2OZ4A

Structural plasticity in igsf domain 4 of icam-1 mediates cell surface dimerization
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
265
structure length
265
Chain Sequence
b'VLPATPPQLVSPRVLEVDTQGTVVCSLDGLFPVSEAQVHLALGDQRLNPTVTYGNDSFSAKASVSVTAEDEGTQRLTCAVILGNQSQETLQTVTIYSFPAPNVILTKPEVSEGTEVTVKCEAHPRAKVTLNGVPAQPLGPRAQLLLKATPEDNGRSFSCSATLEVAGQLIHKNQTRELRVLYGPRLDERDCPGNWTWPENSQQTPMCQAWGNPLPELKCLKDGTFPLPIGESVTVTRDLEGTYLCRARSTQGEVTREVTVNVLSP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Intercellular adhesion molecule 1
publication title Structural plasticity in Ig superfamily domain 4 of ICAM-1 mediates cell surface dimerization.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 50
structure length 265
sequence length 265
ec nomenclature
pdb deposition date 2007-02-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2oz4A01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2oz4A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2oz4A03
5D1XD 1A7NH 4KUZL 4ETQB 1VFBB 3GJEB 1KTLB 4LLYB 1EEYB 1LP9E 3V9FA 3UTOA 4BSWA 1OOAA 4EDWH 3W9EA 4EI5A 1NFDA 3P9MA 1C5DA 3B3IB 4NFCA 1SHMA 3P4LA 5FHBH 3MJGX 1K3IA 2QHRL 2CLVA 1G7PA 2XTJC 5HI4D 1AHWC 3HPJB 2BNQE 1MCFA 1AXSA 4LDLB 4X8JA 2D7QA 1S7UA 1I7TB 3LQAH 5GGVH 1U41A 5I1EH 1Q94B 5EBGA 4LKXA 4DW2H 3MBEB 3WLBB 3T3ME 3IDYB 1ZLUK 4OF7A 4X7SL 3ARDD 3WLWC 1MLCB 3D39B 3IU3A 1JGVH 4N5ED 3SKOA 3DMMA 3L5WA 3P2TA 1FG2A 3VG9C 5C07B 5C0CE 7FABH 2YZ1A 5CJXA 4DN4L 5KVDH 3ULVL 3GMQB 5EU6B 3E8UH 4IRZH 3DSFH 2VDNL 3M8OH 4Z7VE 5HVHB 4XP1L 2ESVB 4XP6L 3WIFA 1Z3GL 2JK5B 2NXYB 3PWNA 4L9DA 4FFWC 3N1QC 2QQNL 4Z8FL 4BELD 3VJ6A 2E7MA 4N8PA 4JFOA 5C8JB 1L9MA 3KYKL 4QRUA 3MA9L 5K9QG 2EDOA 3ARFA 5TDNA 4LPVA 5IM7B 3OR7B 4Y4HB 5CP3H 3SE9H 5GJTL 5E0QA 2YZ8A 3Q5YA 4HCRH 4N0RA 4GXVL 5DEZA 3VA2C 3FONA 3GSNB 1A9BB 3OPZH 5E2JA 1F2XK 5E2UH 1E4WL 3C08L 4LSQH 5E8NB 3Q3GA 4LCCA 2BNUA 4PJ5B 4AG4H 5ADOL 5F88B 3WHXA 3DX6A 4JGUA 5TPWL 1R0AL 3GEWB 3U1SL 1UXWA 3L95B 1L0QA 2IANE 3QFDB 3SO3B 4BFIA 3VXPA 2C9AA 3T4YA 4F8QA 4NQUA 1JGEB 5JIIA 4JJ5B 2B1HH 2YK1L 5J3HD 2LU7A 1WAAE 4PJDF 3SDDA 1CXKA 4AEIL 1QVOA 4ZNEE 3RVXD 1IL1B 1W72L 2RCSL 3EHBD 2BHUA 2QQKH 3TO4B 1HOCB 5ITFA 4KY1L 4KDVA 3NCJH 3P30H 4WHTB 3KPRA 2E27H 1W72A 1NKRA 4JN1L 1BEYH 1UKQA 4N8VG 3QP3A 1MCQA 2V7HA 3T0EC 2G60L 1UWXH 1UEMA 1AQDA 1OP5K 3HFMH 4JGJA 5IMKB 3NN8B 5T1MA 4XPFH 2J8UE 3HC0B 4GFTB 1JYNA 1EGJL 3BH9A 4J6RH 3RNQB 1VFUA 2YD1A 1Y6MR 2ZNXA 5EO9A 1ZLSL 1AGFA 5HHME 5EA0H 3HC4H 3C2AH 1RULH 2V6HA 4HK0B 4MCZB 1EGJA 4XPBL 5DQJA 5H94B 5E6ZA 5F6HI 4JPIB 1LEGA 1KOAA 1NMCB 4PJ8A 2AXGB 3QIWB 2AABH 2PTTA 1I1AB 1CL7I 5T3XL 3AREA 4R0LA 1ZA3B 1I3RB 1HCVA 1H3VA 2ZOKB 2Z92A 2DQJL 1FNSH 2Z0BA 4J3WA 5D71H 1S7SA 2BSED 2X5PA 4JO4H 1QFWL 3LCYA 3PWPA 4ZFOL 4I3SH 5DD0L 5D1ZA 3BPNC 1JHKH 5HBBA 4PTUB 3OF6D 4MZ3A 4GRWH 1RZ7L 3FTGB 3PGFH 2CUMA 5BXFA 5DQDH 5FO8B 1T83A 1WSST 4PV8A 2Q7YB 3UYRH 2CLZB 1GL4B 3MLZL 4WUUE 3RGVA 2E5EA 4ZFOA 2W60B 3CPLB 5K9QI 1U8HB 2Z4QB 1F58L 3RWJA 2WBJC 4FQXD 1NCBL 3MZGB 3KG5A 4U6XA 4MA3B 2YS4A 4R97C 2NY6C 3SPVB 5FFLA 3X11A 4MAYA 4FQPA 3HG1D 4P57A 3H3KA 1ZLVK 3S4SG 4I0CC 4NHUB 4OIAA 2DAVA 3BWUC 4QWWC 3TZVB 4PJEF 1DBKL 4P9ML 3RY6A 3RVXC 2P5WE 1VFAB 5J06A 1T5XB 1IZJA 2H32A 1MY7A 2UWEF 5FYKD 5SWSD 4KZEL 1KG0B 4FQCL 1IGML 4AEHL 3ALWA 1U91A 2BY3A 3MMEB 3C6LB 4H26B 2KZ1B 3VDAA 5FECA 1CLZH 1MRFH 5HTSA 1U2HA 1KJVA 3MV9E 2YD5A 4NC1C 3SCMA 3GKWH 4FQ2L 3SE3A 2D9CA 3P9LA 5DLMH 3T0WA 2VN7A 1WICA 3MOQA 2YXMA 3PNWB 2XWBA 4FQQB 3PDOB 4U33A 3NAAL 2VXQH 4FQHA 3U9UA 3LS4H 4MAUH 1ZHBA 1OLZA 2PXYC 4POUB 5I1DA 3WHE1 5FYLD 1I9RL 4LDEB 3TLRA 2VZUA 1JGVL 3EYUL 2IH1B 3BI9X 3QI9C 4U0RC 2XN9D 4RGNE 1S8DA 4LVHB 4HUXA 4M4PA 1HXYB 4YR6A 1F45A 2R29H 4XVTH 3ZE2F 5IIEB 4OZFH 5E8EB 3WS6A 4DOHE 3TBVB 3DUSA 3TA3B 3C5ZA 2DKUA 2YPVL 3SDAB 1DVFC 5F3BA 4PJIA 1E6JL 2F19H 2FIKB 1NC4D 3TBYA 3B4NA 1FZMB 5IJKA 2AEPL 2ID5A 4OV5A 4HKXB 5T5FL 4UILH 2EECA 1EXUB 1MEXL 2IAND 3WV0A 2VZVA 3UJJH 5FEBA 2ZCKH 5C0RL 1R5WA 4QOKB 5D7JA 5ADPH 4LSTL 1WT5C 3WKMH 3C6SA 4KRNA 3C60B 5DWUL 4JM2A 3CX2A 4QXUH 2OI9C 1JN6A 1IGJB 1CXHA 4IRJC 1GIGH 4OFYD 4P9HL 4P2QD 2GJ6A 4NRZA 4HJGB 15C8H 4A2LA 4WW2F 4IRSB 3TH2T 4DN3L 4HCRA 4PRHB 4GKZB 3O3AA 1KEMH 1CLOL 1BQSA 4R7DA 1LO5A 3T09A 4Z76B 3LRHA 1FAIL 2EEAA 2BSTA 3S37L 4GW1A 5I74B 3BN3B 4RWYL 5IW6B 4LFHD 1M7IA 5I17B 5KSAB 1CQKA 1F11A 3O6LL 3L7FA 4OZHE 3RWCB 4NN7B 1ZHKB 4DKAA 1DUZB 1PG7H 3HI6H 4NDMA 3MV7E 1HINH 4HAGA 4JANA 1VPOL 2AK4B 2VTFA 3RZCB 3ULUE 1F2QA 1ZE3C 3REWA 2G75B 2BC4A 3D3VE 5C0BA 4NNYA 2UUDH 1CWVA 2L4OA 4YXLH 2C4FT 3MUGA 4RAUA 2ZSWA 1JRHL 5GS0C 4YQXL 1J8HA 3QNYA 4WVRA 5EUOE 4ODXA 3RUGB 1CD1B 1JPGB 4G8GD 1OSZA 4FN0A 3CXDL 2FWOA 1QSFB 3UJIH 1TFHA 4HBCL 1PLGH 5E8PA 4JM4L 1LEIA 4JY6A 4JO2L 4Z6AT 1DLHA 4KTDH 4LF3A 4I3GA 4ESKA 3I75A 3P0VH 1RZGA 4JJHA 4JRWA 3NMEA 5INDB 2MCG1 3RVUC 1R3KB 2YRZA 4NM8H 4JDZB 1XAUA 5J6HA 5J11B 5L88H 3N0PB 1F42A 3W0WA 3D0LA 3PQYD 3OWEA 4JO1L 4UOW0 3MLRH 4HKJB 1ZA6B 3BKMH 4TN9A 1BAFL 4DGIH 1BVKA 2HT2D 4GMTL 3GSNL 1NCDL 4N0YL 4P23B 5D7LE 1A6WL 1JK8B 5DURB 1HI6A 3VH8G 4FZ8L 1W0YT 2R0KH 4NYLA 1QRNB 2Y25A 3LIZH 4KROC 4OCXH 3MRLB 4CADA 1HQRA 4D8PA 3G6AA 2WP3T 4U05A 5DR5L 1ROWA 3OZ9L 5IV2A 5B39B 5CEXB 1CLYL 4F9LA 3IFOB 1QR1B 2WLYA 2KL6A 4LLQB 1NCAH 4OZ4A 4XCCL 5KANG 3HUJF 2PYFB 2ENYA 4FXLA 4H20H 4PRID 3IXAA 2HRPL 4FXGA 3QXUA 1E4KA 1I8MA 5IP4A 1VFMA 3MCKA 3RIFF 2OP4H 2WQ8A 4MD0B 1T7VA 3TNMB 5MENB 5HYSB 3QFJE 4APQC 2PCPA 3JVGC 5IROC 5IESH 3TN0C 4UB0L 5DJ8B 2G5BA 1CVSC 4QF1A 4EN3A 1NL0L 4ZTPL 5J56B 3OXRA 3HMXL 3K2UL 1QKZL 4Q6IA 1P4LA 4L4TA 1IZKA 4R2GD 4MSWB 3F5WA 1CDHA 2OM5A 1P4BL 1JNNL 4XPTH 2O5YL 3QAZC 2WBKA 5BRZE 4KK9D 5I8EA 3HMXA 1KC5H 4L3EB 1NKOA 3VMPA 1KELL 4Q9CA 5GGVY 3V5DB 4ZAKB 3DROB 4YHNA 2X40A 3QHFL 2VL5B 2GSGB 3C8KA 4OD3H 1G9MC 3PHQA 4BKLB 1ITBB 3GMOA 3ES6B 3NFPA 1BBDH 4GBXD 1YN7A 1OGTA 5DZLA 3QIUB 5DJYB 3AAZB 4HEPG 5D2NB 1CXEA 1HILB 1RIVH 3P0GB 1J1OH 4P5MB 3DGCR 2XIDA 3VWJA 4U6VH 4OZGA 3RQ3A 5HJ3A 3STZA 1FC2D 2CRZA 1U6AL 1XFPA 1HHHB 1NMAL 4HKZB 1K8DA 3AU1A 5DJ2B 1P84J 2I9TA 3MRDB 1TQBB 2HVKA 2VISB 3NFSL 3TT3L 1MCWW 4OBRA 3P73A 3K81A 1GRWA 2OBGA 2ZNWA 4HZAA 5F7DB 4WCYH 1LDSA 1F6AB 1T20A 4W4OA 1FYHB 1F4XL 2YA1A 5I2IA 1YMMA 2BOBA 4NGHL 3TCXA 4NPYA 4M43H 3X3FL 4M7LT 3MUHL 1JCKA 1Q9LA 4IEFB 3UMTA 1DSFH 3ARVA 4Z7VF 3WN5B 5IOPA 1G7HB 1MWAL 5GHWH 5GS0H 4I2XA 3KYNA 5TQ2H 5DA4A 4OD1L 4CDHA 2F5BL 4JKPH 3O4OB 1A7RH 5BVPL 5E5MA 5KTEL 4E5XB 2JLLA 4JVUA 2B2XH 2KQNA 3EDFA 3OKKA 4J3VA 5CINL 5DD5L 1P53A 2DL9A 4FP8H 2HFEB 2ICWA 4XT1C 3WIHL 3O3EB 1B0RA 5I30L 1P7QD 1RUPL 3PL6D 2DLTA 2ILLA 3QQ3A 4YIQA 3VRJA 1AI1L 3MJ8A 4QYOA 3CC5B 1RVFL 4NQXA 1ZANH 3S3SA 3O2DH 3GK8H 2YPLB 5KANI 3EO0B 3D3VD 4NHCL 3WKNA 3WIHA 2CO7B 3QIBD 5EFIB 5TQ0H 5IB4A 2HWZH 4M62L 1KN2H 1KCRH 4XC1H 4PYGA 4Z7UA 3SDXB 1JZ7A 5CMAB 4H88H 4JRYD 3L3JA 5IB1B 1FGVL 3OL2A 2E7LC 2FEEI 2H41A 4FFYH 2WLZA 5HHOD 3PWLA 4GKNB 1U8OA 4ELKB 3VFUA 2PO6D 4Y5XB 1T1XB 2FX9L 4G3YH 3VGEA 1KCLA 5HVWA 5JNYA 3MRFB 3ZYJA 2A83B 4KKLD 3HNSH 3NABH 4JFHD 3O3DB 4HWNA 1WAAF 2NY0B 1ZWIB 2JCCB 4KMQA 2CGRL 1U8QA 2VLRB 1OT1A 2XYCA 1BM3L 4GS7C 4TVPE 4PRPE 3BP4A 4ODSH 1I3GL 3SGKA 4CVXA 1ES0B 5E56A 3QO1B 3OAUL 2ZUTA 2X4UA 3U7AA 4W6XB 3H9SB 3ZKSD 4KHTL 5FYJH 4YDJB 4Q9QH 1UH2A 3SKNA 1BX2A 1XIWD 3UDWC 5KSBB 4F7PA 3S88L 4EI5B 4OZFG 1HXMA 1OARL 3PXJA 1UZ6E 2VKWA 4QRQA 1HSAA 3NTCL 1X5JA 1YMHB 4G43B 4UT7H 2J8UF 2E7BA 2Y6SC 2BX5A 1JUFB 3UTQB 3KPSB 1NBYB 2BDNL 1OAKH 5DI8B 4GW4B 3C9NA 4YX2L 3GSQB 3LRSA 4P99A 2OX5A 4U1KB 1FNFA 3LB6D 5IHZB 4LSRH 4XPGL 4W6WB 4ZSOB 1NC2D 4YUEH 3S36X 2FGWH 3RP1A 3NCYP 3QO0B 6FABH 3KAAA 4QRPE 3HNTL 2HFFB 2K9UA 4HGKC 3Q5TA 3ZDZF 2YN5A 5FXCH 2OYPA 3SGDI 1SJVA 4AL8H 1WCQA 1RMFH 4OUUB 5C7XL 3CMGA 4YDKL 2LU3A 5KVFH 1SYVB 1Q9KB 2DIAA 3UZQA 2ATKB 2F5AL 3U7WH 1HQ4A 4KUCD 1QLRA 3HE6A 1ZT4B 4GRLC 3QFJD 5BV7C 3PP3H 4KKAC 5HGDB 3RL1A 3MRMA 2J4WL 4RZCB 5DMGC 1V7ML 3IDJA 2NW3A 3GSRB 1OM3H 3WIFB 3FB5B 2NXZB 4EUPH 5IFAL 2JF1A 2YWZA 4M03A 1KGCE 1ZGLA 3OJDA 5FUCE 5HHPA 5A3IC 1YNTA 1YEJH 5BS0E 1FO0B 4M6NL 4KK8C 1DQDL 2L7UA 3BZFB 4MJ5B 4ZS6D 4L9LA 1N0XH 3ARUA 3OKOA 1YN6A 1KPRB 1O0VA 2FJHA 4MA1C 2EEDA 1SM3H 3WJJA 2XNAA 3A6OA 1EMTH 3DETD 4JFDE 1NUNB 4QRRB 4MVBD 5T3ZH 1CICC 4HXAH 5BZDA 5C0GA 4F9PA 2HA1A 5I8KH 1VKXA 2K7PA 5HDQL 4POYA 4KKLC 1BBJA 2F54B 2EDHA 4HDIB 4I48B 4MMZC 1IGTB 1RU9H 4HIJB 2BNUB 3TVMA 2VAAA 1X6LA 2IQ9L 3MX0A 1GGCL 2PKDA 2PUQT 4P46C 5SWQA 4RWHA 3MLXL 4A6YL 3X12A 4HPOH 3KPOB 3WO4B 4ZDHA 4E41E 1TJHH 1HZHL 5F7KC 4GAYA 3L3GB 2W0PA 1OAZL 4NQEE 3KJ4B 4UNVA 4A6YA 4JZJC 3QDMB 1RUAL 4LHUA 4X83A 4CJ0A 4C59B 1RIHL 1C7TA 3QUKB 4LCYB 4JB9H 1J0JA 4XRCA 3U7YL 1ORQA 3S4SB 5C9KA 5SV3A 3VFGH 3I6GB 3R0NA 5D93C 1KULA 1EJOL 4GAGL 4GW5B 4JREC 1BZ9B 1NFDE 1PYWA 1T4KA 4YO0A 3BH8B 4WNQB 4F3FA 2PR4H 3S34L 5E8DH 5T1DH 3E3QC 4HFWB 2VXVL 5HYQA 2LV4A 5HHXL 1BQHA 4WHDA 2NNAB 3DVGB 2EIEA 3V4VH 4TSAL 1KF9B 4UOW1 1Y6KR 2NY2C 1BD2D 4Z78B 3O2WL 1DBAL 2ZCLH 5E1AB 1F4YH 1ZVSA 5B21A 4MNQB 1NMBH 4M7LL 1WIOA 3WS3B 1TCRA 3QBTB 5JO5A 3CVHH 3BZDA 2ICWJ 4F2MA 2P5ED 5EZLA 4R7NB 4GKSB 5E4EC 1UM4L 4EQ3A 3CFDB 3W9DB 3KYAA 1IM9D 2DQEL 4CDGC 1EAJA 2V7NA 4R4NC 4NKQB 1UB6A 5MEQA 1IT9H 3NH7H 4X4XA 5BXFB 1KXVC 2VXTH 5FKAA 5AZEH 3ULVE 1F5WA 3L3KB 1CTNA 5KW9H 1N6UA 4G6ML 2GITB 3ARBA 3ESUF 4HKBA 3DI3B 2YEZA 4XCNB 1U8PA 2H1PL 3GRWH 3QPQC 3LPWA 1FFQA 1M05A 2IAMB 1EUUA 1QSEB 4OT1H 3BMVA 4NO3B 5DEGA 3EDEA 1I3UA 1RI8A 5DMIH 4HQQL 1B2WL 3DRTA 3B9KA 3P11H 3CDFA 2GFBB 2P8LB 5MHSE 5DJXB 3OG4B 5SWZA 1Q0YH 3TP4A 3VGDA 4JFYA 1K2DB 1TTUA 2YUXA 4B53A 2HAZA 5BV7H 4OZHF 4PJFB 4X7TB 4JFEB 1CXFA 5D7KE 3M07A 1NFIA 1MIMH 1NLDH 3K8MA 5F1OB 1N8ZB 2CDGA 3U4EB 2QR0B 1W8NA 4HUVA 1QQDA 5GGQL 1J88A 3ULUF 3B9DA 4R90L 5CD5D 5L2JB 4PLKC 3AY4C 1ORSB 2PYEA 2OCFD 5F9AC 5T33H 1KCSL 1FRGL 4P5TC 1A14L 1AGEA 3KLDA 3OAZH 4JPKL 4WWKD 1IQWL 2X9YA 5IVNA 5ID0B 2CKBL 1UQSA 4U1JA 1RHHA 2A0LD 2EXYD 3ZKMC 1J1PH 3G5ZA 5HY9A 4WI7A 2YD2A 3SQOH 2XZCH 4LSPH 5EUOF 4HAFA 2IC2A 3MRJA 4BFGA 1U95A 4ZOCA 1DQMH 2AJVH 5GJSL 4WI5A 3UZVB 4HZLB 3C8HA 4HFUL 2CKBA 1A0QH 3UTZB 3CVIL 5CEZH 4P3CL 3LVEA 2X4OB 3KPRE 3LKPB 4J3TA 3QXDA 5FCSH 1MLBA 2WUBL 2VQUA 2OTPA 4FQJL 1UB5A 1FCGA 4MS8D 3QUXB 1MNUL 2X42A 4QXGL 2BNRA 5DJ0B 2CK0L 1DN2A 1EFXD 1UCBH 4GLRH 4M93B 4PG2A 5I1JH 5IEHA 3V4UH 4XCFL 1AR2A 3TBSA 4OM1H 3MNWB 1FDLH 3RWGA 3U83A 1TZIB 5A2KH 4HUXB 1AP2A 4E9LA 2LTQB 1NGYB 5AAWA 1VB9A 2C3WA 4XBPA 4JZNB 4NKMB 1M6OA 1MI5A 2ZPKL 5CKAA 5KN5A 2OK0H 3UTSE 3VFMA 1NUGA 5D70L 1A9EA 1XGQA 3AB0B 3HE7B 5CWSA 3ZTJH 3MV8E 2VLKA 1NAMH 2NY7H 1CL7L 1DE4B 2P7TA 3OR6A 4GUPB 4G9DB 5JPNB 3BDXA 1EEZA 3DV4A 1HDMA 3S96B 3L5XL 2MQ3A 2MWCA 3LEVL 1FE8H 1TJGH 5DF0A 1UACL 2B5IC 2I9LA 2VLJB 4G9FD 2JJTC 4JFFD 2R56L 4YHIA 1U8MB 1UKTA 4LIQH 5C0AA 1AQKL 3W81A 1RFDH 2B0SL 2IQAA 2N1KA 3CIQA 3PWPE 5D7IE 1R5WB 4GQ9H 5T3XE 43C9B 4UAOB 4E41D 1FZJB 2E9BA 2R0WH 4WY7L 5EN2A 5D1QC 4NQED 1WZKA 2BJML 4HIXH 2GK0B 1AY1H 2P46B 5J8OA 4LLDB 1IKFH 2DYPD 2Y07H 2GJ6B 3S3PA 3L3OB 3VRLE 1CIDA 5TE6L 3GUTA 3WFCL 4D9QE 3CK0H 4DGYH 1NCCL 1J11A 3CXHK 5TFSL 2SEBA 1OGAB 1CZ8H 3VH8B 1V7NL 1ADQH 5FGSA 3BKYH 3IDIA 3PHOA 1IC1A 1MFCL 3GDBA 2LAGB 5A16A 5AYUH 2FYYB 4TOYH 4H8WL 1PSKH 3D9AH 3MROB 3LKSB 5ACMA 1OAXH 4UIMA 4UNUA 2NPLX 3D18A 3V7AG 2VDML 1YY9C 4NNYB 5JIKA 4KGLA 2AEIT 4G80B 3WNPA 4NM4L 3WFZA 5BQ7B 4P4KA 1FPTH 1JMZA 2AS5M 4OGXH 4IOIB 5JUEH 3ZHLA 2H2PC 3DMMD 3MNVA 4J3OC 3RWFB 4DAGH 1FN4A 5F3HB 5I18L 4JZOB 2NY5L 2V5YA 3F62A 3VXMA 2ADJA 3B2VH 1ZV5A 4ALAH 1CGSL 3N06B 1W0VA 3FQRB 3IJSA 3QEUB 4L8SB 4EUPG 4JHWL 4MXQD 5JW5B 1TENA 2I5YH 5I76B 2HTLC 2VWEC 4C83B 1TPXB 4N8VA 5CJ5A 3BEWB 4IOFC 1QFWM 3P0YH 3P77B 4JDTH 5TDPA 2JIXA 1UWEH 1T22A 5JOFA 2NY1D 1AO7B 2BRRH 5E2WH 3VXSB 3X14B 1A3QA 2D7PA 4C56B 3D85B 2AK1L 1QEWA 3FN0L 3QULB 2KBGA 1G1CA 3D0LB 5IMLB 4HV8B 5IJVA 4OIIH 1FL5B 2DICA 1CFBA 1ZOXA 1OQOA 3L3DA 5FOBB 4MQSB 4RDQF 4M6ML 4PJIE 3D69A 4U1MA 5FK9B 4NQVA 4XI5D 1J0YA 5FA4A 4X6DA 1FL3B 4QHLA 1WVZA 4PUBL 3ZTNL 1A3RL 1A6TB 5LAXA 4N90E 3UZEA 2XTJB 4ISVB 2MPAH 2IPKA 1KYOJ 3SKJH 1SJHB 1AHWB 1ERNA 3NFNB 1H3UA 1F3JA 3Q48A 3IXTB 5KZCB 1IVLA 1JPST 3MJ6A 4JQVC 2GAZB 4TSBL 4G6KL 1U58B 4NCDA 3QRGL 4RRPG 2GSIA 3TBTA 5HGHB 3QG7L 1H0DA 1KJ3H 5IF0A 1VEMA 4Y5YA 2AI0H 4S1RH 3WXVH 1NPUA 1PG7X 5IB5A 3R0MA 3QJHA 4OSUL 4XGZA 4ERSL 4Y4FA 3P9WB 2I07B 1LK2B 3VFWB 3M45A 3VG9B 4QF1B 5ICXB 3GBNH 1D5IH 4PIRF 4NQCB 4M61B 2E8ZA 1MHHA 3PF2A 2Q20A 5AD0B 3V0WH 1JHTA 4RCAA 4RBPH 5KSUB 4IDLA 3RDTA 4OKVA 4M8VA 1CFVH 5EO1B 4JG0L 1CD8A 2A6JA 4XXCA 3NGBC 5IBLC 1WWCA 1PVHA 1K4CB 3NIFE 5EU3A 3WD5L 1SY6L 3BUYB 5BW7C 3MLTA 3UTSD 2OR9L 3GSVA 4V2BA 5LWYL 5CSZA 3EDKA 4G7VL 2D7TL 5ANMB 2HKFL 3MV8D 3QEQA 3MXWL 2BK8A 1XGPA 1SY6A 3V6ZB 3QQ9D 3REVB 3RL2B 1JTOA 1MRCL 3BE1H 4OFKA 5J12C 3DIFA 1EHAA 4FHBD 1J8HE 5JMOC 5C09A 3U4BL 1BF8A 2DN7A 2XWJA 5IR1B 3OGCA 1Z9LA 1SVCP 4WW2C 4EBQL 3T65A 3EW3B 3NCYS 4K8RD 4OI8A 1II4E 4AY0A 2Y06L 1W0WA 2ED8A 3P73B 2FL5B 1XZ0A 5F7WC 1BOGA 4EIZC 5C6PB 5EU6E 1J86A 1MREH 1K3ZA 2XWTA 1U3ZA 2FATL 2BSSA 4GKOA 5F6HJ 5BVJA 1WF5A 5I19L 1JNLL 2EKSA 4OZFB 1BFVL 1AKJB 4KZDL 1IFHH 3QPXL 1ED3B 3CMOH 1FFOB 3JV0A 5F7EL 2CLRA 1U3HD 3W0WE 4ZUVA 3I02B 1JPTH 1D5ZB 1IC7L 3ZYIA 4XC3L 2APFA 1DQTA 5CZXC 5D9SB 5I15H 1I9JL 1XF3A 1Q1JL 1RHFA 3BT2H 3T0EB 4YIQB 1V5JA 1PAMA 3MXVH 1NGPH 3EDJA 3FO1A 4OCNC 3B5TA 4P2OA 1FNGA 3EOYG 4OTXL 1Z9MA 5HYJA 3IJYB 3SE4C 3KLAA 5E03A 1G7IA 4F7TB 2R1XA 3LS5H 1YEKH 4X80H 3FMGL 1UJ3A 1FYTD 1ZEAL 1PEWA 3VFVB 4AENA 4M9OA 5I1KH 2DQDH 3HN3A 4MNHB 1WCBB 4UTBH 1KUMA 4PJAF 1GGBL 1P84K 1HH9A 1IAOB 2HJKA 3MR9A 1YEIH 1G7QA 3SN6N 1BREA 1SJEA 3E2HC 4I77H 4ZUSA 4MCYA 4PRNB 4NZDA 4P3WA 5EORL 2NMSA 2VDKH 1LGVA 1U93B 2GCYB 1CFTA 3BKJL 4KKNA 3LN4A 4WTWA 3ZKXC 3RGHA 2VQTA 1TZHA 3WO3B 3RWDB 3BPNB 1M4KA 4L4TE 1NCWH 1EO8L 1IAKA 3BP4B 1P1ZA 2CH8A 3T2OA 4CVXB 1GXEA 1SBSH 1QD0A 1S5IL 3B2UC 4RAVA 2Y7QB 3MRRB 2ZUUA 5EZOH 1NSNL 3VFRB 5GRUH 3RWEB 1T0NA 4Z77A 5IG7A 3RA7L 3GJFA 2OXGA 4U49A 5HHNB 4MJ6B 2WBJB 3O4LB 4QTIL 4JY5H 4Q74A 1PGRB 1NFDF 4B7LA 1D9KA 4QRQB 5HGAA 1SEQH 4Y19D 4R97B 2NY6B 3D2UB 5DRNA 2QSCH 4JY4A 5FF6B 3P4OA 5JPMA 1ETZB 2NX5A 2M1KA 4L8DB 2CIKA 4LCIH 3CX5K 3BJ91 4NC2B 3QUZC 4G6FB 4BZ2L 1J1XH 5CGYC 3IJHA 4N90D 3STBA 4YFLF 1X4XA 1KBGH 3OX8A 2GTWB 4TRPL 3ILQC 1V8HA 3GB7B 2HT3C 4M7JH 2UYLA 5KVGL 1LNUB 4EKXA 5ISZA 3O9WD 1KFAH 4DTGL 1PW3A 1IQDA 3ZYOA 4OM0H 2NLJA 4WEBL 1EK3A 3DTXB 5EU7C 3MV11 3DVIA 1XCQA 3E6FB 4MJ4A 1UA6L 4BSVA 1YMME 3H42H 2DBLH 1P2CA 2FCBA 5JW3H 2E6JA 4MJID 1NANH 4XP5H 5DJZA 5IKCA 4LLUA 4CMHC 4BQ8A 3MRCB 3RL1B 3TJEH 2B1AH 2PW1B 5E99L 3TBWA 3KR3H 4EVNA 4FZEH 3VW3H 3ULSA 1BQLH 2XT1B 5SV4A 5C70A 3W39B 4Q9RH 2EEBA 3GSUB 4QHNB 1S7RB 4I2XE 4KQ4L 2BVYA 1U36A 3ULVF 1YNTB 4NZRL 2V9TA 4OCLC 4TUJB 1DL7L 3HZMB 3G6JA 3MRBB 3CH1A 2FLBT 4DZ8A 4LSVH 1WBZA 5I75C 1T5WA 2B4CC 1FFPA 2PXYB 3O3BB 4XBGA 5E94B 1ZTXL 2W9DH 1JPSL 5F9OL 3QDGA 2F8XC 1INQA 4S1SL 5B4MD 1CGYA 1UWXK 3E6HB 3BIKA 4N0FA 3LQZB 2Z31C 5HYEA 3IDNA 5C0GB 4U0RB 5EULV 4HLJA 1JHLH 1OPGH 4EI6B 4X6EA 4MD4B 4Z7UE 2J6EL 5DEFA 4X98B 1HHJB 2FEEL 1G9NL 5CCKL 4YEFA 3IETA 1DVFB 3MBED 3FO2B 5J9PB 1LO3L 5DVLA 1MAML 1QHPA 2J6EA 4WI3A 3KPMB 1OQXA 1YA5A 3D39D 1U8NA 2EDRA 1CFSA 4MXWH 5JZ7D 4I5BB 5IHUL 1FFNA 5C07D 4FTVA 2UY6A 4MNGA 1VEPA 5EU6D 5IK3A 3T0XA 3I50H 4HGMA 5SX5K 1H3TA 4V1DB 4CRPA 5I1IL 5HHVL 5F8RC 2ESVD 3UROR 2NXYD 4KKBC 1GOHA 4D2NA 1YJDL 5GGTH 1IARB 3BQUA 4Y1AB 3ARGC 2OI9B 3AM8A 4IRJB 1JPFB 4TULL 1NCTA 4D3CH 3T77B 2EH8L 1RZIA 3BYYA 1NBVL 4LASL 4Q58C 4KRPC 4UQ2A 1J12A 3GMPB 4MQ7A 5EPMA 5IVXA 4I9WD 4F58H 1L6XA 5J13C 2NY3C 1IBGH 1U8IA 4Y4HD 4K7PL 1MQ8A 1MREL 2BMKB 4XNYL 1RUML 2R1WA 1IAMA 5HSFA 2AV1A 1CDGA 4QHUA 5D5MA 1UH4A 3QUYA 1DBBL 3AVEA 5AWNL 4J3XA 4PRBA 5DS8A 4HS3A 3ARTA 4PJ5D 5JHLL 4LEXL 1C5BH 3TYGL 4AEEA 3QHZL 1E6OH 4P2CG 3C2SA 2DQTH 3BW9A 4JRXB 2ADFL 3LZFH 3RBSA 4D0BB 5LQBL 4UT9H 4Y5VA 3JTSB 4X4YB 4P4RA 1BZQK 3ROLA 1I1FB 1QA9A 3EYQD 3G5VB 4YNYB 5EU4B 4F33B 1KIUA 1QBLL 1KJMA 1OP5H 4K3JL 3STLA 4ZS7H 1E27A 3QCVL 3DX8B 1NH6A 1MPAL 2H26A 4QRTA 3O6FA 4LLMB 3TO4D 1WEJL 2FZ3B 2IPTH 4O9HL 5LCVL 3G5YA 4ZXBC 5JXEA 4HS6B 4PY7A 3VRLF 4Z5RB 4XNUL 4F7MA 4UT6H 1UM6H 4U1SA 4WFHE 3BP7A 4LBEB 2X70B 1XEDA 1VHPA 3D6GA 5I1GH 1B0GA 4IMLB 3BDBA 2QADC 2HT4C 3IDYC 4W70A 3KNBA 5LGJA 1FVCB 3JWNC 1PY9A 5HD8D 1JFQH 4FRWA 2DQCL 4KJPC 1X4ZA 3CDGB 3BKCL 4LPUA 2UVFA 2AK4E 3THML 2A74A 4G8IB 4YHOH 1R3HB 2FR4B 1G0XA 5C2BH 3KPQA 4FNLH 2BFVL 3FFDA 1AJ7L 4HXBH 5T1KA 3K4AA 1B3JA 1H3XA 1S7WB 5EZJA 4RMRA 4XBEL 3QDHA 4KROB 3QIWD 5I73C 1GZQA 1P7KB 2DWDA 3EUUA 1I1AD 5DHVA 4RFEA 3GMNA 5DD1H 1A6UL 1YEDB 2DMBA 4X6BA 4NRXA 5DUBB 2D03L 5KSVA 3QA3B 4UDTA 5D8JL 1D6EA 5L2KA 1Y6NR 1LMKA 1CE1H 4PLNC 4KDTA 4M1DH 5B3NA 1J18A 2EIBA 3FRPA 2IG2L 1N6QL 3ZMRA 5JXAH 5EC1B 2CDEA 2OL3H 1ZLVH 1Q9OB 3QZWA 3SDCD 3GSXB 1PX3A 1UT9A 4KKCD 2FB4H 3L7EB 3MC0A 2ZJSH 4UV4L 4APQB 1X7QA 4ONFL 5D1XA 5I1HL 5H37G 1OP9A 1VGEH 2V17H 2VERN 2NY4C 3TN0B 3PJSA 5B8CA 2N4IA 4JKWA 2MJWA 1A4KA 2W9EL 4IS6B 4O2EA 3QCUH 4MB5A 4AQOA 1LVEA 2CXKA 4PJHA 3KYOA 3FT4A 1FLRL 4XBPB 3IU4L 1H3PL 5CIPH 2MCPL 1N64L 1BVLB 3KDMB 4OJFH 3WE6A 1QRKA 3UTTB 5KBNC 5F70A 5HPMA 2DQUH 4NSKA 3TZVD 1AIFB 5D2LE 4PJIF 1XF1A 1ZS8B 5GRZA 1MCWM 3MCLL 3ARDA 3CSGA 3I6KA 1ACZA 2AEQH 3TO4C 1RJYB 1U42A 5JHDE 1OF2A 4KV5E 3MRKB 4YHIB 3T8XB 4EUPB 5CZVH 1MJ7H 3HZKA 3C6LD 4Y8DC 3VD4A 5GS3A 2OQJA 2IH3B 5C9JA 5J1AB 5ILTH 5IGXH 3NIDE 3OB0H 3LEXA 1X5LA 3QUMH 4L8BB 1CK0L 3T2NL 1PKQB 2GY7B 2O5ZL 4JM2F 3BAEH 2R4RH 1HHIA 3P4NB 4Y16B 3ZSTA 4M6OL 4RQQA 3O8XC 5DK2A 4KMTL 1IGYB 2Y5TB 1J5OL 4L1HA 4NO5A 2ZUQC 3FO9A 4RGNC 5IBTH 4CW1A 2X4NA 4PJ9C 1T66D 4WIQA 1DBML 3GUTB 2VDQL 2H2SC 2WW8A 4NFDA 3F8UB 4QCIB 5ETUB 1AC6A 3MBXL 3BZ4B 4CKVX 2X4RA 3EOAB 5ACZB 3C5SB 1YQ2A 3SKMB 5ID1A 3FOMB 1A1OB 1LO2H 2Q8BL 2VXSL 3G08B 5ESQA 4JDVB 5F21B 4JPWH 1UYWL 5I66A 5IEKB 4YHMH 4NO2B 1K5NA 1I1AC 1UKSA 3VE0B 1QFUL 5HI3C 4TQEL 3NIFF 4WDIB 1A64A 4HIIA 4O58H 1MY5A 2W9LA 5H35A 3LKQB 2R2HB 4KC3B 1KLUA 3TA3D 2FO1A 1DR9A 4CGTA 5SX4H 3SDAD 3LMJL 1C08B 2PYEE 5GZND 2WP3O 4MYWB 2Q87A 3TWCH 1G0DA 3MYJA 3VFTA 2P48B 4OLYL 1D5MB 4RGOL 1KIRB 3TCLA 3V4PH 3MRQB 5K9OA 3NZHH 1NEZA 1ZT7B 4KVCH 5KOMC 4ODUA 1WIPA 1T0MA 3DV6A 4EOWL 3FQTB 4QOKD 1F90L 5D72L 3KYMA 4XH2B 5C3LD 4UIKH 4POZC 5DUML 1GJIA 1A3LL 1AR1D 1WFTA 1CT8B 4OFIA 1PKOA 4ZD3H 4GAJH 2BNRE 3FO0L 4PRAB 2KPNA 3GSWB 3F7VA 3OSKA 4IRSD 4PJ7B 5EOCH 2Q76B 1OB1B 4M02A 4X6CB 3ULUC 3Q6GH 1XR9A 2FLRT 4HJJL 5CBAB 1TITA 4X9IA 3WDIA 4FXKB 4GS7B 3VXOA 1UADC 2EDFA 2WNGA 3LKOA 3TH3T 5T1LB 8CGTA 1MI5E 4OCYH 5C6TH 3CJJA 2EYSB 2H3NA 5KSAD 3C6LC 1DZBA 1CFNA 4R26H 4XMLL 4OFPA 2VLKE 4Q0XL 4WO4C 3CVHB 3FQWA 2CQVA 4U1MB 4CVUA 3UPCA 2AK4D 5C0FA 3RZCD 4LARL 5FA4B 4KJQD 3I2CH 1DDHA 4NJAL 4TUOA 1SEBA 1I7RB 1LE9A 1XGRB 2MHAB 3VG0L 3TIEB 1EEUA 4ENED 4KK5D 2YA2A 4WV1A 5C0AE 4XNQB 4G6AC 2MQCA 4PREB 4TUKL 1MF2L 4GRWF 4LLVA 3TO2B 3FB8A 4JFXB 2EDNA 1R3IH 3DI2B 5BMFH 4JFQB 4YJZL 4GMSH 2VMFA 2BVPB 4KQ3L 3KPNA 1RUQH 2R9HD 3OF6A 3B8YA 3QJFB 3L1OL 1QLEL 1QSFD 1DBJL 1I7UB 5F1KC 1JGUL 1V3JA 3BP5A 4M48L 1JL8A 1D7FA 3BSZL 4NKDB 4YXKL 4PJXA 3BFOA 4FQXA 1JWMA 5ESAA 1N2RA 1FBIH 3V2AR 4GRLB 5BV7B 1RJLA 5GZNC 5IT2L 5AEAA 4D9LL 1N3NB 1LP9A 5F72S 3RX5A 3HG1A 4LRIC 3GMLB 1UWGH 4U1HA 5DMKB 1BFTA 4I0PC 5TH2A 5FYKL 3H9HB 1N6VA 5KSBE 1FORL 1IC4H 3B6SA 5INCA 4K3EH 3TIDA 4JFZH 4ZMAT 4YPGA 4P59L 4L29A 2IFGA 3MLSH 2J88H 4P23D 4WW1A 1JGDA 2ICCA 1YEHL 4N9GB 5I0DA 5SWSA 1A5FH 4LGSB 4MA1B 3C60C 3KPSE 4K3HA 1QRND 4BUGA 2P42B 1IGFL 1S7VA 4KPHL 3FZUD 4F80A 3HI1B 3SJVB 1BGXL 1CICB 3DYPA 2DM2A 4PJGA 1S9VA 1CF8H 5DD6A 2R2EA 4OZGF 2IFFL 3FB7A 2PTVA 2E6PA 4ELMB 2QQQA 5JHDD 5CHNA 5EDXA 3VXME 2BVOA 3S5LG 2A9NL 1L7IL 1AD9B 2AAVA 5F71A 4NUJA 5EOQH 1TETL 4P46B 3TJHC 4Z7VA 5FYLL 3ESVF 5I74C 4BH7B 2JJWA 4L3AA 5I8OL 3UTPD 5MEND 2PW2B 1OAYL 2V2WA 4Z0XA 3JZ7A 3TT1H 3SE8H 3IAPA 4N0CC 2ZOLA 1KNOA 3U36B 4NT6A 4NZUH 4Z7WB 4PLJD 1P9MC 2XZQH 3L6FA 4XCYB 3EFFA 3ZKND 2WWMC 4JZJB 2CLRB 4IDJH 4QO1A 2EDLA 3HMWL 2XN9A 1NAMB 1JI2A 4NKIL 2W65A 4OLXL 5I1CL 4UINL 1RZ8A 1TVHB 2FEDC 1RSFA 2Y36L 4L3ED 1MJJA 3GMMA 4ZAKD 5D93B 1ZVHA 4QY8B 1EAPA 3UO1L 1HKLH 1HNGA 2GQHA 4QTHA 4X6DE 1YQVH 5C08B 3LKNB 4NUGL 4DKFH 1A2YA 2HFGH 4GRMA 5E6YA 1EZVY 5MEOA 2GKIA 3QIUD 2X4TB 4XHJC 3QUMA 3RAJH 3H0TA 4LPWA 1YNLL 4MWFB 2ZG2A 1G7IB 1H15A 5DDHB 3CFCL 4JAMA 5EU5A 2F53B 3U9PH 5DMJB 2V2TB 2IANA 1FNAA 1YYLH 3HA0A 4JG1L 3JTTA 4K07A 4Z7UF 3ULUH 3VWKC 2NY2B 5A40E 2WIIA 3HAEA 2APWA 2EZ0C 1A7QH 4GQPH 3VD5A 5KVMC 5EC2B 5CILL 4ZNEA 3VA6A 1HWGB 1G7QB 5E8OB 1T1ZA 2CD0A 4MA8L 3N85H 4OFYA 2XY2A 2HP4A 4N9OB 2O61A 3BGFC 4P2QA 4JR9L 5HVFB 4BH8A 3DX9B 2QKIA 2F15A 2VE6A 5E4EB 2DQFA 2HJLA 2VH5H 4HUUB 4PTTA 5J6GB 3PP3K 2F8VA 3EJYD 1GGIH 3U46B 1ACYH 4DUWA 4LK4A 1G6RH 4XNXH 4JO3L 1QFOA 3IDGA 1EEQA 2QQLH 1NGZB 3BOVA 5IBUG 4Z77B 3DX7A 4OZIA 2BVTA 4HJ0D 3FFCB 3EJJX 4O2CA 3GHEL 2M2DA 5GZOD 5FHAH 3IKCA 1F02I 4O51B 5DVOA 5C0DB 5TJWK 2AKRA 3QEQE 1JWUA 1JNHB 1T1YB 3QRFM 5D6CB 2F58H 2FHCA 4U6HB 3F7PC 4RMWA 3JWOH 5C09E 2YPLD 1BJ1H 4ODVL 5EUKB 3T4AA 5DUPH 2CR3A 3GHBL 5F96L 1I1YB 1KPUB 1I8LC 1SMOA 1YEGH 4G8GA 3RVVC 4X5LA 1DQQB 3FKUS 2EDBA 4CMMA 5I0ZA 3LSOB 5ISZB 3JWDC 3GM8A 4J1UB 4DKEL 1L0YA 2AQ1A 2BOCB 4WFED 1CS6A 2VDOL 5GRXG 4HWZB 3NIGF 3ZE1E 4P5TB 4FG6D 1ZK9A 4K2UH 1L7TL 3GMRA 3KXFB 3U4AA 3EO1A 1AGBA 3CSPA 3O41B 5CD3B 1GZPA 3OKLB 1BFOA 2A9MH 2HLFC 2XQYK 4P2RB 2JB6A 2NY0D 1GHFL 4K9EC 1JGLH 4BK4A 2VLRD 1VGKB 4NNXA 5LGHH 1JTTA 1MCOL 4QXWA 1LILA 3QIUC 2AXHA 3PWVA 3PQYA 4WU7B 4HIHB 4YHPA 1U8JA 4Y2DC 2ATPA 3TFKC 1T1WA 2JTDA 2APBA 4R3SA 1R3IL 4NWTH 3L5IA 3H9SD 2NYYC 1PQZB 3ZYZA 1H8NA 4DZ8B 2X7LB 4UUJB 3D0VA 2C1OB 4L1DA 2XFXA 3BJLA 1EHXA 4XVUC 4WI2A 4PG9A 2UZIL 4MD5A 3Q6FA 5JQHC 5HYJE 1QO3A 3KPSD 3T0BA 3RJQB 4PRIA 1EFQA 2XRAH 3QG6B 1I7ZB 3QDAA 3MOBL 1IEAA 5FV1L 4PJDB 4RRPA 4X5WB 4FFVC 5ICZB 2BXZA 3R06B 3JBG7 3N9GH 1A6VL 1YYMH 3EYOB 1QUNA 2MTPA 1P4IL 5BJTB 4BFBD 3LPFA 4X99A 5FYJU 2B5IB 1KJ2H 5FUCC 3JV6A 5I1LA 5E9DB 1A1MB 5I1AB 2XZAL 2YSSB 3HNVH 4ONGL 5DJDA 3M1BA 3QCTL 1CR9L 2A2QT 2AXFA 4EXKA 5CBEA 5HXMA 2ARWA 1IGIL 1MFDH 3X13A 3OXSA 1XH3B 2NXZD 4ODHL 2CDFB 3WFBL 4FOMA 3EGSA 1INDL 1A7PH 3O81A 2NZ9C 4I4WA 3V52H 3SOBH 4QRSA 4ZUWB 1T21A 1XF5B 4FQ1L 5IB2A 1R6VA 3MGTA 2BVQA 3EO9L 2A6DA 4RFNC 1BIHA 3HR5B 4AM0B 1OAQL 2WANA 5F1SA 2VZ1A 4NN5C 4IOSD 4P5KA 5E6IC 1K4DB 1YY8B 4GBXA 3INUH 1UG9A 5D7SL 3QDJB 4DFIA 2XICA 4DUXA 4QRRD 2NX5E 4MX7A 4J4PD 3DOSA 4PP1C 2DDQL 3FQUA 4J7RA 4XZUB 1FJ1B 4R8WH 1T7XA 2XG5A 3UDWA 4AZ8A 2F54D 2R0LL 1IGCH 3DPBA 1DANT 2ZG1A 3EOBA 5D2LF 2V2XB 2EDEA 4PJBE 2APVA 1VERA 3KWWA 3RIAK 3QXAA 2YKLH 5IQ7H 3MOAH 3MA7A 3S35H 1V3LA 4KV5F 4L4VB 3ROLB 2GK2A 3TPUB 1G6VK 1MH5B 5IVZB 5EBMA 1OY3B 3NIDF 3DO7B 5MP6L 4EI5C 3QDMD 1MHCB 4PGDA 5EIVA 5HGBA 3V0VA 2Z9TA 1FAKT 4DZBB 5IMMA 4WI8A 3BGAA 4KU1A 5ITBL 2C3VB 3SHSA 1GAFL 2OTWB 2P8MB 4UV7L 2W0FB 3G6JE 4OD2A 3MJ9H 3GGWA 4O2FA 5EO0B 1FZKA 4U1SB 2ZP0T 4UU9A 1EZVX 3QDGE 1P7QA 4ZO6A 4PJEB 3PL6A 4OLZL 4TVPH 4IBLT 2Z8WC 1QTYT 1FZOB 1OTSC 3HC3H 2UWEB 3BPOC 2EH7H 3O2VH 3D3VA 1ZHLA 4WENB 4YC2C 5JR1H 1D5XB 3QIBA 2F74B 3IFNH 2FO4A 4CAGA 4L5FL 2EXWC 4K9EH 5CJXC 1NDMB 1FIGL 4JRYA 1J9CT 3RRQA 1S9YB 4ODWB 4OCSL 4MNQD 5HHOA 4DCQB 1XGUB 3RWHA 4ONHB 2PO6A 2W1NA 3RI5K 4KVNL 2QLVB 4WFGD 4JHZA 4BK5A 3ULVC 1RIUL 5BOZG 5J57B 1HWHB 4C4KT 4FTVE 12E8H 4MNGE 4AMKL 5FUOL 5LXGL 4RGMC 3A6CH 3WNMA 1ND0A 1LD9A 3H9YA 3MLYL 3ARFC 4R4BA 5TDOB 4XAWL 1ZSDA 3VXTA 1KN4L 5K9JH 2RGSA 5KS9A 4LMQI 5T5NG 1X5GA 1GCFA 4MDJB 2J5LC 4X6FA 4CVWA 5HHQA 1XIWA 4TNWF 3MREA 5IVXE 1LO0H 3DUUB 2IAMD 3GI8L 2HTKC 4OB5L 1QSED 4LCCC 5FKPA 2HVJB 3CFBB 2YMXH 2QJDA 4GG8B 4M1GL 2JJSA 3WMSA 3KYOB 3R4DA 3VXNA 3NGBB 5D5ME 3BHBB 5F1IB 5ESVA 4M4RA 3WFDH 3VXUB 3GIZL 4FQIH 1NUFA 4X5XA 4WI6A 2DWEB 4JFED 5DRXA 5L9DL 5JDSA 3CUPB 3SDDC 4HEME 4URTB 1CU4L 1RJCA 2AJXH 2AJ3A 4XXDB 3LHPL 1HEZA 4ZFGL 4F15C 1RZFL 4NKOA 2DLFL 1B4JH 1FH5H 1JI1A 1WWBX 2YUWA 4WJ5A 3VI3E 5DT1L 5IFHL 3VFSA 3GJFK 3QWQB 2P24A 2C1PB 2QL1A 1NJ9B 2QHLA 2EIZB 1JE6A 4PPTA 3QFJA 3WSQH 1GPOH 3RTQD 5FUZH 3VDBA 1R5IB 4KTEH 4MA7H 4WW2B 3MJ7A 25C8H 4UOJA 1F6LL 1S7TB 3PG2A 1KIQA 4LCUA 3SGJA 3RKPA 3VXRB 4P3DA 5E2VL 5FCUL 3PGCA 3X3GH 1K6QH 5C1MB 5E2TL 4ZO7A 3QUXD 2OS7A 4PB0L 4XNMB 35C8L 3BYTA 3T2PA 3BMWA 2X4SB 4PJ8C 1N7ML 2A6IB 2JB5H 4NWUH 3AREC 3O11B 4R0LC 5DHYB 4XNZC 1CFQA 1WTLA 4HIIB 5TE7L 5JQ6L 3HB3D 3QEGH 2R69L 3HI5H 2IBZY 3HE7D 3P4MA 5ANME 9CGTA 1KEGL 5D1ZC 1KJ2A 1T89A 1U2CA 3R1GL 4KUZH 3EJZC 1OL0A 2IMNA 4Y4KD 2IADA 4HK3J 1T83C 5ALBL 1EHNA 2VLJD 3BZEB 3RKDD 1AH1A 3RGVC 1HYSD 3MTRA 1YC7A 4LEOA 2QHRH 4HGWB 3V5KB 3V8OA 5L2KE 5I8CB 2NCMA 3BUTA 4J8RA 3CLEL 4KK6D 3GO1L 5IB3A 4MQXD 3BRGC 1MCHA 1Q38A 3U6RB 3EYVB 1WITA 4LLWB 4MAYC 3CDYA 1I8KB 2ADGB 5DJAB 4G42B 4X7SH 3E2HB 5L7XL 1JF1B 1IEBA 5C0EA 2X10A 1UM5L 4GG6A 1MRDL 1I85A 4AIXA 3RY6C 3F12B 3PHSA 4YHLL 3ZKXB 3VFNB 1OGAD 1DUYA 4UI2A 4DN4H 5EH1A 3ULVH 4PJHE 2FJFB 1UZ8B 2Q6WB 4RBPK 3UXFA 3CAFA 2VDNH 3GBML 4XP1H 4TNVF 2VZ3A 4XP6H 1Z3GH 4NNPL 2GJZA 3H3BC 2QQNH 2R39A 4Z8FH 2ITDB 1BD2A 2DRUA 5CSBA 1XGTB 3HUJB 4TTGA 2NZIA 2WWKT 1FL6B 4PGEB 3SCMC 3SE3C 2EYRA 3S5LB 2YC1A 3KYKH 3MA9H 3FQXA 2VIRA 4X6DF 3PWJA 4FABL 2WAHA 3BD4A 1MFAL 1OD9A 3QQ4A 4YDVA 5GGRA 2P5EA 1JZ2A 4ZODA 2K1MA 5GJTH 5FGBA 5I16B 4GXVH 3QUZB 4U1IB 3V6FB 1IM9A 4OUOA 3UC0L 2DB8A 2W0LA 3MLWL 1XCTA 4I3RL 1E4WH 3VRIB 4M93C 4E42B 4LCWB 2ZUYA 3BD3A 3C08H 2HG5A 3FAWA 4XTRD 5GS1A 3U0WL 5ADOH 5LJYH 3V6OA 2G9HB 3TNNA 4PR5A 4HWEL 1QPPA 5DZNA 4MDIA 5TPWH 43CAA 1R0AH 3U1SH 3NZ8B 4HS8L 5TF1L 4PGCB 3WS6C 3DVNA 4ZTOL 1X6NA 3KPPB 3C5ZC 1J0KA 4CMHB 1AXTL 2YK1H 5H2BA 5D1QA 3SBWC 4AEIH 1AO7D 3BDYL 3VXSD 3SQBA 2VITA 5IJKC 1W72H 4C56D 2XI9A 3D85D 4S2SB 3Q1SL 5KJRL 2RCSH 2IJ0C 3QNZA 3RIAF 3HCVB 2VJXA 2AJYL 4KY1H 3SY0B 5DC4B 3BRFA 2BNQB 2X89D 4IJ3C 1LEKA 1MIEL 4LOUC 5D7JC 5I75B 4JN1H 1A1NB 1YDPB 3L3IB 2D7OA 2VB5A 3NOIA 1VESA 1FCCA 1T2QL 2ICEA 4JM2C 3WL9A 4XWGL 5MEPA 2XKSA 2G60H 1UVQA 2R23B 4WWKA 3CFKA 2Z31B 4K7FA 3DWTA 3JV4A 1J05A 3TM6A 3ROOB 2XTJD 1EGJH 1N59A 1NBZB 2OL3B 4FMKA 5CHNB 4CVZB 1KCVL 1KTDB 4HX1B 5KZCD 2DL2A 1ZLSH 2Y1VA 5C0CB 3RPIB 5FA3B 4P9HC 1JV5A 1A4JA 4X7DC 2RFXB 4XPBH 4Z7VB 5C0JB 1RURL 4Z95L 3WLWD 3LD8C 3ZE1F 3CFJB 1TVBB 1CTOA 5T3XH 1JF6A 2WINA 1EFXA 2VRAA 2DQJH 4R96B 5CIPB 4NQCD 4LKCB 3OHXB 1OTUC 3T1FA 1DQLL 1QFWH 1NGXB 1YECL 4AIZB 1N5YL 2AJZB 1OTTC 4NQDA 5DD0H 3UBXG 3BO8A 1TZGL 4WTZA 3RI5F 3ARGB 3WIIL 1RZ7H 3BWAB 3U0TA 1JYXA 4YBQC 2YD7A 3MLZH 1WZ1L 3OKEB 4LRNL 3LN5A 4KRPB 3G6DL 1F58H 1NC4B 4M5YL 1NCBH 3JV5A 3ZT6A 3RWIB 1DN0B 1HSBA 2NY3B 2VR9A 3QUMB 4G9FA 1QYGL 2H8PA 4OQTL 5K9KB 4JFFA 4XPAL 4E0RB 2Q86A 2R1YA 3FB6A 5F44A 1MOEA 3CCHA 1SQ2N 4HMDA 4CN6A 1ONQA 3F65A 5EZIL 2H32H 4E41A 5BCAA 2VQ1A 4OQTA 1DCLA 2FJGA 4FMFA 1E4XI 3OKMB 1DBKH 4P9MH 4PS4L 2FD6L 3HZVB 3EYFA 3DXAE 3DJ9A 1A8JH 1ZT1B 2DYPA 3PV6A 4PJXE 1QOKA 4KZEH 1PBYA 4DKDC 4U2YA 4FQCH 2VXUL 3GSOA 2R2CA 1IGMH 2EDQA 4AEHH 4U1NB 4YHYC 2CJUL 1BIIB 1R24A 3HG1E 1AKJD 4OIBA 4GSDL 4X0KB 4LPYA 2AXJA 5CJOL 4TSCL 4FQ2H 1G7MB 1AGDB 4RNRB 2IBZX 2J8UB 3HZYB 5FO9A 4JQIL 4QHKI 3HS0A 2XXMB 4H5SB 4HUWA 1I75A 1C12B 1HIML 4ZXBB 4YHZL 2FX7L 2BCKA 5HHMB 4ZFZA 3H7BA 1E4KC 4HWBL 2CXGA 4OLUL 5SWSE 1IM3B 3IGAB 5FYKE 3NAAH 3T0ED 1CN4A 2BSRB 4JHBA 3HRZA 2QADB 1I9RH 4PJGE 3IF1B 1NGQL 4DVRL 4XAKD 1TJIL 1G9EA 1J0IA 4HWBA 3T4AB 1OAUL 3EYUH 3LAFA 3CD4A 4F37K 2X4PA 3MO1B 4ZQKA 1WC7B 4O4YL 5DO2C 3H3PL 4NO0D 4X7CC 1ZVYA 4LSUL 4EN3C 1RK1A 3FOLB 2I26N 2ZSVA 3IRZA 1ZGLP 5FGCE 1DQJA 4Q6IC 1XMWA 2YPVH 3QEHB 4NRYA 4AIOA 2HN7B 2Z35B 4G6JL 4PJBF 1E6JH 4EDXA 5C0IA 5I73B 3MRHB 2VL4A 4H1LA 1GSMA 1I4FA 2AEPH 3DECA 3HKFA 4D0CA 4J3SA 4WUUB 5T5FH 3VFPA 5GRJL 1U8KB 5EOTA 5FYLE 5JORA 3KJ6L 2DLIA 2WUCL 1X5KA 3UBXI 4ZOAA 4UZGA 1BZ7A 1MEXH 3MFFB 3GI9L 1A6AB 5K59E 5C0RH 2XN9E 1U8LA 5E00B 5IVOA 4LSTH 3G5XA 2YD4A 5GRWA 3BEVA 5DWUH 3OV6A 5IMOB 3ISWA 4CJ1A 4QXTB 3BPCA 3FT3B 3PP4L 3G6JF 1PZ5B 3IFPB 3VWJC 1LDPL 5LVEA 3LV3B 32C2B 4MQTB 4P9HH 4TPRL 4Y88A 2NY4B 5GSRA 1S5HB 2WBJD 3O4LD 5L8LB 3QH3B 1J0HA 4BM7A 2DMCA 2NTSP 2A77L 3IRPX 3NA9L 2O93L 2P5WB 3FCTB 4DN3H 2NY6D 8FABA 4U1GC 1QFPA 4U1LB 3RPKA 1HK6A 3IVKB 1CLOH 4HMCA 2IGFL 5DRZA 1FAIH 1HHKA 5IQ9A 3S37H 4M8QB 4W4OC 5M7QA 3KVQA 4RWYH 1S7XA 5L8KB 3S8WA 5CP7A 1JZ3A 4YAQA 4G6FD 3O6LH 4G8EB 5I6XC 4QWWD 1A7OL 2ARJQ 2OTUA 3GIVB 2H9GB 5TGBB 4N0UE 3MCG1 3MV9B 4ZOBA 2AJUL 1VPOH 1JWSA 1MHEB 3T2QA 4DQOL 3GBLA 4HHAB 4P2QE 2GIYA 2R2BB 1QR4A 2D9QB 1Q9WA 5I1LB 2QV2A 4HH8A 3V0AC 3CLFL 5JOPD 3V5HB 1KT2B 3G04B 4ZUUB 5GS2H 1JRHH 3MQIA 4YQXH 4ZFFB 5GQBA 4P0DA 1KB5L 4XCEA 1EBPA 3RIFK 3MNZA 4L3CB 1LO4L 3OKNA 3CXDH 3O8XB 5F93C 2B8OT 4HIEB 5GSVB 1A6ZA 3GM0A 2ZUQB 4HBCH 1BFSA 4RGNB 4OZIE 3IDMB 1ZLWH 1KB5A 1VACB 4PJ9B 5FB8A 3U2SB 2DQIL 3PE9A 4HT1L 3TC9A 3MRIA 4JM4H 4JO2H 4NCC2 1HH6A 5ECJE 3V7AE 2ENSA 3UTSA 4YH6A 5IVXF 1OW0A 3U0PB 4RISL 4DOHB 5DK0A 4ZYKB 3QSKB 5EIIB 2PXYD 3MV8A 3IDXL 1MVUB 1MJ8L 3SGEH 3DO3A 2O5XL 4PV9A 3MODL 4K8RL 4KJWC 4WEUD 3QI9D 5D5MF 1ZHNA 3ZLQC 1WFOA 2A73A 1HHGA 2OSLB 2ITCB 2Z93A 4MB3A 1FNEA 5FDWB 1JZ8A 4G8GE 1HE7A 5B38B 2VSDA 2GTZB 4JO1H 5SX5H 1C16B 5D7IA 1BAFH 1DVFD 4GMTH 5E1HB 3GSNH 1NCDH 4N0YH 1A6WH 3D25B 4FZ8H 2V5RA 4ORGA 3VI3F 2OMNA 3ARRA 2FBOJ 2M8XA 3DXAD 4LSSL 5DR5H 3OZ9H 1X4YA 1CLYH 4JFPB 4G8FB 4XCCH 3L9RB 4PGDB 5EBWA 3V0VB 2HRPH 1Z5LB 4V1DD 4EIGB 1U3HA 1FGNL 1AGCB 3PQYE 4CN4A 3N1FC 3L3HA 4Y1AD 4XX1E 1S9KC 1FIEA 4J2XA 4IRJD 3GGWB 2IALA 4QT5B 3CZFA 5FO7B 1OSPL 2EDYA 4OZHB 2R15A 4RA3A 4YDLC 3I3BA 1TTGA 4DGVL 1IEHA 1KLGB 2DD8L 3PWUA 3MV7B 4UB0H 4NJ9L 3MLVL 1NL0H 4ZTPH 1TQCC 2B4CL 5DZOA 1ZHLB 1G7JA 3FT2A 3HMXH 3K2UH 3QWOB 4MXVF 3HPLA 4XP9L 5IFJB 1QKZH 1NGWA 4PRIE 4OCRL 2OLDA 4PY8I 4NP4L 3WEXA 1W2KT 1P4BH 1JNNH 2O5YH 3HE6C 1LE5B 1FYTA 1SBBA 1CI5A 4XVSL 4WO4B 5EUOB 1KELH 1M71B 3FQNB 4IIQB 3WUWA 4DVBB 1S9WB 4CNIB 1BMGA 2J8HA 1GC1L 3CDCA 4ZNCD 2WMPA 4GH7B 4PJCA 1XF2A 3PIQB 3QHFH 3WFEL 2XPGB 2FSEB 1X5FA 1XF4B 3F7RA 4PRDB 3DGGB 4ZUTA 4JRXD 3I84A 3WDJA 4UBDD 4K71C 5GS0D 3IB4A 1ND0B 1G6RB 4AH2A 3BP6B 4L9LC 1LD9B 5F9DC 5C92A 2JELL 3WFHA 2VDRL 2I27N 2GT9A 5ICYB 1U6AH 3OKDA 3OB0K 5AUMB 3WJJC 5BZWA 2CR6A 1NMAH 3TV3L 5IWLA 1DFBL 5DA0B 1P5UA 2EO1A 4OAWA 4U6YB 4F9PC 1OHQA 3AXLB 4X6FB 4JN2B 2GUOA 3NFSH 3TT3H 1E28B 1RJZA 3UJTL 1Q72L 1CG9A 3C5JA 3G9VA 4ZPTA 1WBYB 3TVMC 4BJLA 4BQ9A 1F4XH 1NLBL 5DK3A 4LU5L 5D7LB 4NGHH 3RVUD 4HG4J 5CJBA 4Y19A 1JF5A 5D96C 3S35X 2P8PB 3X3FH 4JLRB 3T0DA 4PJHF 3MRGA 1WBXA 5L6YL 1YPZA 1YC8A 1WWWX 4PP2B 4I0PB 4M7ZC 1MWAH 1Y0LB 1VENA 4ORZC 1CE6A 3WNKA 1R3LA 5JDSB 4H25A 1NC2B 4OD1H 4A2MA 2X4QB 2F5BH 2AV7B 3VCLB 3OB8A 2R8SL 5BVPH 1B9ZA 2NW2A 5KTEH 3VXQA 5CINH 5DD5H 2XA3A 3O9WA 2R0ZL 2Z91A 4OLWL 3O45A 4B7IA 2VABA 1B0WA 3UAJC 3VU2A 3WIHH 2DOCA 4KROD 5I30H 1RUPH 4HH9A 1AI1H 3CSYB 4V2CB 1RVFH 5CGMA 3UPRA 5GGUA 4YEEA 4MJIA 2ARJB 3HLAA 5KOVC 4NHCH 2BY1A 2OJEA 1KLFA 1QLFB 4M62H 1YUHA 1A7BA 5FYJD 2L7JA 3SO5A 1D5BA 4LCUB 1KPVB 4CN1A 1FGVH 2A6KA 1S7QA 3PGCB 1KIPA 3CFEB 1MFEL 4APQD 3IAQA 2VAJA 4L8CB 2YRPA 4ETQA 1VFBA 4PGZA 2FX9H 4F37F 5BRZB 3GJEA 1BQUA 1KTLA 1EEYA 2IF7A 4LLYA 4X7EC 3TN0D 1SMAA 5MI0C 2QBWA 5BO1L 3B3IA 4YWGL 4U3HA 4G5ZL 4KXZH 2CGRH 1OVZA 2YUZA 1T2XA 4I18A 1GOFA 4KI5C 1BM3H 4YXHL 3HPJA 1I3GH 4UBDC 1I7TA 4JRYE 1RZKL 3OAUH 1Q94A 1KJ2B 4XMKL 5LG1A 5F9JB 3A67L 3MBEA 4KHTH 3WLBA 3HR6A 5HHOE 3S88H 5ERWB 1MLCA 3D39A 1OARH 5DQ9B 1M7DB 3ARBC 3NTCH 4KHXL 4JFHE 4X4MA 1OT2A 5C07A 2UVEA 5DRWB 4LPTA 3GMQA 5EU6A 2BDNH 4IHOB 3T0AA 4YX2H 3VWKB 3DBXB 1TVDA 3BN9C 2ESVA 4XPGH 3SKUD 5KAQF 3B9KC 4O5LL 4YE4L 5KS9E 2JK5A 2RIKA 4Y16D 1FVDB 3HNTH 3S9DB 1FNLA 2WSKA 3BGFB 4LQFL 5CEYB 3ECBB 5C8JA 5MERB 3CZJA 2J3SA 5C7XH 4YDKH 5T3ZD 4LNVA 3MGOB 2I60L 5DJCA 2F5AH 3RX8A 3MRPB 5GISL 3JUZA 5IM7A 1VEOA 3OR7A 4Y4HA 3PGDB 4HC1H 2E8YA 2J4WH 3B9VA 1V7MH 4XMPL 5IFAH 4XHQA 3GSNA 1A9BA 4ZPVB 2FBJL 5M95B 4XB8A 1EERB 5C08E 4O02L 4UDUB 4M6NH 1AD0B 5E8NA 4PJ5A 1RK0B 2D31B 5F88A 1DQDH 5JLZB 2CPCA 1A02N 3ZDYE 1IAII 3A6BL 3L95A 4EJ1C 3QFDA 5IW1B 3RNKB 2CO6B 2CIIB 5F89B 3VD3A 2VLMD 1WFNA 4S1DC 4MHHG 1YZZA 4JJ5A 4D0DB 2ZKHL 3D5OF 3FN9A 2OZ4L 4Q2ZB 1N5AB 2JE8A 4W81A 1IL1A 1NDGB 5HDQH 5F7FA 4PG2C 3RHWK 2Y5EA 2YBRB 3TO4A 1F8TL 1HOCA 2IQ9H 3UBXB 1GGCH 4M3JA 2OZ4A 5HVGB 4PRPB 3M17B 4PJXF 4WHTA 4WEMB 2IBBA 3MLXH 4A6YH 3W82A 1KCUL 2DM3A 2QEJA 1HZHH 2XKNB 1LP9F 1OAZH 1TMCB 5IMKA 3NN8A 1R3JB 4LVEA 2HLAB 3HC0A 5DVMA 5F8QC 1I8IB 4PGJA 5KG9B 3RNQA 1RUAH 2RB8A 3OJ2C 5T1LD 3VMNA 1RIHH 3BXNB 1DEEB 4Y2DB 1Y18A 4HK0A 3U7YH 4MCZA 5H94A 4JPIA 2ERJC 4F7EB 1EJOH 4GAGH 1CVRA 4QRPB 2AXGA 1UVQB 3QIWA 4Y16C 3T0VA 3T3MF 3S34H 1I1AA 1ZA3A 4PJGF 3ARPA 4UQ3B 1I3RA 2VXVH 2Y6SD 5HHXH 5AZ2L 4EQ2A 1T03L 4YGVA 3LKRB 1V3MA 4TSAH 3BGMB 3K3QA 4PTUA 3WDHA 3O2WH 2Q3ZA 1DBAH 3FTGA 3SDCA 1U92B 2Q7YA 2G2RB 2CLZA 4M7LH 2EC9U 3RX7A 1S9XB 2YWYA 2W60A 3CPLA 4JHAL 3W2DL 1U8HA 4F7CB 2Z4QA 4GG6E 5DTFB 5BS0B 2C7UB 5JW4Q 5GRVL 2CMRL 3BVNA 4GRLD 4MA3A 3SEPA 1MWAA 2VC2L 4KKAD 1UM4H 5GIRB 4S0SD 3SPVA 5HI5C 5DMGD 5K59F 4PGBB 2DQEH 3O6MH 2ORBL 4P4KC 2X1QA 4JFDB 4NHUA 1T3FB 1BD2E 5A3ID 4G6MH 1BLNB 4KK8D 5F9WC 1VADB 3TZVA 1AFVL 3LN5B 2X41A 2N7AA 4RFNB 2H1PH 2CSPA 1VFAA 1ZKAA 1T5XA 4KJYB 2DI7A 4NN5B 5E6IB 5DFVC 1KG0A 3NA4A 2WZPD 5CJQL 4PJAB 4EXPX 3DHMA 3E1F1 1T04B 4HQQH 1B2WH 3MMEA 3SJVD 2P5EE 1CICD 3C6LA 4H26A 2NY5C 4EEEA 1NAKL 2H6PB 5CEZD 1PFCA 2DJSA 2YPKB 3F58L 1QACA 2VQ1B 5A2LH 4NQEB 1BVZA 4QHMB 3V6OE 4P46D 4PB9L 4M3KB 4WU5A 5GGQH 1FV1B 1G7LB 4R90H 3PNWA 5TE4L 3F7YB 1KCSH 1FRGH 4FQQA 1A14H 1MUJB 5LGKA 2DMKA 4HPYL 4JPKH 4M7KL 1IQWH 1J10A 2CKBH 4QLRA 4BSWB 1RQ5A 1JZ5A 1EJ6A 3W9EB 2PNDA 1NFDB 3P9MB 1C5DB 3WXWL 2IH1A 5GJSH 2Q8AL 1HXYA 4HFUH 4LAQL 1BWMA 2CLVB 1G7PB 3CVIH 3BPLC 4P3CH 4CU6A 5IIEA 4OZIF 2BY0A 5E8EA 3UEZA 4K23L 4LVNC 1AXSB 3TBVA 4X8JB 1S7UB 3TA3A 2WUBH 4P49A 3SDAA 4FQJH 2Z8VC 4LKXB 1GVIA 1MNUH 2FIKA 5CJ8A 4QXGH 4WTXA 1RAMA 1B4RA 2CK0H 4Y0GA 4X4ZA 5C08D 4LRIA 4X9FA 1FZMA 4Y5YC 4HKXA 1PJ9A 3BPOB 3IU3B 4RA0C 4YC2B 2J8OA 1C1EL 4XCFH 5CUSL 3SKOB 3DMMB 2AERT 2F53D 3L5WB 1FG2B 4JKLA 1EXUA 2ZPKH 3JSSA 1MFBL 2NY2D 4QOKA 1HKFA 4H0IA 5D70H 3S97C 4HC1L 3RDTC 4XXCC 1CL7H 3PWNB 1FQ9C 1IGJA 3ZT5A 3L5XH 3VJ6B 3LEVH 4HC1A 1UACH 4HJGA 4JFOB 4OCWL 4JKKA 2X44D 4RGMB 4IRSA 2R56H 4QRUB 1K85A 4GKZA 1AQKH 2DS4A 2B0SH 3ARFB 1AE6L 5ALCL 4NQDE 5TDNB 4Z76A 4R4ND 1Z0NA 5IW6A 4WY7H 4S10A 3I3EA 5I17A 5KSAA 1CYGA 2BJMH 3RWCA 3FONB 2J5LB 2VDPL 1ZHKA 5A1AA 3FFCD 5GRYA 3QPQD 1IKNA 2AK4A 3RZCA 5TE6H 2G75A 3Q3GB 2XG4A 4LCCB 3WFCH 4DEPB 4ZG1A 3WHXB 1CD0A 1NCCH 3K4DA 1MCSA 4M5ZL 4G9FE 2WM0A 5TFSH 2OMBA 3DX6B 4JFFE 1V7NH 1UXWB 3O3UN 2XA8L 4BFIB 4LP4A 3VXPB 3T4YB 4ETYA 1E4XL 3DVFA 3OJMB 3IFLL 1MFCH 3RUGA 1CD1A 1JPGA 3SDDB 1QVOB 3NACL 4H8WH 3KS0J 4Z7NE 1QSFA 2X1WL 2MSPA 4F15B 4OF3A 4PLKD 1C5CL 1VA9A 2VDMH 5ITFB 4P5TD 4FFZL 4NM4H 3KPRB 3KXFD 1W72B 5DD3L 2EO9A 4DUVA 3ZKMD 1CBVL 3MACL 5INDA 4P2RD 1R3KA 4KAQL 2V7HB 3EYSL 4JDZA 1WFUA 5I18H 1AQDB 3OKNB 2HKHL 4RFOL 5FM4A 4P2OC 1YEEL 2NY5H 1EA9C 5T1MB 3U82B 3BH9B 4YDIL 2DTML 4X7FC 4NZTL 1CGSH 4WFFD 5EO9B 4HKJA 4Y8AA 1ZA6A 1AGFB 1I3VA 4JHWH 4P23A 2CRIA 1UJ3C 1JK8A 3PV7A 2PF6A 4TYUA 5ABDE 3RVTC 2AJSL 2EE2A 5DQJB 1RZJL 1QRNA 1LEGB 4Y89A 3MRLA 2VR4A 5D2LA 4PJ8B 2NR6C 3RHWF 2VDLL 2PTTB 3AREB 4R0LB 5D6DA 3OAYK 4HF5L 5B39A 5CEXA 2AK1H 3FN0H 3IFOA 1QR1A 4XNZB 4LLQA 3VD9A 1FNEB 2Z92B 3RVWC 3C09C 5JHDA 1DJSA 2PYFA 4YHKL 1S7SB 4ZO9A 4QEGA 3PWPB 1KB9J 5D1ZB 1TTFA 3O6ML 5EWIL 4ODTL 2YD8A 1S3KL 4MD0A 4M6MH 4MLSA 4C4KO 3D1MC 1K8IA 1F4WL 5JW4N 3TNMA 5JA8B 5MENA 5HYSA 3OMZA 4PV8B 3JWDL 4GO6B 1KENL 4BYHA 3RGVB 4ZFOB 5E9DD 1QBML 4PUBH 2YD3A 3ZTNH 1A3RH 1QNZL 5DJ8A 3TF7C 3RWJB 2XV6B 1F3RB 4U6XB 1D9KC 1U3HB 4LHUG 3S37X 1YNKL 4TSBH 3X11B 1WV7T 4G6KH 4MSWA 4MAYB 3L3HB 3QRGH 5D1QD 4P57B 5DC0A 4X9BA 3FHAA 1J8KA 1VDGA 3QG7H 2FECI 4L3EA 3V5DA 2XOTA 4ZAKA 3DROA 4OSUH 4ERSH 4TTDC 2VL5A 2GSGA 2YUVA 4BKLA 1UC6A 3ES6A 2IEPA 3V6BR 2H32B 1BQHG 3QIUA 5DJYA 3QDJD 1MCDA 3AAZA 4LP5A 5D2NA 1HILA 4MJ2A 4P5MA 1U91B 4JG0H 2CRMA 4OF8A 2DQHL 4BQBA 2R4SL 2DKSA 5GPRA 5FECB 4OF0A 1HHHA 4OLVL 2Q7NA 4HKZA 3WD5H 1SY6H 5DJ2A 1KJVB 3MRDA 3SCMB 1RUKL 1XF2B 5FM8A 1P6AB 2VISA 1W8OA 3P9LB 1DLFL 1YY9D 2OR9H 2D7NA 1INEL 3QXVA 5LWYH 1UXSA 2F9BT 4G7VH 2GI7A 2D7TH 2HKFH 2LABA 5F7DA 3MXWH 1F6AA 1HYRC 2XWBB 4L4VD 1MRCH 2H2PD 1WTGT 4FQHB 3WHE0 3U9UB 3B5HA 3U4BH 2GT9B 1ZHBB 5I1DB 5ENWA 3WN5A 5BZWB 4EBQH 1G7HA 5KS9F 1UENA 2A1WL 1S8DB 4NQDD 2Y06H 4YR6B 3ZZ1A 4K3DL 2XQBL 5E08L 2HTLD 2HFEA 3DUSB 4IOFD 3O3EA 4K94L 3C5ZB 2FATH 3OGOE 5F3BB 4PJIB 3LH2L 5I19H 3CC5A 5JDJA 1JNLH 3TBYB 3VMOA 4FA8A 1G9NC 1BFVH 1ITCA 2YPLA 3EO0A 4OV5B 4KZDH 3QPXH 5F7EH 1XT5A 5EFIA 1IC7H 3SDXA 1P6FA 5CMAA 1Q0XL 1FSKB 4IJ3B 4XC3H 3OKYA 5D7JB 5IB1A 3C6SB 1I9JH 4JM2B 1Q1JH 1Z2KA 4GKNA 2OJZL 3WNNA 3ZDYF 3BQUC 4Y5XA 1T1XA 4NC0B 2ADIA 1JN6B 3AM8C 4BZ1L 3MRFA 4KUCF 4CBPA 2A83A 4NRZB 4OTXH 4F57L 3O3DA 2VKXA 5JTWA 4LHJB 1ZWIA 3AS2A 3GNML 4I13B 2VLRA 3FMGH 1ZMYA 3O3AB 4R7DB 1ZEAH 1LO5B 4OGYL 1T6WA 2BSTB 4KTYA 4GW1B 1ES0A 3CFIC 3QO1A 1GGBH 3LD8B 1M7IB 4WGWB 1F11B 3H9SA 3L7FB 2HMIC 1D6VL 3O6KL 3QUYC 4YDJA 1OCWL 4LGPB 2QSTA 1S78C 5KSBA 4NDMB 4JANB 4LVOC 5EORH 5JW4M 5FM5M 3REWB 4Q97A 2BC4B 2Y9RT 3LEYL 1YMHA 4HG4K 3BKJH 4G43A 5C0BB 2E9JA 4I18B 4M1CC 5CZKA 5IBLD 1JUFA 3UTQA 3GJFH 3KPSA 1NBYA 1EO8H 2D0HA 5DI8A 3IT8D 3MUGB 4GW4A 4Y5VC 3GSQA 1CXIA 4RAUB 2MMXA 4U1KA 3VXUD 2WWKO 2ZSWB 4S1QL 1FYTE 5IHZA 1S5IH 1J8HB 2EE6A 3QNYB 4ZSOA 1MQKL 1NSNH 4FQLL 4ODXB 3QO0A 1OSZB 2HFFA 4PJCE 3RA7H 5A2JH 2X1XR 2FWOB 4QTIH 3KLSA 2AGJL 3O6FC 4QHKJ 4OUUA 3ILPA 4N8CL 5E8PB 1SYVA 1Q9KA 1LEIB 4JY6B 1MJUL 2J12B 1DLHB 5JXEC 3WJLA 1PD6A 2ATKA 4LF3B 3K2MC 3I75B 1ZT4A 3PXHA 3V79C 1IJ9A 1RZGB 5HGDA 3DURA 1FO0L 3RU8L 4WUKL 4RZCA 3GSRA 4BZ2H 3FB5A 1J0ZA 5JA9A 2O26U 4TRPH 5J6HB 3LQMA 1BWWA 3VXRD 5KVGH 3W0WB 1FVEA 1FO0A 4DTGH 4GG6F 4WEBH 4MJ5A 3BZFA 4G7YL 4YHYB 1BVKB 5KVEL 1JYVA 1FC1A 5DJCB 1UA6H 1KPRA 4XWOC 4Y19E 3QXTA 1HI6B 2VLLA 4XVJL 4J3UA 5CAYB 1YPZE 3AC0A 4NYLB 5E99H 4QRRA 4CADB 1HQRB 4D8PB 2WV3A 3G6AB 4NIKB 4J4PA 3MLPA 1FLTX 5FM5O 4KQ4H 2B7DT 1AXIB 2JJVA 3H7LA 5IV2B 2F54A 4HDIA 4I48A 4NZRH 4OZ4B 4GRWB 1IGTA 1DL7H 4HIJA 4J12A 3IXAB 4KRMB 4FXGB 1G0YR 5CZXD 4KDTC 1I8MB 2D0GA 2XQYG 3H8NA 4M6AA 3MCKB 1ZTXH 5F9OH 1JPSH 3NCMA 4S1SH 1X5AA 2YXFA 4MJIE 1WZMA 2PCPB 3KPOA 4R4FL 2M26A 5D1XC 4TVSa 4OV6F 3L3GA 2P44B 5B8CC 2G5BB 4EN3B 1CCZA 3CU7A 3QDMA 3ZKQD 2J6EH 2XTLA 3OXRB 1G9NH 2YRLA 5CCKH 3SDYL 2BRQA 4Q6IB 1P4LB 3QUKA 4LCYA 4R6UA 4L4TB 5HI4C 2DQGL 3F5WB 4JCMA 3S4SA 1LO3H 1MAMH 1LK3L 3I6GA 5I8EB 3QWRD 4GW5A 3AROA 1BZ9A 4YHNB 5IHUH 3BH8A 4WNQA 3C8KB 4XPHL 3PHQB 4HFWA 1H9VA 3I9GL 3ARDC 3CGTA 3GMOB 4XP4L 5HGGS 3NFPB 1UZ6F 2NNAA 1YN7B 3KPLA 4N5EC 1OGTB 5I1IH 1KTRL 3DVGA 5HHVH 2NQCA 2P43B 3B2UD 1Y18B 1YJDH 3VWJB 4OZGB 3UP1A 3ABZA 5HJ3B 3STZB 1MCPL 4Z78A 4TULH 2HH0L 2RR3A 2EH8H 3ZDZE 1QSZA 4WWID 1K8DB 5E1AA 3MLUL 4U0QB 3AU1B 1NBVH 4LASH 4MNQA 3S36L 2I9TB 3D39E 3WS3A 2HVKB 1I9IL 2MKLC 4U1GB 5K93A 4X4ME 1QBBA 5C07E 2VUOA 4K7PH 1F3DJ 1MVFA 1BPVA 1T20B 4YGVB 4XNYH 4R7NA 3IYLW 1RUMH 4GKSA 5I2IB 1YEFL 1YMMB 3CFDA 2BOBB 1X5XA 2EYTA 3QUZD 3W9DA 4NPYB 5CGYD 2ESVE 2IBGA 4JPVL 5I6XB 1DBBH 1Q9LB 5AWNH 3SGDH 3ILQD 2HT3D 3SDCB 2VN4A 4LCWD 5IOPB 3L3KA 2FX8L 3EOTL 5JHLH 4LMQE 2GITA 4LEXH 4I2XB 3KYNB 3TYGH 2KZWA 2ZCHL 3QHZH 1IC5L 4XCNA 5E5MB 2ADFH 3MGAA 2IAMA 1N4XL 5LQBH 3BVNB 3OKKB 4I9WE 1QSEA 4AEFA 3MUY1 1MWAB 2ICWB 2LVEA 4NO3A 4B50A 3AUVA 1B0RB 3O0RL 3VRJB 3QQ3B 2GFBA 1MHPL 2P8LA 3MJ8B 4QYOB 5DJXA 1QBLH 3PDDA 4NQXB 4K3JH 2EIDA 1EHLL 1K2DA 3QCVH 2WIMA 1MPAH 2C3GA 4PJFA 4X7TA 4JFEA 5J3HC 5IB4B 1WEJH 4O9HH 1N8ZA 4PJ5E 4RSVA 5LCVH 2QR0A 3U4EA 1IAIL 2BNQD 3DUHA 4Z7UB 3EHBC 3L3JB 4JQXA 4U7KA 4AT6A 4XNUH 5L2JA 1ORSA 4N1HB 5IUSA 4Z0BL 4JVWA 3PWLB 1U8OB 4HWUA 2Z31D 1EIBA 1A7NL 3VFUB 5ID0A 5E7BA 5JNYB 4EDWL 4IMKC 2DQCH 3RTQA 5A43C 3BKCH 5FHBL 5C0CD 3THMH 4HZLA 4Z7NF 1U8QB 3UTZA 5DHVH 4WU5B 2BFVH 1AJ7H 4BFEA 1PX4A 2X4OA 1CGWA 3LKPA 4PY8J 3LQAL 5GGVL 4XBEH 2X4UB 5I1EL 3CXHJ 3QUXA 4DW2L 5DJ0A 3SKNB 1A6UH 1BX2B 4F7PB 1EPFA 1X5HA 1HXMB 2D03H 5D8JH 3N1GC 3MNWA 1HSAB 1TZIA 3ZTJG 1NGYA 2IG2H 1N6QH 4KKBD 4L4JA 4JZNA 7FABL 4WV1C 1WIUA 4NKMA 3ARWA 5KVDL 3ARGD 1F13A 3C9NB 3E8UL 4IRZL 3LRSB 3DSFL 3HE7A 3M8OL 4YDLB 4UV4H 1DE4A 4ONFH 5I1HH 4GUPA 4KRPD 4G9DA 2G5RA 4Y4KA 5DJ6A 3OJVC 3SBWA 4PD4J 5JPNA 4HBQA 3S96A 1JZ4A 2YR3A 1H3WM 1X5IA 2W9EH 1TQCB 1QG3A 2NY3D 2VLJA 4PJBA 4YFDB 1U8MA 4FQXC 1FLRH 2HYMA 4Y7MA 3IU4H 1H3PH 1HQ4B 2BHYA 1QLRB 2MCPH 1N64H 3HE6B 43C9A 5IW3A 5FAAA 1FZJA 3MRMB 3SE9L 2NW3B 3IDJB 3D87B 2EDDA 4HCRL 2QSQA 2ZG3A 2GK0A 1ZGLB 3OPZL 4LLDA 3OJDB 3MCLH 5E2UL 2LU4A 5HHPB 3L3OA 5CP3A 4LSQL 4AG4L 4K71B 3FRUA 4L9LB 3OKOB 1YN6B 1OGAA 3VH8A 2FJHB 2XNAB 2N56A 1CK0H 3T2NH 1U9KA 2O5ZH 4KH2A 2B1HL 5BZDB 1UJTA 2FYYA 1VKXB 4M6OH 1ZXQA 4LAJH 4KMTH 1J5OH 4ZXBD 3MROA 3LKSA 1BBJB 1ZLWK 5HHMD 1DBMH 2QQKL 2VDQH 3TVMB 2VAAB 5LBSH 3MBXH 3NCJL 5D96B 2DI9A 4G80A 3P30L 2E27L 5SWQB 5BQ7A 2QADD 2HT4D 2Q8BH 2VXSH 3X12B 4RMUA 1UYWH 1BEYL 1OP3K 4IOIA 4YZFE 3U48A 4KJPD 3LY6A 4M7ZB 1QPXA 1O7VA 4ZDHB 3RWFA 5F3HA 4GAYB 1QFUH 4JZOA 3HFML 4TQEH 2V5MA 3V8CA 2X05A 4XPFL 3VGAC 4A6YB 4J6RL 4M00A 4LHUB 1H5BA 4GLRI 3LMJH 3FQRA 4L8SA 3QEUA 2PETA 5EA0L 3HC4L 2VZTA 3C2AL 1RULL 4XRCB 5JW5A 4YK4B 4OLYH 1ORQB