2OZEA

The crystal structure of delta protein of psm19035 from streptoccocus pyogenes
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
284
structure length
284
Chain Sequence
MEKEELKILEELRRILSNKNEAIVILNNYFKGGVGKSKLSTMFAYLTDKLNLKVLMIDKDLQATLTKDLAKTFKVELPRVNFYEGLKNGNLASSIVHLTDNLDLIPGTFDLMLLPKLTRSWTFENESRLLATLLAPLKSDYDLIIIDTVPTPSVYTNNAIVASDYVMIPLQAEEESTNNIQNYISYLIDLQEQFNPGLDMIGFVPYLVDTDSATIKSNLEELYKQHKEDNLVFQNIIKRSNKVSTWSKNGITEHKGYDKKVLSMYKNVFFEMLERIIQLENEKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Streptococcus pyogenes pSM19035 requires dynamic assembly of ATP-bound ParA and ParB on parS DNA during plasmid segregation.
pubmed doi rcsb
source organism Streptococcus pyogenes
molecule tags Dna binding protein
molecule keywords Orf delta'
total genus 113
structure length 284
sequence length 284
ec nomenclature
pdb deposition date 2007-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13614 AAA_31 AAA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2ozeA00
3HU1A 1U99A 2FSIA 3C16C 5HR5A 1A82A 4JLDA 2EW1A 4HAYA 4B43A 1OF1A 2WZQA 4AI6A 4M8NE 5CLLA 3BIFA 2J0UA 3HR8A 3NC0C 3R9XA 1P7CA 1L4YA 2HLDA 5FR2A 1MO5A 2CMKA 4QXAA 4P33A 3MLEA 4ILEA 5EP2A 1U2RA 1HH4A 1OH6A 1D9ZA 2GJAA 3RNLA 2OO7A 4S35A 3GLFB 2OCYC 3U7FB 1EG7A 2YYZA 3D31A 4QBFA 1PJRA 4KBFA 1KMHB 2PZGA 2AK2A 1ZM7A 1Z0KA 2GK6A 1UBCA 2ZJOA 2R6CA 2QTHA 2YWFA 1JECA 1TQ2A 1T0HB 3NH9A 2KSQA 3CNLA 1WMSA 3QXCA 1TTTA 5JZVA 1R5OA 4KLZA 2BOVA 2XTMA 3AP1A 2WM9B 5HCNA 1Z47A 2Z83A 4TQUS 4GSYA 4GBMA 4NYMQ 5EP3A 4F4CA 4Y0AA 1NNEA 1AGRA 2R2AA 3VU9A 2JAQA 1C9KA 4LJ8A 2QMEA 4EJSB 1Z8FA 4PZYA 2ZI4A 3LVRE 3GLGE 5FUWA 1HUQA 3A1WA 3H84A 1E2KA 1IN7A 5FBVB 3I61A 4MGZR 4A0RA 3FFBA 4ZO4A 1KJZA 2O52A 2OCPA 2QQ0A 1FMLA 2BMJA 2D7CA 2G0NA 2GAOA 2GNOA 4PSVA 5EUMA 3U7EB 2IXFA 2GJ9A 1LVGA 1XTKA 1AA9A 4LV6A 3FHTA 4N1AA 4C2TA 4FMBB 4PZLA 5HZKA 1FMJA 5EUQB 2IWHA 2QMHA 4KODA 4LBYA 1CJUC 1KI1A 3OFNA 2GZHA 5GJVC 4B35A 2D74A 1G6OA 3X1YA 4PQFA 1DAEA 1OIWA 1NLZA 1E0KA 4MA4A 4LHXA 4QFMA 4OYHA 1CEEA 1FQJA 3L0IB 4XSHA 3ZZ0A 5CDFA 2ZRGA 4MITA 3UIEA 1U94A 2ZJYA 1KY2A 1FP6A 1RFLA 4CDGA 3Q7QA 4Q01A 4A2WA 4OQLA 3C14C 3CONA 4LBVA 3GJ3A 2OFOA 2J0UB 3GLHE 4C0LA 5FOTA 5CK5A 4L8GA 1YR9A 2CK3A 1MRSA 1I4LD 3ND9A 3RYTC 1VHLA 1L2TA 2DBYA 1UKEA 2ZI9A 4IVPA 2C9YA 2VP5A 1R7RA 3C15C 4V0ME 2CL7X 3RHFA 1G20E 1HE1C 2YWGA 3AF3A 3QEJA 4OHVA 5FOVA 3SHFA 5BN5A 2GJKA 2ZAMA 4ZIRB 2VSFA 3QXXA 3VR3A 4Q4LA 3R8FA 1T3HA 4F93B 4PAQA 3A4MA 3H0KA 2JIZA 3LWNA 3OAAD 5GJCA 2QAGA 5FUYA 4LI0A 3LDAA 3V00A 2CDNA 3LRPA 3WNBA 4QNRA 5EP1A 2YV5A 3N5CA 4UNRA 4M9ZA 3IO3A 2IT1A 3TBKA 4RZXA 2QT0A 2UVQA 1RVDA 2ZS9A 3KKOA 1DAKA 1QHGA 1ZM3A 2QGZA 2QN6A 4UKDA 4B34A 5EJEA 1DBSA 1N3BA 5EZ5A 4OK3A 3U2QA 2F3TA 2VP2A 3CNOA 4XWAA 1KI8A 3NXSA 3U3OA 2JLWA 4Q47A 1E4VA 1RW4A 2KB0A 4A2PA 4BLPA 4CT5A 5A4JA 4PO1A 2TMKA 2J0VA 4JBXA 3SC3A 4HAVA 4YMSA 2FMXA 2CCJA 4Q1AA 4IDPA 1N6IA 2ZJ5A 4U7DA 2SHKA 2PZFA 2JLYA 1W2HA 1P2TA 5TB5A 3UG6A 2FV8A 3ADKA 3W3ZB 5DNYB 2RHDA 3D3QA 5F9FA 2A7QA 4ERNA 3AVXA 2FZLA 1OSNA 3KUDA 2DWPA 1GIAA 4B32A 1OXXK 2J46A 4K46A 3SJBA 1YRBA 3W9YA 3THXB 3CWQA 5KDDA 1E9DA 1MT0A 1A2KC 4H9GA 3UMFA 4PO9A 1XPUA 2ZIAA 3GFPA 3GEHA 1M2OB 2YVUA 3OEHD 5AJXA 1NN1A 2J0QA 1VG1A 1QHSA 5DGXA 3FMFA 1OH5A 2R44A 4M9SA 1YR6A 1D2MA 1G7RA 4IOKA 1E0SA 2H5EA 2ZYWX 2O0KA 1E9CA 2GBLC 1XDBA 2FX3A 4A6PA 4MYUA 4KVAA 2D4HA 4BECA 3AF2A 3FGNA 2CHVA 4P4SA 2EFDB 5C46F 1IHUA 4KLNA 4MRNA 1KYIA 2VPPA 4P4UA 3RWOA 1Q3TA 1J8YF 3P32A 4UJ3A 2KBFA 3PITA 4JLKA 4ABYA 1LY1A 5JWOA 2DYKA 5AUPB 3ZQ6A 3K70D 4HAZA 4F4IA 1CRPA 1DELA 2EWWA 4OHXA 4E09A 4NPHA 1E2GA 3R9IA 5B58C 2C78A 1G8PA 4BFTA 3VMFA 3GQBA 3FOZA 3QNUA 4OBEA 1YZQA 5FPHA 2H57A 2EFHB 4M1OA 4EKDA 1LS6A 4RD6A 1N0VC 1KJYA 4OL0A 1E4YA 1X8LA 3I62A 2GZAA 2JJ8A 1Z3IX 1VG0B 3IPYA 3FKSD 2D7DA 2GWHA 4MYTA 4LHWA 3Q3JB 1KGDA 2H92A 1VYVA 4LRWA 4V0OA 1L7VC 2XX3A 1TQ4A 5DN6D 2FPKA 1U9IA 3DM5A 3QKSB 2VHTA 1KSHA 5GJBA 3L43A 1WRBA 3B13B 4LBZA 3O47A 4JVMA 4PAMA 1OPXA 3I73A 1KDTA 4B48A 3DZ8A 2J0SA 4RY2A 5FOXA 2QPAA 2OCAA 4PPFA 4OHYA 2RGEA 4I81A 2GBLA 5B2ZA 3GPLA 2Z6VA 1XCPA 2FOLA 1TAGA 1GNRA 1W44A 4FWTA 4L9SA 2GXSA 1E9FA 4Q4HA 3L0PA 2OSBA 4PC1A 2ZEJA 3SN6A 1UBGA 1SGWA 4DT1B 1SULA 1X8KA 4WXRA 2GZDA 3VR1A 2W00A 3NC1C 2FDCA 4TYPA 2VRWA 4O25A 3NBZC 1GILA 5FTMA 2JLUA 3O8RA 1NMZA 1P72A 5KNDA 4PC7A 2EWVA 5FI0B 2JJ2D 3UPUA 4Q5IA 4RD2A 2Z0MA 1LTQA 1JB1A 5E4FA 3VKGA 1RKBA 2NTYC 2Q6TA 2QT1A 3BE4A 2GHIA 3QKUA 1AQYA 4OKSA 4KYUA 4TMTA 5HKKA 5DYGA 4C0QC 2ODEA 4URUR 1XTRA 2V8OA 3CW2A 1A2BA 4BFZA 3SBEA 4LHYA 2JDIA 2B8WA 4A2QA 1X1RA 1EFRA 2BV3A 1Y63A 4BZQA 2OAQ1 1MKYA 2GA8A 2YOHA 4UXIA 4Q9KA 3T1TA 3V9PA 4DLWA 4P4SB 5C4MA 2BKUA 4KI0A 1Q1QA 2P2LA 4DLUA 4JVSB 3RS0A 4KU4A 3MAAC 1Z06A 3K0FA 5GVSA 2V1XA 3A1TA 1JR3D 3Q5DA 3TRFA 1FX0B 4NYJR 2ZJ8A 1E2IA 2QGNA 2BM0A 3NG1A 4QGHA 4JLAA 1A4RA 4B71A 1SVMA 4IEEA 2BMEA 3NBXX 4P31A 3RABA 4KFTA 3HPRA 1FUKA 2WSSA 2XZPA 1ZJ6A 3FMPB 3UMSA 2QUZA 3L0SA 2AK3A 2V54A 4QRHA 4XVRA 5KSPA 3SJAA 1N0WA 3ND8A 4C3ZA 5J4KA 5CK4A 4Z1MD 1EWQA 4M1WA 4XOIA 5D3QA 4I1OA 2BHRA 2ZVQX 4JL6A 1ZAKA 4R98A 2I1VB 2YJTD 4QGGA 4GZMA 1W5SA 3WBJA 1XPOA 4QBIA 1HY3A 4LYJA 1XXHB 4LPSA 3QG5A 4GPTA 3MJHA 1ZM9A 2C98A 5DHAA 1M7HA 4JYCA 3BB1A 1HURA 3F3YA 4JLOA 4Q9HA 4LYHA 4R9UC 3DL0A 2WVJA 3BGWA 1PV4A 2AXNA 1OYWA 1PLKA 1XFAA 5DLQC 4RKFA 5DN6A 1KK1A 2B8TA 1G7SA 1QZXA 4HAUA 2G1KA 2FSFA 4F38A 2REXB 5G41A 4TLBA 4EPVA 1KO1A 3WP1B 2LCFA 2Y8EA 5DO9A 1W0KD 1ZNWA 2XJ9A 2QAGB 4LJYA 1W4BA 5TARA 2KJQA 2OFXA 1EX7A 3PENA 4B75A 3KFVA 1RRGA 5BN4A 1F2UB 2CJWB 2W2XA 2XSZD 1N6NA 1W46A 4MGKR 1M7GA 1UF9A 4XJXA 3WMFA 3T5DA 2H1LA 2XNDD 4JT4A 4GOJA 1KSFX 4G1UC 2P0EA 1G9XA 3OIVA 2CNWA 4Q1EA 2WTUA 3NVAA 1GP2A 3SJZA 3P26A 4CGZA 3B82A 2WPDA 1IN4A 4KYIB 5E7JA 5KYKA 3B1ZA 4KFSA 2DHRA 4FN5A 2P5TB 3W8NA 2GJSA 1Q1ZA 2JLQA 4A92A 2VIIA 3KZ1E 5J40A 3U4QB 1DAHA 3KB2A 1KNQA 1SKYB 2AKAB 3TUJC 4R2IA 2JA1A 2V7QA 5F2EA 4J0QA 1G41A 4GP7A 2C03A 3RRNA 3OEHA 1VHTA 4URZR 4JYBA 1BS1A 1NKSA 2ZTSA 1R0WA 4O2LA 1SKYE 2RAPA 1Z5ZA 1XCMA 4OJKA 2PJRA 1VG9B 1WB9A 1Z07A 1Z2AA 2NO7A 3FFAA 4US2R 3ZLJA 2PLRA 1RJ9A 3GLGA 1UEIA 3K70C 5EXSA 3H86A 3F8TA 1S0UA 5LBIA 5BN3A 2JGNA 1YU9A 2QAGC 3CR7A 3GFTA 4L5BA 4EQ6B 4LX0A 5JJIA 2CHQA 4G5OA 4NHOA 4URWR 2EYQA 1X3SA 2PEYA 4NTZA 5BW8A 3DMDA 5E95A 4TYWA 1ZM2A 4BFWA 4B3GA 3MWYW 5FTLA 1QVRA 1GNPA 3TR5A 3V4FA 4MYCA 5KNCA 2FEOA 2PBRA 5IHPA 3CIOA 1IAQA 1SVKA 4JBYA 4DIEA 3JZAA 5C18A 4TLAA 3C7KA 6Q21A 3KX2A 4BFUA 2EQBA 2X2FA 3VTKA 4YMTA 1HQYE 5A5GA 4TL6A 1YZGA 2IXEA 2YNMA 4K81B 1VCNA 2QZ4A 1UAAA 2OBLA 1ETUA 1NRJB 1Q22A 1ZC4A 2V4ZA 4AKHA 1SVLA 4ZDJA 1RE0A 5JS8A 3MGCA 3CZPA 2JLXA 4DZZA 4Q9IA 1G1MA 1DAGA 1ZBDA 4M9XA 4Q00A 3QENA 1H8HA 1P5ZB 5CITA 1EK0A 3VR4A 3O8CA 4EPTA 2HCBA 2WSSD 2B6HA 3T5GA 3WMGA 4JIMA 4R71A 1WQ1R 3A4LA 3U3JA 3EC1A 2ZSFA 4BFXA 1D8TA 1KHTA 4H1UA 3QVUA 4KSBA 1G3RA 5G40A 3T1OA 1G5RA 1NSFA 1T9HA 2QY9A 1W4AA 2VA8A 5M04A 3B7GA 3VNUA 1Z08A 3BOSA 2ZUBA 4Q1BA 4DDUA 4HB4A 3X2SA 2BJVA 2WMOB 4RZ2A 1AS2A 1HQCA 5FTNA 3PXGA 1TF5A 3B2EA 5J4HA 2JDID 4OI4A 3FVQA 3DPUA 2NO9A 4Q4JA 4XWKA 4QG7A 4U5XA 2A2ZA 4RD3A 5L3SB 1TQDA 1GM5A 1E94E 1NN0A 3P4YA 3AM1A 1V43A 3R9WA 4P3YA 1SVOA 1NVWQ 5FBWB 2CXXA 1F60A 4RKEA 2P3SA 1FP7A 1SVSA 2IXGA 5DSZA 1S9HA 2L0XA 2ZR9A 1SHKA 1BYIA 1OB2A 2DPXA 4C2UA 1J99A 4LC1A 2WPDD 5C2JB 1FX0A 1T5IA 3A36A 3K9HA 4DSOA 5JJKA 1M34E 2O5VA 3ZS9A 2X1VA 3K0FB 2ZRFA 3KJIA 4JMPA 4PSAA 3OIWA 2BKEA 2VL7A 2LWIA 3ECCA 2D06A 1VCIA 2REOA 1KZGB 1II9A 4JSTA 4DC9A 3EPKA 2F1HA 4ITRC 221PA 4NYIR 1L4UA 5EE5B 4AKEA 3P1JA 3RWMB 2GXUA 3VR5A 1SXJE 3LLMA 3FHOA 1G8GA 3QPWA 4BUJA 2CL6X 4IRUB 3QPVA 5EXTA 3NIBA 1F2TA 4DB4A 2ZRHA 4ZIRA 2IL1A 3LX8A 3O8BA 4AKGA 2AR7A 2IHBA 2ZJAA 3CPJB 1SVIA 1W4RA 4D26A 1R8SA 3AP2A 3PR1A 1ZYUA 2IUTA 4MGIR 2I1QA 3MRSA 4IDHA 2FE4A 1OE0A 2V3CC 4WZBE 4XTRA 3IEUA 2OEPA 5GVRA 2FPLA 4UXJA 1U8AA 2PX0A 2WOOA 4FMDF 2ZI3A 4G01B 4TN1A 5FOSA 3WP0A 5L8VA 3KJHA 4U02A 5DE3A 3RRMA 1MO4A 4MUBA 1J70A 3Q9LA 4DT1A 3LD9A 1CKEA 2HJGA 5FH9A 4GMDA 2GJ8A 1LF0A 2QSYA 2DWOA 1QDEA 3KDSE 1Z6GA 2OHFA 5KSZA 1CIPA 3LFUA 3AVVA 3LQQA 3W6NA 1G5PA 1MH1A 2AFHE 2WSMA 3QEOA 3KQNA 4LSGA 5C4GB 5CLQA 5UKDA 4D80A 4FWIB 1ZC3A 3QKSA 1BMFA 1E1QA 3CX6A 1E2EA 1R10A 4W7SA 1DPFA 3UANA 3SQXA 5TV2A 4Z54A 5AUQA 4II7A 1BKDR 2A78A 1ZD8A 4Q1DA 2FZ4A 5H8WA 5IDVA 1G5TA 2F1RA 4B47A 1OFIA 4B6EA 1HYQA 2OUKA 4FIDA 1RRFA 1UEJA 4DLVA 3ZQJA 1WBBA 4AY2A 3RC3A 2BM1A 5KHOC 3PEWA 3ZDQA 3NEJA 2QI9C 2ZUDA 4HSEA 4F92B 1T5LA 1OKKA 5LD2C 4P4TA 2FPMA 3WYFA 1QHHA 1OHHA 3QXSA 5K8UA 1VPLA 4DLSA 2ZRJA 3W3AA 4XH9B 2QP9X 1E0JA 3KKMA 2BMFA 3RS7A 2KWIA 2ZRCA 1IONA 4Q66C 1D2NA 2CE7A 1HEIA 4G5SA 4IVRA 3MUFA 2V55B 3B1WA 3PUXA 4BFYA 5L3QA 1NIPA 1ZNYA 4B74A 1B0UA 3AUYA 1RRPA 3IUYA 4P0TA 2DCUA 3CF2A 2IYQA 1AJEA 3HU3A 1DTSA 1G8FA 4GFDA 4E22A 2PMKA 1RYFA 5EP4A 2GK7A 3GJ8A 4WVFA 4NCJA 4US0R 3FMOB 1ZRHA 1ZW6A 4PQRA 4OJQA 2F9LA 2C8VA 4C7OB 3DKVA 2BBOA 5JCPA 4L9WA 4MDEA 2Z5FA 2O0JA 2QSZA 3KB1A 1VCMA 2NQ2C 4EAQA 1ZCBA 1TUEA 3THXA 1K5GA 4O2RA 1TUIA 3GLIB 2YINC 2IYYA 3QVVA 2GVZC 1KK2A 4JKYA 4LJ7A 3S1AB 1GKUB 3KQLA 1AZSC 4W9MC 2ERYA 1YKSA 2VF7A 3SI7A 2XITA 2QA5A 4LV8B 2IS2A 2HDNB 2O8FB 4PPQA 3HYTA 5LD2B 4QKQA 1K8RA 1Q12A 2VP0A 2ZAOA 3ASZA 4RD0A 4MH0R 1CS4C 4V0LA 1XJQA 2XB4A 1E2LA 1ZU4A 2CCGA 5JEEA 3KQKA 1J90A 2ZYUX 2XZOA 2ZSBA 3BBPA 2KE5A 2OZEA 4DUGD 3CKLA 4PR0A 1VKJA 2WKRA 4A36A 5P21A 2ZJZA 3BH7A 2FSGA 1VCOA 4Q19A 2B92A 1KSJA 2JIZD 2P5SA 3CPHA 3OAAA 3WRXC 5L3RA 3RSOA 3CPEA 4WIAA 2HEIA 3X1XA 2FWRA 3VAAA 4PPGA 3GJ4A 3UK6A 1YR8A 4QHYA 4BASA 3AF0A 1B23P 4OHWA 4OK5A 1D6JA 1QHXA 3DDCA 4L15A 5G3ZA 1E6CA 1OJLA 1Z0JA 3QJYA 4PPNA 1GL9B 1JJVA 4QGFA 1NLFA 1WXQA 1W5TA 2GF9A 3ADDA 1TL7C 3T15A 5HPYB 2MMCA 1N5KA 2QRNA 2QQEA 3EW9A 1KI9A 3Q5EA 4F91B 2GESA 4WBSA 1AM4D 2BEJA 1NY6A 1E2NA 4D2IA 4I1VA 1AKYA 2WIAA 5J4LA 3EG5A 4DLRA 2RHMA 3AQ4A 1U8ZA 4ACAA 3K9GA 4HDOB 4TYQA 4ZCIA 2BDTA 3IIJA 4M0LA 4PC6A 3EWAA 2R8RA 1Q1EA 3SZRA 5HKKD 1R5BA 1C4OA 3NBFA 2ZI5A 1XTSA 4QHSA 3A6PC 3HR7A 4Q7JB 4DKXA 4IOMA 2AN9A 3GMTA 2CL0X 1S3SA 1GTVA 1OFUX 5KUTA 3BS4A 3SU8A 2A30A 1Z63A 3G0HA 3I8SA 3AEZA 1CBUA 1FFHA 1P73A 4TLEA 1EFHA 1N6PA 2IW3A 1AN0A 1DS6A 4QM7A 1AKEA 2WMNB 3MSXA 2XTNA 5CJPA 5TDHA 2C9OA 3MFYA 3OEED 3H4MA 5CIQA 2RB4A 4MRRA 4I4LA 1E2QA 3WBKA 1E2HA 5HZHA 2BVNA 4W5WA 3AUXA 3IPXA 3B5JA 2W6JD 4NCKA 2HUPA 3Q85A 3LBHA 3EIEA 2HXYA 4LHZA 1W36D 4D0LB 3FYHA 3FKSA 4Q4AA 4DDVA 4AWXA 3KKPA 4CYMA 3DHWC 5D3MA 4EFNA 2Z4SA 1UKYA 3VU9B 1VYUA 1E1QD 2IBMA 4Z8XA 1KKMA 5SZJA 4JLMA 3IGFA 4G5QA 1E9BA 5JHGB 1ODFA 3REFA 1G18A 5FUXA 3KQHA 2A3RA 1KAOA 4LDJA 1KO7A 4V02A 1Z22A 1E2JA 3TSZA 4Q4AB 5CDFE 1IN8A 2G83A 1W0JA 1XF9A 3H1TA 5TVKA 4QJ5A 4YONB 2ZRLA 1TF7A 4IOLA 4LJAA 2GCOA 5EQTA 1NJFA 4O3MA 4QHTA 1KNXA 1BMFD 4LV5B 3M6AA 4YDHB 3GLHB 2E87A 4AG5A 2P6NA 3K0CA 5TMPA 4JZKA 4HZUB 4TQ9A 4ZPXA 3A37A 3GJ6A 4HAXA 2H16A 3AF4A 3E1SA 4IKEA 1G8YA 5IK2A 3T35A 3JVVA 1JR6A 5CYPA 3KUCA 4PTLA 1XP8A 1ZCAA 4NCNA 4DHEA 1CRQA 1Z28A 4FMDB 4EFLA 2ORIA 4ZKEA 3HYRA 4FD2A 1VIAA 3K1JA 1R0XA 4L16A 1JR3A 1XTIA 3SHWA 4A8JB 2P6RA 1XD2A 3MJRA 2Q3HA 2ZYVX 1FPMA 3NDBB 1E32A 3KXLA 1WP9A 1GFIA 1I2MA 3N2EA 1NLYA 2GKSA 3SR0A 5B30A 2ODNA 1N6RA 1SQ5A 2IX3A 1QHIA 1HT1E 4A4DA 4FXPA 3PJRA 5BWMA 2H18A 1ZNXA 4BPBA 2UZIR 4RVCA 1GRRA 2J87A 2GAAA 1COWA 1P61B 1ZNZA 1ELOA 4FINA 1OXUA 3SS8A 2R6GA 2A5FA 4UNPA 1W7AA 1MABB 2PJZA 2VQSA 3AKDA 4LJ6A 2C5LA 2ZSEA 4X8OA 1RC8A 5B64A 3MWKA 3REGA 4OI2A 2PX3A 4LHVA 4DSTA 4JLVA 3RS2A 3Q8XB 3K0CC 3PCRB 4M21A 3LW7A 1YZKA 3RANA 4CRWB 3SBDA 1FTSA 4OQXA 1SXJC 4JS0A 1U98A 4R2HA 1JQJC 1YZUA 2V6IA 4Q7LA 1NVUQ 5JSZA 4JT2A 4FMCB 3C8UA 3AVTA 4D82A 4N0EA 4RZ3A 3IIKA 2GXQA 4WZ6A 3ONWA 1ESMA 1R8QA 4YXWD 1BYUA 4A0FA 3TUIC 3LX5A 1NMXA 2BWJA 1AQUA 3I8XA 3MWJA 4B44A 2ZS7A 1T4GA 1X86B 2ZI7A 3QIAA 2XXAB 4URXR 1W0KA 1M7BA 4A8JC 1PLLA 4AKIA 2NGRA 1F6BA 2KBEA 2NO6A 2OAP1 3B9PA 4KAXA 4QJ4A 1W47A 3FTQA 4H1VA 3GJ7A 2R62A 1DG1G 5GJWC 1K5DA 2UZ3A 2NPIA 3VX4A 2XZLA 2QROA 2AD1A 2YWEA 3CBQA 1NI3A 3PEYA 3TR0A 2J5XA 3RS3A 1LB1B 2JLRA 3D6TB 3QXJA 4RCZA 2OXCA 1JI0A 3MMPA 3QKRA 5AJZA 3PUVA 3AGQA 3U44A 1XX6A 1SKQA 2ZU0C 4ZCLA 2Z43A 2ATXA 2BBTA 1P6XA 2OFWA 3B1VA 1L8QA 2VP9A 4M53A 1OHHD 2H7VA 4RD4A 1IQPA 2OLJA 1FW6A 4HB2A 4JL8A 2QPTA 1P4SA 1S1MA 1Z6TA 2CVFA 4XIGS 5BQ5A 3RS5A 1EFUA 1IXZA 2XNDA 1I4DD 3EZFA 2IS6A 1U0JA 3ZS8A 5JI2E 1SXJB 3X1ZA 1C1YA 3KFXA 1E2PA 2MSCB 1GL6A 4LJ4A 4IFBA 1OH7A 1CXZA 3A1UA 5DI3A 421PA 4HI0E 4TQAA 3AF1A 1LNZA 4OQMA 1QHNA 2ZR0A 3CH4B 4CEJB 5K8TA 4BLQA 5DIFA 4PSKA 5GADl 2DWQA 4YDSA 1S9DA 4ZDIA 1G17A 1OLOA 2WOJA 1W36C 5DHFA 1F5NA 1ZM4A 3QF4B 2NZJA 4LYAA 2VTKA 3K0EA 4CVNA 4QC2A 3CO5A 1T8UA 3PG5A 3QF7A 4QM6A 3CZQA 5KPDA 4HLUA 5FL7A 3LQRA 1GWNA 3UMRA 5JECA 1DVRA 5FBLB 4BGDA 3LO5A 3TH5A 1EGAA 3VHXA 1KI6B 2ZE8A 1MR3F 2HF9A 2IS1A 1SXJA 3AVWA 1PZNA 2XOKD 2ZREA 3B8HA 4I99A 2JASA 2BEKA 1WDTA 1E9AA 1G4AE 2IUSA 5A0FA 1Z6XA 3IHLA 4YC7A 3LBIA 3L8ZA 1R4AA 2XEXA 4B3XA 2LKCA 2FEMA 5FOUA 5H68A 1YQTA 2E9SA 1G3IA 4XVQA 4IW3B 2ZQ5A 3F5FA 5JHHB 3LV8A 4PC2A 4M1KA 3BB4A 4DB2A 1M8PA 3GCGA 2CHGA 1OFHA 1OIVA 1S1CA 2QP3A 3E2IA 2O8DB 1GOTA 2ZVPX 5KO2A 2ZSDA 4BRWA 4C0JA 1E9EA 1UADA 4B2LA 4HUQB 2PT5A 4BRUA 2IYUA 2WWYA 2RCNA 3IQWA 4IFEA 2PLFA 2Q3MA 2RGDA 2O8CA 2RH5A 1IM2A 1W36B 3UWOA 3LH5A 4TZ6A 5AJYA 4KHZA 4CEHA 2XAUA 1VECA 1NF3A 1UKVY 1JJ7A 1KY3A 5J47A 3RSLA 1CR0A 5E3HA 2WWXA 4NKRA 4WW0A 2RKOA 2IF2A 2FN4A 2JCSA 2QMUA 1VYTA 3PEVA 1N6HA 4Q21A 4DEYA 5JSZB 3SEAA 1JEDA 5JMTA 4MRVA 4DIDA 3N2IA 1LW7A 1UFQA 4X8LA 1G3QA 1DARA 2OM2A 5JRJA 2VSOA 3CUEF 1SHZA 2I3BA 1TEVA 3FB4A 4TSFA 3BAFA 5KDOA 1AS0A 2ZRAA 4DCNA 3PFIA 4E07A 3HPQA 4D4JA 1TU4A 3EZ9A 3SFVA 3J81k 1DO0A 5HE8A 3W5IA 1IBRA 1CP2A 1XWIA 1Q1BA 3B60A 1US8B 3QQ5A 3UKDA 1XXHE 2ZITA 1NP6A 3QKTA 3B85A 3AVYA 2F43B 1YJ5A 4WZAE 3WYAA 721PA 5FPSA 521PA 4TMVA 1P2VA 3LW8A 5JJLA 1MOZA 1CR4A 3EA5A 4E5UA 2GTPA 4K8OA 3EIQA 4A9AA 8OHMA 4IOJA 1J7KA 2W6JA 2FFAA 2OESA 1W4CA 3KXKA 2P6UA 2FJUA 3G82C 5SZIA 1JXMA 1ZP6A 2QTFA 1ZIPA 2G88A 2HV8A 2QEQA 3S1AA 4ESHA 3DEFA 3GP8A 1P60A 3GLIA 2CCKA 3PQCA 2RGCA 4C30A 2G77B 5HCIA 4TSFD 5DI9A 3ZZTA 4C7OA 3CRRA 4ZV4A 2QBYA 2RGBA 2ZROA 3IBYA 4DSNA 1A5TA 1FTNA 2CLSA 2BJWA 1E96A 1JAIA 2AXPA 4PFSA 2BBWA 4EJSC 1T0JB 2IF0A 4DLTA 2O0HA 4B3DA 4BQSA 4Q02A 1IXSB 5LB4A 2A5GA 4M1MA 5CM8B 4TTRA 1DG3A 1ZUNB 1JQLB 2EVWX 3AH8A 5L3QB 4A0HA 5SZKB 4M1SA 5CM9C 1T3SA 5JRZA 3EAQA 3WXMA 4D0NA 3PUZA 2J59A 1DE0A 3C5CA 3T1VA 5KSYA 2YOGA 4HUQA 1H8ED 4GOKA 2GDJA 2AHOA 2PCLA 4NCIA 3VQTA 5FFMA 3CF6R 4NYIQ 5AUNB 2WKQA 3KTAB 4O0MA 2NG1A 2UKDA 3N70A 2Q21A 4GP6A 3NEYA 3LA6A 1EXMA 1E2MA 1RPZA 1CJKC 2C9CA 1JBKA 5JLJA 4LOAA 2R6FA 4Z1MA 5KNBA 4JLNA 1E99A 2R6AA 3DM9B 4NE2A 3THWA 2FSHA 3AKEA 2VP6A 3HDTA 1OV4A 2EFEB 4TL7A 2HJVA 3U61B 1M1YE 3DO6A 4HB0A 1NY5A 2X77A 4EPYA 1Z0AA 1AS3A 1YE8A 1D5CA 3K0AB 3K0AA 5H1YA 4A15A 1RJ9B 3GLGB 2QU8A 5F98A 1DO2A 1NKTA 2OLKA 2QRZA 1O87A 1QRAA 3KKNA 5G3YA 3R8CA 4D4LA 3QUSA 3OE7A 1KI7A 1G6HA 2D2EA 1UM8A 3TAHA 5LPNA 2PZEA 1KI4A 3C5HA 4Z51A 3B9QA 1YR7A 2ONJA 3ASYA 4Z8YA 4DVGA 3I92A 3QKRB 3EARA 3FKQA 5JS7A 4ZDKA 1Z6YA 3U4QA 1N6OA 4M4SA 4UJ5A 3VKWA 4TTQA 1ZIOA 2AWOA 2FH5B 1GKYA 3KTAA 5FL3A 3WMEA 3T1QA 3VNVA 1EESA 4ASUD 3TUZC 1GRQA 3ZD7A 2O8EB 1W49A 2AD5A 4GDFA 1HTWA 2FFHA 2W58A 1EFCA 5FBQB 2WJVA 1G7TA 3DOFA 4MRPA 4C0BA 4B73A 3KJEA 4GZLA 2W6IA 2WAYA 3EPLA 2DR3A 3K70B 1E2FA 1OYYA 3BWDD 3TE6A 3AVOA 1MO3A 2Q9AA 1NMYA 4AYTA 4XWOA 5AUOB 3TQCA 4OI0A 2WJHA 4HYYA 3D8BA 5FR1A 3THYB 2HCJB 4M22A 2JJ1D 3BFKA 2VHUA 2BCJQ 2PT7A 3AGPA 4CW7A 3T12A 1OKKD 2C2HA 4A82A 1FUUA 1F2TB 2GILA 1E79D 1KDRA 3OHMA 5FTJA 3U6BA 3U5ZB 2ZJ2A 5HE9A 1GZSA 3FMIA 4FCVA 4URYR 5FUVA 4PHGA 4JJZA 1BH2A 1Y3AA 3RRZA 4MDFA 1Z29A 1PUIA 3JZMA 4NBSA 3U44B 2QBYB 4HLCA 1CULC 1U90A 2D2FA 2IA5A 1R5NA 2ZU6A 4NZYA 1R2QA 3TLXA 4LK2A 2IWRA 1SXJD 3Q7PA 5H70A 4HEJA 1XEXA 4PO8A 4QL3A 1Z0FA 2G3YA 5AJVB 2VSXA 5ELXA 1JNYA 2AX4A 2GCNA 4PANA 4TMZA 3LAWA 4PHFA 3K09C 3NHBA 4KFUA 2QAJA 2N42A 3AV0B 1KO4A 3ZIAA 4F4JA 2B7BA 3DOEA 1GITA 1MO6A 1XD9A 4URVR 1BO6A 3VR2A 2NIPA 1IJFA 2QM7A 4NL4H 2XXAA 3BH6A 1AIPA 2P65A 3PVSA 4D25A 5DISB 4G5RA 3ZVRA 1FZQA 5DYIA 1US8A 4NDZA 3KQUA 3CRMA 2H8KA 3TKLA 2YWHA 4C4PA 1KDOA 3QY0A 2NO0A 2OILA 1ZUIA 1UBFA 2QMOA 3LBNA 1P9RA 4LC0A 2W2TA 3U60B 4B3BA 2R6DA 3IBGA 1N6LA 1G19A 4M1YA 3SYLA 4OK6A 1P2SA 2N46A 2YOFA 4ARZA 3GJ5A 3GLFE 3NDPA 1RIFA 2RGGA 3AP3A 5KTYA 1PUJA 2F7SA 3K53A 5E7IA 4RFVA 2ODWA 1MABA 3FWYA 4WXPA 4AG6A 2FF7A 2CK3D 2HT1A 3U7HB 2AFIE 2F1IA 1KJWA 1TQ6A 1PLJA 4A6XA 4R7ZA 3RC8A 2BC9A 3THYA 5TXGA 1J8MF 3NTUA 1II0A 1X6VA 3FHCB 4CEHB 5EE0A 4UNQA 1X1SA 3ZGXA 3CX8A 3WNDA 2ZE7A 2IK8A 3QPUA 2R9VA 4PX9A 3U3RA 4D81A 3ZVMA 4A0GA 2F3RA 1XZQA 2O8CB 2AWNA 1CU1A 2DFKB 5IK2D 1M6NA 2B21A 2WKPA 3CR8A 1A1VA 1S3GA 3BFVA 3QE0A 3ETLA 4JKIA 2V6JA 3RRYA 3GEIA 3CRVA 1P75A 5KDLA 2O8EA 2WHXA 2IEYA 3R7WB 2XSZA 2IYVA 3OIUA 1HT2E 3IHWA 2HXSA 1U81A 2JLSA 2X8AA 1XEFA 1U8YA 1NBMD 4LBWA 2G9NA 3BC1A 3ZJYA 4MKFA 3HWSA 1XEWX 1OXTA 2EFGA 2J3EA 2W6ID 4TYNA 2ZYTX 4BFVA 4TMWA 2A5YB 3AKCA 3RVBA 4TTPA 2RGAA 1ONBA 1NL3A 3OEEA 3TVTA 4IDOA 1SZPA 4RFSA 3DVLA 4RFSB 2G6BA 3QSYA 5J4YA 4TYYA 4FI3C 1GDDA 2WWGA 2GCOB 1XEWY 4DCTA 3BXZA 3W5JA 4DWJA 1OFTA 5FBRB 3SYNA 1UDWA 4UQOA 1IN5A 1BIFA 1E1RD 2XNSA 5AR1A 4DUGA 1TU3A 4QGAA 5EE9A 4PAOA 3SE0A 3NHAA 4PZZA 1TF2A 2IEZA 4KBGA 1OW3B 1FOEB 1LV7A 1DAIA 2A5JA 2IHYA 3DZDA 3QF4A 3G5UA 4IXNA 4DJTA 2GVDC 4BEJA 4OQNA 5KSOA 3R7WA 5JWHA 1KK3A 4MKIA 4CZ2A 2CLDX 4MKHA 3BJIC 3WHKA 2J41A 3L0OA 2ZRDA 1G3UA 2QPOA 3OIYA 1OT3A 1XCGB 1NIJA 4S2EA 1VIYA 5JBQA 3ICQB 1CF4A 5EXXA 5DI3B 2FFQA 4IDQA 4XSGA 2FG5A 2WBLC 4D4MA 1P9NA 5FOWA 4TLDA 3BFXA 4I1UA 4TT3D 5TY0A 2F55A 1AGPA 3RS4A 4TWZA 2VHJA 4Q48A 1DAMA 2E1RA 1D9XA 2AKYA 2IUUA 3ADBA 2ERXA 1JXOA 5HTKA 2CNWD 1E0AA 1F2UA 2CJWA 5JFGA 5F9HA 2QP4A 1U0HC 4HDQB 2ANBA 1XPRA 2OBNA 3THOA 4KXFB 3CH5A 3EA0A 2OCBA 3EWSA 1IOZA 4CIDA 5SZHB 4ARZB 4BWYA 3EPHA 4CEIA 2GEUA 3P20A 4QBHA 2NO1A 1KAGA 2N1BA 2J9RA 4JLBA 3CF0A 1HV8A 2IYLD 5EXPA 5G53C 1GL7A 1SVWA 3U3KA 4DXAA 1N0UA 4RD1A 5IF9A 3EIHA 4KV9A 1P62B 1Z0IA 5AWFC 2XB2A 4HLUC 3O8DA 4TZ0A 2FA9A 4B3FX 3EZ2A 3ZVLA 1JEEA 2IYWA 3TW8B 2PH1A 2BMDA 2W0SA 1U0LA 2OV2A 2XTZA 4XD7A 4EPWA 3WYGA 5CYOA 4AURA 5KPJA 1U9IC 2BIFA 2ANCA 2B7CA 1XTQA 3QBTA 1T91A 1W48A 3NBYC 4GOXA 2ORVA 4BZXA 2YHSA 2F43A 5EE1A 2ZRNA 3B6EA 4A1FA 3E5HA 2IYSA 1G16A 5IT5A 4CT4B 3OESA 4JLPA 1TMKA 3VFDA 2ZUCA 4ZCMA 2J1LA 4IJMA 4QBGB 1BOFA 2W2VA 3EZ7A 4GNKA 2ECKA 4Q9LA 1XEXB 1W1WA 3SOPA 1H8EA 1N5JA 2C77A 2YKGA 1E3MA 1KIMA 3OF5A 1KO8A 2GEDA 1ESNA 3KXIA 3MD0A 4BLRA 3CM0A 1QF9A 4ON9A 2CE2X 3T61A 2WWHA 4B2IA 3A58B 1NG1A 2ZETA 4POAA 4TL8A 4M9QA 4NYJQ 5E7MA 3ICEA 1GSIA 1KO5A 2PEZA 4JJKA 4MYHA 3EC2A 5F3WB 1Z0DA 1GKIA 2C04A 3L2OB 2Q9CA 1TNDA 4RZUA 4TMXA 4C0HA 2ZXUA 4BLTA 4JL5A 4JSYA 3QBVA 2GRJA 3HP1A 3W90A 3B1YA 2XOKA 4MKGA 2RGNA 2FGKA 1N5IA 4LWZA 5FPTA 4IXMA 2ZRPA 1XMVA 3A4NA 1XRJA 2O8FA 4RCYA 2WWWA 4DDWA 2ZRKA 4MUAA 5L3VA 4TL9A 5J5CA 1ZINA 2C95A 2VLIA 3U6KA 1IJEA 1KZ7B 2C99A 4V0KA 1VG8A 5K8IA 4PQYA 2G1JA 2IYTA 3EXAA 4EFMA 4MRSA 3U7GA 1W2GA 4W5JA 3CX7A 2Q3FA 2ZR7A 3B78A 3RDPA 1N6KA 1NG9A 1TX4B 4A8JA 4HATA 1NVXQ 3BK7A 4CEIB 1Z6AA 3MG9A 3CNNA 2PCJA 3M0EA 4HAWA 1K6MA 1UDXA 4NH0A 2HYDA 2WICA 4W5HA 2GCPA 4D6PA 2ORWA 3TGPA 4V0MA 3EPJA 4FW9A 5CJ2A 3FE2A 1XMIA 3PEUA 4BLSA 4ESVA 1Q57A 3VKHA 5BYKA 3GLHA 2FNAA 1F3OA 4PHTA 1MV5A 5JEDA 1Q3HA 2VEDA 1FNNA 2HF8A 4EIWA 3GJ0A 1KDPA 2ZRMA 4Q4HB 2JJ1A 1YVDA 2ZRIA 1KI6A 121PA 2MSDB 1E9SA 4ZI2A 4N3NA 1GAJA 2G0TA 2ZE6A 1GRNA 2P67A 3THWB 2K5UA 2WV9A 1P2UA 4X8MA 4Q9JA 3GEEA 1R0YA 3I5XA 1QHHB 1P3JA 2CLCX 1E2DA 1VDZA 2IYZA 2VBCA 2F6RA 3CB4A 4NCHA 4TT3A 3TAUA 4YMWA 4DLZA 5LB2A 2JLVA 4DDTA 3BB3A 2GETA 4GL2A 4DCUA 3GJXC 2IC5A 2MMGA 3CLVA 4JVNA 3MCAA 5CIWA 5D3MB 4NU0A 4DCSA 4DLXA 2ZM5A 4CF7A 2V1UA 2LKDA 2ZJBA 1CTQA 2NPFA 4CEJA 3ZH9B 5FL7D 2FGJA 3SNHA 2IS4A 1UBEA 3TJZA 3KL4A 1JAHA 1TADA 4AYXA 4UNNA 4QOSA 3IILA 4QNMA 4MGYR 2ODBA 1NBME 3AVPA 1AZTA 3HU2A 1CJMA 3SQWA 1Q0UA 3PIRA 4KSCA 2ZANA 4PHHA 1DOAA 3AVQA 4RSGA 3A1VA 3CWZA 3TIFA 4HLQB 1Q20A 2VHQA 4FCWA 3AKYA 3I3SR 3VX3A 1FL9A 1QG2A 3BERA 2J7PD 2ONKA 2GEVA 3PUYA 1HA3A 1YHNA 2QE7A 1T8TA 2DY1A 4TMKA 5DH9A 4XD7D 2J45A 3K8YA 1EFTA 1G3MA 1H65A 2VYFA 1TEXA 1G7CA 1LS1A 3ADCA 2AL7A 1VMAA 1YZLA 1NVVQ 1KTVA 2YC2C 4NONA 1IN6A 5LDDC 5AJWA 3BORA 2VH5R 1LFDB 4V0NA 1IY0A 1G291 4JVLA 1OXVA 1XXHA 2DFNA 1ZD9A 621PA 1KOFA 3OZXA 3M1IA 4EPRA 1E1RA 3W34A 1D2EA 2WAXA 3CRW1 2I4IA 1QBKC 5CB8A 1KMQA 1S8FA 4FMCF 3FPAA 4M2LA 1RRCA 4YQFA 4RJLA 2C96A 3QI2A 1CJTC 3W6PA 4MQBA 3WHLA 4Q03A 1RYHA 2EFCB 2ZSAA 3AVUA 2QENA 2FU5C 4M1TA 3IQXA 2NOAA 3T34A 2WWIA 5KOYA 4ACBA 3X1WA 3A8TA 2NMVA 2RGXA 4C0SA 1KKLA 2VO1A 5FTKA 2CBZA 3HJNA 3NWJA 5EZ6B 3QOFA 3TSOA 5KU1A 1OB5A 3P27A 4X8HA 2CEAA 4Q7KA 2W83A 1PVOA 2HYIC 4B3CA 2IYXA 2XJ4A 4DBLC 1IY2A 1NJGA 2QTVB 4C0KA 2MSEB 2JEOA 1EFRD 4UNSA 4G0NA 1N5LA 4HB3A 2WJYA 2RGNC 3EASA 4XVUA 1X8JA 1KSGA 4LYFA 1CR2A 1UJ2A 3GLIE 1XU4A 3F0TA 1CJVC 4N0DA 4GMXA 3SFZA 1I4TD 1II8B 4IEIA 3GD7A 5FPYA 3TK1A 4B6FA 4OI1A 3TSWA 3LY5A 3BD9A 1CLUA 3QXHA 2D3WA 4WA7A 3C4JA 1T3LA 1WF3A 2HLDD 3T06B 1G8HA 2PMDA 3GFOA 3K9LA 4AD8A 2O8DA 1NN5A 1XD2B 2ASEA 3TVDA 3ZYCA 1A7JA 1DADA 1QG4A 4PC3A 4XTCS 4OHZA 3WNCA 4B76A 2WIBA 1R0ZA 2V7QD 4DLYA 1T6NA 1V5WA 5JI3E 3TNFA 2QL6A 1GG2A 4NP6A 4DEXA 2JATA 1E69A 4HDCA 4YMUA 3L82B 1YRAA 3W8RA 2F9MA 3KJGA 1GVNB 1I2DA 3QG1A 5IRCD 4FCTA 4KJZA 1ZVQA 4HZUA 4G3XA 4JLJA 2QNRA 3DMNA 1YZTA 2YC4C 3UATA 3IIMA 3C41J 4D0GA 2FFBA 2ZS8A 5JCZA 4US1R 3SJCA 3IEVA 4Q1FA 4I1SA 2WWFA 4JBWA 3I72A 4LJ5A 2VHCA 2YZ2A 5J4VA 4GRAA 3U3MA 3UXMA 3K09A 1S96A 4KCGA 4ASUA 4EDHA 2WJIA 1QHYA 1NVVR 3TQFA 1WE2A 1Z2CA 1UKZA 1XBTA 2X19A 2J7PA 4P32A 4D4KA 1R6BX 2RMKA 3D7MA 3ZVNA 2DFLA 2A5DA 4EPXA 4LGMA 3P4XA 1XZPA 4G5GA 3SDZA 1CR1A 4KFRA 3ZD6A 3B1XA 3TW4A 3I32A 3CRQA 3IKJA 1F48A 4C0AC 3AB3A 1HE8B 2OG2A 3OE7D 4ZKDA 1J2JA 1VTKA 3H2YA 1NN3A 4EUNA 3LNCA 1COWD 3K9NA 3ZZUA 3X1DA 4NMMA 2GXAA 1ZU5A 1N25A 4WOPA 3FDIA 2Z4RA 3IDQA 1JALA 2QM8A 2DB3A 2H17A 1Q21A 2OBMA 3IO5A 4LPKA 1XMJA 4KVGA 4EJSA 4UXHA 1AK2A 5FI1B 4Y0VA 2Q0HA 1JPJA 2ZI6A 4EQ6A 1IY1A 2Q9BA 4BZPA 1JPNA 2QE7D 4B2PA 5K8LA 1OH8A 1G4UR 2JLZA 5FPKA 3SYKA 3VHLB 4AIIA 4L4UA 1XTJA 1O3YA 2OXRA 3LVQE 1G21E 3TMKA 3A1SA 1WCV1 1XJ0A 1XMSA 4ZI3A 1FNMA 1QVAA 4DRZA 1XNJA 3LLUA 1M74A 5ANRB 4LCBA 4BFSA 3I1FA 2A9KA 5AK0A 3E70C 1ZD1A 1W0JD 2REBA 2WJJA 3WRYC 1ANKA 2ZRBA 1KMHA 1LF5A 4HZIA 2BCGY 2OE2A 5JWRA 3VR6A 1TPZA 4C9BA 1G64A 3I5YA 2EU8A 4V03A 4F7WA 4Q1CA 3GLFA 2IYRA 1DAFA 3LXXA 1MRNA 2W0MA 4DSUA 1YZNA 1UPTA 4LJ9A 2ZPTX 3V4RA 3UWKA 4YMVA 2BBSA 3JVUA 1RZ3A 3WY9A 3L8YA 3M4YA 1N2CE 2QG6A 2ATVA 4IVQA 4AC9A 3EZ6A 4ZDWA 3MWLA 2NZ8A 2V9PA 2XGJA 1P9WA 2EYUA 2WJGA 4KITB 5EE3A 1E79A 1S2MA 2DFTA 4WAUA 3K0SA 4DCVA 2KI5A 2HT6A 5BYJA 3I4LA 1OIXA 4LY6A 1II8A 3OFND 2PL3A 4Q18A 4QJ3A 1XJCA 2R65A 1S4QA 2QORA 3BRWD 3BH0A 4LUCA 4YLGA 1Z83A 4E03A 1KI3A 1WA5A 4U00A 4AK9A 1IXRC 1Q44A 1KI2A 1DEKA 5B57C 3RLFA 4HLDA 5C1BA 4BEBA 4GI7A 3DKPA 4YXWA 3Q72A 2O8BB 2J7KA 4IHQA 4LZZA 2O8BA 2JJ2A 1ZUHA 3NKVA 2X2EA 2D62A 1E98A 821PA 4KO8A 3RAPR 1E9RA 3LXRA 4Q7MB 3ZIAD 4NYMR 2F1JA 1FQKA 1H8HD 3W6OA 1GNQA 1NSTA 2GF0A 2ZE5A 4TLCA 1ZMXA 4GT1A 1EX6A 4BLOA 3EX7C 4HUTA 2CVHA 3PV0A 3R20A 3UG7A 4AYWA 5L3SA 1JR3E 2VP4A 4OQFA 1EWRA 1KK0A 4Q4JB 1NBMA 2VF8A 1XB2A 4IDNA 1XD8A 4PXAA 3KKQA 4B33A 1WBDA 1OXSC 5CB6A 5BXQC 2OT3B 3PUWA 1GUAA 3NH6A 4BE7B
chains in the Genus database with same CATH superfamily
1V4VA 2LGJA 5ALQA 2BZSA 5HS6A 3PWTA 1NLMA 3UWMA 4BN5A 2FQXA 3C16C 5HR5A 5LLDA 4JSRA 3AF5A 2QVXX 4HAYA 4XYGA 2OYRA 4AXXA 1P39A 1FNDA 2WDPA 3EWIA 3H4VA 1UT8A 5CLLA 4D9NA 2VRNA 2X7HA 3ZE1B 2NU6B 1Q95A 3HR8A 2HLDA 1Q7CA 4O4IA 3EFHA 4JI5B 1MO5A 5KVCA 3R9XA 4ALIA 4BKQA 2AC7A 2C2XA 2XWBF 4P33A 2WTAA 3P2EA 1TVKA 4ILEA 1U2RA 1Y3IA 4V1CA 3RT1A 1HH4A 4YX9A 1OH6A 1D9ZA 4IJ5A 3JATB 3RNLA 4KLCA 3M1AA 1U5CA 4S35A 2EERA 2OCYC 3BM5A 2O0MA 1XRSB 1U9JA 3D31A 4J0HA 4EGAA 1V3UA 3OQHA 3WA7A 1PJRA 4WHMA 1YIAA 5DHPA 2O2EA 4J16C 5F78A 1DCKA 1ZM7A 2EHJA 5M3BA 2GK6A 5CFRA 1B74A 3AUSA 4UCXA 4IGFA 2PO5A 2BFDB 2BRUA 5KNDD 4NI5A 3IP3A 1S6YA 3CMCO 2YWFA 3LKBA 4M9CA 4X93A 3HBAA 5J2TB 1M1YA 4MS3B 3QKWA 2HHAA 4BN4A 1O03A 3ORFA 2W2QA 3IA2A 3L05A 1IBMB 4P08A 3H5NA 3KQUA 5CLJA 1VSQA 2UUOA 2YVAA 2PAAA 4Y0AA 3QLVA 4F4CA 2WAAA 5JC8A 1KVUA 1PK8A 3WV4A 2QUAA 3ONNA 1MX1A 1ZFNA 4ER0A 4ZI7A 1LRLA 1TTPB 1C9KA 2VJBA 4LJ8A 3I2HA 4MWGA 5IWCA 4PZYA 1ZVJA 1PSZA 1QQ7A 5JAZA 1BX3A 4U2CA 5LQKA 1BVYF 4CKEA 4IIHA 1AN9A 2YL2A 4RADA 3IR5A 1C0LA 3NVKI 4RHCA 1IN7A 3A9VA 5IN4A 1L7DA 1USGA 2IW1A 1JEAA 4ARUA 3FFBA 1L3BA 2NM0A 2O2IA 3K35A 1KJZA 2WJAA 4ZO4A 5CUQA 2OECA 3VPCA 2QQ0A 3R0ZA 1FMLA 2BMJA 1GAEO 1UZAA 4GOND 3UA3A 3TX2A 3WI7A 4WJZA 1ICEA 3HUDA 3JQAA 1I4WA 3G0IA 2IXFA 2GJ9A 3FX2A 4K9RA 2OQIA 3FH0A 3BWVA 3MINB 4FMBB 4N1AA 4HNVA 2I1WA 4RA6B 3WLEA 2ZOSA 3WLRA 4L3WA 2F48A 3PVCA 4DR1B 3TEJA 4DLPA 1V3QE 2VDWA 5CVUA 3KRTA 1JRLA 4GYWA 1CJUC 4PU0A 1SOMA 2RCYA 2GZHA 3GX1A 2C61A 1WB6A 2PZMA 1CYDA 3WK8A 1G6OA 4FFRA 1EFKA 2UYYA 1YCHA 1MAVA 3PYLA 4Y1EA 4Y6QA 1DAEA 1T13A 4WSOA 2BF7A 1VBMA 4JUDX 4YAKA 1PTKA 1CEEA 4R2LA 3L0IB 4J91A 4XSHA 3IDAA 5CDFA 4IJVA 3S8EA 4AUMA 1KY2A 3CNEA 1A7KA 1RFLA 1HMPA 1C81A 1FSFA 1CQIB 2AFVA 2G9RA 2XT0A 3GRPA 3L1VA 3CONA 4OQLA 4PX5A 3PC4A 3GJ3A 2OFOA 5FQOA 1R3DA 1LPBB 1XROA 1ZX1A 3WTCA 1Y89A 4C0LA 4YV7A 1IIRA 1CNFA 4NOMA 5CK5A 5CVVA 1PSDA 1YR9A 4KDFA 5JALA 4TT8A 5L7TA 2CK3A 5K09A 3ND9A 2EW2A 2MYPA 3G9XA 1E18A 2VP5A 1R7RA 4HP8A 4MVJH 5K0BA 1DQZA 1G20E 3QEJA 3RHFA 3SHFA 5FOVA 3SZGA 1KOJA 4NCXA 4EZIA 2F67A 4EENA 5BV1A 4ZIRB 4JN6B 1FJ2A 1RRMA 3R8FA 3UB3A 5E6UA 3SBOA 1HQKA 4MUNA 4F93B 1H23A 5JDCA 5L3ZA 4PAQA 3OAAD 4G2NA 4R1PA 4ZRNA 4NV1A 1ML3A 4MPDA 3TZKA 1EFPB 5K05A 4V39A 3OVMA 4QVGA 3GHHA 1NP7A 4ISCA 4QRIA 1BOOA 1UOEA 4IO1A 5TR9A 3W05A 4KXVA 5CXXA 1WTCA 2YV5A 5EPEA 5SY4A 3TQRA 4HQLA 3IO3A 4LI3X 2VCEA 1AHPA 2OC4A 1TLLA 1AUOA 3CZ4A 5IKPA 2ZS9A 4XR9A 1MVLA 1QHGA 1ZM3A 4UKDA 4YJ2F 3X43A 4B34A 3D2CA 1WCXA 2V6GA 1XKXA 4P7FA 4L4RA 5EZ5A 3UV6A 4AJ9A 4PYRA 4OK3A 1X9HA 4HDNA 2RKBA 5J2UB 3U2QA 4AP6A 5LKAA 5LFAA 1H0KA 4W5OA 4DJDC 1OASA 5AO9A 4RTLA 5A04A 3EY4A 1WXWA 2Q1YA 2XUGA 2TMKA 1T25A 3I5UA 1R27A 3OUZA 1ZN2A 2J0VA 4IYRA 4JBXA 1R0SA 2RHJA 2RGWA 1JLKA 1R4ZA 2FMXA 3DHYA 3H1BA 3KE8A 4FYWA 4FKZA 1EFPA 4KQ9A 3PDHA 2ZJ5A 2B25A 2VK8A 1W2HA 3GYBA 3D8HA 1NA5A 1I13A 1PJTA 3LUBA 3N9IA 5TB5A 1G4HA 3VR6H 5A2GA 3L6DA 3WWYA 5CD9A 3ZWYA 5CYFA 2FWAA 1SVNA 4R2XA 1Z36A 4B4WA 2BP7B 1UM9A 4RWEA 2DF8A 2J46A 4K46A 2H4XA 4LZPA 5GV8A 3SZOA 5A3RA 2PUCA 5JXHA 2H31A 5E7MA 4HADA 2JHAA 3R24A 4N7MA 1RXVA 3K71B 4PO9A 1ZLXA 4NZ9A 4PZ0A 1NV8A 2DUJA 2Q2WA 2R5FA 2WUEA 4U7JA 1L5RA 4WINA 4CT0A 4YV1A 2BGNA 5AJXA 2Z8XA 1NN1A 2J0QA 1QHSA 3FMFA 3DQPA 1J8FA 2HWWA 1OH5A 2FHPA 3FMGA 4MUFA 1ZUD1 2Z8ZA 4G36A 4QU0A 4WCFC 2GBGA 2O0KA 4MKRA 3VPFA 3C3MA 2JVJA 1WVMA 1WD7A 2WF7A 4CR7A 2D4HA 4BECA 2BKXA 2CXNA 3MIZA 3WKAA 2CHVA 2H2GA 4KLNA 4MRNA 2VPPA 2XBMA 4PIPA 3DOHA 2KBFA 3K70D 3LUPA 3ZQ6A 1C14A 4K6KA 3C5WP 1FCJA 1C1HA 3HXTA 4UVDA 3CSDA 5K2MA 3PNPA 4HAZA 3GPBA 4RQTA 2QX4A 1KJIA 1KMMA 1MEEA 1F0YA 1SEVA 4IJUA 1LSOA 2EWWA 2GAFA 3O1HB 4OHXA 4R2KA 1CRPA 1HPLA 1E5QA 3R9IA 2AMVA 1UBKS 3ENNA 4E1AA 4G0ZA 3GQBA 3VSDA 3IKMB 1YZQA 3AI3A 1R3UA 2LPMA 1RI4A 3UJAA 1N0VC 4W1PA 4OL0A 2VUIB 3M2PA 2GZAA 2H0QA 1EGVB 3HO8A 2I4MA 4YJDA 4F2HA 3VR0A 3LUDA 1XKQA 1PYOA 4TWBA 2D7DA 3UJ8A 1J2TA 3NT4A 4JFRA 5LZ7A 4MYTA 1JG6A 3V8NA 2CB0A 3Q3JB 3U4IA 3U1TA 2CLLB 3FETA 3R0XA 3L49A 4LMAA 2XX3A 4C2AA 4B0OA 2FPKA 1S8AA 1T5TA 3DV2A 1U9IA 3DM5A 2VHTA 4AJOA 1KSHA 2J3MA 4DA9A 1WRBA 2JJYA 3B13B 5G0UA 2QS9A 3KSZO 4JVMA 4O1HA 2YJNA 1OLXA 5GWXA 2JRLA 4MS3A 2J0SA 5DT9A 5FOXA 2OCAA 4JK3A 5AD1A 3FCAA 5IBQA 2H65A 5B2ZA 3S28A 2Z6VA 3Q98A 4KR9A 4QEDA 4WD3A 1W2WB 5EINA 4HDSA 2I4NA 2M1XA 2Y6VA 2NW6A 4F71A 4FWTA 4DANA 1KMCA 3CUTA 2P2ZA 1EBUA 1PZFA 1AH2A 1X8KA 4LHSA 3IRVA 1GQYA 2AYZA 5JO0A 4O25A 2ETXA 1SZJG 3ZHZA 5FTMA 2Q6LA 2JLUA 4MVWA 4TTVA 1KJJA 2SICE 3NP7A 1NHWA 1SOWA 2ZYRA 4L72A 2AQIA 5HX7A 2FE1A 3WLHA 4O4HB 1OWNA 4Y8VA 3EQ6A 4Q5IA 2ZUSA 3U37A 2A0YA 5B6PA 4BOYA 1Q84A 4PWYA 3BE4A 2E4AA 1VCHA 1P4JA 4N4AA 4TMTA 4P6VF 3UK1A 1KZ9A 1GPWB 1ZOLA 2FUCA 1XL0A 1NVFA 3PRHA 4AMZA 1WQ3A 1A0OA 2V8OA 1RXYA 2JFXA 4BFZA 1KARA 4LHYA 1ZICA 3NBUA 1DT3A 4LGVA 3N86A 3L8GA 4NMLA 4A2QA 3RFXA 4GQBA 4D79A 5HVNA 4OLAA 1M34A 2YOHA 3DFFA 1MW9X 4M8KA 4EAAA 2EKPA 4GBJA 4ENVA 1NDUA 4IJKA 4L9AA 1Q1QA 3G5TA 3BCHA 3MAAC 3BCUA 3WK9A 2UZ1B 3CRNA 1UP4A 3K0FA 5GVSA 2V1XA 3IFSA 4IDEA 3TLYA 3OCYA 1CDOA 3Q5DA 4G8CA 4MPTA 3LKVA 3UAXA 3TRFA 3UXYA 2F1OA 1FX0B 4F2PA 5C5EA 1AV7A 1W29A 4EUHA 5JD4A 2ZJ8A 4C0XA 2DU8A 5F77A 3AR6A 4FFNA 2INGX 2BELA 1SVMA 4JR2A 2OR3A 5A1TA 1T8YA 4DLKA 2A86A 2IVZA 4W6QA 2M32A 4CEJB 1Z3CA 3ND5A 3UMSA 4WZBA 2LCIA 4Y7CA 1GZ4A 4W7IA 2V54A 4G8DA 3WGQA 4RAQA 4Z53A 5KSPA 5I9MA 1RXEA 4ZTZB 1QDLB 2OBYA 1YK1A 4DV5B 1HDRA 3KU4A 3L7JA 5J4KA 5CK4A 1EWQA 4DG5A 1IHDA 2VAMA 4XOIA 5D3QA 1WV1A 1M73E 4R5HA 4DG9A 1EWKA 3L41A 3L4KA 1TW2A 2ZVQX 3QP9A 2WFLB 4YWJA 5G2OA 4QG3A 2NP6A 3EJWA 4QGGA 1AF4A 3F6BX 4IIBA 4C5BA 3QMPA 4W9NC 1HY3A 1NULA 1ZOOA 4EB0A 4Q3BA 1N3IA 2C98A 5DHAA 2V8BA 3F3YA 3PR2B 2UVPA 4AQ7A 2CYCA 1F17A 2CXRA 4Q9HA 3ER8A 1XA4A 3N0XA 3IJPA 4LYHA 5F2KA 3GEGA 3UAZA 1R0CA 3HJFA 1EBFA 3L4BC 2PT9A 4KO3S 4TRJA 2WVGA 3DEHA 4OJTA 4D8YA 3B70A 2J33A 4B6GA 2B8TA 4JWTA 3N0TA 4OHRA 1Y9JA 3ZWQA 1G7SA 1MH9A 1QZXA 4M76B 4TKVB 4NV0A 5G41A 1T5HX 4KKVA 2VPYA 3LCUA 4Z3OA 3QOXA 4D42A 3EGEA 4HQFA 3EXEA 4C4OA 3GARA 3GPCA 5DBHX 1B16A 2OHOA 4OQZA 1AHIA 1P6UA 1KY5A 2IEDA 1WDLA 2QAGB 3BKWA 3BXOA 4XGIA 4LJYA 4MMZB 4EEZA 1W4BA 4FE4A 4DNFA 1N2GA 1X7YB 1JDZA 4MW5A 4NATA 1A04A 4B75A 4YJ3B 5BN4A 2JD0A 1KQNA 1TKCA 3W04A 3MZ0A 5H80A 4L3VA 4XJXA 4U0JA 2QQ5A 1CX9B 4YRFA 1EZZA 2FWIA 2XNDD 3RSGA 1BE8A 3O8QB 3IKLA 4OGGA 1ID8A 3KWJA 5BRNA 2X6TA 4RTMA 2C58A 4JQOA 4UDXX 1G9XA 4LY3A 3Q15C 5CFZA 1NI5A 2JRCA 3VPHA 3FFTA 1KC1A 2CNWA 5AI9A 3NVAA 4WGFA 3UK2A 2HM7A 4XAQA 4CLRA 4IIGA 3VVLA 2WU0A 1F51E 1SQSA 3GR6A 5BP7A 1Y1LA 4H6PA 2AOTA 2WE7A 3LY9A 2RI6A 3FDZB 4KFSA 4PZAA 4RU1A 2DHRA 5K3CA 3ZH2A 1VLJA 1ORTA 1RP1A 2JLQA 3Q5GA 2OP1A 4M6WA 3U4QB 1DAHA 4KIWA 2W6NA 1ZH4A 3TQHA 3ZY3A 2AKAB 3BIOA 3K1YA 1TUBB 3LP5A 1G66A 4J3JA 3WISA 1AGNA 4UOQA 1U3TA 4GP7A 3D7LA 1HNXB 2EJTA 5AI6A 4EATA 5ENZA 1A71A 4JXJA 3RBVA 4AICA 1NKSA 4DWOA 4CL3A 1R0WA 5TJHA 4ENQA 1QXSA 1SKYE 1XR3A 2BD0A 3DBLB 3HJUA 5BN1A 2JI8A 5GPBA 1CUVA 1KXZA 1Z17A 1DFIA 2NO7A 3FFAA 2O4CA 9LDTA 4ZO8A 1CZUA 2B9VA 2PLRA 1RJ9A 4QYSA 3K70C 1GTZA 4M6WB 4OLJA 1OFGA 4FM9A 1S0UA 5LBIA 3OI7A 2ZUFA 2QAGC 2XD9A 4OA5A 1GPJA 1XRLA 4XASA 3GFTA 2Q4EA 4MDHA 5ESDA 3V2IA 2I8LA 3PLNA 5KWVA 3AJ8A 1R50A 3HB1A 3DOCA 4G5OA 1J5EB 2P62A 1K3UB 2EYQA 1GVHA 1HFEL 2RSLA 4NTZA 2CDRA 3D7SA 3DMDA 3ITNA 3QWAA 4TYWA 2O59A 4B3GA 3L6CA 3MWYW 3OCJA 5ESRA 1QVRA 2JBAA 3BZUA 3DJYA 3JD0A 3LY7A 2PSEA 4LWQA 1GFSA 3CIOA 1SVKA 4RA9B 5IXSA 2NZ2A 2OWEA 4TLAA 1W1IA 1UBSB 2XKBA 5T4EA 4X65B 2GPAA 3NRBA 4KWHA 2C1XA 4WV3A 2GZMA 3VTKA 4E21A 1HQYE 3TZ6A 4E5DA 1YZGA 1MX3A 2H5LA 3R5KA 2YNMA 5K20A 1BQ4A 3HVKA 2WAMA 3CLKA 3RYIB 1R8YA 1UAAA 3QWBA 3G8YA 4IV0A 4I9UA 5KZMB 5HNKA 1QDUA 3ZE0B 1H42A 1QGDA 3F8WA 2O48X 3PS9A 2F1KA 3R4CA 3WV5A 5I9LA 4ZDJA 1MFPA 5JS8A 3CZPA 1Y7IA 2VJOA 4CE6A 4DZZA 4Q9IA 4Q00A 4M9XA 2NUPB 3ZU4A 1NOIA 3EXHC 1N0HA 1C4WA 5TPWB 1L8XA 2FPXA 4I36A 1YS4A 2GKOA 2WLTA 3LHFA 4Y2SA 2WSSD 3ETHA 3AT1A 3WMGA 2FPOA 4JIMA 4EVSA 2BM9A 4NBKA 1VE7A 4FS3A 3EFBA 1G9TA 3QQPA 4E6PA 3PC8C 3L1HA 3O4HA 4LTNA 4DMKA 1K7CA 1SKMA 2C8LA 2VK4A 2NZVG 1GN8A 4H08A 4H1UA 1VGQA 1LW6E 2UVPB 1J33A 2YY7A 4YAFA 1M2HA 4CIXA 4XQ9A 2UUAB 5BXYA 1NSFA 4O4IB 1T9HA 2HRBA 1QIEA 2QY9A 4CM4B 4FCCA 5TGTA 1SZCA 4W63A 2D4AA 1RYMA 1EI9A 2OZVA 3BIJA 1Q7EA 1G5QA 2ZUBA 2DPLA 2Q27A 1L5LA 1I3NA 4LN1A 3WNQA 4M0DA 5AVQA 5L95A 1RLOA 4X62B 2FPIA 4HB4A 2DKFA 4IEFB 4KN9S 2C7QA 3EYAA 4B7AA 4X1KB 4LYEA 3J80A 1M6VB 4YJ3F 3AYXB 3U4AA 3SX4A 3B2EA 4LYDA 1RZRD 1RSZA 2P0AA 1ORWA 3ID6C 3KELA 2FPPB 2QYHA 4OI4A 1U8UA 3LTNC 4IXDA 1PJZA 1J97A 1Z4MA 4QG7A 4U2BA 1XZLA 5U4QA 3AM1A 1AKQA 5CT4A 5ALWA 3R9WA 4O2AB 4P3YA 1BG6A 4HBZA 5E0KB 4KN8A 4F72A 4XPZA 4JEUA 1S9HA 3LVBA 3Q87B 2ZR9A 4P2BA 2DFDA 3P8ZA 1X7HA 1QH0A 2NNLD 1TKRA 4ER5A 2XLCA 1DKQA 1FX0A 1GGEA 2F59A 2B1IA 3ETNA 4MAMA 4MS4B 4LRUA 4DVJA 2QLJA 1XOIA 4AO7A 5DK6A 4D74A 2X1VA 3K0FB 1JLSA 2BGMA 4K28A 1OOEA 1RQ2A 1XALA 1I7LA 2VL7A 2LWIA 2JCGA 3ECCA 2XNHA 3OMLA 3DE4X 1VSVA 1U0GA 1XDDA 3VH2A 3MBKA 4JSTA 4U9IS 1R6UA 1QF6A 2F1HA 4ITRC 1ND6A 5EE5B 1L4UA 5CA0B 4I1PA 4AKEA 2EXXA 5DU2A 5JCXA 1V5EA 2GXUA 2QUBA 4YRPA 3VR5A 1G8GA 3M6LA 3EVNA 4ME6A 3FNBA 1JEQA 1F8YA 3QPCA 4WTOA 5CH5A 1Y82A 1Z6QA 2VNAA 4G67A 3RVPA 3UUWA 3EGWA 3WWOA 2FK8A 2I4LA 3RAFC 2VKTA 2IL1A 4JOCA 2Q0SA 1MIOB 1JG3A 3B8EA 2GTIA 2CUKA 3FGZA 2OOSA 2ZJAA 3FDXA 3MOIA 4KUHA 1W4RA 5B58T 3AL2A 2GDZA 1HDOA 1R8SA 4XRGA 3PR1A 2V98A 5LQNA 1XLVA 1RFGE 4MGIR 1PL7A 2EZ8A 3NHLA 2FE4A 2XUJA 5K3BA 1OE0A 3NIGB 1VMKA 4WZBE 4XTRA 3IEUA 5GVRA 1E7WA 3EQ8A 5DHTA 3PWZA 4MPPA 3ZV6A 2ZI3A 4DZRA 1TJPB 3QX7A 5L8VA 1YB5A 4HKTA 2CXQA 1J70A 2H5IA 1XDWA 3GJQA 2BFFA 4LF7B 1SR8A 4GMDA 1PFWA 1DB3A 2DPGA 2PXXA 3TSAA 3WQRA 2FOIA 1LF0A 2ZT5A 3I58A 2MDTA 2FG6C 2O3QA 3VH1A 5JYDA 1CY4A 1QCDA 2VJQA 3R3UA 4G0UA 3FB1A 5KSZA 5BRAA 3ESXA 3MNFA 1G5PA 4MNTA 4WN9B 4FDVA 3A6GA 3MYYA 2AE2A 1QFYA 3QEOA 1FDOA 2V6BA 3K0HA 3IQZA 2Q2OA 3ET4A 3CX3A 1NJ2A 1GRCA 4WMLA 2ZLBA 2XNJA 3ZY2A 2C2OA 2PUFA 1VJCA 1C9NA 3DCJA 3ETJA 3N3BC 4I5DA 1ULBA 3MBIA 4ZVQA 3X1KA 3O4GA 3LPLA 1NUAA 3ELWA 1RAGA 4H27A 4YRLA 1U02A 5TV2A 2ZJ7A 4QUHA 4AB1A 1KJ8A 1BKDR 3K16A 5TPZA 3ZTTA 4YCLA 3DCNA 3CLRD 1G5TA 3C1TA 4B47A 3PXDA 1B3BA 4FLMA 1EAMA 2A0FA 2Q46A 4FIDA 1UEJA 4KE9A 4JZYA 3T5CA 2I0FA 1QIGA 1YDEA 1AK1A 4LECA 1QK5A 3U3XA 1EZ1A 1TZ2A 1VJ1A 3DVSX 5KHOC 1J49A 1QS0B 3CG4A 3ZDQA 4J7UA 2DHEA 2ZUDA 2MWMA 4JXXA 2IEAA 1NVMB 1T5LA 1Z62A 3D6NB 1GNTA 2XH8A 1WCWA 3A3KA 2C5GA 4Q34A 4HLNA 2NSYA 5GZ3A 5HQJA 5BSGA 4XWTA 1WDKA 4H17A 1DZIA 4CPDA 5K8UA 1GAWA 1P2BA 5JISA 3C7TA 4XFDA 3A28A 1GQQA 1KP3A 1ZK2A 1MT3A 2OGZA 3MRXA 4PV7A 4ZO6A 2VPZA 4Q66C 3PIDA 3WLAA 5KWEA 3ORQA 2QMZA 1HEIA 3ST7A 3MUFA 3CNHA 1MQSA 1YHYA 1PW5A 1DP4A 1AURA 1NYLA 2GD6A 1M1ZA 3S2SA 5FDFA 4QPCA 4B87A 2YJ6A 4JDPA 1RRPA 1NI4B 3K1AA 3LE8A 4P0TA 4ZVOA 2DCUA 3TRJA 3VR3D 3A6FA 2ASVA 3B53X 3IPCA 1ISJA 2DSNA 1G8FA 2Y68A 4E22A 3T5BA 1BQ3A 4X7PA 3QVKA 3TL2A 5I5EA 3WGGA 4JOSA 2YV1A 4QGSA 3EZXA 2XHEA 3ZGOA 4C4SA 2AEFA 2N9UA 2AFIA 3QMWA 4QOHA 5JG7A 1O5OA 2QOEA 2QX7A 5HIIA 1ID1A 4OJQA 5K3OA 3H8JA 1RC0A 1J6UA 3HB4X 3IEKA 5K3FA 4D02A 3B6IA 2IUFA 3DKVA 5JCPA 3JU3A 4JODA 3SQLA 1U2GC 2M98A 4GVLA 4PE5B 5K0GA 4BKPA 1PS0A 1ZCBA 4YT4A 1NR1A 4PYJA 1E1CB 3GPDG 3GZJA 1K5GA 2PKRA 4IGAA 1KK2A 3PP8A 4JKYA 2ORYA 4AY6A 2W8BA 3P2OA 4EY5A 2ERYA 4W9MC 1YKSA 2VF7A 4JP1A 4B8YA 2QA5A 4ZHQF 4LV8B 2AUMA 5BV7A 5DCUA 3IAAA 5IANA 1MC8A 3N75A 2B8JA 1JR2A 1MBZA 2C3MA 2KLBA 1SBHA 2P1DA 4GR4A 4ZC8A 5SICE 4QKQA 5KOIA 2D5CA 1L0BA 3MWDA 5JANA 4G0QA 3TOSA 2A0WA 1H5UA 1U2DC 1E2LA 5JAHA 2ZCJA 2UXBB 1UXOA 3V7FA 1XDGA 1QC5A 2XZOA 4MULA 5KYYA 5IJ9A 4CM1A 1OAOA 2G80A 4YASA 4DUGD 3PFHA 1KZ1A 2RH4A 3V1MA 4F7DA 4HDRA 3SZMA 3A7DA 4ZMBA 5F2OA 2JZCA 2WKRA 4RYLA 1QZZA 2OVBA 3IP1A 1W4LA 3BH7A 3E3OA 3BKXA 3C5VA 1GXSA 2PHZA 2B92A 3F9RA 3PQ4A 2HMAA 4JMLA 5J9FA 3T1HB 1UC8A 1XZJA 2FMTA 4J94A 4GBGA 4PZDA 3SICE 4PPGA 1N8SA 5LP6C 4QHYA 4BASA 3E35A 4LF5B 2LV8A 1XVTA 5LLTA 3Q4GA 4YR7A 1GDTA 6ABPA 3U4MA 3K8OE 4L15A 2FQWA 1WW2A 2FQYA 1E6CA 1WX1A 2XADA 5FWAA 3WL8A 2XUAA 5C1DA 5JZ9A 3LC2O 2R6ZA 2EP5A 1GL9B 1JJVA 1XJ5A 2BI7A 2IPOA 2JI4A 2JVKA 3NW9A 1NLFA 1WXQA 4QGFA 1W5TA 4ZEXA 4QXPA 1JS1X 3ZCXA 1M83A 4QT4A 3HXOA 4XI9A 5HPYB 1U6IA 5BWBA 1EPUA 1INLA 1T5BA 4Q16A 1YJQA 3ETEA 2QRNA 4J3FA 4PG6A 1E6WA 2WQ6A 1JLMA 1XVLA 3EN0A 4DABA 1KI9A 5KNBH 4AULA 3Q5EA 3VVCA 1X3LA 4F6LA 1RYEA 2WQZA 3I9V6 4F91B 1P1RA 2GO1A 2P2DA 1NY6A 4KZKA 1H2AS 4S1PA 1QE3A 4C3OB 4D2IA 1TK9A 3EPRA 4CQLB 1AKYA 5J4LA 1OBVA 3NAMA 4DLRA 2RHMA 5CFLA 1E1DA 2I3AA 3ABRB 3BHIA 4ZCIA 5B2EA 1TC1A 4OHPA 4YIKA 2B34A 3EWAA 4MX8A 4C6RA 5KREA 4LF8B 3M33A 5FI5A 1Q1EA 1NC1A 3SS7X 1R5BA 3RJZA 3NBFA 2ZI5A 1XXLA 2WHPB 1NATA 3HR7A 2CMGA 3HWX1 3PHBE 3FIUA 3UV7A 3A6PC 2PXHA 1N2OA 2CL0X 4ARCA 1S3SA 3JQEA 3P2JA 5KUTA 1OFUX 3C8HA 3AB7A 5EIEA 2GAJA 4FKMA 1A7AA 3LT1A 3SU8A 5ED4A 2AT1A 1Z63A 4CR6A 3AEZA 1I9GA 4IAOA 4TLEA 1AN0A 2B3DA 2EZ4A 3OPXA 4AMGA 2HADA 3D8RA 5JQGB 3OKFA 4ISBA 4HHEA 4O59O 5HJ2A 2WMNB 4LF6B 2E55A 2XTNA 1JT2A 5CJPA 4WPGA 1F20A 5TDHA 1NVBA 1BDBA 2Y4NA 4QLBA 3H4MA 4U8HA 2NU8B 4K0KB 1QWOA 4FOPA 4MRRA 1DZ3A 4I4LA 3O93A 2OWDA 2C5EA 4GW3A 3O94A 4F86A 4W5WA 3ABQB 1RKXA 4IUYA 4UHFA 3K1TA 3Q85A 4PRZA 5DX0A 4B80A 4BX2A 1V6AA 2YV3A 4DA8A 5ALIA 2XMPA 2QZPA 4ZEWA 4LXUA 1D6MA 4AWXA 1NLUA 3KKPA 5ALUA 4DY4A 5D3MA 4ZI7B 1KRXA 4KPUA 3AR8A 2DR2A 2V6MA 5SZJA 2PGOA 2GPJA 3BXEA 5AKXA 4AVYA 5TGZA 2PKCA 4RQAA 4QIHA 3OT5A 4G5QA 3PPIA 1E9BA 2BFNA 5ALPA 1ODFA 2I22A 4AO6A 1G18A 5FUXA 3SXUB 2VJCA 5DMHA 2F8SA 2DTEA 4D8XA 2VP3A 2GHRA 5IAEA 3TSZA 4GE0A 3CIFA 3ZXXA 1SXQA 2BSQA 2P9GA 1OQAA 1A50B 1TLFA 4NZZA 2BFDA 3HA2A 4EABA 3P2IA 2BR4A 5AVWA 2PG3A 1WF6A 2WILA 2IHUA 2ZRLA 3TN7A 2J32A 1YBVA 2EX1A 4K8RB 4WK6A 3T3MB 1NJFA 2WW8A 3JARA 4GWGA 1JZQA 2IXTA 4O3MA 1C3LA 1SA0A 4YBZA 1RTKA 1LWOA 2P9YA 1L7OA 4IL5A 3S7TA 3ZLTA 1BMFD 1NTRA 3UAVA 2E87A 3GROA 4Y2RA 4OSPA 3M34A 2P6NA 3K0CA 4FEAA 1T8WA 4EG7A 1YRWA 5EJMA 3JD3A 4B3HA 3Q0TA 1HWYA 4HZUB 4UQLA 3GJ6A 1D4FA 2H16A 1U6JA 3DUWA 1L4MA 1T4CA 3KTDA 3P2KA 3SM3A 3KQVA 4ZT6A 1Y3CE 2YZMA 5IK2A 3R9XB 4WK0B 1P1HA 3UOWA 3AI2A 1I7SB 4XPIA 1TA9A 1ZCAA 2QRQA 4LNUB 1L5WA 2V4MA 2GPWA 2IDJA 4NCNA 1Z28A 3E23A 3HGMA 3OE1A 5FI3A 4YCBA 4Q15A 1Z9BA 3GN1A 3MGKA 3ZCVA 1OX4A 1VIAA 1R0XA 4IDFA 3UGKA 1XTIA 3SHWA 4EK9A 4OQNA 2XZDA 4DIUA 4M36A 2Q3HA 5CFQA 1FPMA 3CXRA 1DRWA 3ZBQA 1JQ3A 2WG0A 3NDBB 4BO8A 1P45A 4CUJA 2CWWA 1AUPA 3HU5A 3F9IA 4CTJA 1P8AA 3ZE9A 1WKCA 1G2OA 1S4MA 3L01A 1JGTA 2EKDA 2QZ9A 1B00A 3B48A 1NAHA 3W2TA 3IUMA 2IX3A 1WZIA 4P4LA 3NOQA 3T7CA 5AQ1A 1QHIA 3WAGA 2XEDA 4A4DA 2H52A 3BXPA 1L6RA 4C07A 1BWRA 2QTBA 4U6NA 2JZOA 2UZIR 5ADUS 4RVCA 4UU1A 4UHCA 4KWCA 4XIYA 4EGSA 4QEKA 5DM1A 3KDPA 1COWA 2FZCA 4CM3A 3TD9A 4FINA 1ZNZA 2MSLA 5FLYA 3SS8A 5JJCA 1GQFA 3I1IA 2R6GA 4QAJA 5I9NA 1QYWA 1K86A 5BORA 2BONA 3BWBA 1WPQA 1JBQA 1YIDA 2BFPA 2PJZA 5T3UA 3WG9A 3O21A 4COOA 4LJ6A 2GASA 5YASA 2Z30A 1RCTE 1RC8A 1YTLA 1DHRA 2FN8A 3JRXA 3KALA 4BMXA 4MUIA 4LHVA 4DJEC 3Q8XB 1TM1E 3K0CC 4M21A 4WEQA 1PL0A 2I3DA 2Q1TA 3P0HA 3HFJA 2EJCA 5I9IA 3ICPA 1VMIA 3SQMA 4LTDA 2ZVDA 4LHEA 1ZWKA 1FTSA 2H2WA 3HQ4O 3QVXA 4N54A 4NNJA 4NS4A 2QX6A 3NTVA 5ALFA 5EKXA 4MB6A 3TG8A 1MJHA 4OOFA 2GXQA 5KOHB 4YXWD 2QTGA 2VXOA 3FVTA 1QC5B 1W85A 1XK7A 3LX5A 5EXEA 4YAGA 4I5GA 4B44A 1NW3A 4R1LA 2GFIA 1AC5A 1X86B 2FDRA 2ZI7A 4KP7A 4DTCA 3RUCA 2XXAB 2XB8A 1GLGA 4E13A 4Z1OA 1R88A 1PLLA 3GEPA 3DTVA 2R8EA 4GYKA 5A9TA 4OAQA 2CLKB 5FBZA 5ALNA 1JTVA 3FTQA 3GJ7A 4OCZA 4FEYA 4TXJA 2FW1A 1XQVA 3PGXA 3V9AA 5AKIA 1VKHA 2AD1A 1DKRA 1NM5A 1WPXA 2QRLA 2YWEA 1QOQB 2CVQA 1FLNA 2NTJA 2XYVA 3DT6A 3GRAA 3T7IA 4D9CA 3TZCA 3RS3A 1LB1B 1K89A 2P4UA 2C3YA 3V7UA 3R7BA 3MMPA 1NFRA 3QKRA 5C1OA 5LVAA 5M2QA 2PZKA 4E2FA 1ADBA 2J9XB 5EWMB 1S89A 3KOMA 4ZCLA 1V47A 5ALJA 4H1HA 2I4TA 5IULC 1ZSNA 1UXHA 3A0RB 3PFKA 3S68A 4DSAA 4M53A 2OFWA 4RD4A 1L8QA 2VP9A 1JHYA 4H4EA 3NPAA 5NLLA 2AJBA 3SDSA 1IQPA 2OLJA 1YB4A 1FW6A 1VPDA 1LWNA 1P4SA 1PV1A 1S1MA 1Z6TA 2EV9A 2BISA 1IXZA 3HVRA 1G98A 4ZGWA 2IS6A 4IG9A 3M4XA 2KW5A 3EIUA 3FCYA 3ZS8A 4JNKA 3DEZA 4F5YA 1JG2A 5KYUB 1DO8A 2R47A 2WD7B 3KFXA 3DFKA 4KRYA 1PZMA 1GL6A 1VB5A 4EGCB 5A02A 4IFBA 1H0SA 5TGDA 1PGPA 5TT1A 2I99A 4A91A 3E4CA 3AY7A 5DI3A 2G25A 3ZLVA 5ADVA 4IMPA 4TQAA 4ZZIA 3HACA 4KQWA 4I3GA 1HGXA 1HRDA 5F3RA 3GVCA 5HCUA 2Q8PA 2W42A 1B0ZA 4HRAA 2WOJA 1PDOA 2HLPA 3MTAA 1QFXA 4YI5A 1VSTA 3TCXB 1FW8A 3GRYA 3PGA1 2WSYB 3ANMA 3QFTA 2I66A 4OJMX 3QF4B 1SCUB 1Z15A 3K0EA 1JN0A 1XL1A 3V1LA 2JFZA 4QM6A 3CZQA 5KPDA 1SB9A 2O1SA 2XUZA 5I8WA 1N7GA 3ETCA 5A7HA 1YZ3A 2H0AA 2X0KA 4CMIB 3MJFA 5FL7A 1QCYA 3UMRA 1DVRA 3Q9SA 3DMTC 2PS1A 4J6EA 5FBLB 5A6SB 5CPBA 4ENUA 3VHXA 5K0JA 1KI6B 3FVWA 5LQSA 3MT0A 1G6Q1 3AW8A 3HZZA 1KPGA 2EDAA 3W5VA 1RQNA 1RE1A 3PGJA 2XOKD 2ZREA 1CY6A 3QLJA 1LPNA 3W6ZA 4ADSG 4KO4S 4I99A 3ZHSA 2BEKA 3D6HA 3WQBA 5LXTB 2Z95A 1NRXA 4C3UA 8GPBA 5BRJA 2GPYA 1FXWF 2IUYA 2JGMA 3RUIA 1Q74A 5E7QA 4M8SA 4ZT4A 4GSLA 1SCNE 1IZ9A 2ACKA 4R5MA 3VPSA 3D1LA 4IW3B 1NC3A 3DE2X 4L4YA 3BK2A 4FFLA 3AM3A 1VE3A 4XVQA 2XRYA 4MUXA 3U5TA 4W5NA 3UQZA 2LXNA 3WQSB 3IOEA 3LV8A 4FBLA 4DB2A 1HDYA 4IX1A 5AOCA 2BFFB 4K7JA 3FWPA 2QYSA 1OFHA 1OIVA 3HSYA 2DQSA 4OD0A 3T9FA 2I7XA 1RM0A 2VVTA 2WM2A 4BRWA 4C1BA 4C0JA 3P9CA 2JAWA 2RHCA 3P0EA 4HUQB 5B3AA 1RRKA 5EJAA 3H5AA 2PT5A 4BRUA 1Q50A 3HNOA 3Q3CA 1DKUA 4LDNA 3CUSA 2H08A 2RGDA 3ILYA 1IM5A 5FNZA 3W2HA 3E8MA 4C04A 1W36B 3UWOA 4XGKA 5BUZA 4KHZA 1FXWA 2GAIA 2XBLA 4CEHA 3EDRA 1NF3A 3VR4D 1F38A 2PBZA 3GELA 5ALHA 1OREA 3WWPA 3I5AA 3WICA 4FP9A 2GHTA 4PICA 1C3EA 3RSLA 1C7QA 2WWXA 3LP8A 4BU1A 1DL5A 2IF2A 2RKOA 4GX5A 4IH1A 5DHRA 4JGBA 2HMYB 4CKYA 3NX4A 5TF4A 4MRVA 4WFJA 1UDCA 4DIDA 2C7RA 1KQPA 2CSXA 4M0FA 3JASB 4GICA 5REQB 4X8LA 1G3QA 2PN1A 1U2TA 1DARA 2VNKA 3H0CA 4FBMA 4ENRA 3IKTA 2OM2A 4PNEA 4GMFA 2AC2A 3LWDA 1UDBA 5EKUA 4RPHA 3H42B 4DWWA 2I3BA 1TEVA <