A 1IY8A 2ZTVA 4Z3DA 5BMVF 2R6R1 3F5FA 3JV7A 1W4CA 3NUQA 2QI9F 5FL3A 2EZ4A 3M6WA 1GPYA 2B8JA 3WL6A 3QEOA 1E5DA 1KDYA 1EU1A 5ALSA 2V65A 4ZAYA 1ABEA 4ZT2A 3C6BA 1BKDR 1JTEA 3AHEA 1RWQA 4ZKDA 3NVKI 1TEVA 1WKBA 2LWIA 2FQXA 4FDTA 1G20B 1KO7A 4MQEB 4O25A 4PLPA 4UAJA 3L01A 5E6RB 5JYCA 3E6AA 3UB3A 3PQ5A 5DW3A 5E3IA 5IKMA 4A15A 1LX7A 5KYGA 5JCOA 5ED4A 4Z9FA 1PZGA 2RCYA 4YRDA 5EMJA 1A5AB 3BXFA 3VUEA 3P19A 1XXLA 2RHBA 4FI3F 1XQXA 3LVFO 3BCHA 1VYTA 5CFRA 3VHRA 1OKKA 3D3EA 2C2OA 2H1FA 4UCFA 1E9DA 4HWTA 3VDXA 1OPXA 2Q1YA 3B3FA 3X1YA 3IUPA 3WMFA 3STYA 4BBJA 1RI3A 4PCAA 1OZAA 2HA5A 3U80A 3W78A 4MVCA 1WM1A 1ZOSA 2B4YA 3DV9A 1H1LB 5B1YA 1AS3A 1ZRHA 3E2MA 5GTDA 3INYA 3L4BC 3FSRA 3TTVA 2E4AA 2FY8A 3D4PA 4D9GA 1QG2A 2IEGA 5EJFA 4R6XA 4YMIA 1EBUA 2PQ0A 2YMPA 2VTDA 4RZXA 1NURA 4XIIA 2WU1A 2QMYA 5G0WA 4A5SA 4LRTB 5KYWA 1XZAA 1FMLA 5K9ZA 5B12A 5I4KA 4BGVA 4E5YA 4ZAFA 3DMGA 2YN2A 5AKIA 3GLUA 1OXUA 2XB9A 3DL4A 3T7EA 3GDWA 4XUEA 2REQB 4M49A 1JU4A 3REFA 4TTRA 2GNAA 5JNTA 4R98A 1UDAA 1IXRC 5JSFA 2ADOA 3I9FA 3T9CA 1UPBA 2ZYRA 4P3OA 4LXIA 1IM8A 2VRCA 3HADA 4PFSA 3RE1A 4ZV7A 5BXYA 1XTJA 3BQNB 2D0IA 2G0NA 2GZSA 1BMDA 2ZAMA 1RWBA 4ZK6A 1CQIA 5C1IA 3HCDA 3JPYA 3PFHA 5B6PA 2XYVA 4D8WA 5CNKA 4KODA 5C32A 5JPMB 1K9VF 1YVRA 2REOA 3EF3A 3KQOA 4IGKA 3T5MA 1VCOA 3HG7A 5JTWA 1CY2A 1T3TA 4G86A 1JILA 1A27A 1Z7BA 1IUKA 1DHRA 2GPSA 5K0JA 4RSRA 2ZIXA 2FFHA 4CT5A 3TRHA 4JGIA 1WDLA 5ENVA 3LKZA 2HPZA 1IXYA 1IBKB 5C37A 4XJSA 3GLSA 2OUIA 1TA0A 1CKEA 1QJ4A 4TXLA 2A5GA 1EWVA 1QE3A 3NETA 1V9LA 2G83A 1WCIB 1ZI6A 3HV2A 3PQ7A 1E2HA 3WV4A 3C97A 3OKAA 2AW5A 2C5GA 3WLTA 4CQMA 2YHBA 1ISRA 1GY8A 1W29A 5EPOA 1JB1A 4GX5A 4Y2QA 5GGYA 1JIUA 2PKQO 3AHFA 1PR2A 2ZG6A 1X42A 3AX6A 4M7RA 1OZ0A 4QGFA 4HPJB 1IQUA 1OYWA 4BFXA 5I48A 2XGGA 4MAFA 4K3UA 3MEQA 3OETA 3KEFA 1IHOA 1T5SA 4N5MA 5DCYA 2BKLA 4IIDA 3T1VA 3DLHA 3R4VA 3A36A 3MGAA 1HEUA 1LPPA 3SZUA 4BAZA 4KSCA 5K8LA 1WA5A 4DA8A 4D25A 3SDZA 1IY0A 1SC6A 1YB6A 4CV3A 2A33A 2CFOA 1SKAA 4BEVA 4KR3A 5T5QA 2PJUA 2OY0A 1JI3A 5DGDA 4ZZ1A 4PSDA 2I33A 2WB4A 4J3NA 2O9JA 5HZGA 4AZ3A 3ESAA 3DQZA 2HHLA 1BXGB 3WHIA 1EVKA 5H5JA 3RVJA 2LXNA 4EVSA 1NWHA 2R7KA 3HI4A 3LBAA 1KF0A 5BYKA 4NYJR 5D5PA 4OF4A 5FNVB 3M6XA 4ZWNA 2N9UA 3F3SA 3M9WA 4EG6A 4UTNA 4I9FA 3MK31 2GXQA 2XWJI 3DOUA 4GI5A 5CA1F 1QK3A 2ZRNA 3G8DA 4G5QA 4QPDA 3KKKA 1NVTA 1PL0A 2W4IA 1OILA 4KQ9A 3MJRA 3THWB 4E0BA 2EGHA 2PWAA 2IW1A 3LKBA 1AKWA 4AP6A 2AT1A 1RP7A 1ZN9A 5K0NA 1M1YA 5CB4B 1K27A 2HUNA 3JYNA 3EW9A 3I1IA 4I9GA 4OHUA 2WUVA 4V0NA 4CTNA 5AW2A 4FZRA 4EJ0A 3OZCA 2XNJA 3ENNA 3NC4A 3I2IA 3QNWA 2IEAA 4J3FA 8AT1A 5K0SA 1RLTA 2IF2A 4XWWA 5F12A 4PZ9A 3LX6A 4O4HA 4D43A 1Z2EA 1NQUA 2GBIA 4FN4A 1TYEB 1YR6A 4TV8F 4CQLA 1XFAA 2I29A 2Z6UA 2ZSDA 3G17A 5EE9A 3H4VA 3QJ5A 1HETA 4HVAA 3WOVA 1HR0B 4HQOA 3UMFA 2W58A 4Z7OB 3BD9A 3U40A 3QXHA 3E0QA 2APJA 3B1KA 1JYSA 1R5JA 4B80A 4Q18A 4X44A 1QQ5A 2D5BA 2FPLA 3BE5A 1FU4A 3AR5A 1IBCA 4H3SA 2QUJA 4TKUB 1F14A 1Q91A 1A2KC 2Z6AA 1W4RA 2BZGA 2UZAA 3IIIA 3W8RA 3UUEA 3H3FA 4RH3A 2YUIA 2AI3A 2ZYDA 3HCOA 3SSNA 1XD2A 4AJNA 3ZE1B 2HZBA 3GNLA 4P2BA 1ZNZA 1JYEA 1XK7A 4RS3A 4ITRC 1IIBA 3P9PA 5JZBA 3R6DA 2XYPA 2L82A 1KMCA 4OXNA 4AIRA 1MB2A 5BNIA 1RQ2A 1WMEA 2SCUA 2HXGA 2A5FA 4N3CA 3D6MA 3NHMA 4TV9A 3DF7A 4X63A 3DEKA 3CR7A 4BO0A 1QHXA 3H8JA 4XYMA 2YCLA 2ATIA 4PNEA 5CDUA 2ZUFA 3AF3A 3TIVA 1XLVA 3FOZA 1CZOA 4S1VA 4AKTA 1F12A 4MCHA 3LM8A 2VJOA 4EHBA 2RD2A 5I7RA 3LCVB 5CW1A 5ARCA 3E4CA 2H54A 3LX4A 4FYKA 1K8RA 3BGSA 3SPXA 2Y2VA 1RPAA 5LN1A 2XXAA 4MQ6A 2HN9A 3OZGA 2ZVJA 5ED0A 5KS2A 2BH9A 1IBLB 1I3KA 1A71A 1EUDA 1O6CA 4Q01A 1L5YA 2FEXA 4JP1A 4X1YA 1T8YA 1K2VN 1BYIA 1YS1X 3EAFA 4DBZA 5LYJB 4WWHA 5SZKB 3EGEA 2RE8A 3ZU2A 5CB8A 1UZLA 1MT3A 3HM9A 2J0SA 4P53A 2HDOA 3B53X 1U8EA 5EJ7A 2WIGA 1NJ5A 1PNTA 1CHNA 4Q4JA 2VQFB 3RAJA 3NHWA 1GZSA 4I50F 4YYEA 3CUYA 1HE3A 5K3SA 4E33A 3OCZA 4I4TA 4OP2A 1GKKA 1YZTA 4FYMA 3JWIA 1X77A 2RFLA 4HEJA 3CN9A 1QGED 2WIFA 2XNCA 1DRVA 3AUSA 1KK0A 1DAGA 1P0IA 3I2GA 2QTLA 3MELA 4R7TA 2WSMA 3VNRA 1IC6A 1A04A 2O8BA 5JNUA 1MVOA 5AK5A 4JBNA 4MV3A 2JIMA 1HFEL 3LUKA 4BLPA 1XPRA 3CWQA 4MGIR 4Y2RA 1IN1A 1GP2A 5EJ6A 2BI8A 4IJ5A 1UZNA 2AC7A 3GARA 4JJZA 5CAEB 3E7WA 2V7GA 1Q0HA 4BN5A 2H06A 4QLBA 1OHHA 1OZHA 5FTNA 4Z4QA 5HIIA 4K9OA 4HPWA 3I64A 2VF4X 4WVFA 4X7BA 3RJZA 3T1TA 4UOEA 4PLZA 1B7GO 3R5XA 4XGNA 6YASA 1E2JA 1I2DA 4ZVVA 2O8BB 2DFDA 2PYIA 4HQ6A 2IEIA 2FVYA 1O94C 1V7ZA 4M1ZA 3P4UA 4QPNA 1R8SA 4G5YA 4X6LA 4UUQA 4EWLA 4WKCA 2Q9BA 3OZ7A 1WY5A 3U4QA 3FPCA 5DISB 1NR1A 4JP5A 4MRAA 5FUQA 1KPGA 2C3YA 4WXEA 2RGXA 3PC8C 3WJ1A 3E9ZA 2HJ9A 4UPEA 4HWPA 5HGJA 1JG6A 2ZUUA 3KHSA 5C9ZA 2G6TA 3B6EA 3C6YA 4C3VA 1HQCA 1WV0A 3DZGA 3U3OA 1FVFA 3W2EA 1YHYA 1NBAA 4UTVA 3K0BA 1JMYA 3VU1A 3WQSB 4JJEA 4IIYA 2N75A 4CL2A 4J1TA 4XIJA 4ZGBA 3X0DA 4YV7A 3AK4A 2C42A 2IXDA 3AI3A 3IKLA 1Y9JA 4G8CA 4MV9A 2H1VA 4QVKA 1CYDA 3AZPA 4OU5A 4KJXA 2GYYA 2F2TA 4AMBA 1SWWA 3QTLA 3HCWA 3FCCA 5KU1A 3P2IA 2WQ7A 2BDUA 5L40A 3VYWA 3UXHA 3MPOA 2GARA 4UVHA 2HCBA 2H1SA 1X1CA 3GFQA 4DEVA 5I7FA 4MQUA 2R1ZA 1OXVA 2XEXA 3ZDFA 2J9GA 4KXWA 2X58A 1Y9EA 3P9ZA 1U9ZA 4A5OA 1L7OA 4KKVA 1KO5A 3Q3CA 5CDHA 4B5LA 5HQ3A 4BUJA 5JYEA 1ZRNA 1BVYF 1GQ2A 2ZUWA 3ECAA 4LRSB 3ZKAA 1EP2B 2JIDA 2F8LA 1HPLA 2CB0A 2VXOA 3OZUA 4LZNA 2WINB 3OPYB 4DPKA 3FFBA 3H1FA 3ZV7A 3ZK7A 4BO7A 3TFQA 2X9NA 3G0BA 1UFRA 3GQBB 3S8MA 3FAZA 5F5LA 1YZGA 2ONKA 1KS2A 2ZJ4A 4NATA 5KHLB 4WKBA 2PWBA 3FUCA 3HACA 3I5UA 5EUCA 4AQYB 3NM6B 3QLVA 3I6IA 1YC5A 4RA6B 3HB1A 4FMBB 3C3PA 4P8RA 4HVCA 3CEJA 5DNCA 4OB7A 2PZ8A 3IAM6 3T3NA 2AYZA 3BJEA 4RGVA 5ADHA 1LDMA 3JQPA 2ET6A 1EHIA 1XK6A 5BR7A 1X8XA 3NTXA 2CC2A 2XTJA 4HG2A 5C81A 1YNSA 3DTNA 5AK3A 4XI9A 3QU9A 3MNFA 4PG5A 4C78A 1BDHA 1PJTA 1T4BA 3DTVD 4L3OA 2N1BA 3FSJX 5IAOA 1NNUA 2XGOA 4IQ0A 4ZHQF 2G07A 3NOQA 1W5BA 3OX1A 4QHTA 4YH1A 5KCMA 2BP7B 2GERA 3H84A 2HSWA 4EHKA 1TT5B 1U0RA 2BUCA 3N59A 4N0QA 2FEKA 1GSOA 4FBGA 5TT1A 1AZSC 1RRGA 2YOHA 2X2OA 3G85A 4LV5B 5FTJA 1O77A 1QTQA 1ENZA 3CJQA 2M9MA 4KVAA 4C0KA 4MA4A 1P3DA 3TBFA 5L45A 5A9SB 4KNWA 2KBEA 4ND1A 4L16A 1G98A 1CIVA 4Q21A 3EY4A 3W5HA 2GPWA 1Q74A 2GTPA 3OEEA 3GUYA 3L6DA 4P4SA 2MSEB 2EDAA 2EU8A 4UBIA 3RVOA 2NU7B 3FTEA 4KH0A 2PU5A 1EA5A 3HJCA 3VV3A 3M49A 4URYR 2EQ5A 3CWZA 4MR8B 3WZLA 2IHUA 4A8JC 1R64A 3SS8A 5KNCA 4HJRA 5BNFA 2QBYA 1EE9A 1SG6A 5COQA 3SYMA 4B2IA 1H1TA 1TO2E 1AGRA 5DXFA 3CUVA 3V4RA 4ZQGA 4O1IA 5DLPA 3VSBA 1TECE 2ES4A 4G0MA 5GWXA 4TMTA 2IPOA 1EVLA 1DX4A 4F1JA 1AQIA 1WLYA 3E9QA 4NMLA 1Z6TA 2A5JA 4GBED 2AR0A 4RM2A 4YCAA 4F4HA 1WXQA 2OD9A 3WK9A 3MMPA 3JY6A 5C18A 4B3TB 3SEQA 1EINA 1VQ1A 2YV3A 3D7RA 3PVSA 4F3NA 2WU0A 2EAUA 4IJ6A 2NAPA 1GKYA 4I2VA 3WFZA 1TTTA 1SD1A 5JADA 5CT8A 3PNSA 4KFTA 4BWFB 4NS4A 4TTTS 2BOVA 4OQLA 1GGHA 2VRWA 3IJRA 3TTYA 3H11A 2A6PA 3I45A 3GGJA 5H0IA 4D9IA 4RD6A 1YVPA 1SBYA 3C45A 2EKZA 1B41A 3SS9X 4Q3CA 3TLBA 3OTOB 2EYUA 4U3JB 1UWKA 2BFEA 2NSHA 3PL5A 4LZAA 4ZOAA 4QNRA 3JAMA 3ZIAD 3RG8A 1E0KA 4WKNA 2XHEA 3VNBA 2G1UA 2ZRLA 4FD2A 1D2HA 1T9GR 5CD1A 2F67A 1KGDA 3WIVA 1W4AA 4N8EA 3AONB 1AE1A 2HNKA 1QM5A 2XF2A 2YOGA 3BWMA 3BWBA 4GL2A 4N7BA 5AVUA 3L93A 3RWMB 2NYRA 1QQAA 5MDHA 4JKYA 3IAAA 2FQYA 1U2DA 5DEIA 1K63A 3AHHA 1PLJA 1XAJA 3F6BX 1S2DA 4O29A 4UNNA 1ZCJA 2X7HA 4Q4AA 3GMIA 4WLOA 4Y6RA 4ESVA 5HK8A 5HTOA 4XVRA 1SUSA 1Z4JA 1BROA 1GU0A 4LV6A 3GNQA 1ZZGA 2G9ZA 3A4VA 3DAYA 4RC9A 4JNCA 2CK3A 1V1MB 4GPBA 3SN6A 5T3YA 4KK3A 3S2YA 3NT4A 3H6HA 3WL4A 4LV8B 2CHEA 1TOAA 3B7WA 3DVSX 1PWEA 4OXIA 1DDIA 4N3BA 1KEZA 1LQUA 3ESCA 4YCMA 3H4MA 1V26A 1T0PA 5DCLA 2CT8A 1HZZA 1T1IA 3P0JA 3B5EA 1UP6A 1XU7A 2EJVA 1E7WA 3OIWA 1TJ3A 4XB6B 3VYVA 2YFQA 4DJAA 4KQXA 3FNEA 3JZDA 4C20A 3VYSB 2I8LA 1QDLB 3TWOA 3W1VA 2R85A 2PKWA 4NYJQ 5IJ9A 4PSAA 1VMIA 4RESA 4IGFA 4MAAA 4QYMA 2SECE 2D2XA 1UDRA 1CF2O 1BXRB 5EE1A 1EIWA 1E18A 1ZIYA 3WWPA 3VNAA 1OBVA 1ZVJA 3NO4A 3HL4A 3JYPA 2FETA 2XUZA 4WOBA 3LY5A 3CKYA 1JKJA 1TXGA 2B7LA 3D3WB 3ZLTA 2QORA 4LJ7A 3HB9A 1DRJA 1XLTC 4L5IA 5DHQA 2P4HX 3V4OA 4R5HA 1IZYA 4YAEA 4H4EA 3TVDA 3WNDA 4AY3A 3LUHA 3TD9A 4ZO9A 1RPTA 4LDAA 1AA6A 2ZYWX 1JR6A 3KLSA 4F4JA 3TECE 1MV5A 4XR4A 3RYIB 4KXYA 4K9NA 4C7BA 5ADUS 1BHQ1 1YRHA 3M1IA 5JMWA 1O8BA 4IOKA 2EKLA 4O1MA 3SQMA 4BUCA 1FXWA 4CODB 1USWA 2C2YA 4RZUA 1JDSA 4C9BA 2CKMA 3WBKA 1HTWA 1Z0KA 2JI4A 3QXCA 4CIYA 1G3MA 1K6JA 2QZPA 1TGVA 3UNXA 5KTNA 4G4SO 5KWVA 3HMKA 2UZ1B 2O1SA 4C22A 2V7UA 3KNZA 2YNMC 1KNXA 16PKA 2H2IA 4LPKA 1T9ZA 1Z8NA 4UDOA 4ZVMA 4OFBA 5DNEA 4G0PA 1HT0A 2RGUA 2Y1DA 4O6VA 2OP0A 3SZ3A 2WFAA 3GG2A 4YT8A 1TZBA 3EGVA 3AEQB 1H2HA 1R4MA 2AYXA 1O95A 1EQAA 1SVWA 3ZY6A 4EGQA 4F38A 3RC3A 1PFUA 1W0KD 2HCJB 2O2IA 2I55A 2XWBF 5LB4A 5KNDD 4KREA 2OMEA 3Q3HA 2AXQA 4DM3A 2H4FA 2UYGA 5CT4A 5J4LA 3UK7A 2D59A 3SS7X 5HJ7A 1Y9AA 3GEDA 1TF5A 3ADCA 2O2GA 1ZI8A 3F71A 2V7WA 2Z83A 3QF7A 4RLQA 2VZ9A 2PBFA 4EG7A 2B98A 2A1TS