2OZ4A

Structural plasticity in igsf domain 4 of icam-1 mediates cell surface dimerization
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
265
structure length
265
Chain Sequence
VLPATPPQLVSPRVLEVDTQGTVVCSLDGLFPVSEAQVHLALGDQRLNPTVTYGNDSFSAKASVSVTAEDEGTQRLTCAVILGNQSQETLQTVTIYSFPAPNVILTKPEVSEGTEVTVKCEAHPRAKVTLNGVPAQPLGPRAQLLLKATPEDNGRSFSCSATLEVAGQLIHKNQTRELRVLYGPRLDERDCPGNWTWPENSQQTPMCQAWGNPLPELKCLKDGTFPLPIGESVTVTRDLEGTYLCRARSTQGEVTREVTVNVLSP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Intercellular adhesion molecule 1
publication title Structural plasticity in Ig superfamily domain 4 of ICAM-1 mediates cell surface dimerization.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 50
structure length 265
sequence length 265
ec nomenclature
pdb deposition date 2007-02-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2oz4A01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2oz4A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2oz4A03
1KCSH 3WJJA 1JGLH 4TOYH 3W81A 1FE8L 1X4ZA 4ZOCA 1TZHA 5EU5A 5JHLL 4KKCD 1DL7H 4KKNA 4X6EB 1A5FH 4XMLL 5J6HB 4NQED 1TENA 5F7DA 3LD8B 5BZDA 2R0ZL 1G7IB 2X4QA 2BHYA 1CLOL 1U8LB 5ACMA 3H9YA 1RZKH 4K3DL 1F97A 2FJFB 5JOEA 1A47A 1NCDH 1DLFL 4NQUA 3QG6B 3SDYH 4OT1L 3KYNB 4KROD 3WXVL 2X09A 1NCCH 2YMXH 4KWUA 3MLUL 5B39B 4ODTH 4JGUA 4WRLA 3U36A 4WWID 4PRBA 3IFNH 3LD8C 2Q8BL 3O3DA 4QNPE 5JPNA 2FL5A 3ESUF 3D2UB 1JTTA 3DTXB 1G1YA 1NBZA 5C0FA 4QTIL 5C9KA 3H42H 4M5YH 4MQTB 3TIEA 4NWTL 1L7TH 4LCUB 1LP9E 1JWSB 4K94H 4AM0B 1M05B 4NKMA 3MRNB 1YPZB 1I3GL 1ADQA 2FBOJ 4P3WA 5D8JL 5C8JB 5GGSB 3V7AE 4UQ3A 3MV8E 5GISL 4BH7B 4JPIB 1Q9LB 5HHXL 5BW7A 1ZTXL 4NZTH 3RIAK 2UWEA 5EO9B 1EERB 2J88H 5KSAD 2A6JB 3AFLA 1ACZA 4QGTA 1FVEB 1RI8A 5IP4A 2DRUA 3BWAA 4JHAL 4OI9A 4M62L 5BRZE 5D2LA 4F3FB 4WWKA 5I1AA 2Q86B 5FO7B 1IKFH 1MOEA 2YPLA 3D85D 4LSUL 3SOBH 4DZBB 4HUMB 5IB5A 4A2LA 1BFOB 2A6DA 4XH2B 4XAWL 5BO1L 1A21A 1VFAA 3HUJF 4CVUA 4Z8FH 4NQEE 4KJPC 2BDNH 5FKPA 2BVOA 2WANA 4Y89A 5F72S 1TVDA 1QFWL 3FN0H 5B8CC 4F58H 4OZIF 3P73A 3TLRA 1CD1A 5CJBA 2W0KA 1M71B 2EH8L 4OB5H 2HJLA 2G75B 2DDQH 3U4BH 1R5IA 1A7OL 1FVCB 4NUJA 4XNUH 4WO4D 5D7JB 3VJ6A 4HUKB 1KCVH 4F37F 1AO7A 4UDTA 2BK8A 2RJMA 3VFTA 4XNMA 2DLHA 1OCWH 1U58B 4K2UL 5D6DC 3KGRA 5EZIH 2APWA 1A6UL 2AGJL 3VH8B 1IGJA 3RWJB 1I8IB 3TT3L 3S4SB 4Z5RB 4XGZB 1P2CB 1X7QA 5AUMB 1AGCA 3X14B 5D7JC 1DEDA 5MP6H 5C2BH 1VGEL 2CIKB 3P77B 4D9RD 1TCRA 1NLBH 4Y16C 1ZMYA 2Z8RA 3OG4B 4OGZA 2FYYA 2H2PC 3WFDL 1UH3A 4ZD3L 1XF5A 4EN3D 4YEFA 1JZ8A 3VXMB 5CINL 2DKMA 4DUXA 3BKCL 3O45B 1OP3K 2XV6B 4XCNB 4ZSOA 5EOQL 2ADJB 3O6LH 1LP9B 2ARJQ 4G5ZH 5ALBH 5F7KC 4X6EA 1F90H 5J6HA 1HSAB 3MV8B 5C08B 1G7IA 4R90H 4M6NH 1U8LA 1SJEB 3BOVA 4L29B 3ULVH 3MJ8B 2Q3ZA 5BMFH 2XQBH 2FJFA 5FYKU 2ZJSL 5F97E 2YD2A 2OR7A 3KYNA 4HCRH 5I19L 3QWOB 4KJWD 4ZFGH 3VWKB 4GBXD 3C87A 4J7RA 4LLMA 1MCBA 4ELKA 2I24N 3GO1H 4M7LL 4PJAB 3N50A 9CGTA 1JZ7A 3OMZA 5DFVC 1KCKA 3CPLA 3D2UA 2B2XH 1TJGH 3DTXA 4NQEB 3FZUC 5LJYH 1MREL 2Z9TA 5KVEH 4DGIL 5DMYA 1JWSA 4AM0A 1M05A 2C3WA 3MRNA 1YPZA 5DJYB 3VI3F 1LEGB 5C8JA 5GGSA 1WIOA 5JO5B 4BH7A 4JPIA 1Q9LA 3G6JB 2AKRB 4OLYL 4XAKD 5EO9A 1UWXK 3VWKC 4KROB 5B8CA 1YC8A 5EC2B 1A6TB 2BSED 4D9RE 1MCPL 1FVEA 4P2QE 1MLBB 5CZKA 2QHRL 3CLEL 2IH3B 4F3FA 1ED3B 2Q86A 2P5WA 2YWZA 5FO7A 4J3SA 5D2NB 3WNNA 5ITBH 4DZBA 1E27B 1BFOA 4XH2A 4ZYKB 5SX4H 1DQQB 3HMWL 2ZUWA 3V0WL 4KROC 4ZO8A 4XVSH 3BP4B 5D6DA 3H8NA 2EDWA 1R0AL 4LGSB 1M71A 4KTEH 5KSAB 1CWVA 1DQDL 2G75A 5D7SL 1FVCA 5F1IA 2WUBH 2BOCB 5D2NC 2DQHH 2IWGA 1U9KA 3QO0A 4PJIE 1K8IB 4Y16A 1HHGB 1BVLB 4W6WB 5J9PB 4JFPB 3SKNB 4PV8B 1U58A 1G9NH 4UTAH 4LEXL 4NGHL 3VH8A 4KMTL 4JQVC 2V2WA 5KSAC 4HAFA 1I8IA 4Z5RA 3S4SA 4XGZA 5AUMA 4XC1L 5IBUB 3X14A 4LSPH 4KPHH 2ZCHH 1UXSB 4L8CB 2CIKA 3P77A 4WO4B 1LEKB 4RRPA 3TIDB 5F1OB 3CDCA 2X4NB 4R8WH 5KVDH 3GHBL 3VXMA 1I1AD 1I7ZB 3O45A 5DO2D 4AY0A 4XCNA 5TDPB 4N8CL 4OCLC 4J3TA 2ADJA 3PGFH 1LP9A 3GUTB 4X7EC 2EIBA 4XP4L 1HSAA 2IFGA 3MV8A 5C08A 4WO4C 1SJEA 4OIBA 4EI6A 2ZSVB 2VZVA 5E95B 4B53A 4J3WA 3MJ8A 4YAQB 4HWEL 2EDLA 1F4WH 5B3NA 3DUSB 4PPTA 4UT6H 1MF2H 3TVMC 1NCBL 2W9EH 1KIUA 4EN3B 3QWOA 4WHCA 1PQZA 1OHQA 4MDIA 1XEDA 4PJAA 2C4XA 1NDMB 2GYSA 5EORL 1T7VA 4NQEA 3U0WH 2CXGA 2VH5H 4G43B 2ICES 4UNTA 2FX9H 1WWAX 1RK1B 2HJFB 3EO1B 5DJYA 5D93B 2YS4A 5JO5A 4KMLB 4HG4K 3G6JA 5HVGB 4EN3C 2AKRA 1UKSA 4PJ7E 3TYGL 1QTYT 3VDAA 4PJIB 2BERA 4MS8D 3TGXA 1MQKL 3LKOB 5JIHA 4FABL 5EC2A 3V7MA 1A6TA 2OZ4L 4GBXB 1MLBA 4PUBH 3PF2A 3PP4L 2IH3A 1ED3A 4GRWE 4NHUB 5D2NA 4XHQA 5INCB 1YEGH 3D0LB 1IE5A 1E27A 3GJEB 5D93C 4IOIB 5F6IB 3DSFL 3UBXI 4P2RA 4ZYKA 5E00B 2E7BA 3UTPD 1R6VA 35C8L 2H41A 4EXPX 3OAYH 1B2WH 3BP4A 4PR5B 5C0GB 4FQXC 4KJWC 3LH2H 1XF4B 4GBXC 1FGNL 1P5UA 4KVNH 3QDAA 4JQVA 1CD8A 5KSAA 2V6HA 3GMLB 2VR4A 4U6XA 2BOCA 1GGUA 4TSCL 4M02A 5EO1B 3TWCH 4AJ0A 1N6QH 1P53A 2I25N 5F6IC 1K8IA 1QFPA 1BVLA 5J9PA 4JO1L 4JFPA 3SKNA 3L5XL 4KUCD 5DHXB 4PV8A 3UYRH 5DA0B 4LLVB 1E4XI 1YA5A 1EJOL 5GXBB 4LVHB 4U49A 4XRCB 5CZVL 2GEEA 2BY3A 4P2CG 3HFML 1UXSA 4L8CA 5C0AD 3LS5H 4WO4A 1GCFA 1LEKA 3TIDA 2D4FA 1S7XA 1BWWA 2X4NA 2DAVA 3VFSA 3BKJL 2BVQB 5JZ7D 4QOKD 1KTRL 3BP6A 3CVHB 4TUOB 2AABL 5IHLB 3GKZA 1I7ZA 4O9HH 4OLVL 1IAII 3TVMA 5TDPA 3C2SA 3MOBH 4LVHC 3FONB 3ARXA 3FKUS 3GUTA 1YYLL 1XGYL 4Y1AD 2GSGB 3JSSA 3MCLH 2DQTH 1GGCH 1WTGT 2JK5B 4OZFB 4PJ7B 4CRPA 3CX5J 3JZ7A 4XC3L 3SE3C 5CP3A 2ZSVA 1YJDL 5IM7B 2BNRB 2F19L 2GKIA 1OAZL 1UFUA 5B38B 3UXFA 3L7FB 4YAQA 3FRUB 1F6AB 4MVBD 5DEZA 5IVNA 2G60L 2A38A 3DUSA 4G3YH 4GRWB 3HC0B 4EN3A 3GK8H 3CJJA 3QDGD 3QR2A 1I1AB 3RVWC 2YXMA 3MV9A 1NDMA 2PNDA 3F5WB 3TA3D 3NCYP 3QISA 4G43A 4H25B 2QHLA 3IDYB 5FCUL 1RK1A 4KTDH 4UNUA 2HJFA 3EO1A 2XG5A 3PV6B 2A9ML 4RGOH 3MRDB 4G6MH 1N26A 1ZVSB 4Q2ZB 1I1AC 1UGNA 5DD1H 4PJIA 5DO2C 3CVIL 3LKOA 4PRPD 4LQFL 1D6VH 4FQXA 5C0AE 4GBXA 1PZ5B 5T5FL 4BFIB 2VSCA 4HPOL 4NJ9H 4ZS7L 2VSDA 5BXFA 4U05A 4NHUA 4N0RA 3NCJH 1LO4H 3IDYC 5INCA 4QOKE 3I6GB 5FYKL 3D0LA 1J1OL 3OAYK 1MRCL 3GJEA 5IWLC 5CJ8A 1I9RL 3ZLQC 2OR9L 2WAHA 1A8JH 5CP7B 5E00A 4ZO7A 4DKAA 4X9BA 4GKSB 5C92A 4PYGA 3NACH 4PR5A 5C0GA 2EDDA 3INUH 1EK3A 4NKDB 5FYLH 3GMLA 5GGVH 4N9OB 3HNTL 4KJYB 4ELME 1SYVB 2BHZA 2ZG3A 3K81A 1VEOA 1E4XH 3QDGE 4KH2A 2X40A 1D7FA 4M7LT 2EIZB 3P11H 5M94B 3QYCA 3JWDL 2P8LB 1OB1B 2OCFD 2DI7A 4OJFH 1IBGH 4LLVA 1M7XA 1KN2H 4GKZB 4HFUL 4MS8C 1H3PH 2I26N 3KXFB 4XRCA 4Z7WE 4YK4B 4ZPVB 1N7MH 2H3NB 1EEYA 4MA3B 4Y19D 1FPTL 1CG9B 1IAIH 3SE3A 3IDXH 3RBSA 2AEPH 4PRPE 1Y6MR 2BVQA 1G6VK 4IM8A 1NGXB 3CVHA 4TUOA 4Z95L 3RVXD 4KI5D 3V5HB 1WGOA 4LAJH 2OR8A 3UO1H 4KC3B 4X7SL 4TQEH 3PV7A 2XN9D 4YXKH 1U8HA 4YK4C 2VDOH 1JV5B 2GSGA 2EC9T 3CXHK 1X6NA 3QIBC 4OZFA 4PJ7A 3VXUB 5I1CL 1YY9D 5IM7A 2BNRA 3D25B 3ESVF 5KZCB 5C0AB 4MNQE 5B38A 5DEFB 3FRUA 1DN0B 1F6AA 4MMXC 2R29L 4QHUB 3GSNH 1IL1A 2G5RA 2VLRD 1BZQK 5DK3A 5EBWB 3HC0A 4V1DD 4QOKB 3AS2A 3B4NA 4OM0H 1I1AA 1Q9OB 1CBVH 4BFBD 1JYNA 1CQYA 1ITBB 1AJ7L 4YZFF 1J0YA 4OCSL 4F57L 3BP7B 5DJXB 3O2VH 4Y1AB 5E5RB 4H25A 5C07B 2A77L 2F58H 4XVUD 5FYKD 3VFGH 4NP4H 3PV6A 4RDQF 5IWLA 3K1KC 1ZA6B 4MXQC 3MRDA 5K9QI 3C08L 3EW3B 1ZVSA 2IPTL 5JZ7C 4ELMB 4APQD 2GUOB 1SEQH 4Q2ZA 4Z77B 4FG6D 2MNUA 4UV7H 4Y19E 1TTGA 4JCLA 3QDGB 5ICYB 1PZ5A 2EDXA 2Z31D 4BFIA 4DN3L 2HFGL 5T1DL 4UT9H 3QJFB 3TA3B 3I6GA 2EKSB 4Y4HD 3S3PA 3MBEC 3GBMH 4KI5E 2R69L 1MCKA 4LMQE 3TM6A 2XN9E 3V8CA 3MGTB 4Z7WB 5CP7A 3NFNA 4MVBC 1NBQA 1KNOB 1Z6JT 3VG0H 3NPSB 1L9MA 2G5BB 3QNZB 2Y06H 4PRPB 4U2ZA 3VGGA 4HQQL 1HIMH 3TA3C 4QF1B 1CL7H 1SYVA 5K59F 15C8L 3EBAA 4JFHD 2HTLD 3SKJL 1TFHA 2QEJA 2VLRE 4JFXB 1G0DA 1TZGL 5EBGA 5CSBA 2EIZA 1UB6A 2P8LA 2AW2A 4HF5H 1OB1A 1V3LA 1UQSB 3S5LB 1VHPA 4RMSA 3O6MH 1E28B 4EVNB 3E8UH 4GKZA 4AH2B 4J3OC 1EIBA 2FD6H 5FYKE 1H3UA 3KXFA 1PVHA 4TVPL 4YX2L 2H3NA 4MA3A 3CFCH 3QIBA 1CG9A 2JKXA 4H88L 4P3DB 4POZD 3O2DA 3HNSL 5DMIL 4EEEA 3GMPB 1WITA 5DHYB 4XP1H 3RZWA 1KYOJ 5HHOB 1AC0A 1JNLH 1QSVA 2AI0L 2R0WH 1A2YB 2HT4D 4PLNC 3V5HA 5J13B 4MLIA 5C0RL 5F7FA 4Z18A 1ZKAA 2RGSA 3ALWA 3D5OF 4Q9BA 4M7KH 5TE4L 1CFBA 3LMJL 1JV5A 4MJ5B 1FN4B 4BQCA 4GG6F 1H8SA 3V8OA 3LN5B 3VFVB 4P2YA 1RHHB 2VITB 2QSCH 5SWZD 3VXUA 3HC3L 4UBDD 4HIJB 4Y19B 3D25A 1S7RB 4JJHA 4NQTA 1C5BH 5C0AA 4XP6H 5DEFA 4MA1B 5IVXE 1DN0A 1W0VB 3OR7B 4QHUA 2A6KB 1JPSH 1G7MB 2X7LB 5JXAL 4N68A 5EBWA 4LQ1A 1W0YT 4QOKA 3NTCH 2A9NL 3ARWA 5KSUB 1Q9OA 4JFHE 2B4CH 4HKJB 2XN9B 2QSTA 3EOTH 2DWEA 5CBAB 2FATL 4D8PB 5DJXA 3WYRA 2FH8A 4Y1AA 5BV7H 4PY8J 5C07A 1NAMA 5JR1H 2VLJD 4MA1C 3ULUL 1T1XB 3MBEA 4MD0B 4QXTB 2OSLB 2H6PB 1ZA6A 2KUTA 5F89B 1JHLL 4ELMA 2GUOA 4Z77A 1I85C 3RVXC 1IZKA 2K7QA 2Y5TB 3O0RL 4KI5C 4MSWB 2VLRB 5ICYA 4V1DB 3QDGA 3TBYB 1I8MB 1KG0B 1T1WB 2WK2A 1CICD 1K85A 5CD3B 1KN4H 3QJFA 3TA3A 1BPVA 2EKSA 1DEEB 1OL0A 3MOAL 1YY9C 3NGBB 2EYRB 4X4XA 2H32H 3M45A 4GSDL 1MLCB 3MGTA 4Z7WA 1KNOA 1IGIH 2G5BA 4APQB 1NKRA 5JUEL 5SWZE 3QNZA 4TRPL 3HNVH 1NANI 1K6QH 3OL2A 4PRPA 5MEPB 4PY7B 1OAYH 2Z31B 4TVPD 3OBAA 2CD0A 2FBJL 2OJZL 2NYYD 2ZKHL 3I2CH 3BH8B 4LPVA 5IG7B 3NGBC 5EBMB 5E8NB 4XVUC 4HS8L 1FSKB 2PW1B 4Y4HB 5TPWH 4JFQA 4OZ4B 4U6TA 3MRCB 3LRHA 1MCWM 3QG7H 4LPWA 4KZDL 5MEND 3M8OH 1ES0B 1Q94B 1UQSA 4X4ZA 3ZDXE 1ZV5A 3S5LA 4HWNA 4APQC 4H1LB 4P9ML 1QG3A 4WGVB 1E28A 4EVNA 3UZQA 5IVXB 2VLJE 2Z31C 4GXUN 4HMDA 4I77H 4QRRD 5HVWA 5HVFB 4P2OB 5EPMA 5IEHA 1VEMA 4P3DA 4I0PA 1FSKC 3CFBA 2FLRT 2DQUH 4Y4HC 1FC2D 3GM0A 4HUWB 3GMPA 4XVJH 1A3QA 5I8KH 1EA9C 2FIKB 3RKDC 1MCJA 5HHOA 1A2YA 1RU9H 1UACH 1JHKL 3ALPA 3JWDC 5TDNB 1T0MB 3VMPA 4QKXB 3O3UN 2EC8A 4Y2DD 1NBVL 4UIKH 3U0PB 5IFHL 5ILTH 4P2OC 4M3JA 1FN4A 1CXEA 3LN5A 3VFVA 1RHHA 4ZUSB 2VITA 3K2MC 1B4JL 4LK4A 2VZUA 4HIJA 4Y19A 1S7RA 2HTLC 3EOAB 2HRLA 1W0VA 1HKLH 3OR7A 3O4LD 5CGMA 3IFOB 2XACC 2A6KA 1G7MA 3VCLB 1PKQB 3UTTB 4ONHB 4TVPE 1HILB 1WAAA 3EYVB 1I85A 5KSUA 4JO3H 2Y36H 1UM6H 4I3RL 4HKJA 4NNXB 1EH9A 3MV11 2XN9A 5CBAA 4D8PA 4EQ3A 5F7NC 1J0HA 4PG9A 5MENE 2JCCB 4YHKH 5SWZB 1NEZA 1T1XA 3MYZA 4MD0A 4POZC 4QXTA 2OSLA 3FQNA 3TN0D 2H6PA 3K8KA 4RMUA 5JXED 2YK1L 4TYUA 2GJ6D 3SO3B 4LCCB 5F89A 4QRRE 1BQUA 2Y5TA 3KPNB 2HT4C 5JOPD 1H8OA 2VLRA 2DIBA 4V1DA 3TBYA 4XP9H 4HK0A 4HEPG 5I9QB 1I8MA 1KG0A 3K8LA 4I1NB 3TV3H 5CD3A 4OQ1A 1Q0YH 1EO8L 5I1GL 4JZNB 2X4SB 1DEEA 2BVYA 4UB0L 4UBDC 3GSRB 4JO4L 1MFCL 2EYRA 1NEZG 2E27L 1GSMA 2VLJB 1NANH 3SO3C 1MLCA 5FUZH 2YD5A 3CSYB 4FXGA 2ARWA 1NUGA 3ARDD 1MI5D 3F8UB 3I85A 5J06A 4APQA 3PDDA 4BUGA 3ZDXF 1OTUD 5I9QC 5MEPA 4PY7A 3ULUE 2Z31A 3O4LE 1XF2B 5INDA 3MRJB 4ODXB 5HHPB 2H8PB 1CICB 2D31B 4XNYH 5IG7A 5EBMA 5E8NA 2J12B 1Q0XL 2PW1A 4Y4HA 4OFYD 5CWSB 4OZ4A 1YEHL 3MRCA 1YQVH 5CCKL 3DVIA 1Q94A 3LKRB 4MZ2A 2DLGA 1ORQB 4PJEF 4H1LA 1L7IL 2B0SH 5IVXA 4LOUC 2OYPA 1Z0NA 3ES6B 4P2OA 1RMFL 1CICC 3IU3B 3L3OA 2GJ6E 1SYSB 2QSQA 4R97B 5JOPE 3MODH 4HUWA 3GB7B 1CXFA 2FIKA 4RFEB 1MQ8A 4HZLB 5AZEH 1U8MB 4DKEL 1WFNA 4S2SB 5TDNA 5MENB 2AXHA 4PS4H 2J6EL 1T0MA 3U0PA 5EUOE 3CGTA 1UWEH 5L2JB 1RUML 4NRXB 2W91A 4QRRB 4ZUSA 4R97C 3V4PH 2XICA 4ZUUB 4KRNA 2NYYC 1MI5E 2L0DA 4PBXA 1W0WB 3EOAA 3PE9A 1ZOXA 4QXGL 3UC0H 3ZKMD 1KB5L 3WNMA 1FHGA 2EEAA 4AL8H 2X4RB 1UEMA 3VCLA 5JW5A 3MNWB 1PKQA 3UTTA 4ONHA 1ZT1B 2CK0L 1HILA 1KCUL 1UYWL 3IETA 4P46D 3R4DA 1YEFL 4X6DF 1KB9J 2GJZB 3N85L 4NNXA 5BCAA 4Y2DB 3EYOA 1MIMH 1OSZB 4I0KA 1NMAL 4O58L 3HZVB 4LSSL 5DJAB 1XAUA 5TE6L 2JCCA 3S37L 5SWZA 3IAPA 1PAMA 5FV2A 3HAEG 4R9HA 3ZYOA 1G6RL 3AXLB 1KENH 2DBLL 5LWYL 4KRPD 3O4LB 2GITB 3L7EB 5CSGA 1ZLSL 4D0BA 4KGJA 2BY2A 4GAJH 4MX7B 3X3GL 3BN9D 1TQCB 3H3KA 1NUDA 2FX7H 1GOHA 3VWJD 3CZJA 2MKWA 3TF7C 3R06B 4JZNA 3BPCB 5HYQB 2X4SA 3O2WL 3ULUF 3GSRA 3BWUC 5HGAB 2VLJA 1H3GA 1F3DH 4Y5VB 3TN0B 3EO9H 3CSYA 2W07A 4PRDA 1J8HD 3LPWA 1BOYA 2GJ6B 1TQCC 3K74B 4V2CB 2D0GA 4WW2B 1OQXA 1N5YH 3ZT6A 1WVZA 1JPTH 3MRBB 3NAAH 3MRJA 4ODXA 5HHPA 2H8PA 3CMOH 2GSIB 5EOCH 2D31A 2JELH 1IEBB 5AYUH 1E6OH 4Y5VC 3ALXA 3DBXB 5JXEC 4KXZH 3TO4D 1NAKH 3FMGL 4DW2H 3LKRA 1D5ZB 3IFPB 3MGOB 1ORQA 3BSZL 4WW2C 5IJVB 4U1HB 2WNGA 3ARDB 5HDQH 2CUIA 1GC1H 4S1QL 2ZPKL 4YHLL 5HY9B 5IVZB 1JGDB 4XCFH 3ES6A 5E0QA 5EUOF 2AEQL 3IU3A 4JG1L 1A6WL 1JCKA 1SYSA 2R23B 3GSVB 5ANME 3HI5H 4HXBH 3GB7A 2YZ1A 3LQZB 5FF6B 1QR1B 3GKWH 2NTFB 3GI9L 4HZLA 4ZTOL 1U8MA 4S2SA 3AS0A 1ZHKB 3RWFB 3ARDC 4MD4B 3VXRD 1YEIH 1JPFA 1OTUC 5L2JA 3PGDB 4NRXA 4U3HA 3MOQA 4QRRA 3MXWH 4C4KO 1AH1A 2NTSP 4HJJH 1I1CA 2D2OA 4ZUUA 1BEYH 3W5NA 2EE9A 3V0AC 1W0WA 1J0ZA 1KCRL 3RI5K 5ECJE 5CAYB 3PL6D 4JVWA 4WJ5B 2X4RA 3BVNB 3MNWA 3KLAB 1ZT1A 4CVWA 5CFHA 5FHBL 5KANI 4ORZC 2GJZA 1JNNL 3WSQH 2AK4E 1P4IL 1OSZA 4LLUB 7FABH 5C9JB 1ULVA 3VMOA 3P0YL 4L8DB 2CKBH 3HZVA 2GAZB 5I75B 1QFWI 2PTTB 2HVKB 1AE6L 4YQXL 1FGVL 3AXLA 2R1YB 3MLZH 2GITA 3L7EA 3O4LA 4KV5E 5DJZB 2BNQD 2HFEB 4OGAD 4MX7A 2AJYL 5F7EH 4P46B 4K3HA 5CKAA 4Q6YA 5A43C 3CDGB 5L2KD 3VRJB 5DURD 4FQJH 3R06A 2BFVH 3BPCA 5HYQA 1FRGL 5I75C 2Q76B 2UZYB 1FFPB 4FMKA 2IGFH 5HGAA 4LU5H 3VXRE 2VQUA 4Y5VA 4L3CB 1OGTB 3MA7B 5L9DL 5IHBA 3FOMA 1FLTX 5JXEA 5FA4A 32C2B 1QLFB 4KRPB 1BJMA 1Z3GH 3STLB 4FZEH 4WEMB 1MNUL 4P46C 4WW2A 5ANMB 5FUCE 1DQTA 2HFFB 2D7PA 5F9WB 4XP5L 3MRBA 3VWJB 5T33L 4PLKD 4YHNA 3CSPA 3OAUH 5JHLH 4YHMH 1U93B 3DV4B 3T2PA 2GSIA 4PD4K 2MPAL 2Y07H 5DT1L 1GZPB 1IEBA 3OPZL 2X70A 1JGEB 1CXKA 3X12B 4JY5H 4K3DH 1YECL 1IGCL 1YUHB 5T5NG 1CTOA 5IMKB 4KHXL 4KRPC 1D5ZA 3IFPA 3MGOA 3V95A 1W8NA 1MCHA 3K0WA 5IJVA 1J8HB 4U1HA 3ARDA 3REWB 5F9WC 3VWJC 5IVZA 1JGDA 5M7QA 5BVJB 1KIRB 4PB9L 2MQ0A 3ZDYF 3SKUD 4CMHB 2R23A 4JO2L 1J1XL 1JPGB 3PWJB 1UM5H 5TE7H 3GSVA 2BNQE 2VB5A 3MFGB 4YIQB 3LQZA 3FHQA 4P48A 5D8JH 1I3GH 4F8QA 1QR1A 2NTFA 3BDXA 5L2KE 4K23L 3RL1B 5GGQH 2VDRH 1CXLA 1ZHKA 4HK3N 4Q7DA 5E2UL 1DVFB 3QIWD 5GISH 3RWFA 3TO4B 3VXPB 3FO2B 1E4KC 2RQ8A 2NY5L 4G7YH 2VDLH 1BZ7B 3L1OH 4PRID 1BGXL 3PGDA 3QUMH 1B9ZA 4CMHC 1A3RH 5CD5D 1IC4L 3GRWL 4M62H 1MCFA 5HD8D 3TBVB 2CUMA 4LARH 3WUWB 4LSUH 3SDXA 5DTFA 4OI7A 4AIZB 2DLIA 4BZ2L 3WFZA 3OHXB 1F5WA 4WJ5A 3BVNA 3TNNB 1KB5B 3KLAA 3TO4C 1DVFC 3AGVA 3QO1B 4JRYD 1INDL 4JLRB 5D70H 1QFWH 1Z9SA 2W9DL 3QFJB 5ALCH 3VXRB 4U6VL 3KR3H 1SVCP 2O5ZL 1CFTB 1HHIB 5EU4B 3VW3L 3P30H 2HKHH 4L8DA 4HGWB 2GAZA 1HHJB 3WLWD 1MHEB 5E6YA 3I50H 2HVKA 1E4WH 3KPPB 4TTDD 4WFHD 3G08A 3WE6B 2R1YA 3PHQB 5DJZA 1IGFL 3PL6B 5JW3H 1KGCD 2AJXL 3FQXB 2HFEA 4LHUD 1FP5A 3U6RB 1JZ3A 4K2UH 3RZCC 4P46A 3WUZA 1I1RA 1X4YA 1QVOB 1H8NA 4FTVD 2F8XC 5KTEL 5DF0A 1EAJA 3CDGA 3KPRD 3VRJA 1K4DB 4JY4B 2MCPL 4AEHL 4IOFD 1YNTA 2EO1A 3MRRB 1C5CH 2Q76A 1FFPA 1U6AL 5KN5B 3ISWA 5J7CC 4L3CA 1OGTA 3PL6C 4URTB 3DMMD 4PRIE 3FRPG 4PIRF 3HC4H 1QLFA 3L95B 2IF7A 2UZIL 5DJ6B 1X5IA 2BNQB 5ANMA 2ZOLB 4YUEH 3ARED 1TJIL 1VENA 4PJHE 3VWJA 4HW6A 5L2KB 4GXVL 1U93A 3DV4A 5DURB 4XMPL 1R5VB 3S36H 4YXLL 4RISH 1W72B 1GZPA 1EHAA 5F3HA 3T09A 5K33A 1JGEA 1HI6A 4KDVA 3NIDE 4K9EC 3FB5B 3X12A 1PZUB 4H8WL 1YUHA 5B22A 4FQ2L 5IMKA 5FA3B 1J8HA 1HNFA 3QQ3A 1Y6NR 5CEZH 3REWA 4N8PA 4UILL 1E4KA 4YGVB 4BSVB 2F53D 4K3JH 3GMOB 1LO5B 1RUQH 2WIIB 5GS0H 5BVJA 1KIRA 5A40E 1KELL 5L8KB 1FH5H 3Q6GL 4WFHE 1JPGA 3PWJA 2PXYB 2YA0A 1KGCE 2QJDA 5EA0H 1MREH 4YIQA 3S3JA 1E6JL 1DP0A 1XCTA 4FTVE 1KCSL 3ECBB 1JGLL 3EYSH 4TOYL 3KPRE 3RL1A 3CDYA 3GJFK 3TO4A 1DVFA 1DL7L 3OKYA 1A5FL 4Z76B 2P49B 3WIFB 2JJUA 4JKMA 1BZ7A 5BVPH 2J6EA 1U2HA 1MCPH 1CDGA 2HH0L 1RZKL 1T66D 4PLKC 3WS6C 1BAFL 4MXVE 1UB5A 4YHIB 3TBVA 2PXYC 5I1HL 1NCAH 4S1SL 3WUWA 2C3XA 1NCDL 3B2UD 3BYYA 2OTUA 3SDYL 4LASL 1NCCL 2YMXL 3ARGB 5F7YC 2P8PB 4ODTL 3TNNA 5I1EH 1KB5A 1MFEH 3MUJA 4Z0XB 3IFNL 3QO1A 2XZZA 3QFJA 3RZCA 4LPXA 3VXRA 3F7YB 5DVOA 3H42L 4M5YL 5F7UA 1L7TL 2VDQL 5CBEA 1R0AH 1JL8A 1CFTA 1HHIA 5EU4A 4PRIB 4MAYB 4K94L 5ADOL 3T0ED 4FFYL 4HGWA 1HHJA 1MELA 5HJ3B 1HHHB 2KH2B 1MHEA 1KXTB 1PKOA 3ARGC 3N0PB 1P6FA 4NZTL 3KPPA 1CGYA 4PJHB 1VEPA 2J88L 3WE6A 2F53E 3PHQA 3PL6A 4OKVB 4QWWD 4U7MA 4OCWL 3FQXA 3U6RA 4XXCC 5JMOC 4OIAA 1AQDB 4JRYB 1K4CB 2BC4B 2WINB 1QVOA 4OF3A 1K4DA 4JY4A 4MAYC 4NO3B 4XC1H 3VFNB 4NPYB 3MRRA 5CD5C 5HD8C 3Q5TA 3ILQD 1X5XA 2W60B 5KN5A 1Z5LB 4YLQT 4Z8FL 2BDNL 1P1ZB 4XVTH 3FN0L 4F58L 3NIDF 2ZCKH 2QQLL 3L95A 2IMMA 4OB5L 1U95B 2DDQL 5DJ6A 4LEOB 2ID5A 4XNUL 2ZOLA 4LHUB 2BSSB 1UJTA 1IRAY 1KCVL 4FP8H 1VDGA 1WCBB 4FTVB 3QUXD 3KPRB 5IV2B 5EIQA 2P7TB 5ERWB 2DQGH 2VAJA 1R5VA 4MCZB 1W72A 3WMSA 3WLWC 3ZE0F 1OCWL 2BJML 3FB5A 1QRKA 5EZIL 2VZOA 1Q1JH 4TTDC 3EJJX 4HWEH 5FA3A 3DMMB 3E2HB 4QXUH 1NCBH 3T0EE 3DUUA 2BP3A 4YGVA 5MP6L 5C2BL 3GMOA 1HINH 2WIIA 3ULSB 3AREB 2CDGB 1NLBL 3SN6N 1J1PL 4IOFC 3WS6A 5FGRA 2R0KH 2PXYA 3MR9B 4LMQI 4YHZH 3UZVB 3H2WA 5ESVB 4I18B 1L6XA 1VCAA 5J57B 1A14H 3OB0H 1NDGB 4OF7A 3NCMA 1OF2B 3BZDA 3O6LL 3BDYH 3DMMC 3VFPA 5ALBL 3QPXH 4YDKL 1F90L 1HXMB 2DLFH 2R8SH 3L5JA 4Z76A 4GW1A 3FT4B 3W2DH 3WIFA 4CN1A 4R90L 2NY1D 3O3EB 4M6NL 4FABH 2ZNWA 1JF6A 2F53B 4XWOC 5EN2B 3MLXH 4Y4KC 4YHIA 2EO9A 2J4WL 2XQBL 5BMFL 4IJ3B 3THMH 2I9TB 1ITCA 4XNQA 1IC1A 4I18C 1DCLA 3DOSA 1A7NH 4HCRL 3ARGA 2P8PA 4ZFGL 4OD2B 3O4OC 5IB3B 1SY6H 3DVNB 5HYFA 3GO1L 4Z0XA 4X6FB 3F62A 4XXCA 1CD9B 4HIHB 2B2XL 4P4KD 3F7YA 2BZDA 2VXQH 1MJJB 4HJGB 3BT2H 4PRIA 4MAYA 2J5LB 3K4DA 1TVBB 1F13A 2ZG1A 2XFXB 5F7LB 4IJ3C 3JV6B 3S36X 5HJ3A 1HHHA 2OMBA 5ADOH 3DX8A 5EOTB 3KLSA 4PJHA 3GMQB 5AD0A 3MUY1 1WC7B 4OKVA 2DJ4A 1RJLB 5I74B 3BDBA 3L5XH 1S5IH 5E8EB 4PP2B 1AQDA 4JRYA 1K4CA 4P5KB 2BC4A 3ZE1E 2WINA 4X7CC 5J3HD 4XCCH 2YD3A 5ITBL 5GRYA 3PG2A 2IBBA 3BKYL 4NO3A 3VFNA 4NPYA 1EEQA 5FM5O 1T66C 3RWEB 1AIFB 2ILLA 5IMMB 3T0EB 2W60A 1AR1C 1Z5LA 3B2UC 1P1ZA 4XVSL 4DKFH 5I74C 2L7JA 1SHMA 1PLGH 4KTEL 1F00I 1U95A 3RIAF 3GSXA 5EH1A 3LB6D 4LEOA 5L6YH 4LHUA 2ZWLT 1G9ML 2BSSA 4XTRD 4BM7A 1WCBA 4FTVA 5IV2A 2P44B 5CLTA 2P7TA 5ERWA 2ZUXA 4XC3H 3K4AA 1JIBA 1RZIB 5E03A 1DN2A 3S34H 1S7UB 2F19H 3HN3A 1G9NL 1YMMD 1OAZH 1GXEA 4IRZH 4PTUB 5EZJB 4GO6B 2EECA 1OAKL 3B43A 4LLAA 3DMMA 2EXWD 4QWWC 5SWSD 4X9FA 3QNYB 2CXKA 4HDIB 1CU4H 4LSPL 4KPHL 2M8XA 3WKML 2N7BA 3DPBA 3ULSA 3MO1B 1HQRA 4IS6B 4PJDB 1X5JA 2E6PA 3AMLA 3H9SD 3ULVD 4Y4KA 5KVDL 3RPKA 1MIEH 2RCSH 1VGKB 5ESVA 4G80B 4I18A 3RUGE 3DX7B 1NDGA 1OF2A 4XBPB 3PGFL 3FHAA 1HNGA 1CFVH 1Q9WB 4UQ2B 4P23D 1PFCA 1CDUA 4K8RH 1HXMA 3FB8A 1TNMA 3FT4A 4QHMB 3HE7A 5J1SC 2O5YH 2F53A 2Z92B 1XIWD 1X5LA 5JDJA 1DQJB 4HPOH 5EN2A 1F4WL 1FNLA 2OP4H 2I9TA 1MF2L 1NGQH 1V7MH 2W9EL 4JQIH 2OBGA 4OD2A 1HXYB 3HRZA 5IB3A 3DVNA 3FTGB 1ZT7B 1IAIM 1P84J 2ZUVA 4X6FA 4MQ7A 2V2XB 3VE0A 4DOHE 4HIHA 5D7IA 3U0WL 2VH5L 1U3HD 3RP1A 1OQOA 2NY1B 3ZE1F 2FX9L 2MJWA 4HJGA 1YMME 5DHVH 2OK0H 5ISZB 1TVBA 5LQBH 5IFAH 2XFXA 3JV6A 4I3SH 4YEEA 5D5MB 5SWSE 3QCTL 4J4PD 1BOGB 5IJKC 1HQ4B 5EOTA 1R24A 2JB6B 1WC7A 1HCVA 1RJLA 1OP5H 4Y5XB 4PUBL 3QHTC 3LQAH 3H9SE 5E8EA 1YN7B 4PP2A 3ULVE 4BELD 2NY1C 1HE7A 3MLSH 4P4KB 1L4IA 3VRLE 3KYAA 1AIFA 4K94C 1F2XK 3PJSB 1GZQB 1M7DB 1QYGH 4XBEH 1R5WB 4YFDB 2WBKA 5CJXC 4KVNL 1F6LL 4LSVH 4UINH 3MJGX 5DR5H 3QQ9D 4UT7H 5FGCE 2UVFA 5J11B 4YDVB 1CXHA 5GHWH 5DFWH 3LIZH 2YXFA 4P4KC 3RUGB 3TWCL 1N6QL 3R1GH 4RGMB 3EDFA 4ZS6D 4NKIH 5C0BB 5BOZG 1GYAA 3GEWB 1KFAH 1V3KA 2WSKA 1IGYB 1RZIA 2W0FB 5CJ5A 1S7UA 3UYRL 5L8JB 4OI8A 4PTUA 5EZJA 4GUPB 3MBXH 3QNYA 4HDIA 5J11C 1DTUA 1YC7A 4FQCH 4O5LH 1HDMA 3U30B 3EHBD 3LS5L 3MO1A 1JZ5A 4IS6A 2V9RA 1N64L 3MCKB 4JRXD 4PJDA 4QXWA 4RGMC 1GH7A 2EH7H 4OCSH 5F96H 2O5XH 3IKKA 4DOHB 4HMCA 1VGKA 5L7XL 2DQIH 4G80A 1GGIH 4OBRA 4MA8L 1ONQB 3DX7A 3M1BB 4XBPA 1YMMB 4UNVA 3MOBL 1MUJB 3RJQB 1MEXH 1Q9WA 4UQ2A 4NFBA 4F9PC 1RULH 3UJJH 4E9LA 2JB5H 3U30C 4QHMA 3MCLL 4HIEA 2DQTL 1GGCL 3JWOH 1MCNA 5I16B 4GW5B 2Z92A 4IRSD 1DQJA 3PHOB 4LLWB 5E8PB 2AQ1A 4W4OC 3RBGA 3RGVA 4QRTB 3BE1H 3DRTB 2B8OT 4G3YL 4OFDA 1A02N 1EVTC 3GK8L 3GSOB 1BFTA 1HXYA 4HV8B 3FTGA 5E1AA 5C3LD 2V2XA 2EXWC 1KEMH 1OM3L 4P23B 4MAUH 5ID0B 1ADQH 5IR1B 4Q97A 4NM4H 2C1OB 1CTNA 4KTDL 5ISZA 5I30H 5FIEA 3WFEH 3BISA 1XIWB 2J8OA 2MCG1 4RGOL 3ULVC 2YC1B 5FGCB 3BGAA 3FN9A 4G6ML 3VRLF 5D5MA 5DGQA 1BOGA 1JNHB 1HQ4A 1M4KA 5DD1L 5F71A 2JB6A 1T3FB 1MCRA 1XT5A 1A4KB 1D6VL 3FB7B 5CJXA 4JRXE 4P23C 2VL4A 1YN7A 5TFSH 1LO4L 2QQKH 4P4KA 3BH9B 1FLRH 1U3HB 3IDJA 1XIWC 5DXWA 4R96B 5TGBB 1OP9A 1GHFH 3PJSA 1IILE 4KKLD 1GZQA 4MA7H 4H88H 1F4YH 1M7DA 1FZKB 1R5WA 3QNXB 4W81A 3NACL 4R4FL 1BX2B 1KIPB 3INUL 3P4NB 4GFTB 4X5LA 5FYLL 4AMKH 1UT9A 2A0LD 3L3GB 5GGVL 3JUZA 1PBYA 4LSRH 4YDVA 3L5WB 2WP3T 1FYHB 3RUGA 4N0CD 1U3HC 4M9PA 1KF9B 5M95B 5C0BA 1JTPA 5FM4A 1RIVL 1IGYA 4HWBL 4OFIA 4OJFL 4Z7QF 3OKNB 4J4PC 3SDCB 3WFBL 4U1KB 1KN2L 1YQ2A 4HXAH 3WIHH 4GUPA 3SE9L 3IAGC 1FYTD 2R39A 1H3PL 2YRLA 5LVEA 4F9PA 1HEZB 4LPYA 5HYIA 1N7ML 1MHCB 3D3VA 2DQDH 4XNZB 5A16A 1IAIL 1IQDB 3VXOB 2AQ3A 3MCKA 4AYFA 2ZUUA 4FQHB 2X10A 2FATH 3O6KH 3H7BA 4W4OA 1G7QB 3SDCC 3ULUH 4LDOB 1ONQA 4WI3A 1FIEA 4N8VB 3M1BA 3UO1L 1YMMA 1G9NC 3SE8H 4TQEL 1MUJA 4JZOA 1IAKB 4NYLB 5DA4A 2VDOL 3OGCA 4LIQH 3QQ9C 2X05A 4XNZC 4B7LA 3I3BA 5I16A 4GW5A 1MY7A 3PHOA 4XCYA 4LLWA 5E8PA 4JRXB 4P9HH 4ZS6C 2MQCA 3OZ9H 1ZLVH 3DRTA 4POUB 4L8BA 2VISB 3GSNL 3MOAH 3UJIH 3N1FC 1G0XA 3TO2B 3GSOA 5DQDH 4DFIA 4OM0L 1CBVL 3MNVB 3D48R 2NY6C 4HV8A 1ZWIB 3VFMB 3I75B 5LKNA 1A7BA 2RB8A 3ZTNH 3O2VL 4XPBH 5ID0A 5IR1A 1Q38A 3EHBC 2F58L 2C1OA 3VFGL 5D96B 4LAQL 4NP4L 2DQJH 4UUJB 5I1LB 1XIWA 5I6XB 3C5SB 4IRSB 5FUOH 4MMZC 1QA9B 2YC1A 4CU6A 1FYTE 2OJZH 2ZKHH 1T1YB 3E0GA 4G8GB 4W4NA 4HBCH 1JNHA 1SEQL 2DYPD 1N4XH 4M1DH 4UV7L 1T3FA 5DJ0B 1A4KA 3FB7A 5TJWK 5HI4D 2MOVA 5FYLD 2WM0A 4HAGA 2DQCL 2NMSA 5D96C 3OSKA 2E3VA 3BH9A 3GBML 1U3HA 5I6XC 4IRSC 4R96A 5FHAH 5TGBA 4AEIH 1S7SB 1F8TL 1X9QA 1P7QD 4B41A 3HPJB 4ZO9A 1FZKA 3QNXA 1OPGH 3GMMB 3VG0L 2VE6B 1BX2A 1EEZB 3WXWH 4J4PA 3P4NA 4ESKA 4NO5B 3U9PL 2Y06L 1AFVL 3KS0J 4JN2B 3L3GA 3F6LA 1HIML 1JHKH 4OZHF 1CL7L 3L5WA 3BAEH 5HBBA 4U3XA 1RFDL 2FRGP 1FFNB 2ERJC 1D5MB 1C08B 2OL3B 4HZAA 1FBIL 1LVEA 4HF5L 1HZHH 1QHOA 3OKNA 4M4PA 3SDCA 3IF1B 3O6ML 4U1KA 2J8HA 3E8UL 2WWKO 2FD6L 4NN7B 4XCEA 1HEZA 2XKNB 2CIIB 1MHCA 3CFCL 3GI8H 4LLYB 1F58H 1KYOK 1ZHNB 1IQDA 3LKQA 2KBGA 3DUHA 4JRWA 4XP1L 3B9AA 5FYLE 4OZGE 4XXDA 5DC9B 4BSWB 1JNLL 2R0WL 1G7QA 2COQA 4D94A 2CDEB 4N8VA 3LEVL 4R26H 4NN7C 5T5NF 2DKSA 4M7KL 4NYLA 1FYTB 1NC4D 1S9WB 2A0LC 5EFIB 5IHUH 1EEUA 1ZLVK 3HRPA 5GRVK 2UYLA 4GMSH 2N1KA 1C5BL 4XP6L 4JRXA 3C09B 5F6HI 2GI7A 3CU7A 4D9LH 5C2UB 1JPSL 2VISA 1QBBA 3TO2A 1FIGL 3WIIL 3NTCL 4DTGH 3DLQR 3F12B 3MNVA 43CAB 3VFMA 4LKXB 5DUMH 3I75A 5AAMA 5I8OH 3CZFB 2X1PA 5BV7L 2VUYA 1NFDF 4RAHA 2HT3C 4S1DD 4UUJA 5I1LA 3OKOB 3C09C 4I13B 4MJID 4IRSA 4M43H 2J8UB 3GDBA 2VXSL 1DBAH 1WWWX 1MCIA 1T1YA 4G8GA 3ELAT 4Z7NF 1EMTH 2NY4D 4P5TD 1YEHH 1KJVB 3WV0A 4X6CE 4LCWE 1AR2A 1NUFA 2QKIA 5K9JL 3UBXB 2FO1A 3G5XB 3DETD 1V05A 4JFFD 4MHHI 3E6HB 1S7SA 4KFZC 3HPJA 2F54D 1HH6A 2D9CA 3GMMA 1IGIL 2VE6A 4QYOB 2DYPB 2ZSWB 3SDXF 3HNVL 5FOJA 4TNWK 1K6QL 4JN2A 1V3MA 2XY1A 1U0QA 1JMZA 1OAYL 4OZGB 4TULH 3M07A 2IAMD 4BH8A 3EDJA 3I2CL 1FFNA 4NQDD 3RHWK 3LHPH 4E41D 1D5MA 5C1MB 1C08A 4UTBH 2Q6WB 2OL3A 3QG7L 1I9JH 3V5DB 3HZKB 3HI6H 5ENWB 1P7QB 3MRMB 4OLUL 4NQSB 3IF1A 3T8XB 2H1PH 2YUXA 1G84A 4I77L 1FNEA 5KSBE 2XKNA 2OQJB 1GAFH 2CIIA 3DJ9A 5D1ZD 4O4YH 5CKGA 3A6CH 3L3IB 4L5FH 1AGEB 4LLYA 1QSFE 1ZHNA 3N85H 2DLTA 1CDYA 2DQUL 4X6BB 3LKSB 1PD6A 4XVJL 1OLZA 5I8KL 4QHKJ 1YNLH 4LSSH 4BSWA 4S1RH 3C9NB 1RU9L 1UACL 2FEDD 3JBG7 4TUJA 2CDEA 3VFRB 4FS0A 4QT5B 1SJXA 4UIKL 5ILTL 1S9WA 3S6CA 1NCWH 5EFIA 3G9VA 4G7VL 1ZVYA 2F54E 4LSTH 4HGKC 1KXVC 3MRLB 4RAVB 1YEKH 1HKLL 4R2GC 3ZZ1A 4G9DB 3HZYB 1GIGH 3F12A 4JO3L 3GSNB 1SM3H 2Y36L 43CAA 1UM6L 3DARA 4LKXA 4NQDE 4RQQB 1P5VA 4LGRB 4GKNB 4E41E 4FNLH 3CZFA 4X6CF 2B1AH 4NQCB 4YHKL 3LY6A 3QB7C 3SGJC 3TNMA 2CO7B 3OKOA 5IOPB 3SGEI 1UJ3B 4P3CH 2J8UA 1WEJL 1FAIH 2Q7YB 1KJ2H 4CL7A 1DQLH 1UCBH 3DGCR 1KJVA 4N5UA 1CN4A 4U1LB 4UOW1 4XP9L 1J5OL 5H2BB 4YPGB 1CZ8H 2HLAB 2AXFB 4JM2F 3TV3L 5F8RC 1Q0YL 2VDML 3RPIB 1A1OB 4HC1A 2EYSB 2IMNA 3UBXA 4I0CC 3G5XA 2K9UA 4JG0H 4G9FD 1UJ3C 4TTGA 3E6HA 4WV1C 3QEGH 4JG1H 5I1JL 3G9AB 5FUZL 4PJFF 4MJIB 3FQTB 3T0BA 4M61B 4G6FB 3ORJA 4LRIC 4QYOA 2C3HA 2ZSWA 2NY4B 4P5TB 3PXHA 3QEQD 3QH3B 3GI9H 1N0LA 4ZTOH 4O2EB 4OZGA 3NFPB 5KSBF 4QHKI 4LSQH 4XNYL 5DJDA 4R7DB 5EBLB 2X4OA 2Q6WA 2P46B 1YQVL 4JFFB 4LPCA 3V5DA 3HZKA 3IDGB 5ENWA 3MFFA 3MRMA 4LCIH 5C86A 4OIIH 1S9VB 1T80A 2MHAB 4DK6A 2F54B 2VOTA 3D18B 3QA3B 3TJEH 1KCRH 4F2MB 2NY4C 4P5TC 3T8XA 4FQQB 4JPVH 4OCNC 1UM4H 2VXVH 1G9EA 4PYHA 1A6AB 4KZEL 2OQJA 3L3IA 2EDNA 1AGEA 5H8DA 3B9KD 2IAMB 1I9EA 3CVHH 4X6BA 1NGYB 3LKSA 3RVVD 3MODL 4NQDB 4HMEA 4E41B 3FO9B 1TCMA 3V4UH 3WDHA 3C9NA 1U8IB 1RZ8B 1S78D 1Z2KA 4DKDC 5B3JF 4PS4L 4QT5A 1BIIB 1FGVH 4OZFH 2VQTA 1UWEL 1J0KA 1JF1B 5JNYB 2IAMC 1XGQB 5D1ZB 5T3ZD 2QL1A 4RAVA 3UC0L 3DYMA 3SGJA 4WU7B 2D7TH 4RWYH 1HKFA 1ZS8B 1KB9K 5F93C 2CJUH 2MQ3A 1TQBB 4AL8L 3QEQE 4G9DA 4NKOB 3HZYA 3A6BH 3BJLA 3TJHC 4OF0A 1BIHA 4U1GB 4WY7L 4WFFD 4RQQA 5L9DH 4GKNA 3SGEH 3T3ME 1MIML 3KPTA 3EKCA 2AK1H 4RX4D 4NQCA 4XT1C 1MNUH 4JFDD 5D1ZC 2WZPD 1WV7T 1MPAH 4QTHB 2PW2B 4JREB 2UY7A 5BV7B 3QJHB 4PJCB 4XP5H 5IOPA 5T33H 1UJ3A 1TQBC 4WV1A 1CI5A 3LEYH 1EBAA 2Q7YA 3SKOB 3ZYJA 4WI2A 2E8YA 2FEDC 4GAJL 1RIHH 4U1GC 4LVOB 4U1LA 4LRIA 1S9KC 1JNJA 3GIZH 1YECH 5H2BA 4YPGA 4PD4J 2BOBB 5CILH 3SDAD 3WDJA 2J2ZA 2B4CC 2HLAA 2AXFA 4K3GA 4O02H 3RPIA 5F9DC 1A1OA 3R8QA 3UPCA 1QFOA 5LG1A 4CADB 2EYSA 1XF3A 4JREC 5BV7C 1TJHH 3OTTA 4QLRA 3DIFB 1A7QH 3KYMB 3DVGA 5CS7A 1QFWM 3EO9L 4MJIA 4JO2H 2NQCA 4ERSH 3FQTA 1EJ6A 1KJMB 5HTSA 4HWUA 3EDEA 4P5TA 1N5YL 2WWKT 3AVEA 1JPTL 3NAAL 4O2EA 1OTTD 4TNVK 4A6YB 3CMOL 3NFPA 4PJ8D 5EOCL 5IEKA 1HOCB 5C0EA 4R7DA 2JELL 5EBLA 4KGLA 5AYUL 1E6OL 3W0WE 4JFFA 3OJMB 4G9FB 2Q1EA 4WFFE 3IDGA 3BQUD 1NAKL 4U7SA 4XHJD 1S9VA 2MHAA 2F54A 3QA3A 3D18A 3QCVL 4LFHD 4FQQA 4JFDE 5HDQL 3RVTD 4HPYH 1GC1L 5I15H 4X9HA 4CJ1A 1ZGLM 4LNRB 3PIQB 1I3VA 2AJVL 4XCFL 2HFTA 1RPQA 1EHLL 3QEQB 4R7NB 5DVLA 4EIGB 3O2DH 1INDH 2CUHA 2P45B 1S3KH 2IAMA 1T0NB 5DEGA 1NGYA 4HXBL 1TZIA 4NQDA 2V2TA 3PWUB 1QEWB 4TVSa 4N0YH 3VW3H 4E41A 3FO9A 3MJ7B 3GKWL 1C5DB 1U8IA 1RZ8A 5HGBB 3ARYA 3RTQD 4C54A 4C56D 4UU9A 3T3PF 1YEIL 3QWRA 5DLMH 1BIIA 1QP1A 2A73B 2YD4A 4TSAH 2A2QT 2AJXH 4B7IA 4Z0BH 3WO3B 5JNYA 3MXWL 1J9CT 1NCNA 5E70A 2VDPH 4HJJL 5T3XH 1XGQA 5D1ZA 1BEYL 5KVFH 4J3XA 3B9KB 1T2JA 1ZS8A 5JMRA 4AEHH 3HMXH 2NW3B 4NKOA 4JKWA 2LQRA 3QEUB 1IC5H 2NZ9D 3UMTA 3MRHB 1MFBH 1BJ1J 4HKZB 5D71H 1NAMH 3HG1E 5ITFB 1LEIB 7FABL 2VKWA 1MH5B 2EZ0D 2CKBL 4KKBD 3LRGA 3EFDH 2DD8H 2PW2A 3B9KC 5C7XH 3QJHA 4NUGH 4PJCA 4L9LB 1G1CA 3RVVC 2YRPA 3HUJE 2JLLA 4E5XB 2Z8VC 4PRHB 4PJXE 1A4JB 3MLZL 3SKOA 5EWIH 3RFZC 4NZDA 5K9KA 1S78C 1DBML 5HHME 5DFTA 4MD5B 4NDMB 1DBJH 2B1HH 5F7EL 2BOBA 5ADPH 4GMTH 1FO0H 1UENA 2OS7A 4FQJL 3HHRB 4L3ED 5FXCH 1DBBH 4AT6B 3VD4A 2BFVL 2V5MA 1ZLUK 4CADA 3RIFK 3T65B 3QXAB 4NT6B 3GGWB 4F7EB 4JFDB 4L9LC 4YR6B 5K9QG 3DIFA 3KYMA 4C56E 1I75A 4EUPB 4YFLF 3OKDB 3BPOB 2AQ2A 5GGTH 4K7PY 3KYOB 3F65A 1HN1A 1Z3GL 1KJMA 3QWQB 1RVFH 3ABZA 4G6AC 2KQNA 2HT2D 3GMRB 3C2AH 3VI4F 2Z8SA 3OAUL 2F5BH 3JV4B 3SDAB 3UTQB 4EDXB 1UADC 4YHML 4A6YA 2NW2B 3X13B 1HOCA 2Y07L 1OP3H 3HS0B 1KEGH 4OGXH 3K3QA 5D7IF 2HH0H 5E6ZA 3BPOC 1KPUB 1TIUA 4JY5L 4G9FA 1BAFH 5AWNH 1BQHB 3NIFE 4DVRL 1EXUB 5I1HH 4S1SH 3MXVH 2X2YA 4KK8D 4MJ6B 1MWAB 4LASH 2VLKA 3PIQA 5BQ7B 3SDAC 1ZT4B 3QEQA 3L5IA 3RKPA 2YZ8A 4NJAL 3PQYE 1U3YA 4RFNB 3ZL4H 3EJYD 4G6KH 3T0XA 1UM5L 5TE7L 1T0NA 4PJ8B 2VDQH 2ED9A 3PWUA 3MJ7A 1FFQA 4FFYH 1C5DA 4QRPD 1JWMB 3BRDA 5HGBA 1RIUH 2NR6D 2FZ3B 5DD0H 2VDRL 5GGQL 4L3EE 3BQUB 4EDWH 1SBSH 2X4UB 1X5KA 3RJDA 4G7YL 5DVMA 2A73A 4NZUL 4TUKH 2VDLL 3L1OL 2GY7B 3HUJB 5E2TH 1RJYA 3QUML 2AJSH 1QR4A 4OCWH 4DVBB 1A3RL 4IOSD 2R4RH 4ZFOB 4RFNC 1HYSD 3K46A 4OZIB 4PJ8C 3I3EA 1K5NB 5CHNB 1UWXH 1CCZA 4LARL 1XH3B 3VI3E 3B9KA 3P0VL 1YDPB 2EIEA 1KCLA 2XWJB 5CIPB 1JZ4A 2NW3A 4JKLA 1OWRM 3BQUC 3QEUA 4XHJC 3T0AA 4PJXF 3RTQB 5D70L 5JW4R 3QZWB 3MRHA 5ALCL 4C56B 4HKZA 3KR3L 1MHHB 1QQDB 1LEIA 2QQLH 3EFFB 3TH2T 5SX4I 2F15A 4N1EA 1MH5A 2VR9A 2ENYA 2HKHL 3P30L 1RUAH 2IJ0C 4Z7VE 4EIZC 1D5IL 2R2HB 1EBPA 3I50L 4L9LA 3DGGB 2CR3A 3G6AB 1E4WL 4WI5A 4E5XA 5KBNC 2YEZB 1SMAA 4PRHA 2NX5D 1A4JA 1LO2H 5LGHH 3VFOB 5JW3L 1I7TB 3T2QA 3RI5F 4GRLD 4LDEB 4ZNEA 2FHFA 3RTQC 4MD5A 2BJMH 4NDMA 3VXQA 1XGRB 3T4YB 2P43B 5KOVC 1O7VA 3MACH 1VFMA 3SHSA 4GOSA 4AT6A 1MAMH 1BFSA 4CVXB 4QRPE 1C5CL 3T65A 4RX4A 3QXAA 4NT6A 3GGWA 4F7EA 4YR6A 4J8RB 1CGUA 1OAUL 4P2QD 4EUPA 3DROB 1JN6A 1I7UB 4L9DA 1J1PH 2XA8H 3KYOA 5IGXH 4CUCA 3HC4L 1S7TB 3NCYS 3VGEA 3NIFF 4XX1G 4WI4A 2AV7B 4YUEL 4AIXA 2NZ9C 5IW6B 2YD1A 3MLRH 3GMRA 1CDHA 1RSFA 4EDXA 3SDAA 3UTQA 3JV4A 4YDKH 4ODSH 1LK3H 3V5KB 2NW2A 3X13A 3B9EA 4L3EB 4NQXB 2EZ0C 4KKBC 3S36L 3HS0A 4RISL 1RZJH 4AQ1B 4G42B 3BRFA 5IK3B 1KPUA 4H1LH 3BO8B 5DQJB 5IROC 1BQHA 1EXUA 2J4WH 2Z4QB 2GQHA 5BRZB 1KSRA 4MJ6A 1MWAA 5EU6E 3QG6A 3HA0A 12E8H 5CEZL 5B39A 4M7JH 4K3JL 1RUQL 3ZSTA 5BQ7A 5GS0L 1ZT4A 3LN4B 1NMBH 1FH5L 4JCMA 4M6OL 2NX5E 2QSVA 1T21B 3A0OA 5FGBC 4EZMA 4PJ8A 5EA0L 4HULB 4LCUA 5C0IB 4M1GH 2HRPH 3EYSL 2WV3A 2FZ3A 3GBNH 4ONGH 3BQUA 2FR4B 1ZHBB 2X4UA 2QR0B 2Y6SC 5BVPL 2A6JA 5FM8A 5B39G 2X9WA 3HAEH 3KWWB 5LGKA 2HT2C 4ZFOA 4KKCC 1DJSA 4OZIA 3Q6FB 1CR9H 3CLFH 1NCAL 1K5NA 5CHNA 2ICWB 1MFDH 1XH3A 2AXGB 5ICZB 1KUMA 1S8DB 3KPMB 4Z7VF 5CIPA 3BKYH 4ODVH 5GSVB 1WZLA 2VAAB 5I1EL 1MFEL 1G7JB 3MJ9A 4QRPB 4M03A 4KK8C 1LNUB 3RTQA 4OGYH 3OKKB 1MHHA 1QQDA 5CEXB 3IKCB 2ICCA 5E7BA 1IFHH 5KS9F 1G9MH 3ZDZF 1GOGA 5I17B 5D7JA 1FL5B 3AM8C 1EHNA 2CKBB 3DGGA 3G6AA 3D85B 4NRZB 3TC9A 2YEZA 4WVRA 3Q3GB 4DN4H 1LGVA 3VFOA 1I7TA 2V5RA 1TETH 2NR6C 2D3VA 1MJ7L 3SGKC 1XGRA 5HPMB 3T4YA 5D7KD 1WBZB 1OAKH 5DD6B 2XTJD 3RWJA 1P2CA 4HKXB 4M4RA 4CVXA 1HYSC 3SGDH 3S9DB 3WKMH 4KQ4H 3BI9X 4X9GA 1E0OB 4J8RA 3BZFB 3DROA 4X4YB 4XVTL 5D1XD 1I7UA 2NY3D 5IROA 3DRQB 2ZCKL 1S7TA 2NX5B 4MCYB 4PGJA 1FZJB 4GRLB 5L0QB 1CK0L 2AV7A 2XZQH 5CEZD 2ED7A 5IW6A 4FP8L 3VH8G 2ADFH 5GS0D 5I1IH 3W5MA 3V5KA 2DQGL 2ZUYA 3MLVH 4L3EA 2CRZA 1EX0A 4NQXA 3S4SG 4EBQH 4XPFH 3FFDB 5FGBA 1QRNE 3C5JB 2FX8H 3D39D 2BX5A 4G42A 5IK3A 4L29A 3MROB 4NWUH 3BO8A 1Q1JL 4RRPG 3C6SB 5DQJA 4P2QB 3SEPA 5BRZA 5HYJE 4XI5D 4GRLC 4QXUL 5J4MA 3VWKA 1HINL 1JK8B 2P4AB 1MCSA 2Z91B 5CUSH 3LN4A 2WIMA 4YH6A 3HR6A 1RUKH 5HDBF 3IXTB 1T21A 4V2BA 2R0KL 1PY9A 4U1NB 4Z7OF 3B5HA 4YHZL 4OF5A 1IJ9A 1OARH 1A14L 4HS3B 5D7KE 1LEGA 1WT5C 3BDYL 1VADB 3J7HA 2XTJE 4PB0L 3QPXL 2FR4A 3O8XD 3QCTH 2DLFL 2R8SL 1ZHBA 1KLFA 1JYWA 3W2DL 3QXVA 4ZO6A 5KVGH 3U79A 8CGTA 4ZOAA 5B21A 3KWWA 1T83C 1QOKA 3MLXL 1XCQB 3Q6FA 1OY3B 3THML 2AXGA 5ICZA 1A7NL 1S8DA 3KPMA 3AM8A 5E1HB 4YBLB 5GSVA 2KZ1B 2VAAA 5CEZE 2XZCH 1SY6L 1G7JA 4FFWD 4I8DA 1DQQA 3P9LB 4KTYA 1CE1H 1LNUA 5ESAB 3SGKA 3OKKA 5BS0D 1JZ6A 2VXQL 1N6VA 3D39E 3P9MB 5CEXA 1L0YA 2VXTH 3BT2L 2E9JA 3SDDD 4WEUD 3PUCA 4KK5D 2QLVB 1JJUA 3QDMD 5I17A 1FL5A 4GRMB 3RY6C 3D85A 4HEME 4NRZA 1NPUA 4OQTH 4YHOH 3Q3GA 2HA1A 1HHGA 4GQ9H 1NMCB 5EC1B 3RWGB 3F7RA 4L3AA 5J56B 4XB7A 1UH2A 1S5IL 4HK3J 3WL9B 1IGMH 5HPMA 4XCCL 1WBZA 3KPOB 5DD6A 4J1UB 3PP3K 4HD9A 3UX9B 3F7VB 1ZGLB 3BZFA 4WHTB 1N64H 4X4YA 3KHOA 2LVCA 4DKFL 1NMCC 3NA9H 3DXAE 1QACA 2NX5A 1PLGL 5CJOH 4MCYA 5L7XH 1FZJA 5L6YL 4GRLA 4MA8H 1C1EL 3RWCB 4PV9B 2D9QB 5FEBA 1GRWA 2XTJB 4ONOA 4YBQD 1EDQA 1ZLWK 3S98A 4JDZB 3O3AB 3FFDA 2QADD 5IBUG 3C5JA 2W59A 5HI5D 1UXWB 2NXYD 3S34L 1DDHB 3MROA 3TYFB 3C6SA 4ZDHB 5BS0E 4IRZL 4P2QA 3TCXA 3Q5OA 2BSTB 1WT5A 1ETZB 2NY3B 4F8TA 1FCGA 2BMKB 1CLCA 3NMEA 1CU4L 3QDME 1JK8A 1T7WA 2Z91A 3ARFD 3TCLB 2XTJC 1U8QB 1RQ5A 4BFEA 2BVUA 1T83A 1OM3H 1F02I 5GRJH 3BKMH 1MIEL 4U1NA 2FB4H 2RCSL 5JPMB 2X44D 1T7YA 3D39B 4K3EL 2V9QA 2Z0BA 1NLDL 2NY3C 3CNKA 1VADA 3MRPB 1CFVL 4IDLA 1LD9B 5IQ9B 1PSKH 4K8RL 3WDIA 5LGJB 4X7FC 1I9IH 2GK2A 3KNBB 4YZFE 2O5YL 3HZMB 5ICXB 2NZIA 5GS0C 1XCQA 4ZTPH 3REVB 4LHJB 2OP4L 4X4ME 5F9OH 1P84K 1WQVT 1R3LB 3ZHLA 4LPTA 1NGQL 2GHWB 1V7ML 3RY6A 4JQIL 1F3JB 3ZMRA 4IOIA 1EFQA 3P9LA 2AAVA 1EUUA 1YNKH 3LEXB 1L9NA 4X7DC 4MNQD 4R4FH 3O8XB 3AC0A 5SX5H 2AV1B 1XF4A 3P9MA 1F4XH 2A1WL 4S0SD 4ZUVB 3R0NA 2OK0L 3RX7A 5IFAL 5LQBL 4Z7UF 4U31A 4RMVA 4I3SL 1ZANH 4DUVA 5EO1A 4XNXH 1AKJD 1G0YR 1WLHA 1KOAA 3G5ZB 3QXUA 3RAJH 5E9DE 2M26A 5EC1A 3RWGA 1RIVH 1CL7I 4HWBH 4RNRB 3WL9A 3LQAL 3O8XC 1JHTB 3WFBH 3VD9A 3LPFA 2LU4A 3KPOA 3SE9H 3MLSL 4J1UA 5K59E 2FHBA 4XPHL 1GJIA 3F7VA 3QIUD 5F9JB 3SDDB 5JA9A 4N0UE 3S8WA 1ZGLA 1QYGL 4XBEL 4WHTA 4CN6A 5C71A 3MRQB 1R3KB 1Q72L 4H0IA 1D3CA 3EGSB 5HYSB 4LSVL 1YEEH 4FFWC 4UINL 5DR5L 4UT7L 1BBDH 1OAXH 5GHWL 1JGVL 3LIZL 3RWCA 2CQVA 4PV9A 3FONA 3LSOB 3R1GL 3SDDC 4BA8A 4NKIL 3NZHH 4KK5C 4TSBH 4U33A 2JK5A 3VGHA 2HG5B 1KFAL 2JF1A 1UXWA 3G6DL 1DDHA 3SQOH 1S5HB 4ZDHA 3TYFA 5BZWB 3L7FA 1CXIA 2BSTA 4XMKL 4K7PH 3QRGH 4P4RB 1ETZA 4U7KA 3MBXL 3MV7D 2BMKA 4J2XA 1M1SA 4FQCL 1A6ZB 4O5LL 4PGZA 2VZSA 4GG6E 3TCLA 3F5WA 3IYLW 1U8QA 1YY8B 2EH7L 2DF3A 2DWDB 1CT8B 5F96L 2O5XL 5E5MB 2FEEL 5JPMA 4OZFG 4D9QD 2DQIL 4LAQH 1GGIL 2QADB 2EIDA 3D39A 3T4AB 2NXYB 3MUGB 3PGCB 5B38G 1P4BH 4I2XE 1N2RB 1MEXL 1WTLA 3MRPA 1LD9A 5IQ9A 1RULL 3UJJL 1K3IA 4LF3B 5LGJA 2JB5L 1ACYL 1OGAE 4OCXH 1AD9B 5E5UB 1LDSA 3JWOL 3KNBA 3TBTB 1AQKH 5DRZB 1AI1H 3HZMA 3U2SB 4UMGA 5ICXA 3ARFB 2DQCH 1WIUA 4OLWH 3REVA 3S96B 4HUVB 4YBQC 3BE1L 2LFGA 4X5XB 4X83A 5DRXB 2QADC 1B90A 1BREA 2APFA 5SX5K 5HI5C 3K2UH 3ZHDA 2NXYC 2Y25A 1F3JA 1F8TH 4K55A 2JJVA 2GCYB 1I8KB 3LEXA 4UV4H 4N0UB 4GKSA 4PJGF 1KEML 3UJTL 4MAUL 3O8XA 1ADQL 2AV1A 4NKDA 2X89D 3U9PH 1CYGA 4NM4L 1AFVH 3ARFC 4U2YA 5DD5H 4ZUVA 2DS4A 5I30L 3WFEL 4KJYA 3F58L 1RFDH 1X5ZA 3MV7E 3G5ZA 2Z35B 3TH4T 3BP5B 3ZSSA 2GFBB 4NKQB 1FBIH 4GLRI 1NGPH 4RNRA 5E6ID 3NPSC 4ZODA 3VGFA 1T2QH 5TFSL 1JHTA 2CMRH 2QQKL 4MNQB 2X9XA 1WBXB 4D9QE 3T1WA 1FLRL 2JIXD 2OXHA 5GPRA 4ZPVA 2VMFA 5F9JA 3SDDA 4K9EH 1GHFL 1MFNA 1AY1H 3W9DB 4MA7L 1F4YL 1VKXB 4X8XA 4MZ3A 3MRQA 4GG6B 1R3KA 4PJBE 3WHE1 1AKJB 3RWHB 4CN4A 4AMKL 3MRKB 3EGSA 1LILA 3NFSL 3UTOA 5IESL 5HYSA 4GH7B 1NGXA 1OSPL 2VRAA 3KS0H 3X3FL 1QPXA 3V9FA 1IM3B 4LSRL 3LEVH 1P7KB 1BVZA 3LSOA 2EEBA 5JTWA 1W72H 4I2XB 2XWTB 2YKLH 2HG5A 2SEBB 3D9AH 1T6VN 3QIUB 3MPCA 4FXLA 2DBJA 1S5HA 5BZWA 4HXAL 3WIHL 3V79C 2XPGB 3FT3B 5HYEA 5E2WH 3C5ZD 1HCFX 2X1OA 4X4MA 5J13C 1FIGH 2W9LA 3WIIH 1A6ZA 3QT2A 4BZ1H 1H15B 2DQDL 5BJTB 4N9GB 4J6RL 3DSNA 4AG4H 1YY8A 1BQSA 4CJ0A 4MJ4A 2QTEA 2DWDA 3O6KL 3BP7A 1SBBA 1CT8A 3QIUC 5E5MA 1PG7H 1TVHB 3P4LA 1IAMA 4CGTA 1J7VR 1EFXD 4JE4B 4XPTH 3T4AA 5IBLD 1YJDC 3MUGA 3PGCA 3SE8L 4C58B 2VXSH 5GRXG 4YXHH 3QHFH 4YO0B 2YUWA 3GMNB 3MJ6A 3OKEB 4LF3A 4LIQL 4O2FB 3MV7B 1AD9A 1NH6A 4R4BB 2LV4A 3TBTA 5DRZA 3U2SA 3X11B 5DSCB 3ARFA 1A6PA 3S96A 3CSGA 2OZ4A 5GRUL 4HUVA 4P9HL 4FFZH 4BUHA 3OZ9L 3EJZD 4H20H 2NLJB 4X5XA 4QEGA 4ZUWB 3DV6B 5K9JH 5DRXA 3KPQB 3UJIL 5GRVL 5DQDL 1CIDA 4JHBA 1A1MB 1EGJH 2DQEH 1LDPH 5J89A 4WWKD 2GCYA 4ZFFB 3UPAA 2EEDA 4N0UA 3ZTNL 1NBYB 1B0RB 1NSNH 4XPBL 1IAOB 1MCQA 3QDJD 3P40A 1QO3B 4DCQB 2GTZB 3ZO0A 1H5BB 4WHDA 4N90D 2DQJL 1B4RA 4WU5B 4NSKB 5FUOL 4QF1A 4GLRH 3RU8H 3PABB 4HBCL 4HX1B 4JFXA 2C9AA 1N4XL 4JR9L 4M1DL 5H37H 2Z35A 4LP5A 3BP5A 2GFBA 4K7PX 5KJRH 3IDMB 1JYVA 1GGTA 4PJBF 2DL2A 1A9BB 5I0DA 4OLUH 4FG6C 3N9GH 4AH2A 1H5BC 4MNQA 3D0VB 3HCVB 1WBXA 1HWHB 1CGVA 4Q58C 4QRSB 5FHAL 4PRAB 4AEIL 5DK0B 4GT7A 3W9DA 4JFED 1OPGL 4C83B 4GG6A 3WXWL 5DHYA 1AKJA 3B9VA 1FZMB 3CFDB 3MRKA 3RWHA 4PJEE 1U91B 2DMBA 1D5XB 1U8NB 5DZLA 2BNUB 4R6UA 1RJZB 3NCFB 1IM3A 5MHSD 1BFVH 5E6IB 3S5LG 1P7KA 3BAEL 4OLXH 4YNYB 3VA2C 1GPOH 4EOWH 3NCCB 1A7PH 1K3ZA 4JZJB 4I2XA 1TPXB 4MJ5A 2OTWB 2JIXB 2XWTA 2SEBA 5D2LE 5FOBB 4G7VH 3QIUA 4KY1L 5IB1B 1HZHL 3NVQA 2X1WL 1QKZH 1X5FA 2VWEE 3ULUD 1REIA 3QDJE 2XPGA 2X6MA 3S97C 2X7LA 1F45A 3KPLB 4N90E 3EAKA 4P0DA 1OOAA 5E6IC 4YHPB 2KZWA 4L1HA 3GI8L 1F58L 2PO6D 2C3VB 3MRFB 4N9GA 5BJTA 2I07B 4JZJC 1TPXC 1I7RB 2FWOB 1TVHA 4GS7B 4JAMB 4ODWB 4R26L 1TXKA 3UYOD 3W11D 1B3JA 1F2QA 1WEJH 3OWEA 4YO0A 4X6DE 3U1SH 3GMNA 4ODUB 3NABH 2G9HB 4O2FA 1U41A 3C5ZB 3P2TA 3MV7A 4MSWA 3RQ3A 5IHUL 4R4BA 4JFEE 5DDHB 5IF0B 1FNFA 4M6MH 4LVEA 1MCOH 4GMSL 3X11A 1J5OH 1T1WA 3U82B 4MB5A 2VDMH 4D9LL 2NLJA 4GS7C 4ZUWA 2FJGB 3DV6A 4KJPD 1CGWA 2EC9U 4K7FB 3MLYL 5HXMA 5MHSE 4DTGL 1IT9H 1A1MA 1EFXB 2OI9B 2WMPA 4LCCC 5I1JH 5DUML 2P5WD 2DI8A 4ZFFA 5H35B 5ACLA 4QHLB 5I8OL 3C5ZC 1NBYA 1B0RA 3AS1A 3LS4H 5DMGD 1H3XA 1YEJL 1J8KA 3OKLB 1QO3A 4DCQA 1UZ6F 2GTZA 1IARB 1H5BA 1SVZA 4PJEB 4NSKA 3GSWB 1AXSB 4M43L 5ACZB 4PJ9D 1BBJB 1DBAL 4KDWA 1YEDB 3PABA 1EAPB 1T0PB 3BH8A 4HX1A 5EZLB 3T2NH 1CDCA 5E8DH 2NPLX 1EMTL 2PR4H 4LIQE 3FO0H 2OI9C 1X5GA 4OAWB 3IDMA 1ES0A 1A9BA 4YFEA 2NNAB 5FGSA 4E42B 3GHEL 4Y16D 3ARUA 3D0VA 3HCVA 3QDJB 1A1NB 2UWEF 4KXZI 4KZEH 4QRSA 5AZ2L 5A2FA 4OD1L 3O81A 4C59B 1PG7X 3EJZC 4OCMC 1F42A 2VYRE 2BVOB 2DMKA 5D2LF 3O9WD 4ALAH 1CD1B 3JV5A 3CFDA 3NN8B 1FZMA 4RBPK 2R2CA 4DWHA 1YPZE 1U91A 1U8NA 3CU1A 3CSBA 1U8PB 2BNUA 3P3YA 1RJZA 5GJSH 3C6LD 1XR8B 4TULL 4YDIH 5E6IA 3RWIB 4HS6B 5EUKB 4H1LG 5TQ2H 1MRFH 4YNYA 5FK9B 4KAQH 3LHPL 4JZJA 3T77B 2OTWA 4UTBL 2JIXA 4OSUL 2E9WA 5I18H 4X6DB 5FOBA 1I9JL 1WWCA 1BF2A 3HI6L 2P5WE 5IB1A 4M93B 1S9XB 2R2BB 4JFEB 2H1PL 2KQMA 4X80H 3IFOA 1XGUB 2EYTB 2ICWI 3H9HB 3O11B 3D69B 3KPLA 3U46B 1AGCB 1GAFL 3FZUD 4YHPA 5C6TH 3EYVA 5FO8B 2I5YL 4O4YL 2IADB 2B5IB 3A6CL 4L5FL 3GNMH 4OM1H 2C3VA 3MRFA 4WY7H 2I07A 2UUDK 4NC0B 2FWOA 1X5AA 1YNLL 4HH8A 4I9WD 4M93C 1OD7A 4D3CH 4S1RL 3A67H 1RK0B 4ODWA 4Y8AA 1CGXA 1ZHLB 4LCCA 1LMKA 4ODUA 3BJ91 3KPNA 2G9HA 1NCWL 2ZUQB 3C5ZA 2B5IC 4RFOH 2BRRH 5DDHA 5IF0A 4AQOA 4LSTL 5TF1L 4Y2DC 2ZUSA 2PO6B 4JDTH 1A6VH 4IRJD 3WD5L 1UH4A 1YEKL 4P59H 4MJ2A 4NBZB 3QBTB 2FJGA 2CGRL 4K7FA 2D7QA 3WFHB 4GAGL 1GIGL 1V5JA 4LLMB 4ELKB 1EFXA 3ULUC 1CQKA 1SM3L 1UKQA 1QD0A 5H35A 4QHLA 2ZUQC 3WJLC 3BD3A 3CPLB 3VXME 4FNLL 2HP4A 2B1AL 3ARRA 3OKLA 1NGWB 4ORGB 3LZFH 4KJQD 2PO6C 3FN3A 2E9IA 4P2RD 2HVJB 3H3PH 2EE2A 2O26U 4PJEA 3GSWA 1XF2A 1AXSA 4P3CL 3QP3A 4RA3A 4S11A 5ACZA 1BBJA 4NM8L 5C08E 1CICA 4P9HC 1YEDA 1FAIL 1EAPA 4OV5B 4JHWH 5EZLA 1KJ2L 2BVPB 2X5PA 5E2JA 1DQLL 1UCBL 5B8CB 5EUOB 5CWSA 2BSRB 2AK4D 4OAWA 3TN0C 3W11C 1CVRA 1KJ3H 4RSVA 1CZ8L 1YPZF 2NNAA 4E42A 2P5WB 3QCVH 4QO1A 2R15A 1MI5B 4OFKA 4DJMA 4I9WE 4C55A 2D7MA 4BKLB 3LQMA 3QDJA 1IMHC 4JG0L 1A1NA 4PJAE 3TEUA 2AJVH 1EHLH 3QEGL 5IT2H 1MRDH 3WNKA 2W38A 1JVKA 5JORB 2EDKA 4PJ9B 5CSZB 3NN8A 3HB3D 1JRHL 4RFEA 1JFQL 3R0MA 1LO0H 1U8PA 5F1IB 3RWDB 3G6JE 5MENA 1XR8A 2EDQA 3RWIA 4PGBB 4HS6A 5EUKA 3QO0B 5DMGC 1C8PA 1T20B 4KUZH 5FK9A 4LSQL 4JFOB 3ZDYE 1OTSD 4Y16B 3GSUB 3T77A 4JM4H 4X6DA 3TVMD 4PJ9C 4E0RB 2VC2H 3LOWA 5D2NE 4LCIL 1S9XA 4OIIL 3SBWC 2R2BA 4JFEA 3BIKB 3EDKA 3TJEL 3MTRA 4YWGH 1CDJA 2V2WB 5IBTL 5TQ0L 4JPVL 1UM4L 4RIRB 4BQ6A 3O9WB 1XGUA 2EYTA 2VXVL 3H9HA 3O11A 2EDJA 2FECL 3D69A 4P2RE 3U46A 1O7SA 3WIHA 1W8OA 4HFWB 1QLRB 4YHYB 3VXTB 5D72H 5FO8A 1MCWW 2IADA 1P7HL 2Z8WC 1P6AB 3C6LB 4GJTB 2FNBA 5EG6C 4TNWF 3CVHL 4Y2DA 5K93A 2EDTA 25C8H 2DM3A 3WNLA 5DUBB 5DJAA 3MNZB 3V4UL 3RHWF 2IG2H 1RK0A 3MV9D 1ZHLA 3EOBB 2K3TA 3O9WC 3UDWC 1FL6B 4Q0XH 4AEFA 5IB4B 4YHYC 3S88L 3WJLA 3AU1B 1DBMH 3C6LC 1BF8A 1DR9A 4QNPF 5GRWA 4O2CB 4EI6B 1HH9B 2ATPB 2IBZY 2PO6A 2YPVH 2D7TL 4RWYL 1LP9F 2CJUL 3WFHA 3A6BL 4FQXD 1PQZB 4MDIB 1MHPH 3ZKMC 2YPKB 3TN0A 5AEAA 1BJ1H 5ESQB 1LK2B 2GJ6A 1U36A 5JDSB 2AK1L 2EKJA 3V4VH 3C8HA 1NGWA 4ORGA 1MPAL 4Q9QL 3U7WH 3FCTB 3IFLH 2HVJA 5HGGS 2WQRA 4ETYA 4BYHA 2JJSC 3WHXB 4BSJA 4IRJB 4PJAF 4FOMA 3LEYL 5IQ7H 4OV5A 2ORBH 3DI2B 1DSFH 1PG7W 2BVPA 3DX6B 5E2VH 5EUOA 2Y5EA 2BSRA 4NO0D 1RIHL 1KXQE 3IXAB 3KJ6H 3DBXA 3GIZL 2F74B 4DVRH 5HHNB 5CILL 4MQSB 2EICA 4J3UA 4O02L 5EDXA 1MI5A 3BN9C 3G6JF 4BKLA 2XXCB 4ZFZB 5HY9A 1TJHL 4PP1D 3MV9E 1A7QL 3T08A 4IRJC 4P2RB 4NJAH 1H0DB 3OKMB 4ERSL 1FVDB 5JORA 4PJ9A 3QCUH 5CSZA 4G6JH 3SBWA 1DUYB 3U7YH 2Q87A 2X1XR 1QBMH 4OFYA 5FF6A 2AK4B 2VZ1A 4MDJB 1XGTB 4JB9H 4U6XB 3RWDA 1YYMH 4MD4A 4PGBA 1T20A 4LNVA 4RZCB 4JFOA 4NZUH 3CIQA 1SMOA 4KJQC 3GSUA 5GSRB 2HWZH 4OBSA 2CLRB 4FN0A 1NGZB 4J23A 4U1IB 1LHZA 3GJFH 2HN7B 3TP4A 4E0RA 3RVWD 3BIKA 3P0VH 1PYWB 4DEPB 1VSCA 4HPYL 4RIRA 3O9WA 5I15L 3B3IB 3UDWA 3QHZH 4M48H 3O41B 1KC5L 4NNPH 5F3BB 4HFWA 5DUPH 1QLRA 3O2DL 4KHTH 3VA6A 3VXTA 2BNRD 4XWGL 1S3KL 3C6LA 3NH7H 4XAKE 1S7XB 4M7ZB 1I3UA 2BXZA 3VFSB 4LLUA 5C9JA 1P9MC 3MUZ1 4N0YL 5DUBA 3BP6B 3MNZA 1IQWH 4W6XB 3TVMB 4DEPC 1D5IH 2PTTA 3EOBA 1H3VA 5DLML 3QI9D 1OWWA 1FL6A 4FRWA 3HB3C 5IB4A 4TSAL 1G6RB 2MSPA 3AU1A 4Z0BL 1RURL 4NO2B 2HTKD 2VDPL 5T3XL 4X5WB 4O2CA 4M7ZC 4S0TD 1HH9A 2ATPA 5KVFL 1OTSC 4WW1B 2JJSA 3HMXL 4WHYH 3MV01 2EDBA 5IKCB 3C60D 3E1F1 5CJQH 2VL5B 5FUCC 1QUNA 4LSDA 2AJZB 2YBRB 1IC5L 3GM8A 1OAUH 2YPKA 3MV9B 5LCVH 4HT1H 2AJ3B 1MFBL 3MA7A 1UA6H 4GXUM 5ESQA 1LK2A 5D71L 1QLEH 1NAML 32C2A 5JDSA 3STLA 2R56H 2HFFA 3EFDL 2DD8L 3FCTA 5C7XL 1QBAA 4NUGL 3WHXA 2FH6A 3QPQD 2Y72A 3MYJB 4IRJA 4H0HB 5EWIL 4IBLT 2JJWA 3DX6A 2BNRE 3IXAA 4FQXB 4LBEB 1DBJL 1MVUB 1KJ2B 2B1HL 2F74A 5BXFB 5HHNA 5ADPL 4GMTL 1FO0L 1DBBL 1DANU 4OGAC 1KULA 3GZKA 3VDCA 4ZFZA 1GGYA 1TLKA 2PF6A 4NC1E 4PJIF 4Q9CA 3MLPA 5JLZB 1H0DA 3VGDA 3QAZB 2A74B 4M6OH 1WWBX 3OKMA 1MAJA 5GGTL 3ZE0E 4CDGC 1FVDA 3UTSD 1MCEA 4UAOB 5DC0A 1RVFL 1DUYA 3KXFD 4EJ1C 2CR6A 1GOFA 3B8SA 2AK4A 4MDJA 4NO0B 4A2MA 1XGTA 5GZOD 3QIBD 3C2AL 4X99B 2F5BL 1Q8MA 3VXPA 1IC7H 3BMWA 3FO2A 1ZEAH 2OL3H 4RZCA 5GGSY 1KEGL 5GSRA 2CLRA 4OGXL 5GJTH 5I1DB 1NGZA 3QAZC 1CVSC 2BVEA 4U1IA 1B6UA 3KJ4B 1P9MA 2HN7A 5AWNL 4UAOC 3P0GB 2IQ9H 4ZMAT 3MXVL 5FM5M 4AIZA 2AP2A 1PYWA 1LO3H 3CCHB 4Q6IB 3OHXA 2ZCLH 5KW9L 4PJ5D 3B3IA 1Z9OA 3O41A 4JPKH 5TH2B 5F3BA 1HHKB 3VXUD 1EEYB 1NCTA 2XNAB 5KZCD 3MC0A 4JLRA 3ZL4L 4G6KL