2OZJA

Crystal structure of a cupin superfamily protein (dsy2733) from desulfitobacterium hafniense dcb-2 at 1.60 a resolution
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
110
structure length
110
Chain Sequence
b'MARLKNLPQERPLPLASLIEARENQVLSMALAQSDRVQISLFSFADGESVSEEEYFGDTLYLILQGEAVITFDDQKIDLVPEDVLMVPAHKIHAIAGKGRFKMLQITLID'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cupin 2, conserved barrel
publication title Crystal structure of Cupin 2, conserved barrel (EAT53321.1) from Desulfitobacterium hafniense DCB-2 at 1.60 A resolution
rcsb
source organism Desulfitobacterium hafniense
molecule tags Unknown function
total genus 18
structure length 110
sequence length 110
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-02-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2ozjA00
4EWDA 1YHFA 3MZHA 2OYZA 1XE7A 3EBRA 3H3UA 5I8YA 4HLTA 3LA2A 5BY5A 4IESA 3LOIA 4QM8A 4JV4A 1X8MA 3CL1A 1HW5A 4AXOA 3RYKA 4Z07A 3ROUA 4AVCA 5EFUA 3CO2A 4ZU4A 1IPJA 1OFNA 3KCCA 3I7DA 3MYXA 2QDRA 5LEJA 3LA3A 2GAUA 3EJKA 4XFAA 5FCCA 3KGZA 2OA2A 4LEJA 3H1MA 2I45A 3LWCA 2C0ZA 5FPZA 1IPKA 1RUOA 3S7IA 4YRDA 3TNQA 2HKXA 3MDPA 5I0SA 1PM7A 4PIYA 4XF4A 1RL3A 5FLIA 4D7SA 4XF9A 2UYAA 4HVQA 4E2QA 2ETEA 3IIAA 5JSPA 3QACA 1ZVFA 3HIFA 3BALA 4HN1A 4XFBA 2PQQA 2MPFA 2B9UA 3ACLA 3ES1A 3H50A 4QMAA 4BHPA 5FQ0A 1EY2A 2E9QA 4D7TA 4KWLA 1X8EA 4IEPA 3RYRA 4RD7A 2IXIA 3OD0A 1CX4A 1SQ4A 4IEQA 5KHIA 4KWJA 4AVBA 3B02A 2GC0A 3NKTA 4I2OA 3R6SA 2BNNA 3ELNA 2WC2A 5J7MA 1ZRRA 4EROA 1DGWA 3WW4A 1O7FA 3DV8A 4PIZA 2H6CA 4R52A 1O3QA 2CV6A 3E5XA 3NW4A 4AQ6A 4QGMA 4AVAA 1YFXA 1YFUA 4Q0VA 5KBFA 3RYPA 3SCFA 2WFPA 1I5ZA 2H6BA 2PTMA 4J1XA 3DKWA 2VPVA 4F7ZA 4XF3A 4HN0A 1O3RA 5KHGA 1XE8A 2OZJA 3E97A 4L2NA 3E5UA 2EA7A 3SCHA 3LZZA 5KHKA 2GC1A 5I93A 3IBMA 1Q43A 4KU7A 3NJZA 5K8SA 2BNOA 4N9HA 2OZ6A 3HT1A 1LR5A 1YUDA 1O5UA 3L2HA 5BV6A 2V09A 1O4TA 1CAWB 3PNAA 3MPBA 2XKPA 1PMIA 4KWKA 4QXKA 2K0GA 2VQAA 4I01A 1V70A 2P17A 3CF6E 3HT2A 4LA3A 2D5HA 3SMHA 1UPIA 1O3SA 4ZU7A 4OLLA 5BPXA 4KU8A 4UBGA 5HI0A 4FBFA 1CAXB 4I09A 1X7NA 2F4PA 5I8SA 4MZUA 4XEZA 2CAUA 4XFGA 4HMZA 3BB6A 3DN7A 1O3TA 4Q0QA 3E5QA 4IEXA 2XHKA 5JAXA 4LUMA 3N4MA 1RUNA 2PHLA 1ZZCA 2PHDA 1CAVB 4QM9A 3RNSA 2IC1A 4XFHA 4IEZA 4ZU5A 3S0MA 3U0ZA 3FWEA 4HSLA 5I0RA 1YWKA 1J3RA 5LRSA 4E2GA 3RPQA 4E2SA 1J3QA 4P9GA 3BCWA 1CAUB 1NE4A 4O9EA 4LUKA 3PVBB 3KGLA 4GULA 4MH0E 3H1YA 2QJVA 4XETA 3KMHA 4PIXA 2PA7A 4FAGA 3RZZA 3SHRA 2ET1A 5JR7B 1G6NA 5I8TA 4QGNA 2Q30A 3GBFA 4Q0PA 1OI6A 4YYOA 4MGKE 1RGSA 4A2UA 1ZRFA 3WW2A 4FAHA 2IXJA 3FFQA 2D93A 4XFFA 5JSOA 4BIFA 4KL1A 5CADA 1EYBA 1J58A 1Q3EA 4LULA 2EAAA 1RTVA 2B8MA 2D40A 2PYTA 3O14A 5J3UA 5E16A 2OPKA 1J3PA 2IXHA 3NL1A 3FX3A 4IEUA 4LA2A 1OD5A 1Y9QA 2CGPA 1YLLA 5FLHA 5AVPA 2QVSB 2XLGA 4Q0UA 3I59B 1YFYA 3IWZA 1LKNA 3OCPA 4MUVA 2IXCA 3USSA 4HVOA 4LTAA 3H8UA 2BGCA 1CAWA 4Q0SA 2PAEA 3WW3A 1ZRCA 2O8QA 3LA7A 1O5LA 4I0BA 5LRRA 1FXZA 3ST7A 5CU1A 2FQPA 2FMYA 2Y0OA 4OFGA 2XLFA 1CAXA 4XF0A 4HBNA 3FE5A 2XL9A 1QXJA 4WVZA 1ZREA 3QOPA 1WGPA 4H7LA 4JTOA 4IEWA 4I02A 3JZVA 2QCSB 1ZZ9A 3RDIA 3ZDSA 2Z69A 4O9GA 4X6QB 3FJSA 1CAVA 3H7JA 4J1WA 2Q0AA 4EWEA 1GQGA 1I6XA 4MX3A 3LAGA 5FPXA 2CAVA 1FI2A 3E6DA 3NVCA 4MGYE 4K8FA 3OF1A 1ZRDA 2ZCWA 3CEWA 4YNIA 2Z2SB 2GU9A 1QWRA 2EVXA 1CAUA 3DL3A 1H1IA 1SFNA 4IERA 4QX5A 4X6RB 3FHIB 4IEOA 3D82A 3ETQA 1WA4A 4JVAA 4MGZE 2MHFA 2XLAA 5JSRA 1TQ5A 1VJ2A 2VECA 2BYVE 3H9AA 4EV0A 2QNKA 3OGJA 5E1RA 1UIJA 4HSJA 4R8HA 2MNGA 4BYYA 2PAMA 4IEVA 1ZZ8A 2D5FA 5FLJA 4DINB 3BPZA 4NVPA 4PJYA 4TLFA 1JUHA 5FDBA 1X82A 1LB2A 2UYBA 2IXLA 2XGXA 1QY4A 5J48A 5CVRA 3I54A 3SCGA 1UW8A 2KXLA 1CGPA 4MGIE 5BXXA 3TNPB 4I0AA 2GC3A 4BH9A 3U11A 2IXKA 1DZTA 2UY9A 3EQEA 1FT9A 3FZ3A 3I59A 4LLOA 5BUVA 1J1LA 2ZKLA 1DZRA 2ATFA 2ET7A 2N7GA 4EWAA 2XKOA 4UXAA 3EO6A 5I91A 2H0VA 1WLTA 4N9IA 3E6BA 2BNMA 4XFCA 2UY8A 5T3NA 1NE6A 3OTFA 1GQHA 3UKNA 3C3VA 3IDCB 1RC6A 1ZZ7A 3G7DA 4ONUA 4QGLA 2GZWA 2GH2A 4Q29A 1YFWA 2BEOA 1ZX5A 5JCTA 4I3PA 3GYDA 2Q1ZB 4IEYA 1SEFA 5I0UA 1ZZ6A 3E6CC 3SXWA 1L3JA 1EPZA 1Q5OA 2PFWA 3H3ZA 2K9ZA 2O1QA 1UIKA 3NSTA 3KSCA 4YARA 4Z82A 4XF1A 4META 1H1MA 1EP0A 3CLPA 3H7YA 3D0JA 3HQXA 1Y3TA 5KHHA 4L11A 2PAKA 1UCXA 3UKVA 4WBBA 4MV2A 3UKTA 1NXMA 1QXRA 1NZCA 1DGRA 3PLQA 4JTNA 1OMIA 5EZWA 3M3IA 5I0TA 3CJXA 1ZZBA 3EHKA 2XL7A 1J59A 3D0SA 4XFIA 3ES4A 5KHJA 3BU7A 5FQ0B 4IETA 4HZFA 4UBHA 1ZNPA 4YSFA 2GC2A 2HJIA 3H1WA 1U12A 1VP6A 1VR3A 1XRUA 1LRHA 3U10A 4FT8A 5C6CA 4WZCA 5D1IA 2Q4SA 4CYDA 3WW1A 1NYWA 5F1RA 2DCTA 4ORFA 3S7EA 3IDBB 4HVRA 3VHRA 4AQ2A 2B5HA 5C8WA 1UD1A 3M70A 4B29A 4F8AA 5LEKA
chains in the Genus database with same CATH superfamily
4EWDA 1YQ8A 3MZHA 2OYZA 1UU5A 1H2MA 2WWSA 2PHFA 2W3JA 3GJAA 5I8YA 3WQ0A 3LA2A 5SV8A 4Z2WA 5BY5A 4IESA 1W6MB 1AXKA 1HB4A 2ID4A 3N9MA 4QHZA 4CP1A 3CZJA 4GMP3 1Y4WA 1UAIA 1X8MA 1NCRA 3MW3A 3NMBA 1QQP2 5EJ3A 2ZGKA 5EV7A 5LATA 2FDHA 4JZRA 4K3UA 3ZX7A 2YB7A 5EFUA 3PUHA 3NV1A 1VMJA 2GNDA 1JZ4A 4CDQB 3I7DA 3MYXA 3Q8CA 1D4M1 1LJ7A 3LA3A 2QQNA 3FUQA 4NWWA 1AYN1 2TUNA 2GNBA 2ES3A 3AP9A 4IV3C 5FYCA 3ZFEB 1UY0A 2VVEA 3UESA 1GV9A 3OSDA 1W9YA 3IDAA 4BQXA 3H8RA 3WF4A 4CDXB 1W3XA 2EIDA 1RUF3 3LFMA 4GKXA 5JPMB 4W6XA 1RUF2 2WAOA 2CSGA 3UYJA 2W92A 1RUOA 1HV0A 2ZOEB 3LFIA 3QD6A 3AX4A 3AKQA 2BP6A 3N3HA 4NRQA 3WEZA 1FX5A 4AL9A 4QQPA 2W1WA 1QJX3 1CZVA 3AYDA 1GWLA 4KNCA 1V6KA 4N43B 2E7QA 2VNVA 2W1QA 3BYWA 4GJYA 1R083 4DB5A 4CP9A 4EYUA 5BNOA 2ZGSA 3GXUA 1S0CA 4HVQA 2WZPP 4GB33 3ZFFC 4XILA 2ETEA 3IIAA 1AR73 4OCTA 4JDOA 5JSPA 4JHZA 4YGEA 5JXIA 5L19A 4NPLA 4Y5SA 1ZVFA 3ZYHA 2YFUA 3T2OA 2NP0A 4UW5A 4DXZA 1PGSA 1VB4A 4NIDA 1KXGA 2HYKA 2PQQA 4R9CA 3AKRA 2D6OX 2IFRA 4B1LA 1ENXA 2QE3A 2VE1A 3ACLA 3ES1A 2RS12 4XDPA 3ZN6B 3RGBA 4BHPA 1MQTC 1EY2A 1TME3 3OJBA 1VRH2 3ZN4A 1RJ8A 1RUH3 2E31A 3B00A 3Q8EA 4IEPA 2VMEA 4CCMA 3RYRA 1OLMA 2R0FA 3TEXA 1LOFA 4RR3A 2X5IA 3ZYBA 1ULDA 1DFQA 1YO8A 2W9XA 3NKTA 4AVTA 2BNNA 4CEYA 2JG9A 1PMHX 4P14A 5ACA2 5C4WB 5L7OC 2PMWB 4PQQA 4A3ZA 4YG0A 3ACGA 5FJHA 3LOBA 5C33A 1GZWA 2VW2A 4IE7A 3FC0A 4WVMA 5F9TA 1MVEA 2H6CA 2ENRA 1PZ8A 2I07B 1NX9A 3E5XA 1RVF3 4AQ6A 2ZAHA 2VUJA 2VQUA 2Z4FA 4CUGA 1JOPA 3SLIA 3KT1A 4Q0VA 4RGGA 1QJU3 4DXRA 1RVF2 5LZ6A 4A42A 2OXBA 4WM7C 4XBLA 4XW3A 4B7EA 3S57A 2WFPA 5FP3A 3AKTA 4FPJA 1MACA 1H30A 3TAYA 1W6MA 1I5ZA 4P9JA 3FHAA 2H6BA 3ZIWA 4J1XA 1LGBA 1YCIA 3DKWA 3VL8A 1SLAA 2VPVA 4F7ZA 5EXOA 3JUUA 4HN0A 2EIGA 1AYM1 4AHYA 5KHGA 5HXMA 2OZJA 5IVYA 3ZN5A 2A71A 3AZVA 4L2NA 1ODMA 3B01A 4BE3A 1C1LA 4IXLA 3SCHA 2GNMA 3JXSA 2GC1A 3VN4A 1HRV1 3IPVB 3WF3A 1QJX1 4A7ZA 5KHKA 3W5NA 2JE7A 4BPZA 3I2FA 4DFSA 4KQ7A 1D0GA 2NYYA 3VBHC 2A6VA 3ZFEA 1PZ9A 3TOJA 4N9HA 1GWKA 4LQRA 2QQWA 4CDXA 1LR5A 2O0OA 3E1F1 3LDKA 1BBT3 4GB31 2J7MA 5LBEA 3CJIC 2YGLA 1BBT2 1AR91 2XKPA 3PNAA 4QXKA 2K0GA 5GZEA 5C8CA 5LK7B 1NA1B 4AI2A 4V1PA 1FPN2 1G8WA 3CF6E 3BIEA 4UFIA 4P00B 3DECA 4C1WA 2E26A 3MBWA 4ZU7A 1F2NA 4OLLA 2YG0A 4UBGA 2X29A 1JXNA 4IV1B 4PBPA 5LASA 2RHPA 3OEAA 5FYIA 1WBLA 3O0WA 5AFEA 3AP7A 4I09A 4N43A 1X7NA 1SZBA 4MZUA 4BQYA 2CAUA 4HMZA 3THCA 4FXKB 4YM3A 2Z42A 3E5QA 5IHRA 3EB7A 3OUIA 3HOBA 3GNEA 3HN3A 1K5MC 3BVCA 2XUMA 4UFKA 4ZXKA 2VZPA 1RUNA 2FCUA 2QFEA 1W2AX 3THTA 2R043 4XBQA 5C9AC 4HL0A 2O14A 1QH7A 3BODA 3RNSA 1PGW1 2R042 4Y1ZA 3VD9A 2SLIA 3VDCA 5D8AC 4C0BA 1E5IA 2VBPA 1JHNA 3U0ZA 4UFJA 1AX0A 4WM7B 4XCAA 3J7HA 5I0RA 5JLVA 3ZN6A 1GANA 2ZX2A 2XDVA 1UL9A 3PTYA 1JOBA 3BU0A 2A7AA 3O1TA 3ASIA 3T0DA 1K45A 3TRSB 3ZXDA 1CAUB 4WM8C 1DQ4A 4OZXA 4O9EA 2A70A 4AE2A 4LUKA 4BK4A 4AOCA 5A1AA 5JUVA 1W90A 3FLPA 1S2KA 4CTEA 3UETA 5IK5A 4Q8LA 1YQ5A 4PIXA 3U1XA 2RM21 2XBO1 5C4WA 5KXDA 2ET1A 3KM5A 4Q4W2 5DN2A 2WDBA 5L9BA 2HWE1 1Y7BA 3ZYIB 1PK6C 4AWDA 4ZY9A 3UV9A 4CCLA 4RFRB 1HV1A 4Q0PA 3BI3A 4YYOA 2CYFA 2YC4A 2OPWA 2VCCA 2C9KA 4IDZA 3S5QA 4FAHA 1IS5A 4AG4A 3CJIB 2FDIA 3OBTA 4NIGA 1XSRA 2D93A 2X53S 2VMDA 3POIA 3PUIA 5DUUA 5JSOA 4U36A 3LGRA 5FV3A 1G9BA 4NROA 1J58A 1KJLA 2W08A 5FZDA 1VAKA 1YJLA 3HNBM 1OHFA 4KMQA 3WT3A 3ZFGC 2B8MA 1O8SA 2D40A 5JI7A 3O14A 4A44A 5ANQA 1GOGA 4NO4A 4GD4A 5FYVA 5IAXA 3FX3A 3RVHA 3IPVA 3WNPA 3M7AA 1FATA 1AL0G 1OD5A 5JWPA 5FLHA 4QQ2A 5AVPA 4V2VA 2XLGA 4Q0UA 2WO2A 4INDA 4MGQA 4XQDA 1YFYA 3AMNA 2Y0IA 1SLIA 4H3WA 2H0BA 1D0HA 4XJ9A 3PJQA 2ZMNA 2YU1A 4RFT0 2BGCA 3F95A 4Q4Y1 2JDUA 4NHKA 1X9TA 2E33A 3H3LA 3I2KA 5LK5A 4Z8BA 1NA1A 2DWRA 1OH3A 1W0PA 2WZR3 4QHBA 1VBA2 1L7RA 4CE8A 1RMU3 4BWOA 1AR63 3HQRA 3RZKA 2WZR2 1FMD1 2LTNA 2WA3A 2BVBA 4OI1A 5LWBA 1AR62 4IV1A 5CU1A 1JYVA 2FQPA 3QBQA 2FMYA 4QQOA 4OFGA 4HETA 1U5IA 1VBE3 3VBSB 2Y6JA 4HBNA 4UWDA 3J4UH 4BMEA 1QXJA 2ZPXA 3OPWA 3MV11 2BV4A 3R4UA 1WGPA 1VBE2 2DFCA 4CUBA 1QKQA 5A7WB 5BYNA 4PLMA 4JTOA 4IEWA 4H14A 2WSUA 4I30A 1ZZ9A 3VHNA 4A45A 3BIWE 3POWA 4X6QB 4TTGA 3KF3A 4LO6B 4J1WA 4MXVA 4ZS2A 1UPSA 2VUDA 3BOPA 3O1MA 3LAGA 5FZ8A 3RQ0A 5K0UC 4WM7A 1YI9A 1RUJ1 5IW0A 2VQ0A 1H8TC 3OF1A 1NCQC 1GZCA 4OVEA 3WY6A 4ASLA 2Z2SB 4FXGB 4MXWB 2F4LA 1SBDA 2BVVA 5CNAA 1CAUA 1UU6A 1P8JA 3HPNA 1SFNA 4QPGB 4QX5A 4DEVA 1N3OA 1OUSA 3W5MA 2EXIA 3MIBA 1BMV2 4IEOA 2ADEA 3C7GA 4U2AA 5A6ZA 1WA4A 2XWJB 2ZHLA 1QJY1 1JHJA 4JQTA 4YVWC 3WVJA 3ZLIA 1TQ5A 4UT5A 1VJ2A 2FBEA 3H9AA 3U4SA 4BXSV 2WL1A 3OUHA 4K9SA 4IE4A 3BKZA 2FZ1A 2MNGA 3ALQA 1IQAA 4XVHA 3CJIA 1VLNA 5FYSA 1DQ0A 2RDSA 4PDWB 2OUJA 2AREA 1WCKA 4E9KA 4DINB 2PHRA 2GSYA 2P2KA 3JBG3 1IS3A 2WNUB 2R071 1US3A 3JBG2 1X82A 4C91A 4CEWC 2IXLA 3I54A 3SCGA 2VUAA 5T52A 2DBNA 4MGIE 2OX0A 4YPJA 4A3XA 5I91A 2Q5TA 4XMAA 2GC3A 4BH9A 1F31A 1UQXA 1HJFA 1WMFA 2DUQA 2DV9A 3T09A 2HEVF 4LBNA 5FTTC 3ZKUA 2WNEA 1DCSA 1E5SA 1SFPA 3LPGA 1Q8QA 4QWNA 3SITA 1QMJA 2UY9A 2ZHKA 3I2IA 3EQEA 1V9U3 3F2ZA 2YDEA 1N3QA 3FZ3A 5BNPB 5JR2A 2IFWA 3POGA 5A70A 2HLEA 4XJUA 1DZRA 3AM2A 5FZIA 2VUCA 5HCAA 2BBVA 1I9RA 4FOYA 5FRAA 3IMNA 2VW1A 2WAAA 1YJKA 1H8TB 2G9FA 2XJTA 4N9IA 1JOJA 2DYCA 5GLTA 1H2NA 1VALA 4CCCA 1GMMA 1W8OA 1SLBA 3IKWA 2V73A 3UKNA 4XXAA 5GLUA 3KD4A 1E57A 2J1TA 4KG0A 4QB6A 4YZ4A 4ZKTB 2PHTA 2B46X 1WW7A 3OG2A 3GM8A 3K3OA 4ONUA 4QGLA 4WVWA 4YW7A 2DCZA 2P3KA 4Q29A 5FZHA 1GFF2 1W6OA 1YFWA 3VBSA 3PJYA 1LEMA 1ZX5A 2QQIA 3FLTA 5HCBA 4EZ4A 2XWBB 3SISA 3JD71 2ZGNA 1NLRA 4ES8A 1FAYA 3GYDA 1T2XA 3C7FA 5A7WA 5B4XA 5I0UA 2HWF3 4DUXA 2VZQA 4LORA 4TXWA 2VCAA 3NSTA 3RJRA 4LNVA 3RWKX 4CP0A 2WNVB 4XF1A 4META 4YW2A 1Q8SA 3B69A 3O12A 1UYZA 3CLPA 4GA9A 4DNYA 3H7YA 4B3NA 3HQXA 4RSUA 1X33A 2JB4A 3UKVA 1XSQA 3UKTA 1OPMA 1MS8A 1GSLA 1DQ5A 2TBVA 5EZWA 2D6NA 4JAAA 1VMFA 3CJXA 4XJAA 4YGBA 4COWA 5A6XA 1GP6A 1REEA 4MXWA 2PHXA 3X29B 3QH7A 2GNTA 5AC91 4AEDC 1GQPA 4CP2A 2QQKA 3ZPOA 2CTVA 1W2UA 3D0SA 3WNOA 2HWC2 3A4UA 1SACA 1ZRIA 4UW4A 4XAAA 4QX3A 5A7NA 3ZXLA 3RS6A 1ND2B 3ZKYA 2R6QA 2XVKA 5EPAA 5FQ0B 1C5IA 4M3CB 4FTBA 1W2TA 3UT0A 1RUG3 3WQ7A 2PHWA 3ZSMA 2JICA 4Y26A 1PO13 1VR3A 2VTXJ 3INAA 1D7PM 1UYPA 1LRHA 1VBB1 4AHWA 2W68A 1PO12 4LBKA 5FFOC 3JQXA 4CCOA 1S0BA 2ERFA 4QPWA 1OKOA 2BJSA 4GJZA 1Z7S3 4PDWA 1XPWA 3OGVA 2DVDA 5J37A 1V9U1 1UXXX 1Z7S2 2WNUA 1MS4A 1KS5A 1F8VA 2XONA 3VKOA 3WQ1A 2WT1A 2PELA 3M70A 1BKZA 2VZTA 5FXWA 4NR1A 4XJ8A 1UMZA 3LF7A 2QUOA 1TNFA 1YHFA 4W8JA 4S2FA 5IT6A 1M4WA 4M3CF 4XHBA 5LBFA 1A78A 3H3UA 4HKOA 1RJ7A 4HLTA 5J98B 1JH5A 1ST8A 2FDJA 1JYIA 1HLCA 3LOIA 3POSA 3EXUA 1UY4A 3VZJA 3VDAA 5FZLA 1SCSA 5ABJC 2R30A 1DBNA 2JB8A 2VQTA 2R49A 2VAUA 4KBZA 4AXOA 5A33B 5BNPA 5IATA 2DU0A 4OQ9A 5IVCA 2PLV1 1OPOA 1PX4A 3VKMA 1COV2 1ZBA2 1WA6X 3WZ1A 2VMCA 4YFZA 4FVVA 5JXJA 2HWF1 1IPJA 1E5RA 4Q1PA 5DZFA 2W39A 5K0UA 3I4IA 2QZ2A 3KCCA 2VBDA 3NV3A 4LKFA 2MEV1 5FUIA 2YC0A 1SDWA 4E27A 1H8TA 2GAUA 2HWD2 1CD3G 3CDZB 4LEJA 3H8OA 4XE9A 1RUC1 4H55A 1CJDA 3ZXGA 3HBKA 2VBBA 3BN6A 4LIUA 3KCXA 2P3JA 4CXYA 2D7FA 1QEXA 5C3SA 5BNQA 3CMGA 4AI0A 4YRDA 4NN0A 4OHVA 4YZ5A 3T0BA 3VBFC 3ZPYA 4BB3A 1WCDJ 4QX1A 1G9FA 5GZDA 3LD8A 3BUCA 5KXCA 4OZOA 2WNVA 3NNLA 4QPIB 1LHVA 2JENA 3AMPA 4RQPC 5H9SA 2RR13 1VE0A 2RS31 1JYNA 4FPLA 5JXGA 2UYAA 1W0NA 1B35C 1ONAA 3N9OA 5J36A 1WLDA 5F3GA 2E63A 3KS7A 1BCXA 2HEYF 3PIJA 5F7UA 3V0BB 3LPFA 3HIFA 1W03A 3OPTA 4HN1A 5IVFA 2NMOA 3B7MA 5TSWA 1NLQA 1BZWA 1SLCA 1PNFA 3WR0A 1DQ2A 1EAH2 4XIOA 3H50A 4PI0A 1ND2A 4QMAA 5FQ0A 3TN93 3H0OA 1OA3A 2E9QA 3MFCA 3PVOA 4M3CA 4BQWA 1X8EA 1D4M3 2XQXA 3O1UA 1LESA 2IXIA 4LKSA 3KWVA 3OD0A 1AYN3 1CX4A 4IEQA 2KM2A 2QDNA 3KV6A 1D4M2 4GKYA 5IVEA 5KHIA 3OD4A 1AYN2 3IZOA 2GC0A 1CQ9A 3MGUA 3T30A 3W59A 5BNOB 3P6BA 5HBAA 4I2OA 3V56A 3ELNA 4JC1A 4YZ3A 3WNLA 5CIRA 5C3PA 1KDMA 2BWCA 1AXYA 2X10A 4AZZA 2JD4A 4CCKA 3Q9OA 5EYYA 4GWJA 2J1EA 1OF3A 3VUOA 4IE0A 1TZOA 1ZRRA 4M00A 4M4PA 3VL9A 4EROA 3WG2A 1GLHA 3OYWB 2WZEA 3DV8A 4Y20B 4R52A 1O3QA 1XYOA 1UKRA 3NW4A 5LY2A 4AVAA 3T4HB 4COYA 3ZO0B 3JCIA 5CYYA 5KBFA 1GICA 1LODA 4KGGA 1US2A 4QQLA 2HWB1 4SLIA 1Q8VA 1NY72 2BOIA 2W5FA 1HIXA 3N7KA 2PTMA 4CPBD 1PVC3 5GLVA 1RITA 3MIDA 3NAPC 4LBLA 4XF3A 1ULOA 1N1SA 2Q8OA 1R091 2WO1A 3N9NA 5A33A 5C5TA 2WRAA 1O3RA 2LROA 4ASMB 1LHUA 3K4ZA 4K1ZA 3LZZA 1B35B 2CL2A 1Q43A 3NRUA 5FZ0A 3NJZA 4HFSA 3UGGA 1AX1A 1MS9A 4Q5OA 5IWFA 2BNOA 1PO23 2BTVC 1VBD2 4FPOB 3PL0A 1BQPA 2JX9A 3J7NA 4JKLA 2OQ6A 3MW2A 5B4NA 1YUDA 4AEJA 1HN0A 1O5UA 3VZOA 5BV6A 3UL2A 3VDDC 1O4TA 4E4ZA 3MPBA 4KWKA 3I3MA 2G9ZA 4I01A 1V70A 2P17A 4JDMA 4CA9A 5CBLA 2D5HA 3SMHA 1GOFA 1O3SA 3C7HA 3I3DA 3MIGA 4KU8A 5F32A 3RZJA 3CBNA 4ARXA 1SPPB 4LO7A 4QPIA 4FBFA 3TN91 1CAXB 5FPUA 4UAPA 1AF9A 3DF0A 5FZ7A 3HNMA 1LOBA 3C7EA 4XEZA 3QH6A 4N7IA 3DN7A 1MS3A 4LE3A 3N35A 1CZSA 2VXJA 3NV4A 2XJVA 4LBJA 3K4AA 2DVAA 2A6WA 3W20A 3WNMA 4AAXA 4EN0A 5F6KA 5FZMA 1H2LA 2PHDA 1JU3A 3OGGA 4HKLA 3ZSEA 3V0BA 1GR3A 1SBEA 2FDGA 2ZJCA 4FO9A 2WLPA 4QM9A 2VNGA 4P9YA 4NRMA 4Q2FA 1SG3A 4XFHA 4ZU5A 3I2HA 4MHRA 3SH5A 1A3KA 2R7EB 4QQHA 5LCWL 3S0MA 1H8VA 1KITA 4YZ1A 2KD7A 5C8CB 1NKGA 1AYM3 2YBSA 2ZAAA 4HSLA 4L0PA 1OLME 1FNYA 5CG8A 2WYSA 5FY0A 1H1AA 2JDPA 2D43A 1AYM2 4LBQD 5KXBA 3AZYA 1NZIA 3GF6A 5LRSA 3RPQA 2VZRA 5B2GB 1QOTA 1BVVA 1HRV3 1XOYA 1VAVA 3ABZA 3I3EA 3VD4A 2J22A 4DQAA 4I0WB 4F83A 4HANA 4NE9A 1HRV2 1QJX2 4BQ2A 2RMU1 4CDWC 3OBRA 5A3PA 2ZTNA 3M4FA 3ZOIA 2R063 5FK8A 3H1YA 3CNAA 2QJVA 3VBUC 1R082 2RJKA 1H6XA 4Q4X1 1PVC1 5FMOS 3RZZA 2ZEYA 3SHRA 4XHXA 5DUXA 4EN9B 5A3MA 4GXLA 2XQRA 5FY5A 4GB32 1AR93 4B7KA 2WINB 2CWMA 4N90A 4AEKA 3K46A 2B42B 5IK8A 1AR72 1PNGA 2P3YA 2Q30A 5DG2A 1AR92 3GBFA 1OSGA 3OYWA 4BQ5A 2YGMA 4MGKE 1W8WA 4L97A 4Y20A 3U4XA 2BERA 2D3PA 2VZ1A 4FSJA 1HN1A 5FZGA 1UYYA 5FKCA 5D2AA 2IXJA 1OLRA 3PHMA 4JRAA 3O1VA 1QJZA 1HXS1 1PO21 2VGDA 2DCYA 3O0VA 1SLTA 5LA0A 4LBQB 1WUVA 4BIFA 1CX1A 4FQ4A 1TME2 1RUH2 1VBC1 3Q8FA 2EAAA 4UFMA 1QOSA 1S4CA 2RJ2A 3GBGA 1LENA 4LE4A 2YY1A 2PYTA 3AVRA 3MICA 4RQPA 5J3UA 5E16A 1J3PA 2AR6A 2BWAA 2JEMA 3ACHA 3AYAA 1LEDA 1AR81 1UX7A 4FOVA 1PGW2 3FFZA 3ZXKA 1UU4A 3ENRA 3S5AA 3K2OA 4C1XA 1B35A 2J1VA 4IV3B 4MOAA 5FYBA 2K2SA 3AVSA 1SLLA 2R32A 2RJLA 2OT7A 2QVSB 4QPYA 3RMYA 2Q8EA 2VL4A 3IAQA 1HRI1 3IWZA 4RL7A 5ISLA 1LKNA 2DTWA 2D3RA 4XUTA 3ZXAC 3H8UA 3VD3A 3H42B 3OEBA 1QJU2 4M0NA 4Q0SA 5CEHA 2PAEA 5J96B 5HPOA 1ZRCA 1QQP1 4FCAA 2RM23 2XBO3 2VOXA 3AKSA 3K51A 4RS5C 3VB9A 2C9AA 1MEC1 2IVJA 3DYOA 1LCLA 3NQHA 1ND3C 3PMSA 3OB8A 4QAWA 5DMYA 2RM22 4CPBA 3O1PA 2HWE3 4HXCA 5ERLA 1R1A3 1C8M1 1W8HA 2HWE2 2YHJA 1SPPA 2ZGLA 3N9PA 1B09A 2VZUA 2FHRA 1CAXA 3Q8AA 1YRZA 3FE5A 2XL9A 4NAMA 4WVZA 1BVP1 4CUCA 1K5JA 2NQYA 4XPVA 1ZREA 1WKYA 3ZFFB 4Q4V1 4I02A 2A75A 2I2SA 3HQUA 1R1ZA 3WF1A 4M4RA 2V5DA 4K20A 3ZDSA 1VRBA 2A1XA 3B9IA 1EV11 2R061 4DS0A 5A3TA 1U5XA 2Q0AA 2XVGA 3P3PA 5T50A 4Z2AA 2VZOA 1DGRN 1IS4A 1Q8OA 1MQTB 3AL6A 3KHBA 5FPXA 2CAVA 4OI0A 5FZ9A 1XBFA 5F3CA 4LOTA 3J8F1 3T2QA 1KRIA 2ZCWA 5JOYA 2R1BA 4WZFA 3PTRB 2V72A 2GU9A 1F35A 2JXAA 4PCRA 2EVXA 4ZZ5A 1F5JA 3LEKA 2ZEXA 5HXVA 4MGSA 3IMMA 4XIKA 3T2TA 1KQRA 4Y24A 1XQNA 3DCQA 5GALA 1KFUL 4S2DA 5A3UA 1LGNA 5L7OB 4UF0B 1QNWA 4PF1A 3RZLA 4JVAA 1V6NA 1ULCA 4AQSA 4Q4Y3 5FOJB 2MHFA 2Z5WA 2ARBA 4UFLA 1NXD1 2VECA 4NIAA 2BYVE 1IS6A 4Q4Y2 2UURA 4JGZC 3T08A 4QKNA 2BU9A 1KJRA 2RS11 3BOWA 2QQPA 1HKDA 2P5BA 1FMD3 2DBIA 4Y3OA 3I8TA 5FMDA 5SV5A 2C26A 2ZXQA 5BNNC 3W21A 1VRH1 1LOCA 4IEVA 4JGYC 1FMD2 1BK0A 1W0OA 1ZZ8A 2D5FA 3NWKA 4DY5A 1L7LA 3AP6A 2WABA 3TEWA 1WLCA 3CIHA 4IW3A 4JKKA 4YVSC 4NVPA 5KC6A 4QKFA 1OQEA 3DXTA 4LBQA 1W2NA 2CY6A 1CIYA 3DYMA 3VZMA 3DXUA 3GBWA 4R4ZA 2V4VA 2RV9A 5LB6A 5FDBA 3O1SA 4Q8KA 1ENSA 2UYBA 2NN8A 3WG4A 2LUWA 3WF0A 5J48A 1MZFA 5CVRA 3UNPA 1UW8A 3OOXA 5FZFA 3ON7A 4KH9A 4G4FA 3MV01 4Y22B 4OUSA 2DDUA 3N7MA 4K21A 2GALA 5FXXA 4BLIA 1R1A1 2A73B 4CXWA 4IV3A 1RUJ3 1H9PA 3U11A 4OHXA 4KWUA 3VBHB 3T1LA 1W39A 2W47A 1DZTA 1HB3A 3FHQA 1FT9A 1J1LA 1F15A 2G9GA 2ZMLA 1PIV3 5KXEA 2ATFA 2VTFA 4UXAA 1W8NA 2NPIA 3OBAA 3UGHA 4L92A 2W0XA 4Z92B 5DAXA 4FTEA 1W9FA 2BNMA 4XFCA 5T3NA 3M8LA 4A6SA 1QJY3 2VTXA 4LITA 1WBFA 4ZPIA 1W8TA 4EN6B 3IDCB 2W2IA 4OHZA 1QJY2 1UO9A 4N53C 3MIHA 3WNKA 2GZWA 2GH2A 4CDUC 2D97A 4LO4B 3VKLA 2BEOA 5JCTA 4H2AA 2Y60A 3TWIA 3UK9A 1NOVA 1KDKA 4I3PA 2W1SA 1K5MB 1OLQA 1OQ1A 1YYNA 4XURA 3ZFFA 1JN2P 4NHXA 2A3YA 1SEFA 1ZZ6A 2VMHA 5FZEA 4O61A 4QU1A 2CDPA 3SXWA 5C9AB 1EPZA 2NZ9A 1PGL1 5D8AB 2R073 4FPHA 2ZACA 4KBBA 3TB0A 3AMMA 4FP3A 2ARCA 1C8NA 1GYKA 1V6MA 3LDBA 2R072 5KHHA 3WCRA 1E5HA 4AI8A 2PAKA 4WBBA 3WNNA 1MQTA 3IDEA 1NZCA 5DUVA 3LIGA 5I0DA 5T54A 4K8RB 4CSWA 1BK1A 2BDRA 2BFUS 3M3IA 3NJYA 4WM8B 3EHKA 5FR3A 3KHCA 1RMU2 2K46A 4CU9A 1ULFA 2DU1A 4V2WA 1W6OB 4BZ4A 5IK4A 3PUQA 1W8ZA 1LOAA 1U5YA 1J59A 4BQ3A 3ES4A 4PBOA 4FFIA 2BPA2 2B45X 2GN7A 5A7PA 3K48A 4XTMA 5L7OA 4UF0A 5CFDC 4ZZ8A 3AK0A 1HQWA 2ZA9A 2G4IA 3POJA 2CGOA 1PK6B 1DYOA 4A4AA 4COZA 1U12A 4FFGA 2Z79A 3HN1A 4IE6A 2VNOA 1QIQA 1JYWA 1QJFA 1LGCA 1N47A 4F3JA 4MVTA 3WX5A 4FT8A 3I49A 5A7QA 4QT6A 1SCRA 3WW1A 4Y1XA 1H9WA 3RG0A 4CRQA 1C1FA 3S7EA 1LU1A 4COUA 3IDBB 4EZHA 3MIEA 5CFCC 4OI2A 4WV8A 1ASJ1 2A3WA 2CWSA 3PU3A 4XQ4A 3VHRA 4EN7B 3JD73 2R16A 1PIV1 2B5HA 5C5UA 4LR4A 3ZFGB 4ATEA 1UD1A 3WG1A 1ENQA 3I2OA 2B7YA 2DCJA 1RYYA 5LEKA 3OBZA 4F8AA 1JZ2A 3A7QA 3LKJA 4Q4W1 5IFPA 1W06A 1GWMA 1TEIA 2VOTA 5C3RA 2X09A 4FI9A 3MI8A 4Y22A 2Y6HA 2OQ7A 5A32B 2YPJA 1EUUA 1F5FA 2AUYA 1STMA 3VBHA 2SBAA 3AL5A 2WYFA 3CL1A 3WDWA 1HW5A 4UOJA 3LB9A 4Z07A 2J1UA 3KQ4B 3L2YA 3ROUA 5AC93 1FV2A 3DYPA 4HK9A 4QB1A 3CO2A 4DPNA 1XJAA 4ZU4A 1PX3A 5AC92 3ME2A 4Y4YA 5FY9A 1RXFA 3D3AA 5LEJA 5T5JA 2J1AA 3EJKA 4XFAA 5FCCA 4CCJA 2ZS6B 2ZGOA 2GH8A 3WOGA 5T55A 3I97A 2YMZA 3GJBA 1AUYA 3ZSKA 1XNAA 4GWMA 1PMJX 5DUWA 5FPLA 3MLLA 1VBB3 1K3IA 5A1FA 1DYPA 2VJXA 3NKGA 1VBB2 4H7MA 2P6HA 3PU8A 3P3NA 2CHHA 5F8PA 3S7IA 1K5MA 1MZEA 1YQCA 1U5ZA 4QXBA 3TNQA 2HKXA 2OS2A 2B4KA 3MDPA 5C9AA 4YW3A 3RZGA 4XF4A 5K4LA 5D8AA 1RL3A 3AZXA 3FL7A 1V9U2 3GZAA 5FLIA 1T6BX 1LAJA 1UY2A 5K0UB 2CDOA 5EIYB 2RS51 1VBA1 3NJVA 1KEXA 1HX6A 1OOPC 2WR9A 1NCQB 4GWNA 3AYEA 2ZEZA 4AI3A 4LHLA 3ORJA 5EJZB 2FMDA 4P5YA 2D3SA 3POBA 4WM8A 4YG3A 3POEA 1MZ5A 2VZSA 4CCDA 3BALA 1JZ3A 1AZDA 4YZ2A 2FD8A 5FKBA 2XUEA 1Y9MA 4P5HA 2YYOA 3L9JT 2DVFA 2PLV3 4HK8A 4YVWB 1POV1 4MYEA 1YIPA 4DRVA 2PLV2 3GZEA 4D7TA 1PK6A 4KWLA 3WHUA 4D0QA 4PLNA 4D6QA 5IVVA 2MEV3 2HWF2 5FXZA 4RD7A 2DUOA 1H6YA 2TEPA 2MEV2 4KWJA 2EIBA 3AZWA 5FY1A 1NLSA 2RDRA 2KA3A 2J42A 3B02A 1RUC3 2D6LX 1A34A 3R6SA 1WW5A 4KG8A 2WQ4A 3TBDA 3HWJA 1RUC2 1QXPA 1DDLA 2WWJA 4UYBA 4AFDA 3SH4A 3RI9A 3RFRA 4GQ7A 1WD4A 1FNZA 2GDFA 3KV4A 2DCKA 4LT5A 1DGWA 1QDOA 4CEWB 1UN1A 1ODNA 1HQNA 4QB2A 3ZFGA 5HCHA 1BMV1 2WFF3 1CR7A 5FPVA 2W91A 5A3WA 1YFXA 4DXTA 1S0IA 4ISRA 1LULA 3I2DA 1Q56A 3RYPA 3ZR6A 4BOWA 5DG1A 2AC1A 2RS33 5DDJ1 5FWEA 5A32A 1KFXL 1W9WA 2RS32 4DRRA 4A7KA 3M3EA 1RUG2 4P9LA 2XJRA 5A7OA 3MFAA 4BQ1A 1W99A 1S0GA 3MW4A 4K6BA 1N1VA 1BYHA 2WQ8A 1XE8A 1HB2A 3JB4C 1JW6A 2A6YA 3KVBA 3MEPA 5JDBA 5L9VA 2VM9A 2Y6FA 1OOPB 1WW6A 2EA7A 3CKHA 1JYTA 3IBMA 3DPRC 3ZYRA 4KU7A 2A5ZA 4RHV3 1IGOA 1HQLA 4JQRA 3G6JB 4FPKA 5FYMA 3P1IA 1GUIA 1ULPA 3ZXFA 2WT0A 3LEMA 2A6XA 2OZ6A 5JXHA 3SEEA 2G19A 5FPAA 2LALA 3PVNA 1QDCA 1RHI3 5FWJA 1UOFA 1IZ3A 1POV0 2EIEA 2VCMA 4S2GA 1APNA 4LHKA 4JCKA 4A6OA 5J1XA 4NOTA 1GU3A 4LA3A 2YFZA 2UU8A 1UPIA 2C6SA 2WKKA 3OGRA 1ULEA 2AACA 4FPYA 3M2MA 4ITCA 1RUI3 5BPXA 3WCSA 2GP3A 2XB6C 2FDFA 2E51A 2E7AA 1TNRA 3RZHA 4K7JA 5C3OA 3KLSA 1XNDA 2IZWA 1H4GA 5I8SA 3U75A 1Z78A 1HB1A 4XFGA 2W95A 1XU1A 5LY1A 1N1YA 1D2QA 1V6OA 2QQOA 3IM0A 4Q0QA 5E88A 4E4HA 2XHKA 4NPRA 1KD7A 1NCQA 5H9RA 3IB3A 2LM3A 4LUMA 2E6VA 2HWB3 5LBCA 3NNMA 2PHLA 3A21A 2V4AA 5T5OA 5JI9A 2PN5A 4AEDB 1WCUA 1DIWA 1OQDA 1CAVB 3SKVA 2ZHNA 5IJRA 4M3CE 2OVUA 2LS6A 4IEZA 4TLGA 4LHSA 1ENRA 1R093 3PVEA 4AW7A 5DQ0A 1YWKA 1W05A 1J3RA 2XJUA 3B5LB 4AVSA 1R092 1V00A 2JG8C 4YVWA 3UJOA 4PHZA 1XNTA 4E2SA 1J3QA 2WFF1 2ZKNA 5FO8B 2VMIA 2WN3A 2ZEWA 3V65A 1C28A 5F5AA 3GHNA 3HD8B 4MO3M 2HBTA 3HBZA 4AVVA 1AJKA 2DVGA 2IWGB 4GULA 4AI9A 2RR12 3D6EA 2ZGQA 2PA7A 4JKMA 4FAGA 5FYYA 1X9PA 2RDQA 1JZ8A 1G6NA 2JKBA 3DPRB 1ZBE1 2F6BA 4OMCA 3T4VA 5FAXA 5DZGA 1MPXA 2B9VA 2CNAA 2HWC1 1RB8G 1YIFA 4N7UA 5EHDA 1OI6A 2YBKA 4QHOA 3SNMA 1RGSA 4CEWA 4A2UA 4RR3C 4XAEA 1CPNA 3FLRA 4PQ9A 4AGVA 1PHMA 1DP0A 5G04L 1AL23 4IE5A 5LA2A 5FZOB 1WW4A 5GLWA 1A8MA 4RHV1 4CEYC 2JG9C 3FFQA 5GZCA 3ZR5A 3A23A 3VHPA 3A22A 3TN92 4KL1A 4OHWA 5CADA 3TEYA 5ABJB 5DPNA 2XPJA 1Q3EA 1RHI1 5FZ4A 3PUAA 5FYHA 2J1RA 1RTVA 4IGQA 3EMRA 3R4DB 4CU6A 1W6PB 3ZXJA 3WP4A 2IXHA 5A7SA 4XACA 2OUHA 4P9XA 1RUI1 1OOPA 1RIRA 1DHKB 3WDXA 1AXZA 2WA4A 3PMEA 1UZZA 4OHYA 1CWPA 1YLLA 3T0AA 3ZYGA 1CZTA 2Q1MA 2WLQA 2EF6A 2YROA 4C90A 1GNYA 1D2SA 1FOD1 2JECA 4AFCA 3OCPA 2RMU3 4HVOA 2E7TA 4A7YA 4HPKB 1BEV1 4QKBA 1ALYA 3WW3A 2RMU2 2XJPA 3VBFB 2O8QA 4CDQC 3LA7A 4Q4X3 4UW3A 2ADDA 2VOWA 4J6GA 4I0BA 4QU2A 2IVIB 4Q4X2 5CB7A 1PVC2 1COV1 1ZBA1 2Y33A 1POQA 1OC1A 3IAPA 3ZFEC 4RQPB 3ST7A 1QH6A 3Q8BA 4Q1RA 1IPSA 4CDXC 2Y0OA 1GNZA 2CU5A 2QQUA 2XLFA 2W52A 2HWD1 2HH9A 5IAVA 2ZMKA 1XYPA 4S2HA 1H0BA 5DABA 2ZX0A 3VV1A 1G86A 1HXS3 3VKFC 5C3QA 3JZVA 4BMBA 1C57A 3RDIA 1OH4A 1IHMA 2BOJA 1HXS2 1WMXA 1PO22 2EALA 1KGYA 4LOSA 1W6QB 2ZX1A 1CAVA 3FJSA 4AEDA 1VBC3 4CCNA 4XBNA 2XR4A 1DGWX 1TVGA 3CHXA 2EAKA 1UY1A 4N43C 1VBC2 2VR4A 3CQOA 5A6QA 1UMIA 4LKDA 5JVVA 1MS5A 1FI2A 3E6DA 3NVCA 4MGYE 4IQPA 4K8FA 1ZRDA 1AR83 2JIGA 3CEWA 4YNIA 4URTA 3FBMA 1S0JA 2XMLA 1QWRA 3AMQA 1AR82 1AL21 1PM4A 1RUD1 3D8CA 1BJQA 1H1IA 5E6HA 1IG0A 2WT2A 2WS91 4OUMA 2JKXA 3OUJA 4X6RB 1JYXA 3FHIB 1HRI3 1URXA 5FPBA 3ETQA 4GH4C 4LLFA 5FBJA 1ACCA 5JIAA 1GP4A 1HRI2 1JODA 1LTEA 3AJYA 4Y1VA 3TYJA 3DPRA 5JSRA 3KV9A 4DY3A 4TWTA 4BM8A 2YU2A 4GAZA 1OBNA 1QQP3 4HT1T 3AXEA 1H2KA 3OGJA 3AB0A 2GMPA 2OW4A 2ZX3A 3N9LA 1EAH1 1MEC3 4XUQA 5E1RA 3ZSJA 2Y8KA 4R8HA 4LXLA 1UZ0A 5FXVA 1MEC2 2XG3A 4BYYA 1C8M3 3J7MA 3R4SA 2VW0A 5FZOA 2W87A 2IUWA 2Y38A 5JMCA 3KT4A 2BQPA 1O59A 1C8M2 5FLJA 5C4WC 4MLOA 4PJYA 4HKWA 3C7OA 1JUHA 4TLFA 3NAPB 4Q4V3 5C7GA 5ABJA 3I2GA 5APAA 4A41A 1WCSA 4Q4V2 5GJ6A 3ZYPA 4L99A 2XGXA 1QY4A 1EV13 3KB5A 1HJGA 3MIFA 1W6PA 1IOAA 1D4VB 3NNFA 4L9BA 2F17A 3USUB 4DXSA 3GDBA 1EV12 2R062 5BXXA 3VLBB 2ZGTA 3GZUC 5FP9A 1BLZA 3EYPA 1RXGA 2WN2A 4RN5A 3J8F3 1TG7A 1O6UA 2IXKA 1W04A 2VY0A 4LMFA 2PQSA 5F5IA 1XXNA 3J8F2 3KCYA 3N7JA 5BUVA 2X8KA 4BJ0A 4B1MA 4MGTA 1TMF1 2ET7A 2AYHA 3GGLA 4YFWA 1NY71 1OA2A 5D21A 5EQUA 2XKOA 1A6CA 3AP4A 3EO6A 5DAQA 5F37A 4HPKA 1WLTA 3ZMNA 2JDMA 1UMHA 1LOEA 3VBFA 1C4RA 2JG8A 1JMUB 3E6BA 3I3QA 1J83A 1UOBA 1XNKA 5FOBB 2W1UA 1J84A 1GQHA 4DIQA 4GZ9A 5F6LB 3CU7A 1X36A 1YNAA 3O1RA 2UWCA 1ZZ7A 3G7DA 2VVDA 1RUE1 4LO5B 4DUVA 1JZ7A 4RA0A 3JB8A 2ARAA 5JZGC 2RS13 4E8CA 4XJZA 1CIWA 2AZ5A 4GH4B 1YEWA 4YGCA 1VBD1 1VRH3 2E53A 2Q1ZB 1NA1C 3AXDA 4QX2A 2FCTA 4UI9L 5F2SA 3ZM8A 4AHXA 1L3JA 3E6CC 1LU2A 2PFWA 2K9ZA 1UIKA 3PUSA 3M1HA 1H1MA 1W6QA 4IV1C 3MF9A 5CZKA 5FMCA 1UX6A 1ZA7A 3A0KA 5ACA3 3W9AA 1NQDA 1F4AA 4CVUA 3M3QA 1NXMA 1QXRA 3NNJA 4GMP1 3GCXA 3FMGA 3OY8B 3PLQA 2AENA 4E8DA 4P02B 5FUNA 1N1TA 1OD3A 2DUPA 1W6NB 2W94A 4NPMA 2XBO2 3ACFA 2TNFA 4DO0A 3WDYA 2YV8A 1LHWA 2JE8A 3WP6A 2QBXA 3K4DA 3ECQA 4CDWB 4FTSA 1NUKA 2XL7A 1GKBA 3VHOA 1R1A2 4XYXA 4XFIA 3AFGA 4MADA 4Y5Z0 3VBUB 5KHJA 4LBMA 2VULA 4AFMA 5FZ6A 5A3OA 1SFYA 4IETA 4AFBA 4QX7A 4UBHA 1ZNPA 2EICA 1W8UA 4XOGA 1ZYBA 4FQZA 3IT8A 3N9QA 4JDNA 1VP6A 1XRUA 4B4PA 5GLZA 2WO3A 1RUF1 3ZSLA 4AHZA 3U10A 5IUQA 4QDSA 1G9AA 4WZCA 5KWRA 3VD7A 2C24A 3WHTA 4XQWA 3VKNA 2Q4SA 4KGQA 5DZEA 4CYDA 5F1RA 2Q1FA 2DCTA 4ORFA 5DXDA 3VBRC 1NAEA 1QJEA 5HV0A 2HEWF 2BBAA 4HVRA 2EXJA 3D5OA 4CDQA 1M06G 3BTYA 3VZKA 4D7YA 5CISA 1W3VA 1UWWA 5C8WA 1S2BA 3NAPA 3ZYJB 1V6LA 2ZGPA 3URFA 1R081 1WD3A 2XOMA 5L9RA 3ZIXA 3ILFA 4RGAA 5JZGB 1DGLA 2LRPA 1XE7A 3EBRA 1JTZX 4W6YA 3USUA 1PGL2 3LEIA 1AR71 1FPN3 2HBUA 3AYCA 1S1AA 3H8XA 3K3NA 5IVJA 3DKQA 3K75B 1Y9GA 4QM8A 1R64A 4K40A 4JV4A 3HVDA 2PHUA 3KV5A 2CGNA 2O8OA 1UF2C 3ETPA 1DLLA 4BISA 1L7QA 1AX2A 3RYKA 1LHOA 4AVCA 3VDDA 2P37A 2QZ3A 4GMP0 3MHZA 2JDAA 1TME1 1DG6A 1OFNA 2VMGA 3IIIA 3ILRA 1RUH1 1A8DA 1JU4A 1OURA 1W8FA 3R0RA 4JX0A 4R9DA 2QDRA 4RS5B 1MS1A 1ND3B 4ASKA 2VCBA 4FPCA 3KGZA 2OA2A 3SC7X 5FBZA 4B8EA 5ACA1 3H1MA 3LSEA 5AVAA 4Z1VA 1CJPA 2QTWB 2I45A 5K9YA 1S0FA 3LWCA 4QDQA 4NHLA 5LA9A 4NAOA 3AMHA 4XMIA 4D94A 1OT5A 4YWAA 2C0ZA 1OVPA 3C8XA 5FPZA 1S0DA 1IPKA 1I1EA 4XZUG 4GH4A 1DQ6A 3SKJE 2YBPA 3RZMA 2QQVA 4XUNA 3FUOA 4BA6A 5A3NA 5JMOA 1S2EA 5I0SA 1PM7A 1ASJ3 1RUJ2 4PIYA 1WMEA 1RVF1 4HONA 5FYZA 1ASJ2 1QJU1 4MG2A 4D7SA 1NQJA 5HCFA 4XF9A 1PIV2 2VMFA 2WBKA 1V6IA 1XC6A 5GM0A 3VBSC 4XC9A 1EUTA 2XJSA 3MUY1 5T5LA 1NG0A 2ZHMA 3VBRB 3WDTA 4Q4W3 4EN8B 2G1MA 4E2QA 1XNCA 1GZ9A 3OY8A 5FY4A 5EP9A 5LA1A 3RI8A 1W6NA 3QACA 1IG3A 1LHNA 4BQ4A 1DYKA 2ARXA 2UWAA 4RGKA 4CDWA 3MF6A 2VO5A 5JOZA 4XFBA 2NMNA 5F5QA 2MPFA 4OI4A 2B9UA 3WINE 3VBUA 3V0AB 3GZTB 3VD5A 2ORZA 4ET7A 2FCVA 3WP3A 1YQ6A 3ZDVA 1W2OA 3S30A 1JZ5A 4JGZB 3KT7A 4LJHA 3LQCA 3SQOA 1BBT1 1SQ4A 1XYNA 3AKPA 4CU7A 4EJRA 5CKNA 4AVBA 3T1MA 2ZGMA 1FPN1 5BNNB 4QPGC 4JGYB 2RDNA 4EQVA 1AHSA 2DURA 2VH9A 1UKGA 4YVSB 2Q8CA 5J09A 1KS4A 1UOGA 2WC2A 3DUIA 3ACIA 5J7MA 5AFBA 4DMIA 1DU3D 4W4ZA 1W9SA 3APBA 1O7FA 4ZXEA 3WW4A 3BTXA 4E4DX 4PIZA 2XHNA 2CV6A 4COVA 4YM2A 4QGMA 5A6YA 1YFUA 2VG9A 2DF7A 4IGPA 5JZGA 3SCFA 3RRDA 2YPDA 4B4RA 4PDWC 3BGAA 2R041 2GN3A 2RS53 1VBA3 2KR2A 2AEZA 1WLWA 1DZQA 4PI2A 2RS52 2WNUC 5C70A 4JRLA 1SBFA 1ZM1A 2AH2A 3E97A 4WVVA 1XU2A 4XDQA 3UJQA 4AI1A 2D6MA 3E5UA 5FY7A 1H4HA 1UZVA 5I93A 4XXPA 4NMIA 4RS5A 4UW6A 2J1SA 5G05L 2JWPA 2YC2A 1SHWB 3WNXA 5K8SA 1ND3A 1POV3 2D6PA 3NNGA 4YLZA 1JBCA 1GOHA 1AJOA 3JD72 1Z0HA 2ZX4A 4OULA 4B4QA 4N53B 3BTZA 1PZ7A 2V5YA 5EJ1B 3HT1A 4ATFA 2B39A 4CDUB 2GMMA 5BNPC 4UFHA 3L2HA 3POYA 2VXRA 4E4SA 5GZFA 2V09A 3DGTA 1CAWB 4FFFA 4LK7A 1LNSA 1PMIA 1XE0A 2WQZC 4YGDA 3VDDB 1JUIA 2FZ2A 1G7YA 2VQAA 2JIJA 4YW4A 5FMBA 3HT2A 4Y1YA 3WP5A 2WWUA 5FP8A 4R4XA 5HI0A 5DAWA 2WIIB 4P9WA 1UZYA 1XB9A 5GZGA 4NHYA 1S0EA 3HNYM 3WUDA 3ZMOA 2WJSA 2JDHA 5FJKA 5A3LA 2F4PA 5FK7A 1O3TA 2C4XA 3BB6A 1QHDA 1YQ2A 3N36A 3PDQA 5F2WA 4IEXA 3VBRA 3WDVA 5JAXA 1ULGA 5FMOL 4D6RA 2JDNA 2RG4A 3N4MA 2OIIA 5DDJ3 3PURA 5K7PA 4GWIA 1K42A 5H9PA 1ZZCA 3ZXEA 1VAMA 3ZYFA 5DDJ2 4BLJA 2ORXA 3C2UA 2WNVC 2IC1A 3ATGA 3VBOC 2BGPA 4FFHA 5CFDB 3FWEA 4BU2A 1REDA 3V0AA 4Q27A 2VOVA 1OXCA 2WO7A 1G9CA 2DTYA 4E2GA 3JU9A 5C71A 4BIOA 4Y5TA 4P9GA 2OKXA 2ZZQA 3O1OA 4JGZA 5FZ3A 3BCWA 4X8PA 1CVNA 1NE4A 2QQMA 4SBVA 4LPLA 2P1BA 3PVBB 4LIVA 4OYUA 3AFKA 3RSJA 3KGLA 4MH0E 5BNNA 1MVQA 4JGYA 1T6GC 4FPGA 3AP5A 2ZGUA 3KMHA 4XETA 4AYUA 1QNYA 2WZR1 3V64A 5CFCB 1ND2C 4YVSA 5JR7B 5I8TA 1RMU1 1AR61 1GZTA 3MO4A 5A1LA 4AAPA 4QGNA 3U14A 3ILNA 1JZ6A 5IVBA 5FZ1A 3ZVXA 4QXCA 4TSVA 2BUKA 1VBE1 4NRPA 1ZRFA 2ZGRA 3WW2A 4FPEA 4NIHA 3WQBA 1WCQA 3FBYA 1Y43B 4XJWA 4QX0A 4PF5A 1CN1A 3WUCA 4XFFA 4C8DA 1O91A 1JI6A 1RINA 2JJ6A 4HG6B 2JDYA 4LHNA 3SEPA 4K1YA 3SH3A 4TZDA 1EYBA 2VU9A 3I3BA 2YZ4A 4LULA 3VDBA 1WWYA 1FV3A 5FZKA 5FYUA 2C1FA 3N7LA 2L9LA 1EPWA 3WXPA 3RMXA 3HAGA 2OPKA 3P5BA 1MZ6A 3NL1A 1K12A 5E89A 3UGFA 1Q8PA 4IEUA 2PXJA 4LA2A 4D69A 2CGPA 1Y9QA 1SDDB 4YM1A 3K77A 3ITQA 3GALA 3MUZ1 4XCBA 3J9SA 3I59B 4G3YC 4N53A 5CA6A 2XXZA 3U78A 4CDUA 2WFF2 5ANNA 3VBOB 2I74A 1O4ZA 2IXCA 4MUVA 2VZ3A 4LTAA 3USSA 2Y6LA 3VZNA 5CG9A 1TE1B 1CAWA 1QF3A 3BTAA 1AVBA 3KVAA 1W28A 2GMEA 4RYDA 4TYSA 1C3HA 4W50A 2RE9A 4BK5A 1O5LA 1OF4A 1ZBE3 5FO9B 4R9BA 3KQRA 2ZZJA 1MR5A 5LRRA 1FXZA 3M3OA 1ZBE2 5L73A 2RVAA 2HWC3 2VC9A 3KZ4C 4QPGA 4W65A 4LO8A 4XF0A 2E32A 4I3GA 5KC5A 1X50A 1FYUA 3QOPA 4XZPA 1UNBA 5M0TA 2WUHA 3KF5A 3JBG1 1XNBA 2JDZA 4H7LA 3A0NA 3T3YA 2ZBJA 2ZABA 2QCSB 1CONA 1NCRC 4RHV2 3U07A 1UOJA 2Z69A 4O9GA 3S6PA 3WV6A 5EWSA 5LW9A 2NM1A 3H7JA 3THDA 4IUGA 2NLRA 4QPIC 4CCEA 4EWEA 4QDRA 4Y4RA 1SMVA 1GQGA 1I6XA 1U0AA 3GHMA 4MX3A 3POFA 4EE2A 2R1DA 5FUPA 1RHI2 5CFDA 1REFA 1UXZA 4NIIA 2C5DA 4FP2A 2DFBA 4W6WA 4LKEA 1GP5A 4PT6A 1BXHA 4ZONA 3I2JA 4BXFA 1HDKA 2D6KA 3MLJA 1RUI2 2XH6A 3DL3A 1N3PA 5CKQA 5IYYA 4IERA 4AF9A 3NO8A 3R05A 1I3HA 5LBBA 4QD2A 4XDOA 1FOD3 5CAZA 3D82A 2P4EA 4CU8A 5CFCA 4MGZE 1FOD2 1BEV3 1QGLA 2XLAA 2P3IA 3HMYA 4M0HA 3WDUA 4D6SA 1BEV2 2HWB2 1CESA 4EV0A 4ZHNA 2QNKA 4AEMA 1WMDA 2AGSA 4DEQA 5KR7A 1UIJA 4CXXA 2P6CA 4YW6A 4HSJA 4NUBA 4TN7A 5FP4A 3B94A 4LBOA 5E8AA 1COV3 1ZBA3 1QU0A 1JYCA 3IN9A 2EXKA 2PAMA 4URAA 5BNOC 3MPPG 1IKQA 3JQWA 5L36A 1LOGA 3M3CA 2QQJA 2HWD3 3BPSA 3BPZA 2Y26A 4O65A 5FO7B 2X05A 2GP5A 4Q26A 4IGOA 1C5HA 4NWVA 3DEMA 3HEIA 4J25A 1LB2A 1O8PA 4YW1A 4BDVB 1S55A 1MS0A 3J7LA 4QX8A 2BRTA 4ISQA 2KXLA 2JDKA 1IQDC 1CGPA 3D4KA 1VPHA 4DZGA 3TNPB 4GALA 4L8QA 4CZSA 4I0AA 5FZCA 4G9SB 3RJ2X 3T2PA 3AJZA 4AQTA 2XJQA 3QLQA 2FDKA 1NCRB 4FOWA 3GCWA 3LIHA 3O0XA 2DVBA 2VZVA 1LOFC 3U37A 5F3IA 4LLOA 1OA4A 3I59A 2X5IC 5JOXA 5JPNB 1RUD3 2ZKLA 4P9IA 2N7GA 4EWAA 1F9KA 4XUOA 5FZAA 3THPA 4LK6A 3VBOA 2WS93 1AL22 1RUD2 2H0VA 1IKPA 1ZA4A 2R0HA 2QKDA 1RUG1 3O5SA 1PO11 2WS92 4Y1UA 2UY8A 5FREA 3J26N 4OUEA 1NE6A 3OTFA 5H9QA 5GKAC 4XABA 3WSOA 4D8MA 2BFUL 1GNHA 3C3VA 1NT0A 4CUAA 2LW8A 1RC6A 3RWNA 4QKDA 3PIGA 1VB2A 1CPMA 2A6ZA 5A80A 1O4YA 2XVLA 5DAPA 4FOQA 1EAH3 1Z7S1 2ILMA 2YUEA 3WF2A 5DAVA 5IK7A 4AFAA 5HV4A 1W9TA 3WLUA 1GBGA 1WZXA 3LEGA 1UZWA 5JIUA 4IEYA 3HR9A 2WNOA 3OGSA 3B93A 1V6JA 5F3EA 4GIQA 1Q5OA 3H3ZA 2O1QA 4IL7A 3LCPA 4YARA 2EXHA 3KSCA 4Z82A 1EP0A 3VZLA 1VIWB 4YG6A 2UWBA 2Y6KA 2JE9A 4CP9B 4ES9A 4R9AA 4X8NA 3D0JA 4AR2A 1Y3TA 3VGIA 4JHTA 4L11A 1DF0A 1UCXA 1YXWA 4O7XA 2JD9A 4MV2A 5F39A 2JG8B 1QOOA 2Y64A 4XTPA 1DGRA 1DQ1A 4JTNA 4N8MA 1OMIA 4HOOA 4OMDA 1OFSA 2VVFA 3NJXA 3NV2A 5I0TA 5FYTA 1ZZBA 5T5PA 2Q8DA 3MLKA 4BCUA 5FY8A 2QQLA 3OPZA 2D44A 5CKMA 2BW8A 3TEZA 2YXSA 2Y34A 1F4HA 3LDRA 5FP7A 4AK3A 5IFTA 1UY3A 2P34A 2W46A 3BU7A 5FZBA 1VMHA 2BZDA 3LSDA 2WZ8A 1TMF3 5C8CC 2Y6GA 4NJ4A 4DOUA 4HZFA 1DLCA 3WG3A 3B3QE 4QXHA 4YSFA 3QCWA 2VD7A 4MHUA 5EYXA 1YC61 2GC2A 1TMF2 1I5PA 2HJIA 3H1WA 1LECA 3LE0A 1V0AA 1OKQA 3B9CA 3O7OA 4XUPA 4DUWA 5JOWA 5F5CA 3FN9A 2HYXA 2VNRA 4P08A 4RR3B 1YI7A 5FIXA 2X5IB 5C6CA 1OVSA 5D1IA 2WSVA 2JG9B 3W58A 1NYWA 3AC0A 3HJRA 1RUE3 2VOKA 4M01A 4CEYB 4D3WA 2AEYA 1OUXA 4FPFA 1RUE2 1UYXA 4ZS3A 4NHMA 4AGGA 4AQ2A 1PVXA 4YM0A 1G9DA 2BGOA 1JS9A 1BHGA 1VBD3 1GZWB 1J1TA 4KI5M 4Y33A 4C0HA 3CZUA 4WVMB 4OQ8A 2RR11 4PLOA 4YW5A 4AGRA 4B29A 2D98A 2A3XA 4ARYA 4MSVA 3AZZA 3WD5A
chains in the Genus database with same CATH topology
4EWDA 3MZHA 2OYZA 1UU5A 1H2MA 2WWSA 2PHFA 5I8YA 3WQ0A 3LA2A 5SV8A 4Z2WA 5BY5A 4IESA 1W6MB 1AXKA 4CP1A 4GMP3 1UAIA 1X8MA 1NCRA 3MW3A 1QQP2 5EJ3A 2ZGKA 5EV7A 4K3UA 3ZX7A 5EFUA 3NV1A 2GNDA 4CDQB 3I7DA 3MYXA 1D4M1 1LJ7A 3LA3A 3FUQA 4NWWA 1AYN1 2TUNA 2GNBA 2ES3A 3AP9A 4IV3C 3ZFEB 2VVEA 1GV9A 4CDXB 1RUF3 4GKXA 5JPMB 4W6XA 1RUF2 1RUOA 1HV0A 2ZOEB 3QD6A 3AX4A 3AKQA 3N3HA 1FX5A 4QQPA 1QJX3 3AYDA 4KNCA 1V6KA 4N43B 2E7QA 1R083 4DB5A 5BNOA 2ZGSA 1S0CA 4HVQA 2WZPP 4GB33 3ZFFC 4XILA 2ETEA 3IIAA 1AR73 5JSPA 4JDOA 4YGEA 5L19A 1ZVFA 2NP0A 4UW5A 4DXZA 1PGSA 1VB4A 1KXGA 2HYKA 2PQQA 4R9CA 3AKRA 2D6OX 2IFRA 1ENXA 2QE3A 3ACLA 3ES1A 2RS12 3ZN6B 4BHPA 1MQTC 1EY2A 1TME3 3OJBA 1VRH2 3ZN4A 1RJ8A 1RUH3 3B00A 4IEPA 3RYRA 2R0FA 1LOFA 4RR3A 2X5IA 1ULDA 1DFQA 1YO8A 3NKTA 4AVTA 2BNNA 4CEYA 2JG9A 4P14A 5ACA2 5C4WB 5L7OC 4YG0A 3LOBA 5C33A 1GZWA 2VW2A 3FC0A 4WVMA 5F9TA 1MVEA 2H6CA 2ENRA 1PZ8A 2I07B 3E5XA 1RVF3 4AQ6A 2ZAHA 2VUJA 3SLIA 3KT1A 4Q0VA 4RGGA 1QJU3 1RVF2 4XBLA 4WM7C 4XW3A 4B7EA 2WFPA 3AKTA 4FPJA 1MACA 1H30A 3TAYA 1W6MA 1I5ZA 4P9JA 2H6BA 3ZIWA 4J1XA 1LGBA 1YCIA 3DKWA 3VL8A 1SLAA 2VPVA 4F7ZA 5EXOA 3JUUA 4HN0A 2EIGA 1AYM1 4AHYA 5KHGA 2OZJA 3ZN5A 2A71A 3AZVA 4L2NA 3B01A 4BE3A 1C1LA 4IXLA 3SCHA 2GNMA 3VN4A 2GC1A 5KHKA 1HRV1 3IPVB 1QJX1 4A7ZA 2JE7A 4BPZA 4DFSA 4KQ7A 1D0GA 2NYYA 3VBHC 2A6VA 3ZFEA 1PZ9A 3TOJA 4N9HA 4CDXA 1LR5A 2O0OA 1BBT3 4GB31 3CJIC 2YGLA 1BBT2 1AR91 2XKPA 3PNAA 4QXKA 2K0GA 5GZEA 5C8CA 5LK7B 1NA1B 4AI2A 4V1PA 1FPN2 1G8WA 3CF6E 4C1WA 4ZU7A 1F2NA 4OLLA 4UBGA 2X29A 1JXNA 4IV1B 4PBPA 2RHPA 5AFEA 1WBLA 3O0WA 3AP7A 4I09A 4N43A 1X7NA 4MZUA 2CAUA 4HMZA 4FXKB 4YM3A 2Z42A 3E5QA 3GNEA 1K5MC 2XUMA 4ZXKA 1RUNA 2QFEA 3THTA 2R043 4XBQA 5C9AC 4HL0A 1QH7A 3BODA 3RNSA 1PGW1 2R042 4Y1ZA 2SLIA 5D8AC 4C0BA 1JHNA 3U0ZA 1AX0A 4WM7B 5JLVA 5I0RA 3ZN6A 1GANA 2ZX2A 1UL9A 3PTYA 2A7AA 3ASIA 3TRSB 3ZXDA 1CAUB 4WM8C 1DQ4A 4OZXA 4O9EA 2A70A 4AE2A 4LUKA 3FLPA 1S2KA 4CTEA 5IK5A 4Q8LA 4PIXA 2RM21 2XBO1 5C4WA 5KXDA 2ET1A 3KM5A 4Q4W2 2HWE1 1Y7BA 3ZYIB 1PK6C 4AWDA 3UV9A 1HV1A 4Q0PA 4YYOA 2CYFA 4FAHA 1IS5A 4AG4A 3CJIB 3OBTA 2D93A 2X53S 5DUUA 5JSOA 4U36A 3LGRA 1G9BA 1J58A 1KJLA 2W08A 1VAKA 1YJLA 1OHFA 3WT3A 3ZFGC 2B8MA 2D40A 5JI7A 3O14A 4NO4A 3FX3A 3IPVA 3M7AA 1FATA 1AL0G 1OD5A 5JWPA 5FLHA 4QQ2A 5AVPA 2XLGA 4Q0UA 4INDA 4XQDA 1YFYA 3AMNA 2Y0IA 1SLIA 4H3WA 2H0BA 1D0HA 4XJ9A 3PJQA 2ZMNA 4RFT0 2BGCA 4Q4Y1 4NHKA 4Z8BA 5LK5A 1NA1A 2DWRA 1W0PA 2WZR3 4QHBA 1VBA2 1RMU3 4BWOA 1AR63 2WZR2 1FMD1 2LTNA 2WA3A 2BVBA 4OI1A 1AR62 4IV1A 5CU1A 2FQPA 3QBQA 2FMYA 4QQOA 4OFGA 4HETA 1U5IA 1VBE3 3VBSB 4HBNA 4BMEA 3J4UH 1QXJA 2ZPXA 3R4UA 1WGPA 1VBE2 2DFCA 1QKQA 5BYNA 4PLMA 4JTOA 4IEWA 4H14A 2WSUA 4I30A 1ZZ9A 3VHNA 3BIWE 3POWA 4X6QB 4LO6B 4J1WA 4MXVA 1UPSA 3BOPA 3LAGA 5K0UC 3RQ0A 4WM7A 1YI9A 1RUJ1 2VQ0A 1H8TC 3OF1A 1NCQC 1GZCA 4OVEA 3WY6A 4ASLA 2Z2SB 4FXGB 4MXWB 1SBDA 2BVVA 5CNAA 1CAUA 1UU6A 1SFNA 4QPGB 4QX5A 1N3OA 2EXIA 3MIBA 1BMV2 4IEOA 4U2AA 1WA4A 2XWJB 2ZHLA 1QJY1 4YVWC 3WVJA 1TQ5A 1VJ2A 2FBEA 3H9AA 2WL1A 4K9SA 2FZ1A 2MNGA 3ALQA 1IQAA 3CJIA 1VLNA 1DQ0A 4PDWB 2OUJA 2AREA 1WCKA 4E9KA 4DINB 2PHRA 2GSYA 2P2KA 3JBG3 1IS3A 2WNUB 2R071 3JBG2 1X82A 4C91A 4CEWC 2IXLA 3I54A 3SCGA 2VUAA 5T52A 4MGIE 5I91A 4A3XA 2Q5TA 4XMAA 2GC3A 4BH9A 1F31A 1WMFA 2DUQA 2DV9A 2HEVF 4LBNA 5FTTC 4E27A 2WNEA 3SITA 1Q8QA 1QMJA 2UY9A 2ZHKA 3EQEA 1V9U3 3FZ3A 2YDEA 1N3QA 5BNPB 2IFWA 4XJUA 1DZRA 3AM2A 5HCAA 2BBVA 1I9RA 4FOYA 3IMNA 2VW1A 1YJKA 1H8TB 2G9FA 2XJTA 4N9IA 1JOJA 2DYCA 5GLTA 1H2NA 1VALA 1SLBA 3IKWA 2V73A 3UKNA 4XXAA 5GLUA 3KD4A 1E57A 4ZKTB 4KG0A 4YZ4A 2PHTA 2B46X 1WW7A 4ONUA 4QGLA 2P3KA 2DCZA 4Q29A 1GFF2 1W6OA 1YFWA 3VBSA 3PJYA 1LEMA 1ZX5A 3FLTA 5HCBA 2XWBB 3SISA 3JD71 2ZGNA 1NLRA 4ES8A 1FAYA 3GYDA 5I0UA 2HWF3 3NSTA 3RJRA 4LNVA 4CP0A 2WNVB 4XF1A 4META 4YW2A 1Q8SA 3B69A 3O12A 3CLPA 4GA9A 4DNYA 3H7YA 4B3NA 3HQXA 4RSUA 1X33A 3UKVA 3UKTA 1OPMA 1MS8A 1GSLA 1DQ5A 2TBVA 5EZWA 2D6NA 4JAAA 3CJXA 4COWA 4XJAA 4YGBA 1REEA 4MXWA 2PHXA 3X29B 3QH7A 2GNTA 5AC91 4AEDC 4CP2A 2CTVA 1W2UA 3D0SA 2HWC2 3A4UA 1SACA 4UW4A 3ZXLA 3RS6A 1ND2B 2R6QA 2XVKA 5FQ0B 1C5IA 4M3CB 4FTBA 1RUG3 3WQ7A 2PHWA 3ZSMA 2JICA 4Y26A 1PO13 1VR3A 3INAA 1LRHA 1VBB1 4AHWA 2W68A 1PO12 4LBKA 5FFOC 3JQXA 1S0BA 2ERFA 4PDWA 1Z7S3 2DVDA 5J37A 1V9U1 1Z7S2 2WNUA 1MS4A 1KS5A 1F8VA 3VKOA 3WQ1A 2WT1A 2PELA 3M70A 1BKZA 4NR1A 4XJ8A 1UMZA 2QUOA 1TNFA 1YHFA 4S2FA 5IT6A 1M4WA 4M3CF 4XHBA 1A78A 3H3UA 4HKOA 1RJ7A 4HLTA 5J98B 1JH5A 1HLCA 3LOIA 3POSA 3EXUA 3VZJA 5ABJC 1SCSA 2R30A 1DBNA 4AXOA 2R49A 5A33B 5BNPA 2DU0A 2PLV1 1OPOA 3VKMA 1COV2 1ZBA2 3WZ1A 4YFZA 4FVVA 2HWF1 1IPJA 4Q1PA 5DZFA 2W39A 5K0UA 3I4IA 2QZ2A 3KCCA 3NV3A 2MEV1 2YC0A 1SDWA 1H8TA 2GAUA 2HWD2 1CD3G 4LEJA 4XE9A 1RUC1 4H55A 1CJDA 3ZXGA 3KCXA 2P3JA 2D7FA 5BNQA 4AI0A 4YRDA 4NN0A 4OHVA 4YZ5A 3VBFC 3ZPYA 1WCDJ 1G9FA 5GZDA 5KXCA 4QPIB 2WNVA 1LHVA 2JENA 3AMPA 4RQPC 5H9SA 2RR13 2RS31 4FPLA 2UYAA 1B35C 1ONAA 5J36A 1WLDA 2E63A 3KS7A 1BCXA 2HEYF 3V0BB 3HIFA 4HN1A 2NMOA 3B7MA 5TSWA 1BZWA 1SLCA 1PNFA 3WR0A 1DQ2A 1EAH2 4XIOA 3H50A 1ND2A 4QMAA 5FQ0A 3TN93 3H0OA 1OA3A 2E9QA 3MFCA 3PVOA 4M3CA 1X8EA 1D4M3 1LESA 2IXIA 3OD0A 1AYN3 1CX4A 4IEQA 2KM2A 2QDNA 5KHIA 1D4M2 4GKYA 3OD4A 1AYN2 5BNOB 2GC0A 1CQ9A 3MGUA 3W59A 5HBAA 4I2OA 3V56A 3ELNA 4JC1A 4YZ3A 5CIRA 1KDMA 2BWCA 1AXYA 2JD4A 3Q9OA 5EYYA 3VUOA 1ZRRA 4M00A 3VL9A 4EROA 3WG2A 1GLHA 3OYWB 3DV8A 4Y20B 4R52A 1O3QA 1XYOA 1UKRA 3NW4A 4AVAA 4COYA 3ZO0B 3JCIA 5KBFA 1LODA 1GICA 4KGGA 4QQLA 4SLIA 2HWB1 1Q8VA 1NY72 1HIXA 3N7KA 2PTMA 1PVC3 5GLVA 1RITA 3MIDA 3NAPC 4LBLA 4XF3A 1N1SA 2Q8OA 1R091 5A33A 1O3RA 4ASMB 1LHUA 4K1ZA 3LZZA 1B35B 2CL2A 1Q43A 3NJZA 4HFSA 1AX1A 1MS9A 2BNOA 1PO23 2BTVC 1VBD2 4FPOB 1BQPA 2JX9A 3MW2A 1YUDA 4AEJA 1O5UA 3VZOA 5BV6A 3UL2A 3VDDC 1O4TA 4E4ZA 3MPBA 4KWKA 4I01A 1V70A 2P17A 4JDMA 5CBLA 2D5HA 3SMHA 1O3SA 3MIGA 4KU8A 4LO7A 4QPIA 4FBFA 3TN91 1CAXB 1AF9A 3DF0A 1LOBA 4XEZA 3QH6A 4N7IA 3DN7A 1MS3A 4LE3A 3N35A 3NV4A 2XJVA 4LBJA 2DVAA 2A6WA 5F6KA 1H2LA 2PHDA 4HKLA 3OGGA 3ZSEA 3V0BA 1GR3A 1SBEA 2ZJCA 4FO9A 2WLPA 4QM9A 2VNGA 4P9YA 4Q2FA 4EN0A 3SH5A 4XFHA 4ZU5A 3S0MA 1A3KA 4QQHA 1H8VA 1KITA 4YZ1A 5C8CB 1AYM3 2ZAAA 4HSLA 5CG8A 1FNYA 1H1AA 2D43A 1AYM2 4LBQD 5KXBA 3AZYA 5LRSA 3GF6A 3RPQA 5B2GB 1QOTA 1BVVA 1HRV3 1VAVA 4F83A 4DQAA 4I0WB 4HANA 1HRV2 1QJX2 2RMU1 4CDWC 3OBRA 2ZTNA 3M4FA 2R063 3H1YA 3CNAA 2QJVA 3VBUC 1R082 2RJKA 4Q4X1 5FMOS 1PVC1 3RZZA 3SHRA 4XHXA 5DUXA 4EN9B 5A3MA 4GXLA 4GB32 1AR93 4B7KA 2WINB 2CWMA 4N90A 4AEKA 5IK8A 2B42B 1AR72 1PNGA 5DG2A 2Q30A 1AR92 3GBFA 1OSGA 3OYWA 2YGMA 4MGKE 4L97A 4Y20A 3U4XA 2D3PA 4FSJA 2IXJA 1OLRA 3PHMA 4JRAA 1QJZA 1HXS1 1PO21 2VGDA 2DCYA 3O0VA 1SLTA 4LBQB 1WUVA 4BIFA 4FQ4A 1TME2 1RUH2 1VBC1 2EAAA 1QOSA 3GBGA 1LENA 4LE4A 2YY1A 2PYTA 3MICA 4RQPA 5J3UA 5E16A 1J3PA 2AR6A 2BWAA 2JEMA 3AYAA 1LEDA 1AR81 4FOVA 1PGW2 3FFZA 3ZXKA 1UU4A 3ENRA 4C1XA 1B35A 4IV3B 2K2SA 1SLLA 2R32A 2RJLA 2QVSB 4QPYA 3RMYA 1HRI1 3IWZA 4RL7A 1LKNA 2DTWA 2D3RA 3ZXAC 3H8UA 4M0NA 5J96B 1QJU2 4Q0SA 2PAEA 1ZRCA 1QQP1 4FCAA 2RM23 2XBO3 2VOXA 3AKSA 3K51A 4RS5C 2C9AA 1MEC1 1LCLA 1ND3C 3PMSA 2RM22 2HWE3 1R1A3 1C8M1 2HWE2 2YHJA 3WDYA 2ZGLA 1B09A 2FHRA 1CAXA 1YRZA 3FE5A 2XL9A 4WVZA 1BVP1 1ZREA 2NQYA 4XPVA 3ZFFB 4Q4V1 4I02A 2A75A 2I2SA 1R1ZA 4K20A 3ZDSA 3B9IA 1EV11 2R061 4DS0A 1U5XA 2Q0AA 2XVGA 3P3PA 5T50A 1DGRN 1IS4A 1Q8OA 1MQTB 5FPXA 2CAVA 4OI0A 3J8F1 1KRIA 2ZCWA 5JOYA 2R1BA 4WZFA 2GU9A 2JXAA 4PCRA 2EVXA 1F5JA 5HXVA 4XIKA 3T2TA 1KQRA 4Y24A 1XQNA 5GALA 1KFUL 4S2DA 1LGNA 5L7OB 1QNWA 4JVAA 1V6NA 1ULCA 4AQSA 4Q4Y3 5FOJB 2MHFA 2Z5WA 2ARBA 1NXD1 2VECA 2BYVE 1IS6A 4Q4Y2 2UURA 4JGZC 1KJRA 2RS11 3BOWA 2QQPA 1HKDA 1FMD3 5SV5A 3I8TA 5BNNC 1VRH1 1LOCA 4IEVA 4JGYC 1FMD2 1W0OA 1ZZ8A 2D5FA 3NWKA 4DY5A 3AP6A 1WLCA 4YVSC 4NVPA 5KC6A 1OQEA 4LBQA 2CY6A 3VZMA 3GBWA 4R4ZA 5FDBA 4Q8KA 1ENSA 2UYBA 2NN8A 3WG4A 2LUWA 5J48A 1MZFA 5CVRA 1UW8A 4KH9A 4G4FA 4Y22B 4OUSA 3N7MA 4K21A 2GALA 4BLIA 1R1A1 2A73B 4IV3A 1RUJ3 1H9PA 3U11A 4OHXA 3VBHB 3T1LA 1W39A 1DZTA 1FT9A 1J1LA 2G9GA 2ZMLA 1PIV3 5KXEA 2ATFA 4UXAA 2NPIA 4L92A 2W0XA 4Z92B 4FTEA 2BNMA 4XFCA 5T3NA 3M8LA 1QJY3 1WBFA 4EN6B 3IDCB 4OHZA 1QJY2 4N53C 3MIHA 2GZWA 2GH2A 4CDUC 2D97A 4LO4B 3VKLA 2BEOA 5JCTA 3TWIA 3UK9A 1NOVA 1KDKA 4I3PA 1K5MB 1OLQA 1OQ1A 1YYNA 3ZFFA 1JN2P 2A3YA 1SEFA 1ZZ6A 2VMHA 5C9AB 3SXWA 1EPZA 2NZ9A 1PGL1 5D8AB 2R073 4FPHA 2ZACA 4KBBA 3TB0A 3AMMA 4FP3A 1C8NA 1GYKA 1V6MA 2R072 5KHHA 3WCRA 4AI8A 2PAKA 4WBBA 1MQTA 3IDEA 1NZCA 5DUVA 5T54A 1BK1A 2BFUS 3M3IA 4WM8B 3EHKA 1RMU2 1ULFA 2DU1A 1W6OB 4BZ4A 5IK4A 1LOAA 1U5YA 1J59A 3ES4A 4PBOA 2BPA2 2B45X 2GN7A 3K48A 4XTMA 5L7OA 5CFDC 3AK0A 1HQWA 2ZA9A 2G4IA 2CGOA 1PK6B 4COZA 1U12A 2Z79A 3HN1A 2VNOA 1LGCA 1N47A 4F3JA 4MVTA 3WX5A 4FT8A 4QT6A 1SCRA 3WW1A 4Y1XA 1H9WA 3RG0A 4CRQA 1C1FA 3S7EA 1LU1A 4COUA 3IDBB 3MIEA 5CFCC 4OI2A 4WV8A 1ASJ1 2A3WA 2CWSA 4XQ4A 3VHRA 4EN7B 3JD73 2R16A 1PIV1 2B5HA 4LR4A 3ZFGB 4ATEA 1UD1A 3WG1A 1ENQA 2B7YA 2DCJA 5LEKA 4F8AA 3LKJA 4Q4W1 1TEIA 3MI8A 4Y22A 5A32B 2YPJA 1F5FA 2AUYA 3VBHA 2SBAA 3CL1A 3WDWA 1HW5A 3LB9A 4Z07A 3ROUA 5AC93 3L2YA 1FV2A 4HK9A 4DPNA 3CO2A 4ZU4A 5AC92 3ME2A 4Y4YA 5LEJA 5T5JA 3EJKA 4XFAA 5FCCA 2ZS6B 2ZGOA 2GH8A 3WOGA 5T55A 2YMZA 1AUYA 3ZSKA 4GWMA 5DUWA 3MLLA 1VBB3 1DYPA 3NKGA 1VBB2 4H7MA 3P3NA 3S7IA 1K5MA 1MZEA 1U5ZA 3TNQA 2HKXA 3MDPA 5C9AA 4YW3A 4XF4A 5D8AA 1RL3A 3AZXA 1V9U2 3GZAA 5FLIA 5K0UB 2RS51 1VBA1 1HX6A 1OOPC 1NCQB 4GWNA 3AYEA 4AI3A 4LHLA 2FMDA 2D3SA 4WM8A 4YG3A 1MZ5A 3BALA 1AZDA 4YZ2A 4P5HA 2YYOA 3L9JT 2DVFA 2PLV3 4HK8A 4YVWB 1POV1 4MYEA 1YIPA 4DRVA 2PLV2 4D7TA 1PK6A 4KWLA 3WHUA 4PLNA 2MEV3 2HWF2 4RD7A 2DUOA 2TEPA 2MEV2 4KWJA 3AZWA 1NLSA 2KA3A 3B02A 1RUC3 2D6LX 3R6SA 1WW5A 4KG8A 2WQ4A 3TBDA 3HWJA 1RUC2 1QXPA 1DDLA 4AFDA 3SH4A 4GQ7A 1WD4A 1FNZA 2GDFA 2DCKA 4LT5A 1DGWA 1QDOA 4CEWB 1UN1A 1HQNA 1BMV1 3ZFGA 2WFF3 1CR7A 1YFXA 1S0IA 4ISRA 1LULA 3I2DA 1Q56A 3RYPA 4BOWA 5DG1A 2RS33 5DDJ1 5A32A 1KFXL 2RS32 4DRRA 4A7KA 3M3EA 1RUG2 4P9LA 2XJRA 3MFAA 4BQ1A 1S0GA 3MW4A 4K6BA 1N1VA 1BYHA 1XE8A 3JB4C 1JW6A 2A6YA 3MEPA 5JDBA 1OOPB 1WW6A 2EA7A 3IBMA 3DPRC 3ZYRA 4KU7A 2A5ZA 4RHV3 1IGOA 1HQLA 4JQRA 3G6JB 4FPKA 3ZXFA 2WT0A 2A6XA 2OZ6A