2OYRA

Crystal structure of upf0341 protein (yhiq) from shigella flexneri in complex with s-adenosyl homocysteine, northeast structural genomics target sfr275
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
250
structure length
245
Chain Sequence
MKICLIDETGAGDGALSVLAARWGLEHDEDNLMALVLTPEHLELRKRDEPKLGGIFVDFVGGAMAHRRKFGGGRGEAVAKAVGIKGDYLPDVVDATAGLGRDAFVLASVGCRVRMLERNPVVAALLDDGLARGYADAEIGGWLQERLQLIHASSLTALTDITPRPQVVYLDPMFPHKQKKEMRVFQSLVGPDLDADGLLEPARLLATKRVVVKRPDYAPPLANVATPNAVVTKGHRFDIYAGTPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UPF0341 protein yhiQ
publication title Crystal Structure of UPF0341 Protein (yhiQ) from Shigella flexneri in complex with S-Adenosyl Homocysteine, Northeast Structural Genomics Target SfR275
rcsb
source organism Shigella flexneri 2a
molecule tags Structural genomics, unknown function
total genus 69
structure length 245
sequence length 250
ec nomenclature ec 2.1.1.242: 16S rRNA (guanine(1516)-N(2))-methyltransferase.
pdb deposition date 2007-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04445 SAM_MT Putative SAM-dependent methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2oyrA02
3.40.1630.10 Alpha Beta 3-Layer(aba) Sandwich S-adenosyl-L-methionine-dependent methyltransferases YhiQ-like domain 2oyrA01
1G8AA 4M38A 3MHTA 2ZSUA 3X0DA 3FUTA 2YXLA 1L1EA 2ZIFA 3I5UA 5EIFA 2B9EA 3KQVA 1XXLA 3E8SA 2IH2A 5EG5A 4E2XA 1QAMA 2Z6AA 3ANXA 5FWDA 3VYWA 4XUDA 5GM2A 3G5LA 3M33A 4FR0A 3BKWA 3KPVA 5CVDA 3FUXA 2IH4A 2EJTA 1JTEA 2UYOA 1SUIA 3LBYA 4WXHA 3TM4A 1O54A 2G72A 2ZZKA 3EGVA 2ZFUA 3M6UA 4Z2YA 2NP6A 4AZSA 5B1SA 3UZUA 3UFBA 3FRIA 3C0KA 3O4FA 4V0RA 4M37A 1M0EA 2IPXA 5D1NA 4CKEA 4DKJA 2AOUA 1I4WA 1KR5A 3CCFA 5CVUA 2OB2A 4IKPA 4BY9E 2O57A 2BR3A 2YX1A 5DRYA 2JH8A 4P58A 1UWVA 3KQYA 3NMUF 3LX6A 4NECA 3CGGA 4RVDA 4DA4A 3DMHA 4C04A 4YUYA 3NVKI 3P9CA 1BOOA 2P7IA 3BWCA 4IV0A 2XVMA 2I7CA 3SGLA 3VSEA 3BZBA 1QAQA 5FA5A 1KP9A 5HZMA 1VPTA 4PGGA 1R6AA 1XJ5A 4QPNA 2QE6A 5EZQA 5CCBA 4QQKA 4PGHA 2I9KA 3HCEA 2V7EA 5CVJA 3SR4A 2AZTA 5K0JA 2QRVB 3DULA 3PX3A 3ELWA 4E30A 4RYLA 1UFKA 2FPOA 5ICCA 4GOOD 3FTDA 1L3BA 4BLVA 1AQJA 5CCXA 3C6KA 2OZVA 3MCZA 4OA5A 3G2MA 1I1NA 5EQJB 3LBFA 3A25A 4ER7A 2XBMA 1P39A 5JUWA 3FPEA 4KDRA 2OBFA 3DXXA 2NXNA 5DM4A 2HTEA 2ZULA 3TPZA 5DTRA 3PTAA 2Q41A 4X41A 3TR6A 2P3OA 4LWPA 3OCJA 3PX2A 4E32A 3FUVA 4YMHA 4P7KA 3EMDA 3KQPA 4FSDA 4WVLA 1FP1D 1D2GA 10MHA 2IBTA 2YUIA 2FHPA 4G56A 4HH4A 5EMLA 1VP3A 2WA2A 1ZGAA 4EVIA 4RVFA 2UYCA 1OR8A 3ELUA 5CVVA 1R8XA 5F2OA 3THSA 2ZWVA 3G7UA 3B3FA 4E2WA 3PT9A 3NWEA 3UJ6A 3GRVA 3HA7A 3U81A 4FZVA 4UOEA 1RJFA 1VL5A 3M70A 2ZBRA 3MGGA 4R6XA 3REOA 4AUKA 1NW6A 4DM3A 5K0CA 2AVDA 3FTFA 3TKYA 3SM3A 4RTSA 4GUAA 4C03A 4HRAA 5DM2A 1O9GA 4ER0A 5LQJA 2BR4A 5LQKA 5E2AA 1RJEA 1VP9A 4GOMD 3CJRA 2P3QA 3JWJA 9MHTA 5H02A 3G5TA 2YXEA 2YXDA 1B42A 3LHDA 1WG8A 3AXTA 3HVKA 2C7PA 4X1OA 2ZVJA 3K6RA 1P1CA 2NXJA 5DX0A 4EK9A 1R00A 4CXMA 3P71T 5FHRA 3GCZA 1KYZA 2XYRA 3HVHA 3M6VA 5T67A 5U4XA 2AS0A 4HTFA 5LQAA 3LCUA 4YUXA 2C7OA 1FJXA 1YZ3A 1JQDA 8MHTA 4BP3A 1RI4A 3R0QA 3OU7A 5T6BA 4LECA 2NNWB 3C3YA 3UJAA 2OY0A 3SSMA 2IGTA 5KS2A 3KQOA 5FWAA 5BP7A 1XDUA 2P1DA 1SG9A 4R6WA 3EVFA 4ER5A 5GIOE 1KPIA 2CMHA 2ZTHA 5GIPE 4CTJA 3I58A 1V39A 3PFHA 4KIGA 3FYCA 3MERA 5EEGA 3P2EA 2B2CA 3FUUA 3VC2A 4GEKA 2UZ4A 2PWYA 3LKZA 5EEHA 3R3HA 4HG2A 1DUSA 1KPGA 1JSXA 3DMFA 3MB5A 4EKIA 4OQEA 1JR4A 2AOWA 3KU1A 3G8AA 5HFJA 2XYVA 4EQZA 2YQZA 1IY9A 4PYNA 5E9WA 2ZCJA 3T7RA 1NT2A 4CKCA 4X61A 5FULA 1R18A 3HCAA 3TM5A 4K6MA 1F38A 4MWZA 1BHJA 2OPBA 1EQAA 2XVAA 2BH2A 3G2OA 5E8JA 2I6GA 2EJUA 3AY0A 3A7EA 3EVDA 3LL7A 4P7GA 2ZBQA 3PS9A 1VIDA 3OU2A 5F2KA 3THRA 4GOND 2B3TA 5CM2Z 4RTLA 1BC5A 1SKMA 2G70A 1BKYA 5EVJA 2PXCA 2ONYA 3OZRA 4FGZA 3GRRA 4MQ4A 3HTXA 4F85A 2G71A 1XDZA 2PSSA 3EVGA 3OFKA 3GNLA 4OA8A 3UJBA 4FSXA 2VDWA 4FT2A 4C4AA 1WS6A 3FUWA 1SVUA 2H00A 5DSXA 3UJ9A 4F84A 2P7HA 4AZWA 5K0EA 5M5BA 1MJFA 4KW7A 2ZZNA 1SQFA 3A4TA 1EIZA 3HCBA 3LSTA 3JWHA 4PYMA 4R05A 3HVJA 5EKXA 1JSZA 2CWWA 3AXSA 3KHKA 5GWXA 4HTFB 3CKKA 4FP9A 2FRXA 3UBTA 4MTLA 3KR9A 1RJDA 3TLJA 4AZVA 3I64A 4CTKA 3A7DA 2VZ9A 3BUSA 5FUBA 2OO3A 3B3GA 4EKGA 1WZNA 3B5IA 5CD1A 3ERCA 2Y1WA 3D2LA 3BWYA 5G02A 2YVLA 3PLAE 1YF3A 2AN5A 5IH3A 3E05A 4RTPA 1RI2A 1L3CA 3FTCA 3P2IA 3GRZA 3QV2A 4GC5A 5JR3A 5KVAA 5FTWA 4QVGA 3DH0A 1X1CA 1Z3CA 3AWIA 4IWNA 4RWZA 1G60A 1TW2A 2P3LA 2H1RA 3BXOA 3G89A 4AX8A 1KYWA 3IV6A 4EMSA 2AOTA 3HEMA 3KQWA 2C7QA 3K0BA 5GP1A 1MHTA 2AN3A 3FRHA 1WXXA 4AZTA 5T64A 4E2YA 1X19A 4PYJA 1ZQ9A 3BGIA 5E9QA 1Q0TA 3FTEA 2GH1A 1ZG3A 2PX4A 3ME5A 5E1DA 3LDUA 5DTQA 1RJGA 3DLIA 4V0QA 2BM8A 4OBWA 4KVZA 5E1MA 2FK7A 2CMGA 1EJ6A 1QYRA 5FCDA 4A6DA 2UYHA 4YV0A 3GO4A 3KQTA 1JG3A 2IDKA 3R24A 4QPPA 2FYTA 2OKCA 3TFWA 3MTEA 4Y2HA 3HCCA 5DSTA 5MHTA 3GDHA 5DM0A 1T43A 3E23A 1YUBA 3KQMA 2BZGA 1NBIA 1KXZA 1O9HA 2ERCA 2P40A 4PINA 5FHQA 5ICEA 4X63A 2JHCA 1M6YA 2BR5A 5LSAA 2IH5A 3BT7A 1TPYA 3GIWA 3KPYA 3UJDA 3TKAA 4MIKA 3QOWA 5EZSA 5K09A 3DMGA 4QVKA 3G2PA 4C07A 2F8LA 3I53A 3FYDA 4OBXA 3T7TA 2ZWAA 2AR0A 3FZGA 4XUEA 1TW3A 2AOUB 3DTNA 1NW8A 3EGEA 4U7PB 1XCLA 4GBED 1YZHA 4KDCA 2B25A 3FPFA 3OZTA 1ORIA 2JHAA 2JJQA 4C05A 3KQQA 4RTMA 1AF7A 2WA1A 3G2QA 3LCCA 2ZIEA 3KPWA 2YR0A 2DPMA 3GWZA 2FK8A 3CBGA 3ELDA 3EVAA 1RI1A 4PCAA 2H11A 1PRYA 3QOXA 3SX0A 1X1AA 5DTMA 4CKBA 1RI3A 3PVCA 3NJRA 2VDVE 1QANA 2WK1A 1FBNA 1G6Q1 2P35A 3OE5A 2ORED 1EJ0A 5DLYA 5GM1A 5FA8A 5ERGB 4DCMA 4Y30A 2IFTA 3KPJA 4YV2A 3ELYA 4PYLA 3B89A 4HGYA 1Q0SA 2HWKA 2AOTB 3IEIA 2NP7A 5FADA 1XDSA 2NYUA 4E70A 5KYGA 1N7JA 2GPYA 3M6WA 3OE4A 5KQSA 2GLUA 1P91A 5C0OE 5BXYA 1ZHFA 1IM8A 3LKDA 4GQBA 5BW4A 4CWAA 4XCXA 3L8DA 2BM9A 2N47A 3MCTA 3DR5A 4IV8A 5CVEA 5FQNA 4YUZA 3EVCA 1DCTA 4RVHA 4LWOA 2NXCA 3NVMB 4PNEA 4YUVA 2JG3A 3GGDA 3ORHA 3KKZA 3HM2A 5DM1A 2PXAA 4DF3A 5F2NA 1EAMA 2PJDA 3SSNA 4LG1A 4JXJA 5K05A 4DCGA 3S68A 2O07A 4GOLD 2R3SA 2NXEA 4PIPA 5C9ZA 3TMAA 3UA4A 3GRYA 3KPUA 3ID6C 3EVBA 3EGIA 2OYRA 3OFJA 3P8ZA 1EG2A 1NKVA 3OZSA 4ISCA 5DWQA 2LD4A 3P97A 5E1BA 3UA3A 4MHTA 1YB2A 3NDJA 1U2ZA 5FQOA 5K0LA 1UIRA 3KQSA 3M6XA 4OQDA 5GINE 2B78A 2ONZA 2Y1XA 5EOVA 1X1DA 2O06A 3DP7A 2XYQA 5LR6A 1YFJA 5DRTA 4ER6A 5DXJA 3P2KA 2G8NA 1NE2A 5K0NA 5HIIA 5LQCA 4KIFA 3SXJA 2UYQA 3EEYA 3Q87B 3BWBA 2V74B 1XVAA 3TRKA 1R74A 3HP7A 4KRGA 3T7SA 3O7WA 5DT2A 3UJCA 1G38A 1F3LA 1ORHA 2IDJA 3WSTA 1VLMA 2PGXA 2PT9A 2PV0A 3DUWA 1KHHA 3HA5A 4ER3A 5KQRA 5D1HA 3GRUA 2G1PA 2YTZA 2OB1A 2Z6UA 1JG2A 3MAGA 2GS9A 2QYOA 2QY6A 2ZBPA 3FPJA 3ER9A 4DQ0A 1QZZA 3V97A 2PX5A 3HVIA 3JWIA 2PXXA 4R8RA 1HNNA 1RI5A 4PIMA 4C08A 2PT6A 3KR1A 5LQRA 5C1IA 5EMJA 3UJ7A 3BKXA 3Q7EA 3F4KA 3SVZA 5HIJA 4F86A 3RW9A 3UWPA 3E7PA 3DOUA 2A14A 1FP2A 1D2HA 1INLA 1ZGJA 2AOVA 1NV8A 3BWMA 3DLCA 3HNRA 2PX2A 1R8YA 2R6ZA 2DULA 2KW5A 2O05A 3HA3A 1VQ1A 5CUQA 1NBHA 4PWYA 3G88A 4L7VA 5CIYA 4GF5A 3R9XB 3BGDA 3NW9A 4RVGA 5EPEA 3HCDA 4YV1A 5K0GA 1VE3A 3OPNA 3PFGA 3IYLW 4RTOA 3KR0A 5EMMA 4RTRA 1M6EX 4C06A 4YMGA 5HOQA 2HR1A 2JHPA 2HMYB 4PYKA 2ZZMA 4DMGA 1JQ3A 1X1BA 5EGSA 4POOA 1N2XA 4FT4A 3I9FA 5K01A 2GB4A 4FS8A 3NWBA 1IXKA 4RX1A 4PYQA 1JQEA 2AVNA 3B7PA 3CC8A 5EHGA 1N7IA 2IP2A 1YFLA 3LPMA 2ZIGA 3P9NA 2Z6QA 5P8WA 1NW3A 3JWGA 5K0FA 2GAFA 3PB3A 4E33A 4HC4A 1L3IA 4XUCA 5EHIA 2JH9A 4KWCA 5K8VA 4QDKA 4M7RA 2P8JA 3CVOA 4RSRA 3TOSA 3DXYA 2PKWA 1PJZA 3KR2A 2HNKA 4RV9A 5EC8A 3RIEA 3OU6A 1VBFA 2FCAA 3T0IA 4BLWA 5HIKA 3DXZA 3EPPA 3O31A 4QDJA 2PWPA 5LQUA 4RTQA 2QM3A 4ZTBA 4E2ZA 2ESRA 2PBFA 3C3PA 2EFJA 5GOZA 1KPHA 3R6TA 5K03A 1KIAA 3NTVA 4U7TB 3H2BA 4HGZA 2C7RA 4HSGA 3LDGA 4BP1A 2P41A 1JTFA 5ICFA 4BLUA 2PVCA 1D2CA 2O0LA 5DX1A 2CL5A 1SUSA 1ZKDA 4E31A 1AV6A 4OX9Y 4QTTB 3ER8A 1SQGA 5EKUA 1AQIA 5E1OA 3IHTA 4A6EA 3A27A 5EMKA 3P9IA 2AOXA 2K4MA 4X60A 1HMYA 1XCJA 3FPGA 1NW5A 3GU3A 3B3JA 5E8RA 2AN4A 4PYIA 4QTUB 5IKMA 1WY7A 2ZW9A 3EEOA 3AJDA 2GA9A 4P7FA 1JG1A 5HEKA 3G8BA 3UJ8A 3LGAA 3SSOA 7MHTA 4M36A 2ADMA 3NDIA 2PX8A 4PCLA 4O29A 5DX8A 2VDUE 4YUWA 4R8SA 3BGVA 2ZLBA 1FPQA 3EVZA 5EIWA 3M4XA 1I9GA 5ICGA 5HIMA 1XTPA 3P9KA 3GXOA 2VS1A 3EMBA 3LCVB 3CJTA 2CKDA 2I62A 5DPMA 1NV9A 1G8SA 4P7JA 5LQNA 1G55A 4RTKA 1QAOA 3LDFA 3RODA 5BW5A 1P1BA 3MTIA 3MQ2A 1Y8CA 1DL5A 4DZRA 1L9KA 3SMQA 5K0BA 1JG4A 2PY6A 3TQSA 3FPHA 5HILA 4H0NA 3C6MA 5E9JA 4PYOA 2EX4A 2QRVA 5E2BA 4B17A 3A26A 3CJQA 4RTNA 3GJYA 4GC9A 1H1DA 2IIPA 2HV9A 4QQNA 3HCFA 3LECA 4RTJA 4PONA 2EG5A 2E5WA 2PLWA 3V8VA 2IBSA 4ATNA 2OXTA 3VC1A 1NW7A 3EVEA 5DXAA 2VP3A 1WXWA
chains in the Genus database with same CATH superfamily
2NZWA 4UEQA 1XNGA 2GD2A 3JYNA 4B6PA 4RHYA 2W42A 1E6WA 2JAXA 2XF8A 2ZYSA 1B14A 3BDIA 3O93A 3GZTB 4MLCA 4WACA 5IAGA 4D3YA 4EHBA 3NAMA 3EQ8A 1SG6A 3WG9A 5A1TA 2PJUA 3O75A 1RBZA 1FPMA 1FLNA 1A96A 1R9MA 3EXAA 3ICPA 4HMOA 1GG8A 4ZYLA 3EAGA 4EYOA 2DQZA 3UV7A 5DGCA 5ER9A 4CQJA 3GL9A 4ZCQA 2H3EA 1DRKA 2PRYA 2IZ1A 3F47A 4PXSA 3KX2A 4PICA 4GX0A 2J6BA 3RVMA 1MG0A 5ES4B 4MARA 4WLUA 1V37A 1C4OA 1XKLA 4MB2A 4RS3A 5B1SA 4DR1B 2V98A 1S2GA 2WNSA 3L93A 4DHWA 5D1NA 1CLUA 1Y9ZA 3GPBA 3QVXA 3Q9SA 4YJ3B 5C5CA 4BRZA 5CVUA 1GTG1 2DWUA 3FOCA 4LSZA 3X1WA 1XVTA 3PUIA 4LGMA 3QW2A 5KNCA 1YCHA 3LQKA 4KJZA 2EKDA 4ENVA 1U2SA 1M3SA 1VM8A 1PL8A 4RMJA 2WE8A 3LX6A 4DXHA 1XRMA 4AYXA 2WLSA 4KVGA 1S2MA 1H23A 1Y8ZA 5TMEA 2EHDA 4V0QA 4D57A 1FNNA 3VSEA 1VHTA 2WJ6A 2P67A 1QAQA 3GT0A 4ALIA 3VR2D 1V11A 3IAS6 1ZJZA 4ZCLA 2XPCA 5JD6A 4PZUA 3ZNNA 3IO3A 3LC0A 1WBJB 3C97A 5J47A 3ABIA 5EHZA 1Z0ZA 1MAHA 2EKPA 5ICCA 1GNQA 1V8DA 3VV3A 4AKHA 1VHQA 3D9QX 1I1NA 3B1XA 2PUAA 5JUWA 5BQFA 4L9AA 4ND4A 1QU3A 2OBFA 4DV6B 1E32A 4QEKA 5DM4A 1JA0A 1TT5A 1LTHR 4P4NA 4YMIA 3VKWA 2GTPA 3DFMA 4X41A 3U7QA 2P3OA 1HE5A 2VUHB 1XNJA 3ZY2A 4N7RA 4XYBA 4RY9A 1U0TA 3GLIB 1JXQA 2OWEA 3A9UA 4FSDA 7MDHA 2VQFB 1D2GA 1HE3A 2H2WA 4JYPA 1AGRA 4NWIA 2AFIA 3KYJB 4I6JA 1MW8X 3RPEA 4EVIA 1QDUA 4ZCRA 1R8XA 3N0TA 3QI2A 3E9MA 1DIGA 2GRJA 2DPXA 3ILHA 3QM1A 2VK1A 3C7CB 4J03A 1DXHA 3BJRA 1FYXA 2F3TA 1Y8QB 4Y6GB 4YJFA 1A2QA 4E14A 2EP7A 4DDVA 2EZTA 1TAHA 2ZBRA 3QA3E 4JP3A 4ON9A 4Q19A 3N76A 1IQUA 1HUQA 3PC2A 2HNAA 4MYCA 2ZPAA 3W9BA 4FGSA 2O2GA 4CM4A 1MX3A 1AO3A 2OGWA 2AYXA 5SICE 3ZU3A 2EC5A 3JWJA 4FMCF 5A4JA 2OV6A 1V1JA 2I87A 1XL1A 4UTOA 3VU3A 1LVHA 5C8YB 3OEEA 4KOEC 1RZ3A 4LQLA 1PYGA 4HWSA 2J3LA 1SUEA 2C5FA 4MRMA 4NMXB 3S2IA 1TAUA 3TQTA 3ICCA 5ALXA 5JAZA 3BSYA 1QONA 3KYIB 1EM8B 5EJ6A 4TM8A 5KDOA 1PEAA 4HT3B 2GQ0A 1OH6A 3ZHUA 5K4GA 3K8ZA 2C9CA 5DV9A 3UAYA 1TRKA 1PEDA 4RXUA 4EKNB 1YZ3A 3HJUA 8MHTA 4OSPA 2EFDB 3T3HA 4HHEA 2C99A 1H9CA 1EWYA 1JIIA 3CPJB 4NKRA 2X86A 3EXG1 4B3TB 4DNFA 3T15A 2YFQA 1AKMA 2AMJA 2Q50A 4JBIA 4MS1A 5IN5A 3GV0A 1EFDN 3KJQA 3MFYA 3WA6A 4DA7A 4LI3X 5TGTA 3WNBA 4M9ZA 5TRTA 2GASA 1GQFA 5EEGA 2FE4A 1NJGA 3ZV6A 1UP4A 3TECE 1NI3A 1UCFA 2WYIA 4KAFA 1I10A 1SVNA 2J3QA 3EWIA 5JEDA 3AM3A 2ALJA 2C5SA 3AUSA 2KHZA 2CUTA 1U2TA 4EEZA 1T5LA 5EGNA 5C53B 1PTKA 1TPZA 3BJIC 3LVQE 4QEDA 4QXAA 5EUQB 4A23A 2BDEA 3M4YA 4L3OA 2WEKA 3LLVA 4PX3A 4CIAA 1T1RA 4U02A 3FMGA 5KYWB 1ZUD1 3NHRA 2X13A 1N33B 4RW0A 4M9UA 1LGYA 5B2FA 4ASUD 2VYVA 4WESA 4EY3A 4RDCA 2CT8A 4QVIA 3I1IA 1Y4DE 4MVWA 3ZVLA 1BHJA 4Q4JB 1XLTA 2OESA 3ZDEA 3QUTA 1EP9A 1T1SA 2J0SA 2OV1A 5ALDA 5DSZA 3SLKA 3W8RA 2H16A 1J9GA 3MUNA 3UMRA 4EZBA 5C8ZA 4DXAA 4ZI2A 5LP6B 4D8XA 4BB0A 1RYYA 3M8KA 4HMQA 5JRDS 2CCKA 2CJPA 3D54D 3HS3A 1HORA 3OURA 1EQ2A 1I4TD 1KZ6A 2PSSA 4PLWA 2RHJA 3WYEA 4C4AA 4B4KA 1N2ZA 5JCOA 1TEVA 4C5CA 621PA 3LZDA 1J0CA 1KQFA 2Q1SA 3C4QA 4BIMA 1G5HA 3MUEA 4R1NA 2YWEA 2AHRA 1L5SA 2A5DA 3KHKA 1GIAA 2HA5A 3AXSA 1EMDA 1Q1ZA 1O6ZA 4FOPA 4OQLA 3PUYA 1G3IA 2HJRA 2MSCB 1V8OA 2QE7A 3NBUA 5TQJA 4CTKA 3A7DA 4Z7NB 1CF2O 4JI8B 4BU0A 4JYCA 3BTUA 1QGAA 1S2IA 4LHVA 3UC9A 2Y4OA 4DMUB 1TUBA 1CTQA 4QTZA 4AN0A 2XGOA 4D9JA 1EZ4A 5JR3A 4MR8B 1EVEA 3B1WA 2W6QA 2F4VB 4NFYA 1GEEA 1N2EA 1SHKA 4K9LA 1C9EA 5HE8A 1D0SA 4I1YA 1IL0A 1DRJA 2H17A 3BXOA 2QP3A 3IUSA 2KX7A 1KMCA 2VF2A 2G4CA 1JEOA 2VNHA 2WKRA 2A7XA 3HHEA 2NSLA 4HP8A 3HEMA 4LPKA 4PG4A 3UH0A 1R9GA 3TJMA 2OV8A 4A26A 3I9V1 4EB0A 2FFQA 4WN9A 3IXLA 2OL4A 2YWHA 5J1SB 4P32A 1R6XA 1DRUA 2VWGA 3WMXA 4PYJA 4WX2B 3O03A 2ASVA 4RNDB 1LLUA 1M67A 2I33A 2KJQA 2Z5VA 4Q1FA 2GH1A 1SCIA 1B6RA 2C7BA 2VTDA 5CU7A 3D6JA 2BBSA 1MB0A 3TTVA 4UVDA 4AC9A 4GI1A 1S7GA 4YEDA 2XXJA 1K5DA 3TTWA 2IDKA 1L7RA 1GZHB 1NATA 3MTEA 3VR6D 4E15A 3WOVA 3VZSA 3E23A 3OLZA 1EX1A 2ERCA 3F2IA 5BPFA 3W8EA 1N36B 1R9JA 3L06A 4G5XA 5E6SA 4CI0B 2GO7A 2A9VA 4M0CA 1U04A 2V9ZA 3N28A 3OESA 4PAMA 3V8NA 1L5WA 3ZW8A 5EA2A 1JWLA 4FR5A 5IASA 4RXTA 3ED5A 4AYTA 4P0QB 4RH3A 1YJBA 1Q16A 1IHDA 1T13A 1TKRA 2Z2YA 4NK5A 4ANFA 5HRCA 2ECQA 5DYTA 3QYAA 3Q40A 1NW8A 4RKRA 4U7PB 4GBED 2SICE 2E85A 2IYRA 3AJAA 3FPFA 1EHCA 2GFIA 1ZHHA 3QLEA 5ITVA 4A7PA 4OOEA 3V4VB 3AIKA 4E5VA 1OLSB 3UMFA 2QQEA 4JGBA 1CQXA 1N2CE 1X1AA 1RVDA 2LCFA 2VK2A 3F9CA 1QIMA 3FAKA 2XE8A 5HSGA 4UQPA 4RLQA 3WGGA 2XUKA 5KWJA 2AXEA 2JAOA 5E3HA 5A6SA 1TZBA 1ENYA 3AB8A 3E2IA 1P5ZB 1EJ0A 4H16A 3WOHA 3ICQB 4X7MA 3TIGA 2D1QA 3RJ9A 5I5EA 4C30A 3FKSA 3T9BA 3WK7A 4ZPJA 5GJVC 1Q0SA 3DMPA 3IEIA 1ABFA 5LYJA 3QEBZ 1FP4A 4KC0A 4Q3AA 4D41A 1OFTA 1HSOA 4K6OA 4Y18A 2GLUA 5SYMA 4CLDA 1K27A 3LX5A 5I4KA 1NQTA 3WHKA 4BAUA 2X19A 3LKDA 3R0ZA 1M74A 3ZJVA 3JAWB 3N7AA 1I4EB 1BS9A 2BM9A 1HQCA 2X7XA 2YHSA 4LCBA 5IHXA 2I6XA 4LJ4A 4YUZA 2AEEA 1EGAA 1D0VA 3SM9A 1X15A 2FY8A 3U3OA 3VNVA 2YZKA 4MMYB 2W6CX 2ZUEA 2QJOA 1KZ1A 1HWYA 1JFFB 1AHNA 1I01A 2PUWA 4PPQA 4DF3A 2V7VA 4YMUA 2UVPA 3H87A 1EAMA 4WZ6A 1N92A 4NV0A 3ZJYA 1M2NA 4ARZB 5BMVB 2V4MA 3FSJX 5ALUA 1XL0A 3RLIA 1IIBA 2NO0A 1GPJA 2IZZA 3TI7A 3OT1A 3UA4A 3ZUPA 2P9QA 4HEJA 2OYRA 2HPVA 3RARA 1R4ZA 3PFIA 4YJHA 3IAXA 4ZRDA 1SVOA 1YB2A 2EZ4A 3T41A 4ZT4A 3ZDCA 1IY0A 1N9GB 1U8UA 1WXDA 3IC5A 3WL7A 1YFKA 4IX9A 1Q2XA 1YOVA 3O21A 4YWHA 1CPYA 3ZE9A 3RF7A 1EINA 1F6WA 4EELA 3IV9A 3KLNA 3DF9A 1NE2A 2WIIB 4IIJB 2A7QA 4HBGA 4CKWA 2YMLA 2UYQA 2DOKA 1XFAA 5HTOA 1UJ6A 2V74B 3PRJA 3HI4A 2BYTA 2BBTA 4YP1A 3DDUA 3INRA 4UXJA 1WMBA 5D01A 1BGXT 5IAKA 3UAOA 1CQPA 4Q9IA 1GLNA 1MRSA 3ZWWA 1VLMA 3I6QA 1D03A 2JAWA 3G2NA 1XSEA 4MJ7A 1GTMA 1WQ1R 2G1PA 4BVEA 3MAGA 1YR7A 2FWBA 3AFHA 3QEJA 3FVWA 1U8YA 1T5BA 3QUSA 3BIXA 3GLSA 3OY2A 1J2EA 4YMLA 2Y92A 3C1OA 2H48A 3QUBA 3H8VA 4W9NA 4DQ0A 1XB2A 4LC1A 1W85B 4XUGB 3SIPA 3E1SA 5HKAA 3FDIA 1H3FA 3R3VA 1B8PA 1QV7A 2WG0A 2WU1A 3ILSA 1QRSA 3SP1A 1BMFD 3VH1A 2MINA 2K6GA 3S7TA 3UW1A 2WAYA 1I7SB 3F4KA 4L1KA 1SPBS 3H5TA 1KYIA 4IXDA 1NV8A 3DL0A 4IEFB 4TKUB 1YS1X 4HQFA 1FDSA 4OQMA 1EDDA 4KQHA 1WRBA 4XVUA 3NX4A 5AOAA 1V1MB 3QBJA 2E9SA 4UTNA 1EUZA 4FCTA 3PFGA 1WZIA 2GA8A 4RPGA 1E3JA 2NZ2A 2OA0A 3KDSE 5CA0B 4TKVA 4N01A 3RVKA 4GYYA 1H1TA 2PYDA 1II8B 1QTIA 2H1CA 1MZVA 4CV0A 3I9FA 4RVUA 4RK4A 4TZTA 4FS8A 2F1HA 4Y6OA 1XGKA 2BGUA 2CJYA 4XPZA 4EBFA 3EGDA 3I05A 3B7PA 2JGKA 2ZSHA 5AVUA 4K88A 1N7IA 5B1EA 1OLOA 5BN3A 1CEQA 2MYUA 2KM1A 3NOQA 4TN1A 3FSGA 1OV4A 5ESRA 3P4UA 5G0WA 3NHFA 4Y9UA 2YW2A 3R40A 3O38A 3F6EX 2IKSA 2DF8A 4M7RA 1EUCB 1TUEA 2NZXA 5DEOA 4BGDA 2P8JA 3TOSA 2PKWA 1IG3A 1YI1A 2GXUA 2HNKA 1LFAA 3OU6A 1SOWA 1JLMA 1JJBA 1EVJA 1FVFA 5C31A 1RD4A 1Z26A 3MRSA 3DM9B 2IUTA 4REOA 3IBSA 2ZRFA 1X42A 1EX9A 3FPLA 5COBA 4ARSA 2QP4A 2C7RA 1VJ5A 1WCYA 3DR3A 2YASA 3ZZNA 3QENA 3KAKA 4ZT5A 4FFMA 5ERYA 5HK8A 4AKGA 5ICFA 1IQ0A 4EGSA 2A5YB 2C3UA 4TLLB 3H5AA 3L0BA 4MKHA 5LM3A 1Z6TA 2I55A 1L7EA 1SCJA 2A5LA 3JZIA 2X2EA 2VDPB 3IHTA 1KO5A 2K4MA 1J2YA 2GZRA 3HI6A 1I4DD 3N5KA 1NW5A 4O33A 5H81A 2C04A 2JIQA 1WWKA 2BKEA 2WWHA 3KP1A 1YR8A 2UXCB 3W4IA 3RJZA 2QSJA 4P7FA 4F04A 1XZHA 4IDDA 5BWLA 1EAYA 5DN6D 2HU7A 2LIPA 5HEKA 4EAAA 1TLTA 4GPTA 1FTQA 1YB4A 2A59A 4FKZA 3NHUA 2J3EA 1V5EA 2WT4A 4OMCA 4WUTA 3K0AB 1SC6A 3I76A 4C29A 1PLKA 1KZ9A 2OHVA 3R3XA 1QQTA 2QLBA 4FDTA 4YJ3A 5EIWA 3FN4A 1I9GA 4A73A 4AU1A 3T1TA 4HB3A 1PNTA 4TKMA 4IMRA 4DM4A 1J8VA 3DMTA 3LGSA 1K06A 3ZDYB 4U7JA 1MJNA 1GZ7A 4ZT6A 3WWEA 4BMVA 3NHZA 1P0QA 5DPMA 4ZCPA 4GLOA 4MIOA 3VAYA 3KOWA 2VBGA 1LSOA 2P2GA 2XGGA 3PUJA 4J1NA 2I0FA 4F3TA 3BCHA 3AHJA 1QYCA 3LUHA 2XKJE 3N74A 4Z9BA 1MR3F 2AX3A 1V9CA 1IVNA 2H63A 1L9KA 4HXGA 3TL3A 2XMZA 5P21A 4NCAA 4ZARA 3SK0A 4JL5A 3GJ0A 3VR3A 2JIZA 5AKGA 5LQMA 3UPTA 3GPLA 1P6UA 1DBPA 1HSZA 4NF2A 3X1JA 2P0YA 5LNK1 3ZN2A 3BPSA 2VRCA 4HQNA 2ZUDA 4GC9A 3RQIA 3VR4D 2HA4A 4D97A 4RH1A 1WXQA 2GK4A 3AF2A 5E4TA 3D0KA 3K9FC 5D5QA 4DG9A 4A15A 1E9DA 1E5TA 2QD2A 2J41A 2JZCA 3OJOA 1LNZA 3IX7A 4Q3KA 5INTA 3MHTA 4Q5IA 3D6UA 4NLLA 4LXXA 3PE6A 3GLIA 1U3DA 1VJ0A 3I5UA 1YDFA 1KDOA 2V6FA 3OOEA 3GFBA 4I2NA 3M82A 1E1KA 4XUDA 2V9PA 5JCJA 4DA9A 1BVHA 1C81A 2CLFB 3M33A 4N12A 4B6OA 2BMFA 1M76A 1UKAA 2A0YA 2A1UB 1U7TA 2H4XA 2IYNA 2Q21A 2XVYA 3DGFC 5TMPA 4ARBA 1FTNA 2BN4A 3GUYA 1Y8QA 4ZALA 3L8EA 3TM4A 1N6HA 1P2GA 4I08A 1A5SB 4ZEWA 3UIEA 1Z06A 1VPDA 4WZAB 3BBLA 4V0RA 3PCTA 2W48A 4FPXA 1NYQA 3PG5A 1X80B 2NAFA 3DKRA 1I4WA 1K3UB 1OTXA 1SUPA 2N9UA 2N3ZA 5C8YA 4V1CI 3H4TA 2PUTA 5DASA 5LXTB 2IHJA 5FPHA 2JIRA 2CYAA 5FP0A 1R50A 1T3HA 3USCS 5AW0A 2B7BA 4PC1A 4WLOA 1JAYA 1TKCA 4I6GA 1EM8A 1Y1LA 1ZI9A 3A1UA 1NUHA 4LJSA 4G3XA 4HGPA 5JD5A 2WJPA 2QENA 3CWCA 2A74B 1VJGA 2E5LB 2R96A 2DKFA 3BZBA 1SC1A 5HKBA 1CUDA 4ZVRA 2Q5CA 3KZCA 5MFPA 4QQKA 3QGMA 1YJCA 1C5KA 1U7WA 2V7EA 3EDMA 2V4UA 3N9IA 3WJ1A 1VPWA 5JTWA 3PX3A 4E30A 2O20A 4H6PA 4YXFA 3CTMA 3SMVA 1I6KA 5EQJB 3FTQA 3WIBA 1T6BY 3AGQA 1OH7A 5CLQA 2H9IA 3FFTA 2BTEA 3O4IA 5LUBA 2JGEA 3IKLA 3L02A 1LX6A 1BTOA 4L8LA 2JH3A 3VPGA 2Y77A 1Z0AA 4DNOA 3WL6A 4PQGA 1U7OA 2YOHA 5AJHA 4F4FA 3I42A 1K0UA 1YR3A 1H0KA 3K92A 3MGAA 1E7YA 1NI5A 4J0KA 3I23A 4UAGA 5AQEA 3LTEA 1L5RA 5IX8A 1CUGA 5LU9A 3FSEA 1DLJA 2BONA 3K5PA 1PFGA 2C59A 2F1IA 4XJTA 4M1EA 1T8WA 1FA9A 1GGJA 1BAPA 3GOQA 4M53A 5E7IA 3A31A 5TR9A 4GOXA 2XITA 3C6QA 3D64A 1NG1A 2IYLD 5LPNA 1A4RA 3IRVA 2RGGA 2IL1A 4CJXA 2BZ1A 1VL5A 4R6XA 4RSMA 4D3FA 2RSLA 5FA6A 2QAJA 4Q4JA 5HJ7A 2W2NA 1XJCA 4K6KA 4IIDA 3ANMA 3OMWA 1Z4IA 1RJEA 2Y67A 5CNJA 9GPBA 5ADHA 1SCBA 1B26A 4JODA 2XB9A 3G5TA 4FFNA 4M9SA 1BMTA 1NMZA 1X38A 2YXEA 4YONB 3S27A 3ML1A 4TMZA 2Z5FA 3IIMA 1SUWA 4YAKA 2RH8A 3HU5A 1WG8A 3P2MA 3QFHA 1J00A 4ZGGA 5FBRB 4X1OA 4G81A 1BYUA 5DX0A 3ASZA 1QMGA 3AHCA 1RM0A 3H8WA 2DBQA 3N39C 4TOIA 4J3FA 3T7IA 1Q17A 3ZXYA 2FETA 2FI1A 4B3DA 1SD5A 3I09A 5U4XA 4A8JB 5L3SA 2WILA 4G1UC 3QFRA 1LBEA 1BNCA 2EAUA 3E9RA 3DVAB 4KSYA 4GI2A 1C41A 2DLNA 4IW3B 1XJ0A 3SR3A 4KHZA 5CPFA 2WM8A 4GOJA 4GM4A 4H1WA 1OY1A 1C0KA 1D4OA 5AH0A 2XWJB 1Q11A 3D6VA 5J9FA 2VPZA 5JTUA 3GLHE 4US1R 4C14A 2FEPA 4DIUA 4G23A 4I36A 1CDZA 4MR8A 5E4JA 3AHEA 1A9XB 4IV5A 4OHVA 5LOVB 4KXMA 2QMZA 4QUAA 1V39A 1JJFA 3TIVA 1DEXA 2H1HA 4MGYR 1Y7HA 2I3GA 4GPD1 5KTOA 1WU8A 2IGBA 3AZPA 4ZQIA 1H2BA 1BMDA 5LZ4A 1PFKA 5KYYB 5AI5A 4K8OA 3OE7D 5TF4A 3VPHA 4DV4B 3S8YA 1P0FA 2Y1DA 3LK7A 4JB2A 4FGJA 4F4IA 1E64A 1U3TA 3MGBA 4XH9B 1HLGA 3T7JA 2GJ8A 3ZQ4A 2PMCA 1BW9B 3U2QA 1LDYA 3I2FA 3UJ3X 2VSYA 3V1NA 1SBIA 1WD5A 3PLNA 3RBVA 4MVJE 5JWRA 4U9IS 1EQAA 4M6WB 2AWNA 4MA0A 5A4IS 3Q9LA 4FHCA 4QBKA 1GFWA 1C7QA 3EVDA 2FEXA 4B7ZA 3T34A 5F2KA 2C4UA 4ZEOA 3HY4A 4UU1A 1SKMA 1ULBA 5I6DA 5B6JA 2G5PA 5HRAA 1JH9A 4DSUA 5JXGA 2NO1A 5CRIA 4RCZA 1FMLA 2Y2VA 3CLSD 3WFJA 3GYGA 3L0ZA 2CHVA 4UD2A 4D74A 1N77A 2OD9A 2CW5A 2V58A 3G13A 3A9TA 5LYJF 3DZKA 3ROKA 1FYEA 1MJFA 5D5PA 3REQB 5DM60 3HVJA 2HN9A 2I3AA 4I5IA 4BNDB 2ASEA 3OEHA 1IJFA 3TDNA 2H4ZA 3F6YA 4XX1A 4ALNA 1WM1A 1RP1A 5DTIA 3HR4A 2QZJA 4N6GA 4EJSC 1K8XB 3ROQA 1JHPA 1J22A 1N1MA 4IIHA 1LY1A 4PHFA 2Y1WA 4YDSA 2POQX 4PAGA 4BLPA 1I3OA 4F11A 1FSZA 2N0SA 3E05A 2QN6A 5FD8A 4HDKB 3HDGA 4PU0A 4DLAA 2O8EB 2ZRGA 2WJHA 5KHOC 3HB7A 4P4LA 1R9NA 4RWZA 1ISHA 1Z6GA 4HY3A 2YXBA 4HZGA 3NCTA 1FUEA 1XTQA 1M2GA 3EH1A 4G36A 4D4JA 1XA3A 1DPGA 5AXDA 3A6EA 2ZAMA 1YACA 5DBFA 3MHPA 3PYLA 2OBNA 3IVCA 1VRCA 3JAWA 4LGYA 1T4MA 1Z4KA 4LV5B 1ZR4A 4U5QA 5I9MA 1KEUA 1UJ2A 1IB6A 4QNRA 1S2LA 1XPUA 1BEZA 1QO0A 1KJIA 2QQ0A 3NPMA 1OPRA 2BW0A 1JFFA 2O5VA 2RHGB 1BWRA 3ZNOA 5A4MS 1RIIA 1GNVA 5DSTA 1V9SA 3SPXA 2QX8A 3UMMA 1NONA 1T43A 2Z9BA 3KQMA 4ARZA 4M1SA 5BMVA 1KSHA 2RI1A 2O52A 3UBMA 3OQOA 3HL4A 2CNDA 3FETA 3U3DA 4RKWA 5BOVA 1QFXA 1CRZA 2HIAA 1QMPA 3SHWA 2PN1A 4XWWA 3RYCA 1C29B 3HJGA 5KPJA 1UM9A 2TMYA 1NAHA 3H2JA 1N9GA 1C3EA 4OAOA 1E94E 2FPRA 4CM8B 1W47A 2ZSEA 1JSRA 3WAGA 3NV7A 2L69A 2IHZA 2QTRA 5A05A 3NTXA 2XB2A 3VR5H 4FDLA 4L0DA 4UAJA 2Q9BA 1EUDB 2X4LA 3OKCA 4U1RA 5AI6A 4CFZA 5IMBA 1AF7A 2WA1A 3HSKA 4IIJA 5MN5A 3A2KA 1N5IA 4AJHA 3CLSC 1FCJA 3LHFA 4KYIB 4UUAA 4UATA 4UASA 1LX7A 2QN7A 3BCRA 5JXHA 1R1DA 4UQOA 3O74A 4FOOA 3JARB 2LDXA 5AK4A 2X76A 4R2KA 3B8EA 4GSLA 1D4AA 2R7KA 2V5VA 4DCMA 3CVWA 5ERGB 4RMIA 1QWSA 1VJTA 4M83A 4JYAB 2BGMA 4I99A 1E2BA 1U1CA 1FFEA 3E35A 3LY7A 2O5EA 1ATZA 2NT3A 3FI9A 3TW0A 1UFVA 3F2VA 5AUPB 2V8OA 1Y34E 2FN7A 2NPFA 1W85A 4Z49A 4QXRA 4O3MA 1MABB 2R751 2G07A 2QT0A 1I7DA 3VPCA 3LVFO 3N59A 4J07A 4KPUB 4R3UC 5KOYA 1E4YA 1A69A 4YN3A 1GWNA 1MN6A 2CNNA 3LOQA 1YI8A 5CVEA 1H42A 5FQNA 5JSYA 2HCRA 3C8DA 3TNFA 3C74A 3FDZB 4GM0A 4IFBA 2J9FA 1GLVA 1TI7A 2W43A 4QGAA 4TKUA 2Y68A 2DECA 4GXTA 4CIDA 2CFSA 1DVRA 3AW9A 3GZNA 1E6LA 5HA5A 2QTNA 3KAPA 1DBRA 1UFQA 1V1MA 1W73A 1E66A 2QRKA 3S68A 1TZKA 1JS1X 1EHYA 3AM5A 3QXGA 4K2HA 3ZHQA 1JLHA 1PS8A 5CA0A 1AMOA 1XZKA 4MHTA 3WGOA 2LD4A 1DWUA 5K3EA 3JQ7B 4G5HA 2EZ9A 1II8A 4O8ZA 4W8OA 4FFDA 4WZBB 4E5PA 5AVRA 4N8DA 2AKYA 3WJAA 4N7MA 3E9DA 1SOUA 1SU8A 2Y1XA 1I3LA 3LC1O 1UMDB 3R0XA 4DAEA 1IZ7A 4D4MA 1ZVVA 1AXGA 5CDTA 3QWFA 4FE4A 1ZK2A 3IPLA 3ZTTA 1ZHOA 3G23A 5AO9A 3HSSA 4HNUA 1QGZA 4ZZIA 2QORA 4W5QA 4DSTA 1EUCA 3VU8A 3CO5A 1GN8A 2QW8A 4FIDA 4UUMA 1JPJA 2P4QA 3W5UA 4YROA 4RD1A 1TTTA 2Y0PA 3G2IA 4LF6B 1IHPA 3LOPA 3TSZA 1ZIYA 1KDTA 3JQ6A 4G5QA 5G1OA 3WLPA 5M29A 4FFPA 1CZOA 4QREA 1FU8A 4UTRA 3JAKB 4PS1A 5JXJA 1HXHA 1H4QA 5C18A 4GOKA 4YJ3F 2ZBPA 2VRBA 1F8UA 2PKRA 1DKRA 2X6QA 3IHLA 1QZZA 2ORVA 3KM0A 3IQDB 1G20E 4KFTA 4C03A 2VEDA 1HQKA 1DO0A 3MVEA 4WJZA 2B61A 3TGPA 4IGIA 1G7SA 2HNBA 3S2SA 4OG2A 3PXXA 4DV3B 4MP8A 1Q2UA 4V0OA 2ADFA 1TIKA 1GADO 3IQIX 2O3SA 3R6LA 3UAGA 3DBOB 4HTAA 1FP2A 2OECA 3OC6A 6GPBA 3DZFA 1B0PA 2HWWA 2R6ZA 4C78A 5FXMA 2JRCA 3VZQA 1VQ1A 4CKYA 1Q44A 5HF8A 3WB1A 4HQOA 3ZU5A 1PDOA 4C2UA 3SXUB 3AU9A 3RK1A 4DY6A 1W6UA 3AU8A 1EUYA 1PWEA 4AUEA 4XWGA 3WLHA 2QKIB 5EMMA 4RTRA 4KIUA 3IUPA 3K70D 2EWVA 1NKSA 4NIMA 3KALA 2BEKA 1JQ3A 3W3AD 3Q3JB 3M5DA 4AJ1A 4XLTA 1FRNA 3O95A 1S3SA 2OEPA 1JSLA 1SKYB 1LI5A 3WK4A 3EMKA 4B73A 2VF7A 4H3HB 2AVNA 3CC8A 3ZCPA 4OP2A 1CQWA 3Q7QA 5IF3A 1C1DA 1I2AA 4OQNA 2VZ0A 4V0SA 3P9SA 2WWYA 3L49A 4LYJA 3U17A 4E33A 1KKMA 4XUCA 3PNOA 5EPOA 2ZVDA 3WV5A 3RC9A 4QDKA 4J3JA 5CB6A 5K8VA 4P93A 3H3FA 1M7HA 4XYGA 3TN7A 4PRYA 3F6PA 2Z58A 3ASYA 3N70A 4BLWA 1RAAA 3DAYA 2BHLA 2WSSA 2ZBVA 1E6CA 1X1QA 1N0IA 1IDOA 2CHEA 3O1HB 3QPCA 1M2FA 5DHFA 1OXXK 3I2YX 3RWMB 3SJUA 5K8JB 3ZOKA 3LUAA 1YVRA 4ZVOA 2QDXA 3TTTA 3A4NA 4HSGA 4GUDA 1KMNA 4KQEA 4F91B 1TA0A 1U0GA 1AF4A 2XUAA 4ERNA 5HDQA 5C8YF 4BLUA 2HX1A 3WGYA 2MU1A 1TYEB 1E20A 1RBYA 1ZL2A 4UBLA 3R8FA 1PJCA 1L8AA 1W7AA 5KDDA 1XK7A 2I4RA 1CNMA 3GJRA 1Y9AA 3DW3X 4G0QA 1LK5A 3A06A 4AJEA 1S9HA 4U2DA 3U6KA 3TUIC 3IUEA 2JLYA 2IE8A 1ICEA 4G09A 1J06A 5D3MB 1N9ZA 3ANNA 3F6CA 1CUJA 1TJ3A 2PMEA 1TYDE 4QTUB 4L8FA 4I4CA 2PGJA 3A1SA 4WCFA 2QVGA 2BTOA 1W35A 2I2CA 1FFXA 1NN3A 3QU9A 4WKNA 4PSUA 3BXXA 3VPXA 5IT5A 2JJ2A 2R62A 3G8BA 3RGGA 4GWGA 4LJ8A 2BFAA 3QPBA 2NV2B 4WZAA 2DG2A 4DCTA 4U7HA 1HG1A 3NGMA 3EUEA 1M73E 4PSAA 5DX8A 1F7UA 2Q4EA 4TRJA 4KXYA 2OT3B 1XTSA 4D46A 1X80A 5L3VA 1E4OA 1IYZA 1TCUA 1W4BA 4CF7A 5L3SB 4KR3A 1Y7LA 5LXTA 1WVIA 3AERA 1BRMA 2AKEA 1P1FA 3DS8A 1HDRA 4HGQA 5F5LA 2C29D 1TECE 2C5AA 2PNJA 2H4YA 4B3IA 1GL7A 4ED9A 3O8QB 4MW6A 4OD0A 4AMBA 1F0KA 3NWOA 3PQFA 4LS3A 5TSDA 1L4HA 1X77A 4LIPD 3H9GA 1R0CA 5AVWA 2PU5A 3WDLA 1OC2A 2Q3MA 3PTZA 3RJTA 1JHUA 3K70C 3G0CA 3KSMA 2DCUA 4EB3A 4N0QA 1XTJA 1TYZA 3C3EA 1NFQA 2CK3D 4B17A 2RK6A 2I2FA 1O7JA 1ULAA 2HK8A 4I19A 4GIBA 4RZXA 5C5IA 4JBNA 5LZ2A 2BDTA 3GCWA 3L92A 5E9AA 3CX8A 1U5CA 1LZKA 4RPKA 2W2KA 2OXTA 3ROFA 3RS0A 2AFIE 2V6IA 3GMIA 5EPUA 2KWIA 4MWOA 1KI1A 2R8PA 4JIGA 1G8AA 3DMNA 2ZSUA 5J1TB 1MJGA 3C3MA 4CG0A 2ZIFA 1LF5A 1YTUA 4W5OA 3E8SA 2AXNA 3MCVA 4LQCA 3ZD8A 4M49A 2AZMA 2I4OA 2QVYX 4UULA 2FXVA 5JBQA 3OQMA 1DARA 3ZG6A 5LQUA 3ILYA 4EZIA 2WJ3A 1RXWA 1T8UA 1S01A 4BRWA 3CBQA 4LJ6A 3GLVA 4QUBA 1W59A 2UYOA 5DM70 2FV8A 4WY2A 4BEJA 1B8NA 2HLPA 3RWBA 2BHTA 1MAWA 1VHDA 2IY8A 1QSGA 1VB3A 3CF2A 1J25A 1UBUS 3SN6A 2CMKA 3UZUA 3FRIA 5DBIA 3FWKA 4KAXA 1J23A 2FRDA 2P6MA 4WWHA 8OHMA 2C2OA 3ICVA 1YDMA 3CCFA 4FC7A 1CVIA 4IKPA 4MVJD 3T9EA 3P27A 2FW7A 3EW9A 2II6A 3JAMA 1FSSA 7REQB 4TSFA 1LLFA 3ZKWA 1Q19A 2JVKA 2QMUA 4R4JA 1EE2A 3KT8A 4NECA 3EOBI 2GZ2A 1ZESA 4F71A 3DBHB 4KV7A 1MB2A 3D5EA 4GPIB 3T99A 3ET5A 1JDPA 3WLRA 4P4TA 4D82A 1U63A 1ZN8A 5LMNB 1JZSA 2BCEA 3HB5X 3M6AA 3VSAA 4A8JA 4Q9NA 4MKXA 3AB3A 3O8CA 4DV0B 1M34B 3DVAA 3ZLJA 3SYRA 4BNGA 4TUYB 3SKXA 2QX6A 3OZAA 1PUIA 3OM9A 4MRRA 1XI2A 1V95A 3UAZA 5KTRA 3T5BA 1K2WA 4X84A 4IYJA 5ALQA 4JGGA 2OR3A 5LOVA 2F6RA 3HU3A 2INGX 3QYPA 3OKPA 1DIRA 2HTEA 2ZULA 1M1YE 1RPTA 5A6SB 1KDVA 1QH0A 2VQ6A 4MI6A 2IIBA 3LI2A 4TTQA 3FGOA 2JFYA 3ZHCA 2F67A 7AT1A 5JNTA 3OQ1A 4CU5A 3FOBA 2FZ5A 4D02A 2NZJA 4Z99A 3L8CA 4EW1A 2BE7A 5B55A 2RGDA 5KYYA 1VJRA 2XZTA 2IBTA 3PDWA 3PC7A 5JDCC 4F9FA 1JB1A 1NJ2A 1P4JA 3UB2A 5CIWA 1IATA 3AP3A 3B3FA 3PITA 1JECA 3I30X 1KWGA 2RKWA 3NHAA 1QKJA 4E5SA 1DZ3A 4UOEA 2EKLA 4K86A 4MUGA 1VKJA 2VNKA 1GAQA 1O94A 4M6WA 1MV8A 2IEBA 5T41A 2YY7A 1EGMB 1AUOA 1I5OA 2V55B 1H1LB 1VIAA 3KZNA 4BMXA 4WY8A 1KDRA 1GTJ1 1T1GA 4CHTA 1BU5A 2VLBA 3PIIA 3A6GA 4TS4A 4Y9TA 3LHDA 4AN4A 4YS6A 3HCWA 5FOVA 4QNMA 4BMNA 3IIIA 4J75A 2DU8A 1OCEA 4P9NA 2C2GA 4WADA 4XJSA 2VHUA 3REQA 1H3NA 2Q6VA 1IBMB 4BNDA 4F7DA 4K28A 5LQAA 3KUKA 1P3DA 4X85A 3HPQA 4JJZA 4ZO4A 5EJ2A 3WLQA 2C8LA 4NMMA 3RT9A 4O1IA 3UM9A 5LKAA 3VO9A 3W5DA 4EJ2A 1ZQ1A 3JQBA 3PJEA 4KRFA 4DRYA 3PEUA 4L5AA 3WIEA 2O2ZA 2P30A 4MVYA 4DWJA 1CT9A 3EF0A 1SG9A 4HDKA 2O8EA 1NDHA 3L8FA 1ISJA 1JHXA 2GF2A 2BUCA 3P5SA 3GJ6A 3PXUA 4MWEA 5EZ6B 5JHGB 5BMVF 1YV9A 5LBIA 2P5YA 3UGKA 3I4CA 2B2CA 2PKEA 1NF9A 2IHTA 4QJ3A 2J4DA 3TS1A 4TYYA 4DMKA 3HP4A 5DE3A 5BVGB 3OMXA 4KGXA 3PDCA 2E55A 5FV4A 1JYEA 2FP4B 3KXDA 1CRQA 3MB5A 3UXEA 1PR0A 4B3BA 5CW1A 4FXKB 5F76A 5T3YA 3KU1A 1NT4A 2QDKA 2W2OA 1IY9A 4GDMA 3THWB 5FNZA 5K8UA 1TUIA 3DPSA 3RTBA 2VNJA 3HVUA 2FTKE 4QUEA 2HHJA 4QJBA 3QBDA 2XZOA 4IIJF 2D00A 1YBFA 2Q6OA 3FX2A 3MWFA 3OJEA 4G6ZA 2C2HA 2YIDA 4I5EA 3BM5A 2GD6A 4MIYA 4RUKA 4TMYA 1L4EA 4B6RA 1C2YA 4G5YA 2Q0HA 2ZYRA 2SKCA 2BV3A 4DQLA 4W6QA 3FB1A 2G71A 2FX2A 3ZE1B 3HXPA 4ND8B 2F3RA 4Q21A 1D2MA 4G1CA 1DC5A 2NACA 1U0NA 4KO3S 4M7OA 3ZZMA 2RMKA 3KXLA 4CM8A 3K5IA 2IXTA 2TS1A 5T4FA 3NWPA 1XZDA 4N54A 1PHPA 3H13A 4IOKA 1AKWA 1ZXBA 2A5FA 2DFLA 1ZJ4A 1J1ZA 1JE0A 3C48A 3G2LA 3IBGA 3RVSA 3O1IC 1EUDA 5TVGA 2ZSAA 3NM6B 2QY9A 4RQAA 3GMDA 3I64A 3UXYA 1EWKA 4CIBA 1UJBA 2AJLI 4RKQA 1IZ8A 5KKAA 4CVNA 5LWQA 2YFYA 3AVVA 3D2LA 1VG9B 3I6BA 4E7PA 1V8FA 3JARA 1LRJA 3BB4A 1CQIA 1NVBA 5CA1B 2DWPA 4DDUA 1FDUA 1M7GA 1TW2A 4DR2B 1HX7A 1G21E 1XQ9A 5C1OA 1OHHA 2WIDA 1V5IA 3CUSA 1L5HB 5CA0F 1SVMA 2VDJA 3B51X 4GYJA 1XZAA 4HNRA 4NOJA 3WX0A 1QHNA 1OYYA 4P98A 1MABA 1VL2A 3CNOA 4PSKA 3VR5A 2GVDC 5DWVA 4KPUA 4PG5A 4FXGA 3OLVA 4GI7A 4EA8A 1KNXA 2HWYA 2VFAA 5I9TA 1S2DA 3ME5A 4EL0A 2FN8A 1RJGA 2BM8A 1L4UA 1NTOA 4UMFA 2VP9A 2YWFA 1VDZA 1EGVB 3UKDA 3KQTA 1C0EA 4LF8B 4LZAA 1NDQA 3RYFB 1PV4A 4QG7A 3I04A 3EZGA 4IDCA 5DNVA 3S81A 2XRZA 1U98A 1DFGA 2JAPA 1WUHS 1GXSB 4C7VA 3F73A 4W8HA 2IH5A 2FUKA 3PR3A 1CRWG 1T0HB 3BHJA 2Z1MA 3IPYA 4MIKA 4RCYA 4ZAYA 2XD9A 4ETNA 1NJ6A 1G4HA 2VEOA 4JR2A 4ZVKA 4AM8A 3U4HA 3ENNA 2UVQA 2GOYA 4L8YA 3IAFA 1UMDA 4FW9A 1PGOA 3HGQA 2ZSKA 3ZY4A 3RCBA 2ZRPA 4WOKA 1BD3A 4EGFA 1UOEA 1LNQA 2DC1A 2QTBA 2FZWA 4KK4A 1SZJG 1X7HA 2RH9B 3LP6A 4AP5A 2ZRJA 3QLUC 5KNBH 4JBXA 2C82A 2ODBA 2A84A 2PBRA 4OXXA 1T34A 3QOXA 1BU8A 2VJNA 4YECA 2OYCA 2C42A 2H1LA 1ZUNA 3PVCA 1M9NA 4RD6A 2FWAA 4EY5A 4MWGA 4LSMA 3G5AA 1UBTS 4BQPA 1WE2A 1Q57A 4Y30A 2DSTA 3KSUA 4Z53A 4MW2A 2AG0A 3JAKA 4NP6A 3K0KA 2IY7A 1NBMA 5KZMB 3G5UA 1ZWLA 2BJHA 2Q29A 4PO8A 1DLIA 2NYUA 3WIOA 3COJA 3SS8A 1MT3A 3M6WA 1IQPA 1ICIA 1U0OC 3ZCVA 2BFFB 3I73A 3IBYA 5C0OE 4LVNA 5DTQA 4DLRA 2OXIA 1QB8A 1A9PA 1XCOA 4P81A 1H2YA 2WYVA 1VI6A 3DOEA 1MBZA 5C4GB 5IEBA 3RHTA 3MWEB 2OO5A 4GL2A 3D1VA 9LDBA 2JG3A 4CI9A 4NAUA 3L77A 4QDOA 3ZCRA 1ZH0A 4FGLA 2FGJA 4NCHA 5K6AA 2BI4A 2QPTA 3LRPA 4KSBA 4PRLA 1YL5A 4DJFC 4KSCA 2IYSA 2VJDA 3EN0A 1UC4B 4N1AA 1KEKA 2D1TA 3WZ2A 3KKMA 4F4UA 2E18A 2L42A 5JNWA 1OXSC 1Z4JA 2FW9A 3SXUA 1MO6A 1D9XA 2OZEA 1JHOA 2ZJ1A 4QFCA 3BMXA 5F33A 3RRJA 1R15A 3ZE8A 2GBGA 1CIPA 4Q1EA 1AVTA 2ZP1A 1P8JA 3P8ZA 4JOBA 1EG2A 2P4SA 3JQFA 4KIWA 3HN2A 2J46A 1YH3A 3TXXA 1ZH4A 4HWRA 5HW0A 2O59A 3JZAA 3NDJA 3NVAA 2OVBA 5K0LA 1BN6A 1CS4C 1Y6JA 4MW0A 4CR7A 4ETMA 4D2IA 4W9MC 4W5RA 1X1DA 2ZRLA 1MB3A 1PVDA 2G17A 4ENRA 4G4IA 5LR6A 3I34X 1YA6A 4MPRA 5DRTA 4PY2A 1AY0A 3RKRA 1NL3A 1NOKA 1BRTA 3SXJA 2XNSA 3T5MA 4BKUA 2DE0X 1N75A 1RWPA 1XA4A 4LBYA 2XCTB 5DGXA 3KEOA 5EAIA 1RPZA 3KLPX 4MRPA 4AO8A 4QOHA 3O7WA 4HUJA 4YT8A 3SJBA 1YGPA 4MGHA 4B4OA 1F3LA 3V34A 2ON6A 5JH7B 2JCGA 3PTLA 4MYDA 1PR2A 2Y9PB 1JG2A 2DX7A 1MH9A 4FDMA 4KFUA 1RPJA 3KJHA 4P0TA 1X2EA 3M3PA 3KKEA 2FMXA 5LXTF 4GX1A 1GZUA 4PLGA 2PZEA 4TT3D 1E2LA 2EXXA 2NUTB 4DV5B 4PZDA 4PC7A 4NPHA 1RLMA 3QF4B 3WRYA 1P7ZA 5C1IA 4EABA 5D3MA 4F1WA 4NVRA 1R5NA 1BROA 3E15A 5LP6A 1QF6A 2PRSA 1SIBE 2QUIA 3EDCA 3Q4GA 4JUDX 4CG1A 4CFSA 2PANA 2QTTA 4G5RA 4AB1A 1WKBA 2AOVA 5LMCA 5I7OA 2ILTA 3BWMA 3HNRA 4FGKA 5JY1A 1H5QA 1RBMA 2C00A 2AFRA 3FR7A 5DW3A 3A3PA 1HETA 1QTRA 2F43B 3A6KA 4R2WA 2X8WA 3N75A 1YJ8A 3FBTA 4DWOA 1J39A 2BHRA 1XRNA 4RVGA 221PA 4MKGA 4DRXA 3OCZA 1F8FA 1XRJA 3DQPA 3JQ9A 3ORQA 4R7GA 1MHPA 2RGRA 3RYHA 1GAXA 1FNSA 2GEFA 1QG6A 3NKLA 4R31A 2I66A 2XB4A 1X1BA 3KOMA 3USZA 4DLBA 1WZ2A 1GPNA 2J9YB 5GTDA 2VH2A 3TD9A 1ONBA 1IXKA 1HPLA 1BX1A 2VSNA 3O8QA 2B8NA 4M89A 1UJCA 5GAJA 4L16A 3SF0A 1Q0LA 1OD6A 5A2QA 1KFEB 2OE2A 3IUBA 3P9NA 4ZU3A 3TRDA 5JYDA 5K0FA 2H7XA 1NZDA 2HHHB 2GSDA 2JH9A 1UAYA 3DTTA 2CLDX 2KI5A 3O8LA 3WLTA 1U11A 3SDBA 3QIAA 4JCOA 2FPXA 1ODCA 2PS1A 4EYEA 2OFWA 5E2IA 5HKLA 2G88A 2ZIAA 5CFLA 2NV6A 3JQAA 3LGXA 4BDTA 3E3OA 1PR4A 4EFLA 1VJCA 4PYRA 4CMKA 1GZ3A 2SCUB 3M5WA 2XZLA 4DR5B 1DCFA 3H2BA 1YULA 4ENWA 1E2KA 1XAHA 2XH8A 1JEYA 5CT6A 3STXA 3DL7A 3CNNA 4YX9A 3GBSA 3JSAA 2BLLA 4L51A 2DY1A 1MJ5A 1RP7A 5DX1A 4C88A 4EMUA 4OX9Y 5JC1A 2ACVA 1UFRA 2H1WA 2AHOA 5G4KB 4ES6A 1EFLA 5BRAA 1FFCA 1IAQA 3BRCA 1Y48E 4BBJA 1WSWA 3V3KA 5DHSA 1G17A 4J0DA 4PS0A 1VCNA 2P9JA 3ONDA 4A4DA 1VLZA 1T9ZA 5CCEA 2QGNA 2QMEA 2HO5A 2GR9A 5C80A 1BXZA 1KJZA 8ATCA 2YIJA 4BWFB 3HACA 2CSUA 4H3SA 1C9DB 3NS7A 1KBQA 2X8JB 4M36A 5KTPA 1DX9A 2WF5A 2WU8A 1UDCA 1PYDA 1LDEA 5TE9A 3T06B 3VNQA 2XW6A 5DNEA 3N2NA 1PZFA 3CIFA 4AG5A 3ECSA 1E7RA 4FI3C 4NBWA 4PSVA 5FOBB 1S3IA 2C92A 1KAHA 4LHXA 5J4HA 3GJQA 1PTJC 2QUKA 2VHZA 5KNDH 4EX6A 1RWKA 4IO1A 1CUZA 4X7RA 5LOVF 2ZYHA 1FXSA 1M0SA 3SNHA 5K0BA 2CKDA 1PG2A 2O9JA 4P7JA 5KYUB 3Q5DA 1FU4A 1Y98A 1KFBB 3DBHA 3DHWC 4E03A 2QU7A 1I3CA 1IK4A 1OI7A 2HQ1A 2G5CA 2VYFA 1GPKA 4DZRA 1GZSA 2FSSA 5JLJA 4NCNA 3HO6A 2X9VA 3PDHA 5GWXA 4H0NA 5BR8B 3WXMA 1M34A 3W8DA 1F0YA 4YAWA 3GAAA 3P96A 1Z74A 3A6FA 4LMBA 4TUYA 5JPIA 1CY2A 1EJBA 1DRWA 2B6NA 3CIOA 3ORFA 3R5HA 5K3DA 4MP6A 1G9TA 2ODPA 3V46A 4RZQA 3WGVA 1XQWA 3WQHA 2BKAA 4LJ7A 1ECPA 2ZUVA 4NMWA 5BQXA 3ZEAA 3QP9A 1S8OA 4JU9A 1SCAA 1Z83A 2IZ7A 4NZYA 3NYWA 1PJSA 1H6DA 2AJ8A 3LY9A 4LY9A 2BLNA 3N0RA 4HNAB 3PZBA 3UANA 4BVGA 5C51B 4UU7A 1E18A 3HZZA 3BBPA 3DBIA 2J67A 1VBMA 2ZVQX 4LK2A 2KYRA 3RFVA 5LWHA 3M9XA 4DIEA 5H8WA 1ZISA 1Z73A 2WWTA 1O4WA 1VHWA 3OQJA 5C3MA 3SIWA 4FR0A 4LX8A 2YN2A 2X8BA 3CM0A 2CBZA 4F3YA 5EINA 3EF3A 1UR5A 4TSKA 4M1KA 1YA4A 1UEIA 1S7CA 3KZKA 4Y6LA 2ZFUA 4AZSA 1DS6A 1AGXA 1Z6QA 3OZXA 4FHGA 4BMDA 4QOSA 4RJKA 1JHYA 4AF8A 1T6NA 1H1LA 1HY3A 4DDMA 3OHXB 2J9RA 1IHYA 1TC2A 4GKBA 3UV3A 1EKXA 1UXGA 1UWLA 4ITRC 3MSXA 4R98A 1IE3A 3O4JA 1AV7A 3NC1C 3P19A 1AG9A 3D6TB 1WIWA 3KQYA 1Q7CA 1E9CA 2GETA 5BPHA 3RTAA 4NCKA 4AY4A 4L3WA 5EFOA 3INGA 2P7IA 2IXFA 3SQDA 5EJ8A 4UUOA 3D6NB 3SGLA 2XWPA 2HSZA 3EXG2 2Y05A 2H1OA 2PRIA 1FYVA 4YCJA 1VPTA 1WTAA 1Z0FA 3CF4G 4XE5A 5EZQA 1VSTA 1REQB 1ES9A 2O7NA 3DE0X 3ACDA 5IG2A 3TK1A 1DWPA 3E2PA 4PXYA 4XQ0A 4B3FX 1KEPA 1MEEA 3EIQA 4QJ4A 4D8YA 2FPOA 3UT0A 5CCXA 1L3BA 2NSDA 3A6ZA 5AW3A 3PXCX 4JA0A 1YCFA 3JTEA 2REBA 2XE4A 3GZJA 3N7UA 1SZCA 2IRWA 1ZLXA 3PNSA 1NFFA 1MB4A 3A9SA 3DXXA 4W1PA 4CMAA 2PSHA 5AW5A 4II2A 1HC7A 4S0XA 3UPUA 1GZ5A 2WDZA 4R84A 1W96A 3OECA 4I3HA 8GPBA 4BFTA 3X1YA 3EMDA 4N18A 2A8YA 5BVGA 10MHA 3ZE7A 1VKHA 3FWYA 1FQWA 3U44B 1HZZA 1UIMA 2B1RA 4NCBA 3HEAA 2FP4A 2JKZA 4LUCA 1E3TA 4TLAA 4FXKA 3BH7A 2FMUA 4N5NA 4OP3A 1SAYA 2WSMA 1BXRB 3L46A 1U3UA 2E3JA 2X0RA 3GRVA 1EWVA 2HSEA 1YDGA 4YGXB 5G1PA 3UJ6A 4UCXA 1RE1A 4E94A 1Y9EA 1JB9A 1OASA 1W5AA 3FPKA 2DUMA 1VYTA 2PWZA 1CF9A 2Z8ZA 3O4VA 1UP7A 1V16A 2VCEA 5H7XA 5B5SA 3E84A 5FBVB 1PX2A 1CJTC 4GUAA 4YREA 2DSNA 2WMDA 3K0CC 2RGWA 3VDRA 2Y1KA 3S99A 1R0KA 1MCZA 3FBGA 2JASA 3JQQA 5I5GA 1P9RA 2TYSB 2PPVA 3DW1X 1C0IA 2YWDA 4CMGA 4BTVA 1B42A 1GR0A 1S02A 3AONB 3RUHA 1EFRA 5LIPA 3CLHA 1YJXA 2AMVA 5TEVA 1APBA 4ND8A 5TGDA 3ZDQA 2VQ3A 3DD1A 3ODPA 4BQIA 1HG0A 2ANCA 2OFOA 3UJPA 2CZQA 3MS7A 3PGVA 1QLWA 4PAWA 3EC2A 4YFVA 3GN1A 1N6LA 4I46A 2YCBA 1VKNA 3LMKA 4LE0A 4HAZA 5HMMA 1XFDA 1ML3A 5CCDA 1OI3A 2AS0A 5BSMA 5FTLA 1FJXA 4Z4FA 4ZV7A 1XN1A 1ADCA 1DO8A 5T6BA 5T4EA 4YQYA 4D81A 1FS5A 3RSHA 2JJMA 1WCXA 4JB3A 1Q1BA 2IXAA 4MUJA 2GPBA 4UBKA 3KD3A 3C7TA 4J6FA 4DJDC 2IQ5A 2JIPA 4EFNA 2Q5QA 4S1OA 2R7AA 3MTAA 1OFIA 2AG8A 4N5IX 5GIPE 5CA1A 2ZTHA 3N8DA 2RBEA 5EUMA 3LVRE 4ZDWA 3PXGA 4D5EA 3TF5A 1OVGA 2C7VA 3WB2A 3IVGA 1VSBA 1VM6A 4WW0A 2CD7A 4GBGA 521PA 3V7UA 1K5HA 2BEVB 2TMGA 3WRXC 2WTMA 3KAJA 5K3OA 1L5HA 2G7ZA 1ETUA 5KJFA 3WADA 1Y9DA 3VHQA 2QK4A 3HJRA 4COOA 2PX0A 3J81A 5G0UA 1U8FO 1G1AA 2V59A 3ESAA 3QX3A 5CP8A 1KPGA 3BF8A 5LKRA 4CN9A 4OQEA 1JR4A 2FDRA 3ZBUA 4AURA 3D0QA 1OIWA 4FWBA 1UC5B 3QX9A 2YYSA 5IAEA 1J0XO 2FDXA 2RKOA 5HTKA 1JAZA 1YRBA 3L7IA 2HHAA 1F38A 2O2IA 3OT5A 3M9WA 4LRYA 1DC3A 1M6HA 1SA0A 2XVAA 4HYQA 5IDVA 4I1IA 2X0EA 5JTTA 2D7DA 3AY0A 3RYFA 5KB3A 4C9BA 1G63A 4G0ZA 4LOHA 4RHFA 4RTLA 4PZAA 3PDUA 4HFRA 1GXSA 1Z9BA 1TQ6A 1RT9A 2AUMA 3CX4A 4MQ4A 3HTXA 4HDMB 1WW2A 4FIZA 3PENA 4WKOA 1TVMA 4EKGA 5L4NA 1OAAA 4I9NA 2COUA 1YC2A 5A71A 3FUWA 5HS4A 3VKFA 3ZGZA 1Q3TA 4RHCA 3M4ZA 2HDNB 3WMGA 2DERA 4IJWA 3CPSA 5JCZA 1BXKA 1RLOA 1BX3A 1W29A 1YBMA 5FL7D 5JRJA 1JP7A 4UREA 5FUBA 3A04A 2HCFA 1KORA 1GR1A 3M89A 2I1QA 1U65A 1FNBA 5HM6A 2XXAB 1KK0A 3L07A 2AFHB 3OX2A 3P7MA 1RI2A 1PR6A 5B37A 1PQ4A 2OBXA 3MWYW 4X20B 2RC5A 5FTWA 3SJAA 3UGTA 4EEKA 4Y98A 1F2VA 5CNIA 4KUGA 2R1TB 5BQPA 1ZK1A 2Y4NA 3L4KA 3DEYX 5GOTA 3KHSA 5B3LA 4QGSA 2C7QA 5CPBA 2XCSB 5K9ZA 1CETA 3BXPA 2JI8A 3JD3A 3MQFA 3QVUA 3HBMA 1IY8A 2A3NA 4HNQA 3L8HA 4IVPA 4MWBA 5BY2A 3VVBA 1Q0TA 1PQWA 2PX4A 4Q47A 1OWOA 1ZD2P 2C2KA 1TRHA 2VUUA 4G0XA 2P77A 3VVCA 1WDTA 4J0QA 5KNBA 3NALA 4P31A 4S2UA 3KFLA 2CMGA 4H35A 1ODTC 4HWKA 1Q0PA 4DDWA 2CL0X 3M83A 2D74A 3C3XA 5CB4B 1UH5A 1DADA 3H4VA 1ZJ6A 4EY7A 3KOOA 3ESDA 4IGKA 5BV0A 5IBQA 1KXZA 3IOCA 3TR5A 2NADA 3BGSA 4HAYA 5IARA 5BNIA 5BQ5A 3IXMA 4FHDA 3CGWA 4GX2A 4C0QC 3TXYA 1M6YA 3AEUA 4DCUA 1Z8FA 4YRLA 1TPYA 2IOHA 5K0TA 3BT7A 1XTZA 2AMYA 1RCTE 3QXHA 5K09A 2B8EA 1YRHA 1P0MA 4BE7B 2VLIA 3E7DA 3I53A 3CH4B 3FYDA 3V48A 3KJIA 2XMCA 1K4MA 3HCOA 5TIIA 1ZU4A 3TFQA 4IP0A 3E9CA 2Z5LA 5FI0B 3VNRA 1WLSA 4RVCA 4BO0A 1GTSA 4GICA 4Y2PA 2C1XA 3BFXA 3BSSA 2ZWMA 3PLRA 4MGZR 5DBHX 3NRJA 4A5SA 5JD4A 4MV0A 2OQRA 2P8SA 3JPWA 1H66A 5DOVA 3TSYA 2VYNA 2ZJ0A 3KPWA 4U6QA 4KUEA 4LYHA 1EJ2A 1E2JA 1LK0A 1IBCA 4FYMA 2YFKA 5BV1A 1XU7A 2VJMB 4WECA 2H92A 5KX5B 2BFWA 2P35A 4KQIA 4MQLA 3KELA 5AVVA 5JH7A 5JMTA 3E3LA 1WULS 1HI9A 1FMFA 3W3ZB 5I48A 1N6IA 1L7QA 3JALB 1T8YA 3L7BA 3RB8A 2E48A 2GZHA 2Q1YA 1CUXA 4IH9A 2ISCA 1I3KA 3ZWMA 1I1OA 4B4WA 4OHKA 5H3LA 2NUTA 1SXJE 1R6BX 3RC8A 3RHFA 3QF4A 5LU8A 2QR5A 2ZTVA 3ULKA 4BPRA 4ZK2A 2WF9A 2QUBA 4QKQA 3QEAZ 4D9CA 4I9FA 1ADYA 1HDYA 3GR6A 4KCGA 3CX6A 4RH0A 3CRNA 1G6KA 1H6AA 1XJQA 3H2SA 3HM2A 3RT7A 1P4HA 3KEQA 2DP4E 4PCVA 1PR1A 5DMHA 3MMZA 3K8OE 3IP8A 4NBLA 1DFHA 3EOAI 5KTKA 4ZJZA 1K7CA 2IX9A 5CM9C 5I9NA 3BL8A 3R9IA 1CDDA 3THRA 4YA6A 3CX3A 5EQTA 1NZJA 1FW6A 1Y7IA 4FFLA 2GBLA 4KODA 1G8YA 4H1TA 4QGFA 1NN0A 5DT9A 1PUXA 1UMCB 2FEAA 1S4QA 5ALSA 2PV7A 4BQRA 3T7EA 4DLKA 2HLDD 4DNXA 4EI7A 1P4GA 3DP9A 1CP3A 2WYUA 1KERA 4QD3A 1IOVA 1YZKA 4RENA 3D3JA 3K9BA 1EVIA 1N7HA 2B0CA 3ADOA 2CY0A 2GO1A 3R3YA 2ECPA 2G8NA 4BGUA 3EDOA 4CPDA 5T4HA 3BWBA 1FOEB 1OA1A 3I3SR 1KJ9A 3NLLA 4J0JA 2EG9A 1ZLYA 1N6PA 1R8JA 2N42A 2HGZA 4UTXA 1KHHA 1XTIA 2CVQA 3EHEA 5DULA 2SCUA 5D1HA 3GRUA 5AM0A 2FN9A 1FY2A 3MWGA 5KCZA 2O8VA 5G40A 1VTKA 3R3SA 1U90A 4ENUA 1IJKA 1S1CA 3T54A 4EPXA 3QYJA 3SLRA 3PU6A 3L2OB 4ZJPA 5G4KA 4R8RA 4ROTA 2AV6A 4MH0R 2PKYX 2BMWA 1S4MA 2HF9A 1D8TA 2PT6A 4ALMA 4DMHA 4AJ4A 3KR1A 2GAJA 4CEIA 3T35A 1AZWA 3DFZA 1XNRB 1IUKA 1JT9A 1PT6A 3QTLA 4XJVA 2Q5JA 4DJEC 5DBOA 4OSOA 3IL2A 1L8QA 4Z3DA 2ZB3A 2I07B 2YVAA 3T7AA 4BGIA 1TFUA 2XY4A 5LFAA 1NLFA 3AV3A 3TCKA 3ZKAA 1T25A 3G0BA 1A9YA 1NVKA 4Q3LA 3WC4A 4XCVA 4TUYF 1W30A 3R9XB 2CUZA 4MLDA 2R6FA 5EPEA 3NC0C 4ZT3A 4AW9A 3C3KA 3AI3A 2WSIA 3BD6A 4J8PA 1M6EX 3VOBA 2FW6A 2AQIA 5C8DA 5ELXA 1YXMA 2HMYB 1P7VA 4F2WA 2Z95A 5F4BA 4DMGA 1U4SA 1N2XA 1NMXA 1VKZA 3NV9A 4L78A 3U3RA 2D2FA 2J3MA 2Z1DA 3WLAA 3NWBA 1N6RA 1V7PC 5KYUA 2JRLA 3LLMA 3DKKA 2AB0A 4MEJA 2FKNA 1ISIA 5IFKA 4DN6A 3O4GA 5IM4A 4MMZB 1GG5A 2FFAA 4IIVA 2UZ1B 1K6JA 2PBZA 4OVKA 3WSWA 3WLLA 2XUGA 4DNPA 5DI3B 4DG8A 2OKGA 3CVOA 2FR8C 4LRQA 4IXNA 3CKMA 5CH3A 3E8XA 1M2OB 4DAOA 1V41E 4M0MA 3WTCA 3PX7A 5B64A 3C3PA 4JXZA 4PTLA 5GOZA 1P33A 3RRYA 5K03A 3G82C 1KIAA 2CL7X 1KU6A 1ZGZA 3MPUA 4QYMA 5KNDA 4Q4LA 1XZJA 3MJSA 3ZVMA 4MA5A 4B9AA 4C87A 4HNAA 1G4AE 2HA2A 2IYEA 4JQZA 1ZM3A 2VATA 4EDFA 1IMOA 4RA9B 1T5HX 2O0LA 1OILA 3EAFA 2AJBA 1H2ZA 1DIAA 3IS3A 1MLDA 2I91A 2X5JO 2AR7A 1K97A 1TVCA 3VZCA 3K35A 2IPOA 3KZMA 5TARA 1Y5MA 1UKYA 5JLAA 4XASA 1B16A 2QL7A 1ACMA 1T9AA 1XCMA 3LXXA 4RELA 2DLDA 2QMOA 5F77A 2A0KA 4OGFA 4LE2A 4PBRA 3H1GA 3Q8KA 1YJAA 1PNVA 2AG6A 4XQEA 5E7QA 5REQA 1QHXA 5J58A 3SZRA 2ZM5A 2HQOA 4IUYA 1WSAA 3VZBA 2A73B 3I2HA 4TWIA 1E2UA 4ESEA 1J5EB 3E3NA 4XKJA 1T4DA 3DTVD 1OLUB 5IPFA 2XECA 2JA2A 2JFUA 3MJRA 5DDIP 4KOAA 3DL2A 2WWWA 5LUAA 2O4UX 4EVQA 3IAUA 4PX9A 5CJPA 2VPQA 3N05A 5T5QA 4L9SA 4URZR 2R86A 3U4IA 1KRWA 3H1TA 2ZUBA 4R1LA 5KU1A 2PSFA 2Y27A 3K2IA 1XOIA 2XRYA 3HV0A 4P7BA 3C5VA 3KLSA 1Y3AA 3SX4A 1QAOA 3TW8B 4L9RA 2CFRA 3UCEA 3MQ2A 3WIVA 2KLHA 5GZ3A 3DEFA 3I9KA 1AB5A 4M22A 5B7QA 2ZATA 5JYBA 1CCWA 4XGNA 3THWA 4EB8A 4U7DA 4KQ1A 3UHOA 2AZXA 1REQA 3OJFA 1UBNA 5HXAA 5K0SA 3AI2A 4HXFB 1ZOIA 4RTNA 1O5OA 3ENWA 1E63A 4S0ZA 4EOGA 1XN4A 4C0KA 4MV8A 3CF4A 3A9RA 4J4BA 3WYCA 1A72A 4PONA 4U6NA 4L4YA 5A1JA 3C41J 3D5TA 5DHAA 5J4KA 4TXMA 1G8JA 4QU8A 1NNI1 3U3MA 3AV0B 2IU6A 2QI9F 3K32A 3NNDA 1BEEA 2CD9A 4L5YA 4PBTA 3EF1A 2PZGA 4Q9AA 5JNRA 3EUFA 4N9QA 1Z4QA 3FYHA 4QEZA 5EIFA 3ZNPA 1C9JA 1JG7A 3KQVA 1GQSA 1WMFA 3KL2A 3Q8XB 3GZ4A 2C5HA 1VECA 2W0SA 3L1KA 3KOXA 4XXHA 4ZT2A 4HVTA 5FTKA 3VYWA 3K6KA 1NI4B 4L8WB 4QDUA 2QAGC 2QTAA 1BDHA 5AUOB 3TIIA 1JT2A 4B84A 5HWSA 3WGIA 3RC7A 1BXRA 4B2PA 2X6RA 4M88A 4MCAA 4GH5A 4RK5A 3HLTA 4EHHA 1NVFA 1XRLA 4ZA2A 4WXHA 1ZO8A 3U48A 2G72A 2GGSA 2JFVA 4AQYB 3UH1A 4Z2YA 1MOSA 3AW8A 4EZEA 5A06A 1B0AA 1COWD 1ZRMA 2DQSA 1IHOA 4Q1BA 4AJ9A 4D4LA 2IPXA 2LVBA 4AI6A 4FOSA 3GFOA 5EE0A 5LQDA 2GJSA 2Q2NA 4MUKA 4M9CA 5CA1F 1VSQA 2QF7A 4H4DA 4P0PB 1QLHA 1WUYA 3TZHA 3GGJA 4A0QA 1ZC3A 4ALJA 4D3SA 1H9AA 3HFSA 1A9QA 4MUEA 4WNAB 4HMPA 1JPNA 1IWOA 3K2EA 4NDAA 4JUFA 1HT2E 3R7AA 1GUZA 1MRNA 3C43A 1MIOB 1JU4A 1Z4NA 5DK4A 4A8PA 4B82A 3I62A 3I9JA 2YYYA 1T5OA 3F5FA 3AVTA 1E2MA 1G2PA 3MMXA 1F1JA 1YE8A 3TAHA 1LW7A 3VO1A 3W05A 3DA8A 1AQJA 2WHYA 1GNTA 4S3MA 1WBBA 5F3WB 1E5VA 4RM2A 4D9BA 5A5EA 5KWSA 1CSEE 4L4RA 4LJKA 4ZOEA 5DNAA 4ER7A 3I5MA 3ADBA 1T91A 4FXOA 2REOA 1HV8A 1MO5A 3CNHA 2OHGA 4V0KA 3SJCA 4N5LA 1ZGBA 1TC1A 2OXCA 2WABA 5EE5B 1TM5E 3U62A 1QYDA 2BEVA 4LWPA 4HDQB 4A0SA 3L6CA 2Z98A 2Q0XA 3I9MA 3L01A 5E38A 3OAAD 4D99A 4BEBA 3QE2A 4FMPA 3WTBA 3P26A 1N6OA 2W2XA 1V43A 3VR4H 4JJEA 2WHPA 3G7UA 3KL4A 3CRRA 2W4MA 5L3QA 2PJRA 2Q8QA 3R3JA 4G65A 3G9UA 3U81A 1Y3BE 4IIXA 1QP7A 2YNMA 3AR3A 1SD2A 2ZRCA 3BG5A 3L1IA 3P9ZA 4I66A 1IXRC 4CN8A 3CV3A 1MP0A 5B3JC 1IRIA 4KPFC 2BMDA 1F9EA 4DLTA 3V00A 4AROA 3S2YA 5AOVA 1U7PA 3VR2A 2BEWB 3DLPX 1V71A 4HDMA 3KTOA 1L7DA 1DTWA 1QV9A 1XD9A 2XIJA 3HVKA 4NJMA 1IN8A 4UXIA 5EKSA 1A9XA 3SVTA 3MWJA 3C39A 4AJJA 1X8LA 3TX2A 2ZXUA 4CXMA 2O1WA 4K5QA 2XMRA 1YR6A 2ZRQA 1LBTA 1VHLA 4WIAA 5B57C 3ZK7A 2Q49A 3QKIA 1G291 1K3FA 1Q6ZA 2V5AA 4ND2A 5G3YA 3OQVA 4BU1A 4YUXA 2O8BB 3L43A 2J3HA 3O2JA 4HX5A 3L4SO 4KO8A 1J9ZA 2UUCB 5F12A 5DHUA 1LPAB 1CX9B 4LYEA 3V2GA 4LKOA 3SSMA 2OTCA 2XXAA 5I7HA 2AFHA 4TVSA 2GBIA 4K1LA 1RAGA 4ZZ1A 3ZQUA 3EVFA 5A7HA 4X20A 1XZGA 3K09C 1MX5A 2PTHA 1E2QA 1W19A 3FYCA 2J0QA 5TVKA 4C0HA 2EFYA 2R1TA 3I2KA 3JZFA 4H15A 2JLRA 4KZKA 3UT5A 3JVUA 4KGZA 4OQQA 5KREA 3OF5A 3TLYA 1YQTA 4URXR 1LA2A 4W63A 4N5HX 2FEMA 4RA6B 1KE1A 3EGWA 3VKGA 2EQAA 2Q9CA 3G8DA 2JLZA 2KSQA 3ZIAD 5J59A 3SYLA 3CNEA 3ICOA 4G1BA 2FG5A 1WPRA 4IJ6A 1NOIA 1GG9A 2H51A 3HA2A 2WQZA 4Q66C 2XMQA 4EFMA 2XZDA 5CB0A 4MQUA 4B8WA 4EF4A 5FULA 1GFSA 1SXJD 1X70A 2BI7A 3VDXA 4LNVA 2PTGA 2A4KA 4UC0A 1RIFA 3WYAA 4WV3A 5BNTA 2X1MA 5CB4A 3SZLA 3WGKA 1CP2A 4EVSA 5JQWA 4WZBE 3PS9A 3KLBA 2YQ5A 2AMFA 3OZFA 5KVSA 3AFNA 4MCIA 3FCOA 4EG7A 1K89A 3J7AC 3JYQA 1N9KA 2OHXA 1XDZA 3AHHA 3W6ZA 1GKUB 3LFUA 1OW3B 2DJIA 3LWZ