2OZJA

Crystal structure of a cupin superfamily protein (dsy2733) from desulfitobacterium hafniense dcb-2 at 1.60 a resolution
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
110
structure length
110
Chain Sequence
MARLKNLPQERPLPLASLIEARENQVLSMALAQSDRVQISLFSFADGESVSEEEYFGDTLYLILQGEAVITFDDQKIDLVPEDVLMVPAHKIHAIAGKGRFKMLQITLID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Cupin 2, conserved barrel (EAT53321.1) from Desulfitobacterium hafniense DCB-2 at 1.60 A resolution
rcsb
source organism Desulfitobacterium hafniense
molecule tags Unknown function
molecule keywords Cupin 2, conserved barrel
total genus 18
structure length 110
sequence length 110
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-02-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2ozjA00
4FAGA 4MGYE 3LA7A 1YLLA 1RUOA 2K0GA 1O3RA 2PTMA 2H0VA 3NW4A 3KCCA 3KSCA 4J1WA 3CLPA 5JSRA 4P9GA 1EPZA 4IEPA 1Q5OA 5CU1A 4UBHA 3ES4A 4BIFA 3RDIA 5KHKA 4MV2A 3H3UA 3DV8A 4LTAA 5FQ0A 1CGPA 2BNMA 2B9UA 3SXWA 1H1IA 4Q0QA 4YRDA 3MPBA 1O5LA 4I02A 4LLOA 5AVPA 4JTOA 2PFWA 4E2SA 2EA7A 5C8WA 3OTFA 5I0UA 4MZUA 2UYBA 2GC2A 2PHDA 1NE4A 3E6CC 4HVOA 4I0AA 2I45A 4LA2A 3E5UA 3HQXA 4MGIE 1QXJA 3IIAA 3U0ZA 5HI0A 2ZCWA 3RYRA 4PJYA 2EVXA 5KHHA 1QWRA 1U12A 4META 4IEVA 4PIZA 5I8SA 5JAXA 2VECA 3H1MA 3G7DA 4MH0E 2H6BA 1RTVA 1CAUA 3H50A 3NJZA 4I01A 3E6DA 5BPXA 3IDCB 4XFIA 3CJXA 4EROA 1O3QA 2PQQA 3ROUA 4EV0A 2D5HA 4ONUA 2GAUA 2FMYA 4YSFA 5I91A 3OD0A 4R8HA 2IXKA 3SMHA 4HVQA 2VQAA 5LRRA 1J3RA 4NVPA 4FAHA 1YFWA 5F1RA 1LKNA 2UY8A 4D7TA 1FT9A 2QCSB 2B8MA 1IPKA 1CAWA 1ZX5A 4WVZA 4ZU5A 3NKTA 4PIYA 3RNSA 1X82A 3LA2A 1J58A 5FLJA 3LWCA 2F4PA 4YARA 5J3UA 3RPQA 3E6BA 4JTNA 4UBGA 4QXKA 2ET7A 1WGPA 5EFUA 2O8QA 4Q0VA 2ZKLA 3CL1A 4ZU4A 4XFBA 4X6RB 2O1QA 3WW4A 3USSA 2GC1A 4HLTA 3CF6E 3SCFA 3H1YA 1X8MA 5I0SA 4I3PA 3M70A 3UKVA 4AQ6A 4RD7A 1RGSA 3RYPA 5KHJA 1J3QA 4LEJA 1GQGA 1OFNA 2BNOA 4QGNA 5LRSA 1ZZBA 4KL1A 2BGCA 2IXCA 5I0TA 4E2QA 4HZFA 3I59B 4XFFA 5K8SA 1IPJA 3SCHA 5D1IA 1LB2A 2BYVE 3DKWA 3D0SA 4K8FA 4F7ZA 3NL1A 1L3JA 4GULA 1WLTA 2D40A 3WW3A 3EQEA 3HT2A 4HSJA 1O5UA 2WC2A 3EBRA 4KWKA 1QXRA 4ORFA 4XEZA 1QY4A 3OCPA 3IWZA 1Q43A 2PA7A 3FE5A 4MX3A 3BB6A 1NZCA 1EP0A 4HBNA 4EWEA 5FPXA 5LEJA 5KHIA 1YFXA 5KBFA 3FJSA 1DZRA 4MGKE 2XL9A 4E2GA 3U11A 1G6NA 4QM9A 3H7YA 2ET1A 1DGRA 2K9ZA 5I0RA 2ETEA 3DL3A 3FWEA 1CAVA 4LA3A 3M3IA 4FBFA 4KWJA 3U10A 2GC3A 2P17A 4XFHA 2XLGA 2C0ZA 4J1XA 3E97A 4A2UA 2IXHA 5T3NA 3EO6A 4WBBA 2IXJA 2EAAA 3R6SA 1NE6A 4IEUA 3NVCA 3RYKA 4HVRA 2Y0OA 2QDRA 1RL3A 3PLQA 3QACA 4QX5A 5JCTA 4PIXA 2E9QA 3TNQA 5BXXA 3RZZA 2QNKA 3KMHA 3DN7A 3MZHA 1DZTA 2OZ6A 2PHLA 4BHPA 2CV6A 1VR3A 1VP6A 2OYZA 1I5ZA 3ST7A 2UY9A 3S0MA 3PVBB 4Z82A 4ZU7A 2B5HA 4LUKA 3E5XA 3E5QA 1Y9QA 1VJ2A 5LEKA 2QVSB 3TNPB 5JSPA 4HN1A 2VPVA 4H7LA 1CX4A 2PAMA 3HT1A 4XFAA 4XF0A 1O3SA 4QMAA 3H3ZA 1YFYA 2BNNA 1Y3TA 3QOPA 4XFCA 4EWAA 4YNIA 1LR5A 3FFQA 2GU9A 2D93A 3BPZA 1YUDA 4JVAA 3MYXA 4L2NA 3D82A 4TLFA 2MHFA 4QGLA 1ZRCA 4F8AA 2Z2SB 1RUNA 5EZWA 3KGZA 1X7NA 5FLIA 1UIJA 2DCTA 1ZZ9A 3EHKA 3ES1A 3HIFA 2CAVA 3IDBB 3SHRA 1SFNA 5I8YA 2IC1A 3H7JA 2PAKA 4XF9A 1TQ5A 4AXOA 1OMIA 2KXLA 2Q4SA 4LUMA 2IXIA 4KU8A 3VHRA 2XGXA 3UKNA 3S7EA 1CAXA 1SEFA 3OF1A 3BCWA 1NYWA 3LOIA 1CAWB 1J3PA 3SCGA 1PM7A 2MPFA 4I09A 5I8TA 1ZZ6A 2UYAA 4OLLA 4CYDA 4D7SA 4JV4A 4EWDA 4Q29A 1ZRRA 3GBFA 4WZCA 4XF3A 3N4MA 1FI2A 2Q1ZB 3JZVA 4OFGA 5CADA 1XE8A 2CAUA 4IERA 3BALA 2XL7A 1YWKA 3EJKA 3LA3A 5C6CA 3KGLA 1J59A 4N9HA 3FHIB 4Q0PA 1ZVFA 3GYDA 3WW2A 3S7IA 5I93A 4AQ2A 2QJVA 4QGMA 1UIKA 2Q0AA 2XLFA 1CAVB 4BH9A 3L2HA 5J48A 5JR7B 4I0BA 4BYYA 2ATFA 3ZDSA 1OD5A 2OA2A 3H8UA 4UXAA 1Q3EA 4Q0UA 5E1RA 3FX3A 1NXMA 3PNAA 2Q30A 3BU7A 1UPIA 4XETA 1H1MA 1ZRDA 1HW5A 4XFGA 4IEQA 4IESA 3CO2A 2FQPA 4HN0A 1SQ4A 2D5FA 1V70A 2GH2A 3D0JA 5J7MA 5FPZA 5BUVA 1FXZA 1CAUB 4IETA 3C3VA 4HMZA 3H1WA 3FZ3A 2MNGA 2IXLA 2OZJA 5E16A 1JUHA 3ACLA 1J1LA 2CGPA 4L11A 4IEYA 4X6QB 4XF4A 5FDBA 4KWLA 1UCXA 2V09A 4XF1A 1CAXB 2PAEA 3UKTA 5BY5A 4AVAA 1LRHA 2PYTA 1ZZCA 2XHKA 4KU7A 4AVBA 1YFUA 3O14A 5BV6A 3I7DA 4B29A 2N7GA 4LULA 4MGZE 1PMIA 4Q0SA 1RC6A 4N9IA 1YHFA 4YYOA 1ZZ7A 1ZRFA 2XKOA 1O3TA 4FT8A 3NSTA 4IEZA 3WW1A 2OPKA 2XLAA 3ETQA 2HKXA 3CEWA 1DGWA 1XRUA 3ELNA 4DINB 3LAGA 1EYBA 5KHGA 3OGJA 1XE7A 1ZNPA 4O9GA 5FLHA 4IEXA 1WA4A 2WFPA 4HSLA 4AVCA 1I6XA 5CVRA 4IEOA 1ZZ8A 4R52A 3B02A 3LZZA 2XKPA 1X8EA 1EY2A 4QM8A 5JSOA 5FQ0B 2Z69A 4I2OA 3I54A 4MUVA 3I59A 1UD1A 1ZREA 2HJIA 2GZWA 2H6CA 4IEWA 1O4TA 3IBMA 1GQHA 1UW8A 2GC0A 4Z07A 2BEOA 4O9EA 1O7FA 1OI6A 3H9AA 5FCCA 3MDPA
chains in the Genus database with same CATH superfamily
1HB1A 1J83A 3LA7A 1YLLA 2XJTA 3R05A 3BTXA 2PTMA 2W94A 2EIGA 4A4AA 5FYIA 1XXNA 3WP5A 4J1WA 4YM2A 3GZEA 1EAH3 5C70A 3K77A 3DKQA 4K8RB 5CA6A 3AYAA 4UFJA 4JX0A 2VUAA 1RUG1 1VMFA 3JD71 4Q4V3 3OBRA 3TEXA 3NAPC 4TZDA 4FFFA 2LW8A 4IEPA 3K3NA 2G9FA 4WM8B 4BIFA 2CDOA 1YJLA 1TG7A 3ZR6A 4FQZA 4BQYA 1RUJ1 5KHKA 5LY1A 2QQLA 1E5HA 5F5IA 3V65A 1VBC1 4L0PA 5FPUA 2D6KA 2XXZA 2HWB2 3JBG2 5D8AA 5IT6A 2B9UA 4Q0QA 4YRDA 4N7IA 1REEA 3MBWA 3AP4A 1NT0A 4ISRA 5K0UB 1OKOA 1WCDJ 2HWB1 4EQVA 5A7PA 4OQ8A 4M3CA 5LA9A 1VBC2 5C8WA 1W8OA 3PVEA 4BDVB 1KFXL 2UYBA 2OXBA 4N53B 5K0UA 2R1DA 3E6CC 4OQ9A 3ZFEA 1XNTA 1SFPA 3VBOC 1WMFA 5FO9B 1YQCA 4AFCA 5T5OA 3U0ZA 1K42A 1HQNA 2DTYA 3HQUA 1E5SA 2VU9A 5F5AA 2JG9A 2O8OA 3MEPA 2UWAA 2VZOA 3OUHA 3ME2A 3FUQA 4NRQA 1AR73 2BVBA 2W2IA 2W91A 4META 3ZDVA 2WS93 2Q8DA 3AMPA 4DQAA 4ZXKA 1S0DA 1UYXA 1REDA 3WUDA 5H9QA 1UNBA 1UX7A 3H1MA 5FR3A 3AFGA 3G7DA 1GANA 1CD3G 2V72A 2H6BA 3B00A 5FYTA 2VZPA 3WQ0A 4A3ZA 1SZBA 1CAUA 3RG0A 2XPJA 3VKFC 3TEYA 1ENRA 1PZ7A 1RVF3 1OBNA 3HOBA 1GWMA 5IVBA 1RUI2 4XFIA 2J1SA 3J4UH 4FOWA 2PQQA 1HDKA 2JG8C 1GZWB 4BE3A 5LCWL 1TMF2 4XJZA 4DY5A 2RS13 2D5HA 1UOJA 3I2GA 1QHDA 2GALA 2GAUA 1PX3A 1SBDA 2WZR1 4LKFA 3OD0A 1FV2A 1F4AA 2IVIB 5FTTC 2HWD3 4DXTA 4EZHA 3B01A 3ZYJB 3AZVA 1DU3D 4AR2A 4ASMB 4LBLA 2LM3A 4NVPA 1LHVA 3IPVB 1QIQA 5F1RA 1WW4A 3AKPA 5GLUA 3LD8A 4BQ2A 4BOWA 3ACFA 2B8MA 2QQKA 3NNJA 3POEA 4GJYA 4I3GA 3VBUB 3B9CA 4YVSC 4AI2A 3OB8A 3AL6A 5GLWA 1EV11 4V2VA 2ORXA 1K5MC 1SLLA 4F83A 3O1SA 1MR5A 2FZ1A 2WWUA 3T1MA 3WDVA 3DPRB 5CFDB 4UFMA 2HBUA 1LGBA 3RNSA 4XABA 1J58A 1ONAA 3LA2A 2AACA 1IQDC 4JHTA 3MIFA 4RR3C 3JXSA 2Z42A 5F3GA 3TEWA 2QZ3A 3D3AA 3JUUA 3WNOA 4UBGA 3O1UA 5HV4A 1LENA 2YB7A 3PUSA 1YEWA 5JLVA 4CSWA 1WGPA 1GKBA 4PBOA 1K45A 3HBZA 4GALA 1ENXA 1NLSA 3LOBA 1AL21 3CL1A 2ZJCA 3K4AA 4NRMA 4YW1A 5FYZA 3NJYA 4CCMA 3U78A 1FMD1 3AYCA 5FMOS 4PLNA 1A34A 1HV0A 4JGZC 3WW4A 2QQUA 4HLTA 3VBHC 1LHNA 2VH9A 4QQOA 3CF6E 2IFWA 4XBNA 2G1MA 1ASJ3 2Y6JA 4LBOA 5K4LA 5LW9A 1D4M3 5I0SA 5C8CC 1WMEA 2QKDA 2VVFA 5FJHA 4RD7A 1RGSA 1R093 2VM9A 2QQIA 1NCQB 2BW8A 1W90A 2QQVA 1CN1A 1GQGA 1U5YA 4AL9A 3LEIA 2BNOA 3T30A 2JB4A 2BGPA 2IXCA 3MW4A 4KL1A 5FZCA 3WEZA 3BN6A 3LGRA 3K48A 5IK4A 4GXLA 4HZFA 2VOTA 3I59B 3KS7A 1JYWA 4RN5A 1CR7A 2BYVE 3DKWA 2BGOA 2LTNA 4FI9A 4OULA 1W6PA 1VBD3 2EALA 4KGGA 1WKYA 3RWNA 1L3JA 5CISA 4LBQA 2ZHNA 4GULA 1G9DA 4KWUA 4FTEA 1HB4A 3WW3A 3EQEA 3H3LA 4HSJA 4B1MA 1JN2P 1O5UA 2YGLA 1W99A 2NM1A 2J1UA 2W46A 1W6PB 1AYM3 2E51A 2Q1FA 4QPIC 1ZYBA 3ZSEA 1W9TA 1ULFA 3A0NA 1ZM1A 4XILA 1EV12 3GCWA 2ARBA 3WG4A 4MX3A 5APAA 4QPGC 1UO9A 1B35C 1EP0A 2VMGA 5CFDC 4EWEA 2YC0A 4XYXA 4LBKA 1E5RA 4HXCA 2LROA 1YFXA 1G7YA 3FHQA 3WX5A 3WOGA 1D2QA 5FZ7A 3S5AA 3NJXA 3D6EA 2YV8A 4QB6A 4E2GA 2HWF2 2RDNA 4GH4C 2ET1A 3Q8EA 1DGRA 4TXWA 1V6OA 3OEBA 5I0RA 2XBO3 3FWEA 2VTXA 3ASIA 2YYOA 5E88A 5FWJA 3ZYFA 1NXD1 3M3IA 1RUI1 3KCYA 1ASJ2 2E7QA 4KWJA 3VDBA 4FP3A 3GGLA 1OURA 2TUNA 4J1XA 3E97A 4RSUA 2WSUA 1ULOA 1AR62 1GQPA 3CQOA 2FZ2A 1BEV2 2W0XA 3PUAA 1YQ6A 1N3QA 3BIWE 1C8M2 1FYUA 1O4ZA 1ULDA 3ON7A 4IEUA 1SBFA 4W6WA 1RL3A 1UKGA 1UYYA 1K5MB 4YM1A 1KS4A 3ZXGA 1LULA 5IYYA 2ADDA 1R1A1 4XJUA 4AVVA 1BZWA 4QX1A 1G9BA 4S2DA 1GOGA 1GZCA 3KMHA 5BNQA 3RSJA 1ODMA 3ZVXA 3ZPOA 4Y22A 4CU9A 1LNSA 2ZMNA 3UETA 5DAXA 2OYZA 2IVJA 3JQXA 1I5ZA 4LBJA 2UY9A 4NRPA 3PVBB 2H0BA 4XUNA 4Z82A 3Q8BA 1DDLA 2PLV1 3O1VA 1UMHA 3UGHA 1XNDA 3KZ4C 3QD6A 1Y9QA 1JYCA 5LEKA 4RL7A 1RYYA 2FBEA 3TNPB 1GNHA 1XNKA 1CX4A 1COV1 2HH9A 5E8AA 1QGLA 3KHBA 4RGGA 2VBBA 3HT1A 4XFAA 2GP5A 4K1YA 5JOXA 4TSVA 5A7WB 3PTYA 1AR83 1BQPA 1AX0A 3LQCA 1FAYA 1G9FA 5LASA 1WW6A 3IT8A 3ZM8A 5IVEA 1BBT3 3KV5A 3ZYGA 3MYXA 3MIBA 1PZ9A 5GJ6A 4LQRA 3NNMA 2MHFA 2BDRA 3AK0A 1ZRCA 3VUOA 3VN4A 2WNVC 1XOYA 3CMGA 4H7MA 2AGSA 3KGZA 3M3CA 2VZ3A 4XAAA 1X7NA 2RHPA 4NAMA 1RUC1 3J9SA 2JDZA 4HETA 4IGPA 5C5TA 2YGMA 5JR2A 2VVDA 4UW3A 2EIDA 3SHRA 2JG9B 1O8SA 4JGYB 5FO7B 5A3TA 3HPNA 4YW7A 4D8MA 1PO22 1RITA 1YIFA 2KXLA 2Q4SA 1ZA4A 1KDMA 4R4ZA 3T4VA 1C8M3 5EYYA 3O0XA 2Z79A 2YUEA 2XGXA 3Q8AA 3I97A 1C3HA 1OC1A 4V2WA 1VBE1 3HBKA 1E57A 3OY8B 3ZXDA 4AK3A 1SEFA 3B7MA 5M0TA 2SBAA 3OF1A 4YVWC 3LOIA 1U5IA 2W1QA 2C1FA 2O14A 1T6GC 4LO7A 2VMFA 3DGTA 2D6NA 1W06A 2RS53 5DZGA 3KWVA 4CYDA 3WDWA 4EWDA 1NQDA 4YG0A 1OQ1A 2QDNA 1F5JA 1T6BX 1SLCA 3RVHA 2JIGA 1PGL2 1HXS3 1W6NA 4AEJA 5C3OA 4WM8A 1FI2A 2YMZA 3PUHA 3I49A 3A4UA 4A42A 1CZTA 1MQTC 3U1XA 4WVVA 5K0UC 2XQXA 4P02B 1UOFA 2CAUA 1XJAA 2PLV2 2RG4A 1C5HA 1UU5A 2CWMA 3LA3A 3PTRB 4QX8A 4RFT0 3QBQA 4YLZA 3WT3A 4AZZA 3LEKA 1J59A 2PHRA 5LBCA 2WKKA 1RUE1 3DPRA 3WW2A 2W3JA 4Q26A 4XDPA 3S7IA 4DS0A 1R1A2 2R30A 1RUG2 1LHOA 1W2UA 2F17A 2ZX3A 1OOPB 1W9FA 4I0BA 3SKVA 2FHRA 3ZDSA 1OD5A 5C4WB 5BNOC 4Q0UA 1ND2B 5E1RA 3VBSB 4YZ1A 4OUMA 3FX3A 4EN8B 1OUSA 1NXMA 5LA1A 1GZ9A 2Q30A 1LECA 1UMZA 1IQAA 3BU7A 3ZFEB 1GWLA 2WBKA 3M2MA 4OZXA 2RS12 1HQWA 1SLIA 4QQPA 4Y26A 1H1MA 4O61A 1ZRDA 1HW5A 2G9GA 2CSGA 1US2A 4IESA 4IEQA 1HB2A 3U37A 1WMDA 1UY4A 5LBFA 5G04L 2C4XA 2GNDA 4BLIA 4NMIA 1PIV2 1HN0A 4G3YC 4CCCA 4HANA 1BMV1 2HYXA 4I30A 2OQ7A 1LOAA 5FPLA 1UZ0A 4HFSA 1RUF2 4LOTA 2E32A 1DGWX 1MS4A 1FPN1 4ISQA 4QD2A 5FPBA 1DQ6A 4QX7A 5FIXA 1CAUB 3CIHA 3ZOIA 5HPOA 4LNVA 3ECQA 2XMLA 1W04A 4UWDA 3HEIA 3TEZA 3RZJA 2WNUC 1HJGA 4YZ2A 3H1WA 2J22A 2XVGA 1JU3A 4CDXC 2MNGA 3W20A 3WY6A 1BXHA 2HLEA 2Y8KA 4LK7A 1C8NA 4N90A 4QDRA 4ZZ8A 1AYN3 1W8TA 4OMCA 1BKZA 5JUVA 2WIIB 2DBNA 4AHYA 4ASKA 1W28A 1J1LA 5CIRA 1VAKA 5FZDA 4QPGB 1UMIA 1WA6X 4IEYA 4NPRA 1LEDA 5FDBA 4KWLA 3POFA 2R0FA 1D7PM 3CZJA 2KM2A 3GHMA 3MHZA 4FFGA 3UK9A 5H9RA 5HV0A 4OI0A 5FY0A 5BY5A 4AAXA 2NN8A 3POGA 4Q4W1 3BOWA 1G9AA 2Y6KA 4QKNA 3MI8A 3VBRB 2XHKA 3EMRA 1YFUA 4COVA 3U07A 1Z7S1 5HCBA 4EJRA 2HEVF 4LULA 4YW5A 3SH5A 3H42B 2VOXA 5FZ3A 4CEWB 4YZ3A 4NIDA 3KF5A 4RGKA 4FPOB 2RM22 4N9IA 3J7LA 4MGQA 1YHFA 5FYUA 1RUD2 3LF7A 1AF9A 3VL9A 4UFLA 2HWC2 2WINB 2AYHA 1QJU1 4FT8A 1P8JA 4FVVA 1AVBA 1R092 2AEYA 4GH4B 4E4SA 2R1BA 4FPEA 3CEWA 4XE9A 3W58A 1G8WA 5FO8B 2GNBA 3I3QA 1AR92 3LAGA 3VDDB 5BYNA 1GP5A 1W05A 5KHGA 2LUWA 4WVWA 4O9GA 3DECA 3G6JB 4IEXA 3LDRA 3ZN6A 4HOOA 1GR3A 4NPMA 4AVCA 2ZZJA 3M4FA 5KWRA 3WD5A 2DCYA 2GNTA 3MIEA 3B02A 4R52A 5FBZA 1U5XA 2XB6C 4L8QA 4HG6B 5FYSA 2XKPA 1JW6A 4NIIA 2AH2A 5FZHA 3BTYA 1QJFA 3WHTA 5JSOA 4K40A 2JE8A 4XHBA 1FX5A 4JDMA 5DN2A 1AYM2 1UZVA 5CKMA 5FYVA 2JJ6A 4I2OA 1H30A 2A7AA 3U14A 5DG2A 3ZYRA 4CDUC 1R64A 3VBRA 4HKWA 2P3JA 2YDEA 1OPMA 3JU9A 4RQPC 2VULA 4B1LA 5D2AA 4Z07A 5IVVA 2BEOA 3LDKA 5GKAC 3WF0A 2FDJA 4LO4B 2JIJA 2VZ1A 3UYJA 3MDPA 4FAGA 3WNPA 1TZOA 1RUOA 3PVOA 1ULEA 5GZDA 3UJOA 4EYUA 1YQ2A 3KCCA 4BJ0A 1QU0A 3VD5A 5JSRA 2A6YA 4KMQA 1X9PA 3DF0A 4GMP0 1EPZA 5FK7A 2A6ZA 4M3CF 1F15A 3FHAA 1UYZA 4HKOA 1Y9GA 4IE7A 5CNAA 5DDJ2 3THCA 4XPVA 3HNMA 1S0EA 2DYCA 2RM23 3I2OA 3N7LA 2VXRA 4XMIA 2W1SA 1ZBA1 1BK1A 1UY0A 1CJDA 4LPLA 3DV8A 3DCQA 1HRI3 3USUA 5FQ0A 4CDWA 1MS9A 4LR4A 3H8RA 2BNMA 1SLAA 3SXWA 1VBB1 2W92A 2XG3A 3MPBA 5J09A 4I02A 4LLOA 5AVPA 4YPJA 1A78A 4UF0A 1CPMA 4AEDC 2VQ0A 4R4XA 5GLTA 5IJRA 1JHJA 2VNVA 1NA1A 2ZMLA 4K1ZA 5A7OA 1LOGA 3GJBA 2GC2A 2PHDA 2ZEXA 1WCUA 4K20A 4R9CA 3J8F1 3QCWA 3CKHA 1APNA 1OVSA 2WL1A 5FYHA 1JZ8A 1ND2C 4LXLA 5JWPA 4QPGA 3RZHA 1JI6A 1QXJA 1W8UA 4JGZA 2AENA 3IIAA 1Z7S3 2VW2A 5HI0A 2XUMA 1V6IA 5ACA1 3POBA 2ZCWA 3RYRA 1U12A 2XJPA 4Q4W3 4OI4A 4LHNA 4PIZA 5DAQA 4A7YA 2VAUA 3J26N 1YXWA 2VECA 1N1SA 3M8LA 4YW6A 3AJZA 4MH0E 1W6QA 2A5ZA 4UFHA 4XURA 2NPIA 1AR82 5FRAA 4CP1A 3NJZA 4I01A 3E6DA 2JG8B 1PX4A 4PDWC 5DAPA 1R083 5FMDA 3ROUA 4CPBD 1IS4A 2P3IA 3IKWA 2FD8A 3WSOA 4K21A 4EV0A 3SH3A 4ONUA 5DABA 1YNAA 3KF3A 2FMYA 4XW3A 4IQPA 3WHUA 3MF9A 4R8HA 3ZYPA 2SLIA 4QKDA 2B39A 3ACHA 4LHLA 3T2QA 2C24A 3POWA 4XDOA 2V5DA 3SMHA 1FPN3 3VDAA 3IDEA 4BIOA 2D6PA 1FV3A 2XWJB 1LKNA 1MQTB 2UY8A 2WLQA 3ZSJA 3ZYIB 4BQ5A 4D6RA 2BZDA 2D43A 1X9TA 4N43A 3ZO0B 3PVNA 2CWSA 2ZEYA 1SPPA 3VBHA 1CQ9A 2RS32 1TME2 3VZJA 4UI9L 1AR91 2FDIA 1DLCA 3N36A 1Q8SA 2X5IC 1OLME 2DVBA 2EXJA 5J98B 5FUNA 3WQ7A 4COZA 4YVWA 3NKTA 1SCSA 4FP2A 5FY5A 5AC91 4PIYA 5FZIA 4XTPA 1X82A 5GALA 4A41A 1XU2A 3VGIA 2X10A 4BU2A 5F6LB 4CDQB 2F4PA 1N1TA 3I4IA 4AW7A 1B09A 5A7QA 1OPOA 4COYA 4CZSA 5C33A 4CUGA 5IAXA 3E6BA 4D3WA 3VB9A 4XQDA 4JCKA 1KS5A 1VIWB 4GWNA 2OVUA 1QJX2 2VZSA 2X5IB 5EFUA 3VZOA 2O8QA 2R073 1UPSA 4Q0VA 2ZKLA 4GWIA 1QNWA 3IMMA 1KJRA 2TEPA 3FMGA 3K51A 3LFMA 3NV4A 2XWBB 1SBEA 4ZU4A 3VKLA 3SH4A 3KB5A 4AGGA 5G05L 3RGBA 2GC1A 3SCFA 2D6LX 1C28A 2VUJA 1RMU3 1W39A 1XQNA 1X8MA 1AJOA 3TN93 4PHZA 4EE2A 3UKVA 1RMU1 4NROA 3VDCA 4NHMA 4AQ6A 1SDWA 5CG8A 2A1XA 3WNKA 2EXHA 4CU8A 2XR4A 1RUH1 2LS6A 1UZWA 3U4SA 1HXS1 5LRSA 2BGCA 1NCQA 1A8DA 4W65A 3Q8FA 2VZTA 4Y4RA 3RQ0A 1WBLA 2VZRA 5A1LA 2PN5A 3SCHA 5IFTA 5D1IA 5C9AC 3OPZA 4RHV1 5FMCA 4AI8A 3BVCA 2AEZA 5JXIA 2HBTA 4ZKTB 5EHDA 2C9AA 4F7ZA 5DZFA 4TTGA 1JXNA 3F95A 2JB8A 1F9KA 1WLTA 3AMHA 3I3BA 4XBLA 2C9KA 2QFEA 1NY71 1JZ2A 1GOHA 2WSVA 3OGGA 2WC2A 4OHVA 1OH4A 3MPPG 2LRPA 4MLOA 3B5LB 3AVRA 4DUVA 1JU4A 4ORFA 4XIKA 5AC93 1QY4A 3O5SA 1JZ4A 1MVEA 2CHHA 2HWE2 3EB7A 1Q43A 2PA7A 3RWKX 2W1WA 2WZEA 5L7OA 2W87A 2HYKA 3IMNA 5AFEA 4ZS2A 2Z4FA 4NE9A 2BFUS 4YGDA 4GH4A 2E7TA 1RUF3 2R061 3O1PA 4CPBA 4JHZA 5KBFA 3FJSA 4CUCA 4P9JA 4MGKE 4CP0A 1V6KA 4XUPA 4RHV2 3WP6A 5KC6A 1NG0A 1G6NA 2B9VA 2IUWA 2YBKA 3HAGA 2G9ZA 2XONA 4N43C 4CRQA 3CJIA 1RUE2 2BOJA 1F2NA 2D97A 2QQMA 3OBAA 5HBAA 4FPHA 2K9ZA 2ETEA 3DPRC 4GZ9A 1NUKA 5T50A 4LA3A 5JI9A 1V00A 3VBFA 4FBFA 3U10A 1RMU2 3O7OA 1AR81 1R081 1DZQA 3ORJA 4XFHA 4W6XA 5F37A 2C0ZA 2A3XA 5BNPC 4C91A 5DAWA 5T3NA 3ZSKA 1ND3B 4PT6A 3WUCA 5FZ8A 3KD4A 2KR2A 3R6SA 3ZN5A 1PNGA 4FFHA 4B4RA 4FTSA 1KITA 4AE2A 5C9AB 3U75A 4HVRA 5A33B 3PLQA 5C71A 4QX5A 5ANNA 5ACA3 1KRIA 4J25A 4IL7A 5BXXA 4LOSA 2G19A 3RZZA 1W6QB 2QNKA 3J8F2 2WRAA 1S2BA 2OZ6A 1H2LA 2ZGSA 4P9YA 5HXMA 1QOSA 1RUD3 2RR11 2CV6A 4D7TA 1V6NA 3E1F1 1VR3A 2HWC3 1KGYA 5CBLA 4H2AA 1UU6A 2Y6GA 2GMPA 3OJBA 4HPKB 4XQWA 4AFAA 2CGOA 2WZPP 2B5HA 2RMU2 2ZGOA 4ZU7A 1ND2A 3UV9A 2ZPXA 1AR72 1BJQA 2GP3A 2QVSB 2YBPA 4IV3C 2RVAA 1AR93 4HN1A 4H7LA 1UY2A 4M01A 2XUEA 5EV7A 1VBB3 5FKCA 5A6ZA 3FN9A 5LA0A 2WA3A 2ZGTA 4Y20A 1NCRC 2J1AA 1NZIA 4NIHA 1RVF2 1WBFA 3QOPA 4XFCA 1S0FA 1HRI1 4EWAA 1RUC2 4OUEA 1XB9A 5FY8A 1DYPA 1PGW2 2D93A 1JS9A 2OX0A 4D6SA 4FPKA 5F8PA 2VCMA 4B7EA 2W1UA 2VL4A 3VDDC 2P3KA 3PMSA 1SCRA 5F32A 4AHZA 1W3XA 1W2NA 3GBWA 2WNEA 5EWSA 3OUJA 4TWTA 1WW7A 1PM4A 4Y22B 5FLIA 2NMOA 1Y4WA 4GKXA 1YQ5A 3V0BB 5B4XA 1MZEA 1E5IA 4YFWA 1LJ7A 4FPYA 2IC1A 5C3SA 4DXZA 2YXSA 5L7OC 2NP0A 3OBTA 2PAKA 4LBMA 1CONA 3NV1A 4XF9A 4XZPA 3LKJA 2JDUA 4JQRA 5FZOA 2UWBA 4AXOA 2Z5WA 2DWRA 2WO7A 1TNRA 2K46A 4KU8A 5LZ6A 2XJVA 4P08A 3T3YA 3UKNA 3S7EA 2QQJA 4YVWB 5A6YA 5K9YA 3INAA 5T52A 3K75B 2YC4A 4A6OA 5ACA2 1D4VB 1OSGA 1W6MA 3KT7A 2MEV2 1Q8PA 4PQQA 5DUUA 2BWCA 1JYVA 5A7WA 1NYWA 3NKGA 3RMYA 2DTWA 2BFUL 4Q4X3 1J3PA 2VCCA 1PM7A 3J8F3 3JCIA 1C4RA 1OQEA 3QH7A 3R0RA 1HJFA 1W0OA 2BVVA 1S0JA 3I2HA 4CEWC 5I8TA 2B4KA 5I0DA 1XU1A 4OLLA 3SLIA 4JV4A 2W95A 5JMOA 3TB0A 2DVGA 4IXLA 5IVFA 1IKPA 4NWWA 4Y3OA 3THPA 4CEYC 3WDUA 3N4MA 4ARYA 2P3YA 2Q1ZB 3VKMA 2VNRA 3AM2A 1BVVA 5A6QA 4KI5M 2E33A 1GFF2 4OFGA 1TVGA 1XE8A 5JIUA 4HONA 3C7GA 4IE0A 4D69A 1ZBA3 3BPSA 1HV1A 5CFCA 2R0HA 2VW0A 1QJU3 4Z8BA 5F2WA 5C6CA 4P5YA 4UFIA 2RR12 2WO3A 4YW4A 3A22A 4Q4X1 3FHIB 4WV8A 4CCJA 4QAWA 2E63A 5T5JA 4GAZA 2ZGQA 4QGMA 1OA4A 1UIKA 3M1HA 5FP9A 3LSDA 3ZX7A 1CAVB 4QQLA 4QKFA 5F39A 4QX2A 4BH9A 4S2GA 2JE9A 4RQPA 5F3IA 2P37A 1W0PA 4MG2A 4CE8A 3WQ1A 1AXYA 1N1YA 3WNLA 1PK6A 1AL0G 5E89A 3PIJA 3VBFC 1H8TB 3HMYA 2JX9A 4ZS3A 1UPIA 4AI1A 1JBCA 1WCKA 1GICA 1GOFA 1W2OA 5FYYA 4XETA 3MLKA 2DUPA 5FZMA 2VMHA 2WT2A 2J1TA 2OPWA 4PI0A 4XZUG 3CO2A 1EV13 2FQPA 4FXGB 4M3CB 5DUVA 5CFCC 2PELA 1V6JA 1FPN2 2BU9A 3FBYA 1D0GA 3VBSC 1DYOA 2YC2A 2BPA2 1QH7A 4RGAA 1V70A 4XDQA 2DUQA 5KXBA 1V6MA 3RJRA 2DVAA 5FOBB 4CEYA 5FZLA 2R062 4MHRA 5J7MA 5T5PA 5FPZA 1ACCA 5D8AC 4R9DA 3B94A 5FZ0A 3TYJA 3PMEA 2TBVA 3W5MA 2VMDA 3KV4A 3V64A 3O1RA 4CP9A 3C3VA 4HMZA 5HXVA 1Y9MA 1XYOA 4QPIB 2DVFA 4P9LA 3RS6A 1QH6A 3LIGA 5E16A 4BISA 4CA9A 3IM0A 3LDBA 2PHFA 3O1TA 4R9AA 4BWOA 3ZLIA 1WLDA 3I3EA 5KXCA 3T4HB 2FCUA 4YFZA 2HWC1 5J36A 1PNFA 1I5PA 3PUIA 1RUD1 2RR13 2YPJA 4Q1RA 2BBAA 1FMD2 3O1MA 4L97A 3P5BA 5JVVA 4AAPA 4FPCA 1XE0A 1BCXA 1HQLA 4YW3A 4GJZA 1JZ3A 4JDOA 1H8TA 4AVBA 4DB5A 1RJ8A 1B35B 3O14A 4D0QA 4W6YA 5KXEA 4LIVA 4MGZE 5JOYA 1VMHA 1NAEA 4AI0A 2AZ5A 2BUKA 5JI7A 1ZZ7A 5ABJA 5LWBA 3MW2A 2DV9A 1GP6A 3NSTA 4NIAA 5F7UA 3GZUC 4IEZA 1US3A 4XUTA 2ZAHA 2HWB3 2P34A 3WCSA 4Y1XA 4AFBA 4IDZA 1XRUA 2X53S 4QKBA 3ELNA 4YGBA 1GZWA 5FZBA 4QXHA 3WG2A 4XHXA 1XE7A 2Y60A 2RDSA 3C8XA 3WVJA 3VZKA 4HSLA 2I74A 4YW2A 2ZXQA 5FUPA 1I6XA 2ZGLA 4DXSA 1OD3A 5DUXA 1RUF1 2R063 1F4HA 4QB2A 2RJKA 1L7LA 1BMV2 1X8EA 5F3CA 4OHYA 4BPZA 4QM8A 2ENRA 1S0GA 5BNPB 5AC92 3T0DA 2ILMA 4YZ4A 4Q4Y2 1DF0A 1BHGA 2ARXA 5F6KA 1UD1A 3POIA 1ZREA 3VD9A 2AUYA 2GZWA 1DQ4A 1IG3A 5F5QA 5HCFA 4DUXA 3IBMA 2GC0A 4O9EA 3GZTB 3WXPA 2ZS6B 4MGYE 3MO4A 3WDTA 2K0GA 3VBRC 2ZX4A 3T09A 5TSWA 1O3RA 2H0VA 1W2TA 2OT7A 4RHV3 3WF4A 3KSCA 2R6QA 4DUWA 4JGYA 4M4PA 3RZMA 2YFZA 1RUE3 3LPFA 4CDXB 1Q5OA 2GH8A 2ZGRA 1GSLA 5CU1A 4G9SB 1RUH3 1ZBE1 2VMCA 3ES4A 2OUHA 4ZHNA 2AR6A 3CJIC 3AXEA 3N7KA 5FP4A 4MV2A 5DG1A 2VY0A 5FPVA 3TN91 3GNEA 4KBZA 2AC1A 2RDRA 4JKMA 4QT6A 1JYNA 3OGSA 1OUXA 3CJIB 4H55A 1QJY1 3VKNA 1CGPA 3LEGA 1H1IA 1W6OA 2CL2A 1G86A 2VNOA 1O5LA 4MXVA 4QXCA 2JD9A 3VL8A 4COUA 4CVUA 4LK6A 4JTOA 1QJY2 2PFWA 2EA7A 2R071 4ZY9A 4AG4A 4PQ9A 1OA3A 5I0UA 3VHNA 1JHNA 2J7MA 3KV9A 4MYEA 1NE4A 2A6XA 4UYBA 4HVOA 3GZAA 4AGVA 3R4SA 4I0AA 4DY3A 5CKQA 4LA2A 3N9OA 1W0NA 1Y7BA 3HQXA 3LPGA 3P6BA 1VBE3 4OYUA 4YZ5A 2EICA 4XTMA 1JYXA 4AFDA 2FMDA 2PXJA 4L99A 3U4XA 1GLHA 4OMDA 1R1A3 2UWCA 2OIIA 2ZEZA 5KHHA 4A6SA 4XC9A 1JZ7A 5A3MA 5DMYA 2DBIA 1RINA 4IEVA 1DGRN 1AR61 1LHWA 1UZYA 4M0NA 1KFUL 4BMEA 2KA3A 3AKTA 3R4UA 2WABA 5A33A 1RTVA 4YGCA 1YO8A 1FNZA 1W8WA 2VJXA 3H50A 4WM7B 5FBJA 1CESA 4B3NA 2L9LA 2EIEA 1RUC3 5IAVA 1DYKA 2R041 1ENSA 4EROA 1SACA 4FQ4A 4PCRA 2XH6A 1MZ6A 3WINE 2VCAA 2XVKA 3LFIA 4NWVA 4AHXA 1F35A 4IV3B 2D6OX 1OLQA 3B3QE 3NAPB 1CJPA 5A80A 1GUIA 3NJVA 4YSFA 4LKSA 4UAPA 3VKOA 3NV3A 2F6BA 1NLQA 1W9SA 5FAXA 1BBT1 5JIAA 2IXKA 4B7KA 3MV11 1WWYA 2VQAA 2ZX1A 1J3RA 5LRRA 3MLLA 4FAHA 1VB4A 5F9TA 4XCAA 4FSJA 2ZACA 3FBMA 4LMFA 5T55A 1Q8OA 1CWPA 3OD4A 1COV3 3I8TA 1KD7A 2G4IA 3POSA 4LBNA 3ZFGB 1ZX5A 4JRAA 2OQ6A 4WVZA 4ZU5A 3LE0A 1LAJA 1H0BA 3AXDA 3DXUA 3RMXA 3O12A 3B9IA 1AYN2 3S30A 1LOFC 1AYM1 1S1AA 4MGSA 4WVMB 1RJ7A 3LWCA 4WZFA 3ZFFC 4CCNA 4YARA 4AQSA 3DEMA 1ZRIA 4JGYC 4DRRA 5A6XA 3N3HA 3ZSMA 1DGLA 5J3UA 4YGEA 4JTNA 3GHNA 1ULCA 1VBD1 1HLCA 4WM7A 4QXKA 4MHUA 1YJKA 5J1XA 5L9VA 4RS5C 3AZZA 3MW3A 2RE9A 2HWF3 4DPNA 4XFBA 2GN3A 2PQSA 2RJLA 1JODA 3BOPA 2BV4A 3K46A 4FOVA 2XBO2 4BK5A 3RI8A 3VHOA 1NX9A 4RR3B 3AC0A 3KT4A 5FP8A 3H1YA 1R091 2VZQA 3C7HA 5IK7A 1PHMA 1RUI3 1QJU2 3OPTA 3M70A 1VE0A 5CB7A 1HX6A 2QTWB 3F2ZA 1D4M1 2JDKA 3PU8A 1ASJ1 2Q8CA 3WZ1A 1PVC2 1KDKA 3AKRA 2RM21 1O59A 2DCKA 4LEJA 4S2HA 2RV9A 5L73A 3KHCA 4QGNA 1Q8QA 2EXIA 1ZZBA 2DCJA 2OW4A 5FMBA 4XJWA 4ZXEA 3ZN6B 1WCSA 1WZXA 5LBEA 4BQ4A 1AL23 1WMXA 2JECA 2WZ8A 5K8SA 2KD7A 4BQXA 1POQA 5T5LA 1LB2A 2CNAA 3ZPYA 1LU2A 1A3KA 2Y64A 3D0SA 4FXKB 3BGAA 3WR0A 3LIHA 1POV0 4K8FA 1SMVA 4BXSV 1GV9A 2D40A 2W08A 2X5IA 4K7JA 5JDBA 2JICA 2CU5A 4AI9A 1PMHX 3EBRA 1LOFA 4KWKA 1QXRA 1ODNA 5A3LA 2QBXA 3T2OA 4XBQA 3GCXA 1AJKA 3JB4C 4Q1PA 5FOJB 2WNOA 4RS5B 3S57A 1OQDA 3OOXA 3IWZA 3FE5A 3VDDA 1OXCA 1XSQA 3UGFA 2RDQA 4HBNA 1IS3A 2UURA 2E6VA 4KG8A 3IAPA 1DZRA 2XJSA 2P4EA 1BBT2 3URFA 4E8CA 2CYFA 5LK7B 4Q8KA 3FLTA 1W6OB 2DU1A 2XVLA 3NMBA 4IGQA 4QM9A 3NV2A 3H7YA 4HL0A 4URTA 4DMIA 2GDFA 1TMF1 4YM3A 3DL3A 4QPWA 3SKJE 3O1OA 2C26A 1BK0A 1HRV3 3EXUA 1UKRA 4Q5OA 3SC7X 1CAVA 1DP0A 2RS11 1FOD3 2JD4A 4E4HA 5B4NA 1F8VA 3WDXA 4NUBA 2NYYA 2AREA 1D4M2 3ZMOA 2GC3A 5LA2A 5JZGB 1PO12 1TE1B 1GWKA 3THTA 1LOBA 2WAOA 3PU3A 4A2UA 2IXHA 3KLSA 1FMD3 2HEYF 2EIBA 2IXJA 1UWWA 1LCLA 2EAAA 3MIDA 1MS0A 5L7OB 1H9PA 2P6HA 3RYKA 2WYFA 5JXJA 1M06G 2W52A 2QDRA 2Y0OA 3OGVA 3ZFGC 3NNGA 4FOYA 1AL22 3QACA 4R9BA 3VZNA 5JCTA 2E9QA 2WLPA 3TNQA 2VQTA 2ZA9A 1V0AA 5EPAA 1VAMA 3ZMNA 1VBD2 3DN7A 4TN7A 1N47A 2W9XA 3C7EA 1DZTA 2JDAA 2XJRA 2MEV1 3AP6A 3AZXA 1IPSA 1VP6A 1W8NA 2RS52 4LLFA 4XOGA 4A44A 4CCOA 5C8CB 3S0MA 4QHZA 1SLBA 4XJAA 3J7HA 1MQTA 3E5XA 3E5QA 3IAQA 1RXGA 1AYN1 4NHKA 5EJZB 5A3OA 4JGZB 4AYUA 1LEMA 5C4WA 5KXDA 3NQHA 4XF0A 3B69A 1PGL1 3H3ZA 4KNCA 4PDWB 4UF0B 3N9NA 4YG3A 2JDPA 1J84A 5EQUA 4AFMA 3SNMA 4YNIA 1LR5A 5FYBA 2VMEA 1O4YA 2J1RA 3ILFA 2GU9A 2GNMA 4PLOA 1ZBE2 1RUJ3 1HB3A 1L7QA 1EUTA 1JTZX 1XPWA 1YI9A 3BPZA 4UFKA 5C9AA 4LT5A 3HNBM 4U2AA 3D82A 2Q1MA 3JD72 4TLFA 4YG6A 2JXAA 3AKSA 1W3VA 1YRZA 1UY1A 4OUSA 1N3OA 2Z2SB 4QGLA 5FZGA 1PK6C 1RUNA 2V4VA 5EZWA 1VRBA 1RUG3 4P9IA 3WDYA 5AFBA 1GZTA 4NOTA 4CXXA 1UIJA 4Z1VA 4EN7B 3WNXA 1RVF1 2DCTA 1VBA2 3WCRA 4XQ4A 2VOKA 3ES1A 4DZGA 4SLIA 5IATA 3GF6A 1MVQA 4XAEA 2YU1A 1CZVA 1WD4A 2EF6A 2VC9A 2RJ2A 1QDCA 5GZEA 5BNNA 3ZXEA 1TQ5A 1JZ6A 1OMIA 5IFPA 4LUMA 4P9WA 1C5IA 4NAOA 3PJQA 4LO5B 4SBVA 3WF3A 4C1WA 2R16A 5GLZA 4EN6B 4N53A 1JYIA 1BLZA 3I2DA 4DOUA 3N7JA 1NA1B 1UXXX 2I2SA 2B45X 4Y20B 5FXVA 1AXZA 1X36A 3ZFGA 2J1VA 4LHSA 3SISA 4ES9A 2VO5A 1Q56A 2V4AA 2WNUB 3ZKUA 4P5HA 1ZZ6A 1XNCA 1DQ5A 1GBGA 2UYAA 4HPKA 4OI2A 2GMEA 2X29A 4LE4A 4N43B 4D7SA 5C7GA 4Q29A 1ZRRA 3ILRA 4KBBA 1GU3A 1S0CA 2LALA 3IPVA 2CY6A 2DUOA 3JZVA 5FPAA 4X8NA 3HNYM 3SEEA 1VBC3 3WNMA 5A1AA 3OYWA 4HT1T 2ZHLA 3BALA 2WYSA 4N8MA 4CDXA 1UOBA 3EJKA 3TN92 5A3NA 2RS51 1AX2A 4L92A 5C3PA 1W2AX 3THDA 3CNAA 4QHOA 2BERA 1QKQA 3KV6A 4N9HA 5JZGA 3JD73 4Q0PA 4Q4V1 1ZVFA 3AJYA 3GYDA 4PLMA 4C90A 5I93A 4FPGA 4QPYA 4AQ2A 2D3PA 3RZKA 4TYSA 2Q0AA 3AVSA 3L2HA 3AB0A 3ZIXA 5J48A 5E6HA 1C8M1 2W47A 4BYYA 2DURA 2ATFA 4PI2A 5EP9A 2D44A 2OA2A 2A71A 4AI3A 4UXAA 1Q3EA 2Y38A 2JDMA 3A7QA 4NJ4A 5FY1A 4QU1A 3BKZA 3VBUA 1W9WA 5FKBA 1IS5A 2YPDA 1URXA 4CU6A 1PO11 2V5YA 3KVBA 4Y5Z0 4YWAA 3KT1A 3MF6A 3BODA 4N53C 3NRUA 1ENQA 3UESA 3RZLA 2VBDA 4MXWA 1FATA 4NIGA 3SEPA 3PL0A 1MS3A 3OY8A 5K7PA 1U0AA 3H8XA 1UX6A 1K5MA 1D2SA 3POYA 1NY72 4O65A 1K3IA 4LKEA 5JZGC 4LORA 4C1XA 2FDFA 4IE4A 3IB3A 2D5FA 1LGNA 3D0JA 5IUQA 5LK5A 4GIQA 1GNZA 2WNVA 3HQRA 5FZAA 5T54A 1ULGA 3ZXFA 2WA4A 1QJZA 1FXZA 1PZ8A 3PJYA 1QQP3 2ZGPA 3M3QA 3HVDA 4IW3A 3RFRA 4IETA 5CG9A 4XIOA 3RI9A 4DIQA 2R32A 3RZGA 5FWEA 5EIYB 4BMBA 2IXLA 2BOIA 4AVTA 2XQRA 2ZHMA 2OZJA 4OVEA 2JDNA 4D7YA 1ST8A 5BNNC 4BK4A 2ARAA 1UYPA 2PLV3 3ZXJA 3UT0A 1DQ2A 3DUIA 1Z0HA 1CPNA 3JB8A 3W9AA 4XF4A 2PMWB 1UCXA 2V09A 4XF1A 1CAXB 2DDUA 1H6XA 4LE3A 3WP4A 4DXRA 3BYWA 2A3YA 1LRHA 3AP7A 4AVAA 5LB6A 1IOAA 1OVPA 1QJX1 4KU7A 1OHFA 3MIGA 2VCBA 4B29A 1MACA 4E4DX 5HCAA 5FYCA 5LBBA 4EZ4A 5D8AB 1UOGA 4MOAA 4Q0SA 5ANQA 4YVSA 3L2YA 4K3UA 1RC6A 3ZXKA 4I0WB 4YYOA 1ZRFA 2ZOEB 4P14A 3I2FA 4Z2WA 2XKOA 4CP9B 4ZONA 4DNYA 4Y33A 3WW1A 2OPKA 2XLAA 1PVC3 3MFAA 3DYOA 4HK8A 1XYNA 2XBO1 1DG6A 3O0VA 4V1PA 3MUY1 4DEVA 3TBDA 3AMQA 5CZKA 3OGJA 1ZNPA 1KJLA 3MUZ1 1S55A 2JG8A 2WAAA 4CDQA 2WFPA 1RHI3 1XC6A 2B46X 1QOTA 5JOZA 4ARXA 5CVRA 3OG2A 1SG3A 1WCQA 1ZZ8A 4IEOA 5H9SA 3ATGA 3ZR5A 3I3MA 3LZZA 4KG0A 4L9BA 2XHNA 3ITQA 4BLJA 1A6CA 1EY2A 1EUUA 2VOWA 2VR4A 3VBFB 2VUDA 4OHXA 3CHXA 2DU0A 3I3DA 4MUVA 4LITA 1B35A 1GMMA 1DFQA 4XUQA 3HR9A 2HJIA 2X8KA 3BTAA 4JC1A 4M00A 2ZABA 2H6CA 2YFUA 1O4TA 1VLNA 1JOJA 3NWKA 3UGGA 1OI6A 3H9AA 3VBOA 5FCCA 1JH5A 3AMNA 4EN0A 3X29B 2ZAAA 4XXPA 5FJKA 5FZOB 4QXBA 4FPLA 1VRH2 3GALA 3GXUA 4W8JA 4B8EA 4BCUA 1C57A 3CDZB 3NW4A 4GD4A 5FP7A 5C3QA 5A3UA 2WO1A 5JXGA 3CLPA 3LSEA 1HKDA 3C7FA 4P9GA 3CBNA 1KXGA 3C2UA 3OUIA 1Y43B 1SFYA 2WZR2 5FY7A 2BP6A 2QUOA 3T0AA 2ADEA 4JDNA 1L7RA 2DCZA 1HRV2 4UBHA 5LY2A 3VD7A 1LU1A 1O6UA 1PGW1 2J1EA 1FOD2 2JEMA 1CIWA 2K2SA 1CVNA 4Q4X2 1AZDA 3RDIA 4HK9A 1RHI1 3MFCA 4ET7A 1OF3A 5A3PA 5KR7A 3TWIA 3H3UA 3IN9A 2A6WA 4PF1A 1UXZA 4LTAA 1S2EA 1IHMA 2VE1A 1TME3 4XACA 5EXOA 1W8HA 2PHTA 4ES8A 1BEV3 3MIHA 3W59A 2WWSA 4M3CE 5JPNB 1BYHA 2OUJA 1AX1A 2P6CA 4LKDA 2WNUA 2Y33A 4CXWA 3D5OA 1OLMA 4E2SA 3I2JA 1W03A 5JXHA 1K12A 2ZEWA 3OTFA 1C1FA 1MS5A 4MZUA 3ZYBA 1RHI2 2GN7A 3N9MA 1H2KA 1ZBA2 1V9U1 1WW5A 5L9BA 3A23A 2I45A 3E5UA 1ALYA 4MGIE 4LJHA 4LO6B 5FY4A 5A32B 2P2KA 2FDHA 1RIRA 4CUBA 4U36A 3BIEA 4Z92B 1VPHA 5GZFA 1QNYA 2R072 4PJYA 5ABJC 2EVXA 1QWRA 3K2OA 2I07B 5H9PA 5I8SA 5JAXA 5C3RA 3C7OA 5L36A 2IWGB 1UU4A 2BWAA 4IV1A 3JBG1 3OSDA 4CU7A 2Y34A 5BPXA 3WQBA 3IDCB 1KEXA 3LEMA 5BNOA 5L19A 1JOBA 1VRH3 1H9WA 3CJXA 1RUJ2 3POJA 4NO4A 1OF4A 4O7XA 1O3QA 5IK8A 4NHLA 2DVDA 2NMNA 4S2FA 2WT0A 4A7KA 3HWJA 2YHJA 2ARCA 4IE6A 2QQWA 4J6GA 4PDWA 3VV1A 5I91A 2HWD1 1U5ZA 1X50A 1S0BA 1LOCA 1QQP1 2ZZQA 1NCRB 2WZR3 3A21A 3AP5A 3MICA 3FL7A 3QLQA 4HVQA 5DDJ3 4JAAA 4ZPIA 4AEDA 5F3EA 4OZOA 4WM7C 2A6VA 4QQHA 1QMJA 1YFWA 2DFBA 4P00B 4H3WA 4OHWA 1FT9A 1VBA3 4B4QA 4CDWB 2QCSB 2WQ8A 1IPKA 1ULPA 1YQ8A 4IV1C 4GMP3 1MZFA 1UN1A 4JZRA 1PO23 2HWE1 2X09A 4XCBA 1CAWA 5IK5A 3JQWA 1H6YA 5C8CA 1I1EA 2VMIA 4IE5A 2ZGKA 3WP3A 2WS91 1W8ZA 5B2GB 2EAKA 1AR71 5FZ4A 4Q4Y1 1QXPA 1LOEA 3SQOA 2RMU1 5FLJA 5IVYA 1QJEA 3T1LA 2FCVA 4NN0A 4A45A 2E31A 1STMA 1I3HA 4ASLA 4WVMA 4XJ9A 2CTVA 1K5JA 3ILNA 3RPQA 1HIXA 4GWJA 4IV1B 3ZFFA 1POV3 2WFF1 5IW0A 4FFIA 1Z7S2 1RB8G 2ET7A 4Y5SA 4FTBA 1REFA 4KGQA 1MEC1 5AVAA 2DF7A 1HXS2 1GNYA 4OHZA 2VGDA 1S0IA 1IS6A 3N9LA 3ZFEC 4C0HA 3H0OA 3UJQA 4X6RB 5A3WA 4AQTA 2O1QA 2YZ4A 4BM8A 1CIYA 1X33A 1CZSA 4PBPA 3USSA 5CEHA 4YVSB 4Q8LA 4DRVA 5FFOC 2C6SA 5BNPA 2WR9A 3M7AA 4MO3M 1WLCA 4QB1A 5FYMA 1QOOA 1H8VA 1QEXA 1W9YA 4I3PA 1R082 1O8PA 3L9JT 2F4LA 5ERLA 4TLGA 3RYPA 5KHJA 4BQWA 1J3QA 2VXJA 4ZZ5A 3AP9A 1OFNA 5FZKA 1JZ5A 1DIWA 2Y26A 5I0TA 2A75A 4CXYA 1VMJA 4E2QA 5HCHA 4C0BA 1NLRA 4RR3A 3OGRA 5FY9A 4UW4A 5F2SA 4XFFA 1EAH1 2VTXJ 1IPJA 4G4FA 2P1BA 2WFF2 4K9SA 1MEC3 4KH9A 1JYTA 1SDDB 1LHUA 3BU0A 3NL1A 5C4WC 3APBA 3MV01 1OOPA 3PDQA 3WF1A 3DXTA 5GZCA 1H2NA 1DQ1A 3HT2A 2RS33 2A70A 3IDAA 2NQYA 3B93A 3PIGA 2Q8OA 2W39A 2WUHA 4JRLA 2RMU3 2BTVC 2VW1A 4XEZA 4A3XA 4XUOA 4FPJA 3AMMA 5FZEA 4Q4Y3 4BQ3A 1BVP1 1OOPC 1AXKA 1YIPA 3NNFA 5CKNA 1CX1A 3KVAA 3J7MA 3OCPA 4CCLA 2NZ9A 3LB9A 3AZWA 3BB6A 5SV5A 5IHRA 1NZCA 1F5FA 1PIV3 4CTEA 4GMP1 3VBOB 3VHPA 1W6MB 5JPMB 3FC0A 3OYWB 5FV3A 3RRDA 5FPXA 5LEJA 5KHIA 2JG9C 2WQ4A 4P9XA 2BBVA 3AFKA 3BI3A 4QWNA 2WDBA 5SV8A 4CDQC 1S4CA 1H4HA 1QQP2 2XL9A 1WUVA 1EAH2 3CZUA 3U11A 5CAZA 2FDGA 1DHKB 1OT5A 4Q4V2 4CEWA 3Q9OA 4JQTA 5IWFA 5DQ0A 1RUH2 3OBZA 2BQPA 3RJ2X 2E7AA 1H4GA 4RYDA 4XXAA 5FZFA 2D6MA 4Y24A 3VZMA 2ORZA 2P17A 3UNPA 5J37A 2XLGA 1MS8A 3ENRA 1VALA 3OPWA 3WG1A 3OEAA 3KM5A 2OS2A 2PHXA 3HN1A 5FMOL 2HEWF 3EO6A 4WBBA 2WNVB 3JBG3 1LESA 4M0HA 4E4ZA 5FP3A 2GMMA 1H2MA 4LO8A 2XJUA 4NHXA 4AHWA 1NE6A 3NVCA 1XBFA 2WT1A 1QF3A 1POV1 2WFF3 5CFCB 4FPFA 4PIXA 5DZEA 4Y5TA 2MEV3 4LBQD 3MZHA 1SLTA 1V9U2 2Q8EA 3WG3A 2PHLA 4BHPA 1GP4A 4CDUA 4COWA 1UL9A 5GM0A 1OFSA 5CFDA 1HN1A 3ST7A 2VZUA 4NHYA 4DFSA 4NR1A 2D7FA 3IIIA 4IUGA 2Q5TA 4LUKA 2VTFA 2VZVA 1WLWA 2YG0A 1PGSA 5EYXA 1VJ2A 2JDYA 2WS92 5JSPA 1PO21 2HWE3 4UOJA 3MGUA 2VPVA 2X05A 1S2KA 4Y1UA 2CGNA 1NCRA 1NQJA 3T08A 2PAMA 3KQRA 1O3SA 4QMAA 1YFYA 4AEDB 2BNNA 1TME1 4D94A 2O0OA 2E53A 1VBA1 1Y3TA 4X8PA 1DCSA 4CCEA 2QQOA 4IV3A 3S6PA 1FOD1 3FFQA 2BRTA 4BZ4A 2NLRA 3A0KA 1HRV1 5DDJ1 2QZ2A 1NA1C 3KCXA 5GZGA 5JOWA 4GB31 4QHBA 4YM0A 1TMF3 1UF2C 1YUDA 4JVAA 4L2NA 5JMCA 3I2IA 2ERFA 2ZX0A 5IVJA 4F8AA 4MVTA 2HWD2 4E8DA 5ISLA 3ZSLA 2XDVA 3UL2A 4AVSA 5FXXA 1JUIA 2BJSA 5A7SA 1XYPA 1VRH1 2IZWA 4W50A 3ZIWA 4OCTA 4CEYB 3I2KA 4BA6A 3QH6A 1JMUB 4F3JA 4LHKA 1ZZ9A 3EHKA 2A3WA 3HIFA 1TNFA 2CAVA 1MS1A 1IG0A 2VVEA 2ZX2A 2JE7A 3FUOA 3AL5A 1SFNA 3GM8A 3IDBB 3ZFFB 5I8YA 1UY3A 1COV2 3FLRA 3H7JA 3FLPA 4DEQA 3V56A 2V73A 3M3OA 2VNGA 2IXIA 3VHRA 1ND3A 3NO8A 4FO9A 4MSVA 3TRSB 2YBSA 4XVHA 1CAXA 4OI1A 1PMJX 1W8FA 5DAVA 1XNAA 2YY1A 4D6QA 3ABZA 3HD8B 5J96B 2WQZC 3ETPA 2ZHKA 3BCWA 3SCGA 1CAWB 1YC61 2VUCA 1V9U3 3H8OA 1VAVA 4GB32 1R1ZA 3TOJA 2MPFA 4I09A 2JKBA 4WM8C 2ES3A 3T0BA 2QQNA 3P3NA 1TEIA 1ZA7A 1HRI2 1AHSA 4RQPB 3VBSA 1YYNA 4A7ZA 1Z78A 4JKLA 4AEMA 3GBFA 5D21A 2FDKA 4WZCA 3D8CA 4B4PA 3V0AA 4W4ZA 1N1VA 2ZMKA 3J7NA 3P3PA 1BEV1 4XF3A 3ZKYA 5FK8A 2ZTNA 5FREA 2E26A 2B7YA 5FZ1A 3VD4A 3K4DA 1VBB2 1SHWB 2Y6FA 4LBQB 4CDWC 1UAIA 2VOVA 4PF5A 5CADA 4IERA 3VZLA 3K4ZA 5EJ3A 2XL7A 1YWKA 2PHUA 4JKKA 1NCQC 1LGCA 3AYEA 5BNNB 3KGLA 2Y0IA 4GKYA 4RS5A 5L9RA 4C8DA 2WJSA 1N3PA 5A1FA 5CYYA 3WNNA 4KQ7A 2ZGMA 2W5FA 2ZBJA 5FXZA 2HWF1 3V0AB 2QJVA 4E27A 1DQ0A 2XLFA 4Q4W2 2DFCA 2JENA 2QE3A 3EYPA 5JR7B 5ABJB 3N9PA 5DUWA 3D4KA 3H8UA 4Y1YA 5GLVA 1UZZA 2VQUA 4XMAA 5KC5A 1WD3A 1SPPB 2J42A 3VBHB 5A32A 1IKQA 2VBPA 4MADA 3K3OA 2JDHA 1LODA 3PNAA 3GDBA 4BB3A 4EN9B 4LIUA 3WLUA 4Y1VA 1I9RA 1C1LA 3ZN4A 3VD3A 4Q2FA 3ZYHA 2B42B 1OH3A 2EXKA 2R49A 2TNFA 5F5CA 4NPLA 2CDPA 4AF9A 3PHMA 4QU2A 4XFGA 3S5QA 4CCKA 4HN0A 1SQ4A 2XOMA 3GJAA 4CUAA 2YROA 4CP2A 4UW6A 1IGOA 5EJ1B 3IZOA 3W21A 3GBGA 1O91A 2GH2A 4GB33 2P5BA 2WWJA 3ZXAC 1NKGA 4Q27A 3AYDA 3DYMA 4INDA 2PHWA 3PURA 4QX3A 5BUVA 2WN3A 3V0BA 5FUIA 1MZ5A 4AGRA 3WV6A 3M3EA 1DBNA 4FCAA 1F31A 3MLJA 1OLRA 4DO0A 5FXWA 4K6BA 1KQRA 1T2XA 4UT5A 3FZ3A 4RA0A 1DLLA 1PVC1 2JWPA 4QDQA 1XSRA 3AX4A 3BTZA 1JUHA 4URAA 2QQPA 3ACLA 2R043 5FZ6A 1VB2A 2ZGUA 5DPNA 1OKQA 2CGPA 1V6LA 4L11A 1ND3C 3CU7A 4X6QB 2FCTA 3N9QA 4AEKA 1PO13 4MXWB 4MGTA 4HKLA 4Y4YA 3NNLA 1LTEA 2GSYA 2PAEA 1AR63 3R4DB 5DXDA 2IFRA 3UKTA 1H1AA 2WO2A 1IZ3A 3NAPA 1QJX3 1NOVA 2PYTA 1ZZCA 4GWMA 4XJ8A 3N35A 4FOQA 3VBUC 4UW5A 5BNOB 3I7DA 5BV6A 3W5NA 2WN2A 2OKXA 2N7GA 2Y6HA 1GYKA 4Y1ZA 1PMIA 3DYPA 3O0WA 4CDUB 2Y6LA 1H8TC 4E9KA 4QPIA 1UQXA 3FFZA 1O3TA 2VD7A 3PUQA 1OA2A 3ALQA 3VLBB 1RXFA 3ETQA 2VG9A 1MPXA 2HKXA 4BQ1A 4M4RA 1DGWA 5A7NA 4BXFA 1QDOA 4DINB 4ITCA 3Q8CA 1EYBA 1QJY3 3LCPA 1AUYA 2C5DA 3BUCA 5FLHA 5IVCA 1WA4A 2XJQA 1MEC2 4GA9A 2W68A 4IGOA 1YCIA 3KQ4B 2YU2A 3T2PA 3N7MA 3AZYA 4AOCA 1G9CA 3HJRA 1YI7A 1ZBE3 3P1IA 3T2TA 1PVXA 1JOPA 1XNBA 3ACIA 4GQ7A 4AWDA 1VBE2 4Z2AA 1PIV1 1PK6B 1W6NB 2JKXA 4QDSA 5LATA 2ID4A 2D3RA 1J1TA 2R7EB 2UU8A 3WF2A 4ATEA 1EPWA 5FQ0B 2Z69A 3USUB 1D0HA 3I54A 4RFRB 4H14A 5C5UA 3ZXLA 4ATFA 4CCDA 3I59A 3HN3A 2D98A 2D3SA 3TAYA 4QX0A 5FZ9A 3AKQA 2R042 3ACGA 2ZGNA 1Q8VA 2ZKNA 4IEWA 3SITA 5A70A 1GQHA 1UW8A 4N7UA 1O7FA 1FNYA 2RS31 1A8MA 1M4WA 4QQ2A 2A73B
chains in the Genus database with same CATH topology
3LA7A 1YLLA 2XJTA 3R05A 2PTMA 2EIGA 1XXNA 3WP5A 4J1WA 4YM2A 1EAH3 5CA6A 3AYAA 2VUAA 1RUG1 3JD71 4Q4V3 3OBRA 3NAPC 4TZDA 4IEPA 2G9FA 4WM8B 4BIFA 1YJLA 4FQZA 1RUJ1 5KHKA 3V65A 1VBC1 2D6KA 2HWB2 3JBG2 5D8AA 5IT6A 2B9UA 4Q0QA 4YRDA 4N7IA 1REEA 4ISRA 3AP4A 5K0UB 1WCDJ 2HWB1 4M3CA 1VBC2 5C8WA 3PVEA 1KFXL 2UYBA 4N53B 5K0UA 2R1DA 3E6CC 3ZFEA 3VBOC 1WMFA 4AFCA 5T5OA 3U0ZA 1HQNA 2DTYA 2VU9A 2JG9A 2O8OA 3MEPA 2UWAA 3ME2A 3FUQA 1AR73 2BVBA 4DQAA 4META 2WS93 3AMPA 4ZXKA 1S0DA 3WUDA 1REDA 5H9QA 3H1MA 3AFGA 3G7DA 1GANA 1CD3G 2H6BA 3B00A 3WQ0A 3RG0A 1CAUA 2XPJA 3VKFC 1ENRA 1PZ7A 1RVF3 1RUI2 4XFIA 3J4UH 4FOWA 2PQQA 1HDKA 2JG8C 1GZWB 4BE3A 1TMF2 4XJZA 4DY5A 2RS13 2D5HA 1QHDA 2GALA 2GAUA 1SBDA 2WZR1 5FTTC 3OD0A 1FV2A 2HWD3 3B01A 3ZYJB 3AZVA 1DU3D 4ASMB 4LBLA 2LM3A 4NVPA 1LHVA 3IPVB 5F1RA 1WW4A 3AKPA 5GLUA 4BOWA 2B8MA 4I3GA 3VBUB 3B9CA 4YVSC 4AI2A 5GLWA 1EV11 1K5MC 1SLLA 4F83A 1MR5A 2FZ1A 3T1MA 3WDVA 3DPRB 5CFDB 1LGBA 3RNSA 1J58A 1ONAA 3LA2A 3MIFA 4RR3C 2Z42A 2QZ3A 3JUUA 4UBGA 1LENA 5JLVA 1WGPA 1GKBA 4PBOA 3HBZA 4GALA 1ENXA 1NLSA 3LOBA 1AL21 3CL1A 2ZJCA 4YW1A 1FMD1 3AYCA 5FMOS 4PLNA 1HV0A 4JGZC 3WW4A 4HLTA 3VBHC 1LHNA 2VH9A 4QQOA 3CF6E 2IFWA 4XBNA 1ASJ3 4LBOA 1D4M3 5I0SA 5C8CC 1WMEA 2QKDA 2VVFA 4RD7A 1RGSA 1R093 1NCQB 2BW8A 1CN1A 1GQGA 1U5YA 2BNOA 3MW4A 2IXCA 4KL1A 3LGRA 3K48A 5IK4A 4GXLA 4HZFA 3I59B 3KS7A 1CR7A 2BYVE 3DKWA 2LTNA 4OULA 1W6PA 1VBD3 2EALA 4KGGA 3RWNA 1L3JA 4LBQA 2ZHNA 4GULA 1G9DA 4FTEA 3WW3A 3EQEA 4HSJA 1JN2P 1O5UA 2YGLA 2NM1A 1W6PB 1AYM3 2E51A 4QPIC 1ZYBA 3ZSEA 1ULFA 3A0NA 1ZM1A 4XILA 1EV12 2ARBA 3WG4A 4MX3A 4QPGC 1B35C 1EP0A 2VMGA 5CFDC 4EWEA 2YC0A 4LBKA 1YFXA 1G7YA 3WX5A 3WOGA 1D2QA 3D6EA 2YV8A 4E2GA 2HWF2 4GH4C 2ET1A 1DGRA 1V6OA 5I0RA 2XBO3 3FWEA 3ASIA 2YYOA 5E88A 1NXD1 3M3IA 1RUI1 3KCYA 1ASJ2 2E7QA 4KWJA 4FP3A 2TUNA 4J1XA 3E97A 4RSUA 2WSUA 1AR62 2FZ2A 1BEV2 2W0XA 1N3QA 3BIWE 1C8M2 1FYUA 1O4ZA 1ULDA 4IEUA 1SBFA 4W6WA 1RL3A 1UKGA 1K5MB 4YM1A 1KS4A 3ZXGA 1LULA 1R1A1 4XJUA 4AVVA 1BZWA 1G9BA 4S2DA 1GZCA 3KMHA 5BNQA 3RSJA 3ZVXA 4Y22A 2ZMNA 2OYZA 3JQXA 1I5ZA 4LBJA 2UY9A 3PVBB 2H0BA 4Z82A 1DDLA 2PLV1 1XNDA 3KZ4C 3QD6A 1Y9QA 1JYCA 5LEKA 4RL7A 3TNPB 2FBEA 1GNHA 1XNKA 1CX4A 1COV1 5E8AA 1QGLA 4RGGA 3HT1A 4XFAA 4K1YA 5JOXA 4TSVA 3PTYA 1AR83 1BQPA 1AX0A 1FAYA 1G9FA 1WW6A 3IT8A 1BBT3 3ZYGA 3MYXA 3MIBA 1PZ9A 5GJ6A 2MHFA 3AK0A 1ZRCA 3VUOA 3VN4A 2WNVC 4H7MA 2AGSA 3KGZA 3M3CA 1X7NA 2RHPA 1RUC1 3J9SA 2JDZA 4HETA 2YGMA 2VVDA 4UW3A 3SHRA 2JG9B 4JGYB 5FO7B 1PO22 1RITA 1YIFA 2KXLA 2Q4SA 1ZA4A 1KDMA 4R4ZA 1C8M3 5EYYA 3O0XA 2Z79A 2YUEA 2XGXA 1C3HA 1VBE1 3ZXDA 1E57A 3OY8B 4AK3A 3B7MA 1SEFA 2SBAA 3OF1A 4YVWC 3LOIA 1U5IA 2C1FA 1T6GC 4LO7A 3DGTA 2D6NA 2RS53 5DZGA 4CYDA 3WDWA 4EWDA 1NQDA 4YG0A 1OQ1A 2QDNA 1F5JA 1SLCA 1PGL2 1HXS3 1W6NA 4AEJA 4WM8A 1FI2A 2YMZA 3A4UA 1MQTC 4WVVA 2CAUA 2PLV2 1C5HA 1UU5A 2CWMA 3LA3A 4RFT0 4YLZA 3WT3A 3QBQA 1J59A 2PHRA 2WKKA 1RUE1 3DPRA 3WW2A 4Q26A 3S7IA 4DS0A 1R1A2 2R30A 1RUG2 2ZX3A 1LHOA 1W2UA 4I0BA 1OOPB 5C4WB 2FHRA 3ZDSA 1OD5A 5BNOC 4Q0UA 1ND2B 5E1RA 3VBSB 4YZ1A 4OUMA 3FX3A 4EN8B 1NXMA 1GZ9A 2Q30A 1LECA 1UMZA 1IQAA 3BU7A 3ZFEB 3M2MA 4OZXA 2RS12 1HQWA 1SLIA 4QQPA 4Y26A 1H1MA 1ZRDA 1HW5A 2G9GA 4IEQA 4IESA 1WMDA 2GNDA 4BLIA 1PIV2 4G3YC 1BMV1 4HANA 4I30A 1LOAA 4HFSA 1RUF2 1DGWX 1MS4A 1FPN1 4ISQA 4QD2A 1DQ6A 1CAUB 4LNVA 3ECQA 2WNUC 4YZ2A 3H1WA 2XVGA 4CDXC 2MNGA 3WY6A 1BXHA 4N90A 1C8NA 1AYN3 1BKZA 2WIIB 4AHYA 1J1LA 5CIRA 1VAKA 4QPGB 4IEYA 4NPRA 1LEDA 5FDBA 4KWLA 2R0FA 2KM2A 3GHMA 3UK9A 5H9RA 4OI0A 5BY5A 2NN8A 4Q4W1 3BOWA 1G9AA 3VBRB 3MI8A 2XHKA 4COVA 1YFUA 3U07A 1Z7S1 5HCBA 4EJRA 2HEVF 4LULA 4YW5A 3SH5A 4CEWB 2VOXA 4YZ3A 4FPOB 2RM22 4N9IA 1YHFA 1RUD2 3VL9A 1AF9A 2HWC2 2WINB 2AYHA 1QJU1 4FT8A 4FVVA 1AVBA 1R092 4GH4B 4E4SA 2R1BA 4FPEA 3CEWA 4XE9A 3W58A 1G8WA 5FO8B 2GNBA 1AR92 3LAGA 3VDDB 5BYNA 5KHGA 2LUWA 4WVWA 4O9GA 3G6JB 4IEXA 3ZN6A 1GR3A 4AVCA 2ZZJA 3M4FA 5KWRA 3WD5A 2DCYA 2GNTA 3MIEA 3B02A 4R52A 5FBZA 1U5XA 2XB6C 4L8QA 2XKPA 1JW6A 2AH2A 3WHTA 5JSOA 4K40A 4XHBA 1FX5A 4JDMA 1AYM2 2JJ6A 4I2OA 1H30A 2A7AA 5DG2A 3ZYRA 3VBRA 4HKWA 2YDEA 2P3JA 1OPMA 3JU9A 4RQPC 2VULA 4Z07A 2BEOA 5GKAC 4LO4B 3MDPA 4FAGA 1RUOA 3PVOA 1ULEA 5GZDA 3UJOA 3KCCA 1QU0A 5JSRA 2A6YA 4GMP0 3DF0A 1EPZA 2A6ZA 4M3CF 4HKOA 5CNAA 5DDJ2 4XPVA 1S0EA 2DYCA 2RM23 3N7LA 2VXRA 4XMIA 1ZBA1 1BK1A 1CJDA 3DV8A 1HRI3 3USUA 5FQ0A 4CDWA 1MS9A 4LR4A 2BNMA 1SLAA 3SXWA 1VBB1 2XG3A 3MPBA 5J09A 4I02A 4LLOA 5AVPA 1A78A 1CPMA 4AEDC 2VQ0A 4R4XA 5GLTA 2ZMLA 1NA1A 4K1ZA 1LOGA 2GC2A 2PHDA 4K20A 4R9CA 3J8F1 3QCWA 1APNA 2WL1A 1ND2C 5JWPA 4QPGA 1QXJA 4JGZA 2AENA 3IIAA 1Z7S3 2VW2A 5HI0A 2XUMA 1V6IA 5ACA1 2ZCWA 3RYRA 1U12A 2XJPA 4Q4W3 4OI4A 4LHNA 4PIZA 4A7YA 3J26N 1YXWA 2VECA 1N1SA 3M8LA 3AJZA 4MH0E 1W6QA 2A5ZA 4CP1A 2NPIA 1AR82 5FRAA 3NJZA 4I01A 3E6DA 2JG8B 4PDWC 1R083 3ROUA 1IS4A 2P3IA 3IKWA 4K21A 4EV0A 3SH3A 4ONUA 1YNAA 2FMYA 4XW3A 4IQPA 3WHUA 3MF9A 4R8HA 3ZYPA 2SLIA 2B39A 4LHLA 3POWA 3SMHA 1FPN3 3IDEA 4BIOA 2D6PA 1FV3A 2XWJB 1LKNA 1MQTB 2UY8A 2WLQA 3ZSJA 3ZYIB 4D7TA 2D43A 4N43A 3ZO0B 3PVNA 2CWSA 3VBHA 1CQ9A 2RS32 1TME2 3VZJA 1AR91 3N36A 1Q8SA 2X5IC 2DVBA 2EXJA 5J98B 3WQ7A 4COZA 4YVWA 3NKTA 1SCSA 4FP2A 5AC91 4PIYA 4XTPA 1X82A 5GALA 1XU2A 3VGIA 4CDQB 5F6LB 2F4PA 1N1TA 3I4IA 4AW7A 1B09A 4CZSA 1OPOA 4COYA 5C33A 3E6BA 4D3WA 4XQDA 4JCKA 1KS5A 1VIWB 4GWNA 2OVUA 1QJX2 2X5IB 5EFUA 3VZOA 2O8QA 2R073 1UPSA 4Q0VA 2ZKLA 1QNWA 1KJRA 2TEPA 3FMGA 3K51A 3NV4A 4ZU4A 2XWBB 1SBEA 3VKLA 3SH4A 3KB5A 4AGGA 2GC1A 3SCFA 2D6LX 1C28A 2VUJA 1RMU3 1W39A 1X8MA 1XQNA 1AJOA 3TN93 3UKVA 1RMU1 4AQ6A 4NHMA 5CG8A 1SDWA 2EXHA 1RUH1 5LRSA 1HXS1 2BGCA 1NCQA 1A8DA 4W65A 3RQ0A 1WBLA 2PN5A 3SCHA 5D1IA 5C9AC 3OPZA 4RHV1 4AI8A 4ZKTB 2C9AA 4F7ZA 5DZFA 1JXNA 1F9KA 1WLTA 3AMHA 4XBLA 2QFEA 1NY71 2WSVA 3OGGA 4OHVA 2WC2A 3MPPG 4MLOA 3B5LB 4ORFA 4XIKA 5AC93 1QY4A 3O5SA 1MVEA 2HWE2 1Q43A 2PA7A 5L7OA 2HYKA 3IMNA 5AFEA 2BFUS 4YGDA 4GH4A 2E7TA 1RUF3 2R061 5KBFA 3FJSA 4P9JA 4MGKE 4CP0A 1V6KA 5KC6A 4RHV2 3WP6A 1NG0A 1G6NA 3HAGA 4N43C 4CRQA 3CJIA 1RUE2 5HBAA 1F2NA 2D97A 4FPHA 2K9ZA 2ETEA 3DPRC 5T50A 4LA3A 5JI9A 1V00A 3VBFA 4FBFA 3U10A 1RMU2 3O7OA 1AR81 1R081 1DZQA 4XFHA 4W6XA 2C0ZA 2A3XA 5BNPC 4C91A 3ZSKA 5T3NA 1ND3B 3WUCA 3KD4A 3R6SA 3ZN5A 1PNGA 4FTSA 4B4RA 1KITA 4AE2A 5C9AB 4HVRA 5A33B 3PLQA 4QX5A 5ACA3 1KRIA 4IL7A 5BXXA 3RZZA 1W6QB 2QNKA 3J8F2 1S2BA 2OZ6A 1H2LA 2ZGSA 4P9YA 1QOSA 1RUD3 2RR11 2CV6A 1V6NA 5CBLA 1VR3A 2HWC3 1UU6A 2GMPA 3OJBA 4HPKB 4XQWA 4AFAA 2CGOA 2WZPP 2B5HA 2RMU2 2ZGOA 4ZU7A 1ND2A 3UV9A 2ZPXA 1AR72 1BJQA 2QVSB 4IV3C 1AR93 4HN1A 4H7LA 4M01A 5EV7A 1VBB3 2WA3A 2ZGTA 4Y20A 1NCRC 1RVF2 1WBFA 3QOPA 4XFCA 1S0FA 1HRI1 4EWAA 1RUC2 1DYPA 1PGW2 2D93A 4FPKA 4B7EA 3VDDC 2P3KA 3PMSA 1SCRA 4AHZA 3GBWA 2WNEA 5EWSA 4TWTA 1WW7A 4Y22B 5FLIA 2NMOA 4GKXA 3V0BB 1MZEA 4YFWA 1LJ7A 4FPYA 2IC1A 4DXZA 2YXSA 5L7OC 2NP0A 3OBTA 2PAKA 4LBMA 1CONA 3NV1A 4XF9A 4XZPA 3LKJA 4AXOA 4JQRA 2UWBA 2Z5WA 2DWRA 1TNRA 4KU8A 2XJVA 5K9YA 3UKNA 3S7EA 4YVWB 3INAA 5T52A 5ACA2 1D4VB 1OSGA 1W6MA 3KT7A 2MEV2 1Q8PA 5DUUA 2BWCA 1NYWA 3NKGA 3RMYA 2DTWA 2BFUL 4Q4X3 1J3PA 3J8F3 1PM7A 3JCIA 4XYXA 1C4RA 1OQEA 3QH7A 3R0RA 3SCGA 1W0OA 2BVVA 1S0JA 4CEWC 5I8TA 1XU1A 4OLLA 3SLIA 4JV4A 3TB0A 2DVGA 4IXLA 1IKPA 4NWWA 3THPA 4CEYC 3WDUA 3N4MA 2Q1ZB 3VKMA 2VNRA 3AM2A 1BVVA 1GFF2 4OFGA 1XE8A 5JIUA 4D69A 1ZBA3 1HV1A 5CFCA 2R0HA 2VW0A 1QJU3 4Z8BA 5C6CA 2RR12 4YW4A 4Q4X1 4WV8A 3FHIB 2E63A 5T5JA 2ZGQA 4QGMA 1OA4A 1UIKA 3M1HA 3ZX7A 3LSDA 1CAVB 4QQLA 4BH9A 4S2GA 2JE9A 4RQPA 1W0PA 2P37A 3WQ1A 1AXYA 1N1YA 1PK6A 1AL0G 5E89A 3VBFC 1H8TB 3HMYA 2JX9A 1UPIA 4AI1A 1JBCA 1WCKA 1GICA 4XETA 3MLKA 2DUPA 2VMHA 2WT2A 5K0UC 5DUVA 5CFCC 3CO2A 1EV13 2FQPA 4FXGB 4M3CB 2PELA 1V6JA 1FPN2 3FBYA 1D0GA 3VBSC 2BPA2 1QH7A 4RGAA 1V70A 4XDQA 2DUQA 5KXBA 1V6MA 3RJRA 2DVAA 5FOBB 4CEYA 2R062 5J7MA 5T5PA 5FPZA 5D8AC 4R9DA 3B94A 3TYJA 3PMEA 2TBVA 3V64A 3C3VA 4HMZA 5HXVA 1XYOA 4QPIB 2DVFA 4P9LA 3RS6A 1QH6A 5E16A 3IM0A 2PHFA 4R9AA 4BWOA 1WLDA 5KXCA 4YFZA 2HWC1 5J36A 1PNFA 1RUD1 2RR13 2YPJA 4Q1RA 1FMD2 4L97A 5JVVA 4FPCA 1BCXA 1HQLA 4YW3A 4JDOA 1H8TA 4AVBA 4DB5A 1RJ8A 1B35B 3O14A 5KXEA 4W6YA 4MGZE 5JOYA 4AI0A 2AZ5A 2BUKA 5JI7A 1ZZ7A 5ABJA 3MW2A 2DV9A 3NSTA 3GZUC 4IEZA 2ZAHA 2HWB3 2P34A 3WCSA 4Y1XA 4AFBA 1XRUA 2X53S 3ELNA 4YGBA 1GZWA 3WG2A 4XHXA 1XE7A 3WVJA 3VZKA 4HSLA 2I74A 4YW2A 1I6XA 2ZGLA 5DUXA 1RUF1 2R063 2RJKA 1BMV2 1X8EA 4OHYA 4BPZA 4QM8A 2ENRA 1S0GA 5BNPB 5AC92 2ILMA 4YZ4A 4Q4Y2 1DF0A 2ARXA 5F6KA 1UD1A 1ZREA 2AUYA 2GZWA 1DQ4A 5F5QA 5HCFA 3IBMA 2GC0A 4O9EA 3GZTB 3WXPA 2ZS6B 4MGYE 3WDTA 2K0GA 3VBRC 2ZX4A 1O3RA 5TSWA 2H0VA 4RHV3 3KSCA 2R6QA 4JGYA 1RUE3 4CDXB 1Q5OA 2GH8A 2ZGRA 1GSLA 5CU1A 4G9SB 1RUH3 1ZBE1 3ES4A 2OUHA 2AR6A 3CJIC 3AXEA 3N7KA 4MV2A 5DG1A 2VY0A 3TN91 3GNEA 4QT6A 3CJIB 4H55A 1QJY1 3VKNA 1CGPA 1H1IA 1W6OA 2CL2A 1G86A 2VNOA 1O5LA 4MXVA 4COUA 3VL8A 4JTOA 1QJY2 2PFWA 2EA7A 2R071 4AG4A 4PQ9A 1OA3A 5I0UA 3VHNA 1JHNA 4MYEA 1NE4A 2A6XA 4HVOA 3GZAA 4AGVA 3R4SA 4I0AA 4DY3A 4LA2A 1Y7BA 3HQXA 1VBE3 4YZ5A 4XTMA 4AFDA 2FMDA 4L99A 3U4XA 1GLHA 1R1A3 2UWCA 2OIIA 5KHHA 5A3MA 1RINA 4IEVA 1DGRN 1AR61 1LHWA 1UZYA 4M0NA 1KFUL 4BMEA 2KA3A 3AKTA 3R4UA 5A33A 1RTVA 4YGCA 1YO8A 1FNZA 3H50A 4WM7B 1CESA 4B3NA 1RUC3 1DYKA 2R041 1ENSA 4EROA 1SACA 4FQ4A 4PCRA 2XH6A 1MZ6A 3WINE 2XVKA 4NWVA 4AHXA 4IV3B 2D6OX 1OLQA 3B3QE 3NAPB 1CJPA 4YSFA 3VKOA 3NV3A 2F6BA 5FAXA 1BBT1 5JIAA 2IXKA 4B7KA 2VQAA 2ZX1A 1J3RA 5LRRA 3MLLA 4FAHA 1VB4A 5F9TA 4FSJA 2ZACA 3FBMA 5T55A 1Q8OA 3OD4A 1COV3 3I8TA 1KD7A 2G4IA 3POSA 4LBNA 3ZFGB 1ZX5A 4JRAA 4WVZA 4ZU5A 1H0BA 3AXDA 3RMXA 3O12A 3B9IA 1AYN2 3S30A 1LOFC 1AYM1 1S1AA 4WVMB 1RJ7A 3LWCA 4WZFA 3ZFFC 4YARA 4AQSA 4JGYC 4DRRA 3N3HA 3ZSMA 1DGLA 5J3UA 4YGEA 4JTNA 3GHNA 1ULCA 1VBD1 1HLCA 4WM7A 4QXKA 1YJKA 4RS5C 3AZZA 3MW3A 2RE9A 2HWF3 4DPNA 4XFBA 2GN3A 2RJLA 3BOPA 4FOVA 2XBO2 3RI8A 3VHOA 4RR3B 3KT4A 3H1YA 1R091 5IK7A 1PHMA 1RUI3 1QJU2 3M70A 5CB7A 1HX6A 1D4M1 1ASJ1 3WZ1A 1PVC2 1KDKA 3AKRA 2RM21 4LEJA 2DCKA 4S2HA 5L73A 4QGNA 1Q8QA 2DCJA 1ZZBA 2EXIA 2OW4A 4XJWA 3ZN6B 1WCSA 1AL23 2JECA 5K8SA 1LB2A 5T5LA 2CNAA 3ZPYA 1LU2A 1A3KA 3D0SA 4FXKB 3WR0A 1POV0 4K8FA 1SMVA 1GV9A