2OZKA

Structure of an n-terminal truncated form of nendou (nsp15) from sars-coronavirus
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
306
structure length
306
Chain Sequence
INNAVYTKVDGIDVEIFENKTTLPVNVAFELWAKRNIKPVPEIKILNNLGVDIAANTVIWDYKREAPAHVSTIGVCTMTDIAKKPTESACSSLTVLFDGRVEGQVDLFRNARNGVLITEGSVKGLTPSKGPAQASVNGVTLIGESVKTQFNYFKKVDGIIQQLPETYFTQSRDLEDFKPRSQMETDFLELAMDEFIQRYKLEGYAFEHIVYGDFSHGQLGGLHLMIGLAKRSQDSPLKLEDFIPMDSTVKNYFITDAQTGSSKCVCSVIDLLLDDFVEIIKSQDLSVISKVVKVTIDYAEISFMLW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uridylate-specific endoribonuclease
publication title Crystal structure of a monomeric form of severe acute respiratory syndrome coronavirus endonuclease nsp15 suggests a role for hexamerization as an allosteric switch.
pubmed doi rcsb
source organism Sars coronavirus
molecule tags Viral protein
total genus 65
structure length 306
sequence length 306
chains with identical sequence B, C, D
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2007-02-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.360 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2ozkA01
3.40.50.11580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2ozkA02
2GTIA 2H85A 2RHBA 2GTHA 2OZKA 4RS4A 4S1TA
chains in the Genus database with same CATH superfamily
4ECEA 4O4HB 1GOTA 4HDNA 4YJHB 1CUYA 2IUYA 2H2GA 3SEQA 1QIKA 4MR7A 4RL4A 1GQ2A 1YJAA 2JIDA 4BZWA 2WIJA 3WGOA 1Q1EA 4ZV4A 1Q7GA 4A3JI 1NXXA 2BKVA 3L9XA 2V0CA 2J3MA 3HA7A 1R12A 4UQOA 2XZDA 4WN3A 3BH7A 3CRMA 3H2JA 3KPVA 4GWGA 5PNTA 2WJVA 5BW4A 1MJFA 4MW4A 4TTSA 2EJBA 3QF4B 2B1IA 2WFMA 4U3JB 3TRDA 2EDAA 1V26A 1RPTA 1J8QA 3AI7A 3QNMA 5CT9A 1FZTA 1AM4D 1FJ2A 1OIVA 1TT7A 1W2WB 1F8GA 3MQFA 2H59A 3OE1A 1ZNZA 4CMEA 5L4SA 2Q51A 4E30A 5G1OA 5BN4B 1Q0HA 4L78A 4KO1S 2V5VA 3P5JB 1H8EA 2C8JA 1H22A 3BK1A 1F2UB 3CLRC 3JZIA 1Y5IA 2GJ8A 3KL2A 3NEPX 4IINA 4NE7A 5A71A 3UMJA 4EA7A 2F00A 4E2YA 3GCZA 3S2GA 3HR7A 4DSTA 5D7NA 1EFRD 5CFNA 3L92A 2WIAA 4GDFA 2YXNA 4X92A 5KNCD 2H8GA 3RK1A 1ZD3A 3FYCA 3LDUA 4O2AB 1IHYA 3IALA 2AFIE 4H7EA 4U7PB 4YDHB 3IP6A 1CW2B 4ZJUA 1KRWA 1MX3A 4EUNA 3AG6A 2IEBA 5HF5A 4CHGA 3TF5A 3I2FA 4HI0E 4OSOA 2WA2A 3AH8A 2P2ZA 4RELA 4KMRA 1KHTA 1B93A 3DF7A 1LA2A 1OFUA 4DE5A 1RZUA 3FOBA 3SIXA 1SVUA 2R3SA 1NWCA 4HUQA 3UKDA 4P4TA 4GAEA 4MZDA 2FUG1 1NM5C 3KL4A 3N0VA 4B3DA 2J5XA 4FOOA 1DAMA 3VJLA 4EYQA 5JW6A 4DZTA 3CLHA 3E27A 4GZ3A 1JFLA 1IBCA 1ST3A 3ZXYA 1LNQA 1E3EA 1NN5A 2LKDA 3GJ8A 3O9MA 3QMVA 3C3BA 4FI3F 5G4KB 3VNSA 4DBZA 3J80b 1W48A 1XXHE 3O8LA 4GMFA 5F7ZA 2KI7B 1NMEA 3CXCY 1NI4B 3F6PA 3IELA 4LDAA 1O87A 1IUKA 1EP2B 4G36A 4CG0A 2Y1EA 4UMFA 2HNAA 3TW8A 3AO0B 4QXPA 2EL9A 1SNYA 2VIIA 4HXEB 3P52A 2CMFA 4U6SA 1P1HA 5F7JA 2BRUA 3PQ8A 4TS3A 1I6WA 4RGYA 4RZUA 4EHBA 2E2WA 2B5OA 3OQPA 3I2YX 5EP4A 5CFMA 3TEJA 1BCSA 1MW8X 3QPBA 3TDHB 1TZMA 2PIDA 3VDQA 1LY1A 2VHUA 1E2IA 2HA6A 2P27A 3FMIA 5AWFC 5C4JI 1WF3A 2WYUA 3IEUA 2MSCB 3AHDA 3H11B 3WRVA 4AP5A 1N6KA 2GEUA 4RGQA 2YVQA 3ANLA 4QA9A 3S2FA 1KEZA 4CG1A 1I1QB 3O8RA 4GZ6A 5FBHA 3KG2A 2AQHA 2JR6A 3E22B 5ALUA 4UOZA 4KE9A 4K81B 1GCAA 2MYUA 3SXJA 1LI7A 5ALMA 2H1FA 1Y6ZA 2YFKA 1STOA 3SSOA 3AEQA 3ZI4A 2VNJA 3U3KA 3SZRA 3DXXA 2O2YA 4FU0A 3TQIA 3DVSX 4GRIA 1GPUA 3MQ2A 1XQ1A 3FZNA 1P44A 3WKAA 1T3ZA 4C7VA 1N2IA 1TZJA 1JBEA 2EWVA 2O54A 1A9QA 3E82A 1BIFA 1DQZA 1K08A 2O3RA 4H31A 2M6LA 2G70A 5JEDA 5BQ5A 3J7AC 4DMGA 4DDKA 2AN5A 4MIEA 4U3JA 2QK4A 5T3YA 4B3CA 4C9BA 4F6RA 4L1KA 2WC1A 1GNPA 4PPNA 1Z5VA 3R7BA 3GWZA 3I04M 2GNOA 2XLBA 1I5RA 2VXOA 3I9LA 1KJ8A 3HMQA 2B2NA 5CHYA 3QTBA 4KYIB 5IJXA 3TKYA 1UAAA 4ZMRA 2VH5R 1KARA 6ABPA 2DFKB 5FP0A 2JIQA 1T1RA 1VC2A 2AFRA 2BTQA 3KJZA 4KUGA 1U2ZA 4GRAA 1XMOB 1NBMA 4D9NA 1F2UA 3C70A 3KAPA 3I83A 2FFAA 4FB5A 1UEIA 3DEIA 1T1EA 2WB2A 3O4FA 1QGZA 1T10A 4H4EA 2AKLA 3TNYA 4NVRA 1QNFA 2O8VA 2PYZA 1RBZA 2FPOA 2FX5A 2RBGA 2Y76A 3EVNA 3VTZA 4DCGA 1CR6A 3KQOA 1BU5A 5IULC 1II0A 1KI6A 1K97A 2VJLA 3FZEA 3D4LA 2UVPB 3IJEB 4UCQA 4EAAA 3VNVA 2DTXA 1YCHA 1AKEA 5J43A 3CURA 3EYWA 1UZMA 4PQFA 1Z29A 4QU5A 4EPVA 2BMEA 4UPEA 3HOVI 1XDDA 3EODA 3AYXB 4IDGA 4A73A 5ALPA 3DVAB 2Q7OE 1G21B 1WEKA 2C03A 2VXCA 1TCUA 2PGIA 2JATA 5D7BA 2G5PA 2GPYA 4FMDF 3AVUA 2IYLD 4M9UA 4JI0B 5LD2C 1EUZA 1RP7A 1HFWA 2YFHA 3C97A 3PL1A 4E5MA 2WWXA 2NPFA 1CR2A 2Q28A 5CGZA 3WA7A 1OLSA 1JX6A 2V4UA 4KWCA 4H1TA 4Y2GA 4KE6A 2N46A 4R1QA 2Z5LA 5IZCA 2Z8ZA 4M1MA 1NI4A 3VKUA 3FBTA 5CH3A 4D97A 4NR0A 1SFOI 2WFZA 3BJEA 3SGLA 4KQ9A 1NUQA 5K8LA 3D4PA 1NRWA 3RARA 4MHSA 4UM7A 5CDSA 1UOOA 1JMVA 1CRLA 4UREA 1LB1B 1WMSA 2DUNA 4YRDA 5KYVA 1N8SA 2EP7A 3MWKA 3KE8A 4XWYA 4KTVE 5D3MA 1BQ4A 1PSZA 5CPBA 1JJ7A 4JQCA 3IP5A 5LOVB 1NJ5A 2AC4A 2ZDGA 1GAXA 3P0FA 2WJ6A 3CF6R 3B2EA 3BXZA 1OPRA 2OV6A 4C20A 2X1LA 2E5FA 3UOGA 5ES3A 5I7WA 3HJCA 3H11A 1GADO 3C15C 2R8PA 3WL6A 1S8AA 4NBLA 5FLMI 3WMWA 5EKXA 1NZJA 1P39A 1PJCA 1JU3A 2QXTA 3NB0A 5AKKA 4KXWA 1CJCA 1J90A 3E22A 4MQMA 3TE5B 2YVAA 3DOUA 5EZYA 3C7DB 4WZZA 3G02A 4RAOA 3D64A 5JYCA 3MWGA 3IA7A 4MVYA 4MUJA 5K99A 3ORRA 2WTUA 3ZVNA 2TS1A 4D3SA 1CVIA 5AIBA 4CGZA 2QW8A 2C42A 4AJNA 1WU7A 4MUFA 5IPFA 3GP8A 1XCMA 1LBSA 4Y9SA 3E9DA 2PL3A 2ILTA 1F7UA 2C2WA 3IHLA 3NTRA 4U0JA 2QUAA 2OO5A 3VMFA 3ZCUA 1JAXA 2WG2A 3OU7A 1E7MA 3EOBI 5CT5A 1EKXA 1Q0SA 2UZIR 3VH4A 5ILGA 4EG0A 5CEEA 2G36A 2J45A 5JSHA 3NHLA 4DLYA 3N2ZB 1ZO8A 3GUVA 4V02A 1YRHA 4B81A 2MYPA 1COZA 2NSJA 2ZS8A 3DCJA 4LUCA 3S2IA 4WUVA 3GUHA 5CJJA 2ZI4A 4URXR 1PDVA 1TT5A 4EF4A 1OMOA 3DWIA 3PVSA 2VJKA 1DO8A 2I3CA 1A50B 3ORSA 4LHXA 2CHEA 2RHHA 2QL7A 2W2XA 5GM1A 3PTZA 5FBRB 2CL6X 4ECAA 5JYEA 4LSZA 3LLCA 2G72A 4Q1BA 2G4LA 4Z0TA 4TMVA 4J0GA 2E4VA 4HNAA 2NGRA 3O5AA 3P27A 1RMQA 4P7BA 1L5FA 3EW9A 5A4JA 4RPJA 4K1LA 1AQLA 4FXPA 5HIMA 4I1YA 2IQ5A 1X7GA 3CPWY 2CXNA 2WOJA 4BVKA 4A3FI 3OF5A 2RC5A 1MEEA 2BFOA 3OMWA 1NLUA 4M1OA 1VA5A 3H2KA 4YRCA 4IDCA 3RNOA 1CRWG 3IMGA 4WBNF 2PDAA 1IULA 1O89A 3BE4A 3M3HA 2IOHA 1ECCA 3BJMA 3ND7A 1ZSNA 3O2NA 4OQZA 1J00A 5EMLA 5FNVB 3ZV4A 3U7HB 1I2ZA 3PGMA 4ICIA 4JEMA 4OQMA 4N3GA 3NATA 2R5FA 4QUBA 2NZYA 6GPBA 3DEKA 3CGWA 2HXYA 4PIVA 3V46A 3KQKA 3IB6A 4QVGA 4REMA 3HRIA 2POCA 3RSCA 3OJ0A 1Y0BA 3H5IA 3JQCA 1K66A 5I9IA 2PM9A 3OZWA 2QREB 3LK7A 4RLQA 5BN1A 4OJQA 3MK31 4MAAA 2BFBB 4TYWA 2GK4A 2WNSA 3DBLB 5BY2A 2DPXA 3U5TA 1EXDA 3TMKA 2P8JA 4QTTA 1JU4A 3KTAB 4NXMB 2XT0A 4P86A 2G09A 2MSLA 3DMYA 4D4HA 1KEPA 3X1JA 2HU8A 2PL1A 2RHOA 3AONB 1H2AS 1KE2A 4KO4S 2GUGA 4PU0A 4D8XA 5ALQA 3VU3A 2CCJA 5C9ZA 1EGVB 1ICIA 3LW8A 3MERA 2HA2A 3P2JA 2CNWD 3WGQA 1UBTS 1ZYUA 1ZH0A 4I50B 2EU8A 4OYYA 1OZHA 4RXTA 1MLDA 4OKSA 5AI0A 5AT1A 1KEUA 2YYYA 4OIFA 3P0RA 3HY6A 3VXKA 4DJJA 4QGBA 1I4OA 1VP9A 2C9MA 1S6YA 2K7ZA 2ERXA 3K5HA 4PANA 4PHTA 1HRDA 4YT8A 2H85A 3QEKA 4UAUA 1HDOA 1JQAA 2IHZA 1VI2A 4GE3A 4KREA 1K6JA 1BFDA 2H2DA 4RY8A 4OY3A 1O77A 3VYTB 5FPQA 4EPXA 5AM1A 2EJVA 3NC1C 1ZVJA 4XR4A 2WJZB 5FPPA 3QTTA 3COJA 1E1RA 1IG0A 3OSZA 3LCJA 1QK3A 1S3IA 3QKRB 3S3TA 1X1RA 3OHMA 4TLDA 4BIIA 4ERNA 2N3ZA 4MV0A 4FOSA 4QJ5A 2XGGA 1KJYA 1Z01A 1S0UA 1TVCA 2PH3A 2X86A 4J1NA 1N6LA 2Z9BA 3NM4A 4WV3A 3NP9A 2XYVA 3JAMA 5KAMA 5EINA 1KXJA 2X42A 3AL3A 1QONA 4IQ0A 3OO1A 1IXRC 4QPPA 1NXOA 4KBYA 4M7PA 1LK7A 1T5OA 3QXSA 3G89A 2RAUA 4RK0A 4RVOA 4CRWB 2P0AA 2FU5C 1MORA 5M2QA 3OT5A 4G9GA 3KAQA 3PFHA 5EZSA 1IY0A 2I8CA 4JNCA 1RAGA 3FNRA 1Y4UA 4ZAVA 3WLHA 4DR3B 4AY5A 3OICA 3S5JA 2Y1WA 3X2EA 4NBHA 1WXDA 5H3CA 3WIDA 2FSVC 1EMDA 1JEQB 3NHYA 4FE7A 4DC1A 4MWGA 1S2LA 1YJ91 3ZW7A 1NBEA 3I92A 4OREX 1OX5A 2HFKA 2P67A 4A6DA 3BICA 4PLPA 1ZC4A 1ZK1A 2ZVJA 2EL7A 1QBGA 1ZM2A 1MT0A 2PQMA 3CLVA 3IS3A 1BKDR 3PPIA 3I8SA 2DUMA 1CQJB 2NUPA 1Y1QA 3SJCA 3MGGA 3D2LA 4G8CA 2IUEA 1LUAA 2NZ2A 3VAZA 1E2EA 2CFOA 2FP4B 4YH1A 1J23A 1PV1A 2AX4A 3DCIA 3TFQA 3LUKA 4NFHA 5FNVA 1FUUA 1P2GA 1UJNA 3O91A 2ZIVB 2CVOA 1QPBA 2R84A 4UDOA 2ACWA 3BMNB 3K0HA 1P74A 1L7QA 2FWJA 3EF3A 4EVRA 4WNAB 5F5LA 3W6NA 5EC8A 4TTTS 2CEAA 3UK6A 1FTNA 3DLAA 3ZBUA 2WF9A 1YIJZ 3W8RA 3FUWA 4LVOA 4UTZA 1K731 3OTQA 4ZD6A 1K3TA 4NBEA 2WR8A 3AM3A 2BFBA 4UAGA 3FKQA 5CLLA 1VBFA 1XRSB 2RB4A 1OXBB 1B2LA 3G7NA 3QBEA 4L6AA 1YA8A 1UP6A 2BP7B 3LCMA 3LXXA 4F2DA 2FWMX 3WIEA 3KSRA 3H1GA 4IG9A 2QDKA 2G5CA 1M2GA 4MVJD 4L0CA 3RD5A 1KWGA 4XFJA 1NW5A 2V58A 3L0ZA 1YHQ1 3WO0A 2O5CA 2JS7A 1CEYA 3HO6A 1IC6A 2MWMA 3VO2A 3WMXA 1WJ2A 3T7RA 3U9LA 2VSYA 2WU8A 1ICEA 4MCAA 2GAAA 3BL5A 4BFSA 4HX5A 3GA5A 1SZDA 1CF4A 5AOAA 4PHGA 2ZREA 5DHPA 3UWOA 3ZHTA 4ENQA 3JAWB 5HBGA 2UUAB 2YVUA 4UM8B 5JHGB 3DD1A 1CY0A 1V71A 2PE5A 2UXCB 4CM4B 2FYTA 1DEHA 1PK8A 3I0MA 3HLTA 4M9QA 4O3FA 1DQYA 1WCWA 1A9SA 5IU6A 2PUHA 1WM1A 1ZJJA 3PEEA 4RE6A 5C2JB 4GX5A 1J49A 1DTWA 2JGFA 3QK7A 1ZG3A 4RK6A 2IHYA 2VDKB 3ZWNA 3LQQA 5HJ5A 5F7XA 4EFDA 4YRZA 1II9A 4JL8A 1C1XB 1THMA 3QKRA 3WL8A 1MX5A 3R3JA 3U80A 5K09A 3Q7RA 4RV5A 3GT0A 1QF7A 4Y9RA 5TV2A 1I32A 3NBFA 1RTTA 1ZUHA 1PSWA 3OZCA 2XKBA 3T0IA 1NX6A 1HQDA 3V6LA 1W9MA 1G60A 1GL3A 1UBRS 2CMKA 3PUKA 5C4IA 2VYNA 3PHLA 3UANA 1WO8A 2LIPA 2LEXA 1T5SA 4XIGS 1QV9A 2VP9A 4BFLA 2C8VA 4RK1A 1DT5A 3OZGA 4LWZA 1N6PA 3TQOA 3SCZA 4M86A 2DWQA 5FH9A 2CNDA 3GRFA 1SHZA 5T64A 3PHGA 3TDKA 2DZDA 1EA7A 2IK8A 2NO7A 5B2ZA 3ENKA 3ETNA 3H4VA 4DGLA 4LGYA 1G55A 3I56Z 2YOFA 4P7KA 2OCAA 1QGUB 1E1YA 4B6OA 2JZNA 1U9IC 3A1EA 3C3JA 5CP8A 4Q34A 1B8UA 2PMEA 2X58A 1GRNA 2I4LA 1OBHA 4S1WA 1PDWA 4XM2A 2ZG6A 4BIMA 1GTG1 4RHEA 3KAKA 3ZGLA 1SXJE 1JHUA 1LDEA 4ZRNA 5I7FA 2FB9A 3MS4A 5F7OA 1Y63A 5EIXA 1FMFA 4KQFA 1UK9A 5EMHA 1QOPB 4DNQA 1QCZA 3PP8A 4R16A 4Z4EA 2VHYA 1CQJA 1YR1A 4AM8A 2OQ2A 1SCNE 4QOHA 3JQGA 1R10A 5DHQA 3ZQ6A 5C8YB 1GN8A 2FP4A 3KKZA 3OZDA 4K05A 2WAYA 1NYTA 3OCJA 1CDDA 1HSOA 3EK2A 4JP1A 1LU9A 5ALGA 1JEEA 1ZICA 2WPDD 2WWVD 4FYJA 3T52A 4GBGA 3G1UA 3T7TA 4ANFA 1HT3A 1Y9AA 1BMFD 2X1VA 3PDWA 5B64A 4ZEXA 5FI1B 1OFGA 4BTLA 1R0RE 4M60A 1DEXA 4WNAA 3A3NA 4BQNA 1OE0A 5IN5A 4UVIA 2H1RA 4ZQHA 2CDNA 2ODBA 3GEBA 3PDCA 4R3WA 5I9MA 1BE6A 2F3UA 5JS2A 2ZRPA 2ZSKA 4AUNA 5I9SA 5IZ4A 3W5AA 1M2OB 2K5UA 1TZBA 4QDZA 3U50C 3GTGI 2FN4A 1OAOA 2IYYA 1NQXA 3JQDA 1AKRA 1H2XA 1EP9A 1TJ4A 4QQRA 3EAQA 3V4SA 1CDZA 4ED9A 2CL5A 4Q1EA 3CLKA 4OG2A 3WLPA 3AFOA 3KJFA 1U5BB 1ZW6A 3O8CA 2GZHA 3FMGA 4Z5XA 2MINB 1AXGA 3GCFA 4YRRA 1AG9A 1JJ2Y 4F71A 3N1UA 2GJKA 4UBNA 1WZIA 2O0KA 1TVKB 3DEHA 4D9EA 5EJEA 1U7TA 3WYAA 3GP3A 3RFVA 3C5WP 2QX4A 3IUPA 2VSQA 4RYLA 1HO3A 3B89A 4Y2SA 2Z0MA 4PSAA 1ISMA 3WLMA 1AX9A 1VCNA 3OAAD 5IAGA 4NMWA 5K8IA 4CM4A 2N47A 2BFAA 3EHEA 4FCVA 5D86A 1CEXA 4AZ3B 3CU5A 4NENB 4CM1A 4DR4B 1T6ZA 4BJ1A 2E4YA 3MONA 3SHTA 4RKRA 1D2HA 3QIVA 4R2JA 3W5SA 5K8TA 1YU6A 2MR6A 5CAEB 1AK2A 2GESA 4A23A 2XRMA 5L3SB 4NX2A 5BYBA 4AQ7A 1LV7A 2W2TA 1O58A 5TJ9A 1C1XA 2ACVA 3MJ4A 3NVAA 1JQDA 1Z22A 2BFEB 1IG3A 3HJTA 3IJ5A 3Q2IA 3R0QA 4HDRB 2F9MA 4JBHA 3SF8B 2ZSEA 2OXRA 1TCVA 3Q2KA 4YAFA 3D0QA 3UOAB 4FDUA 3DW1X 5EIAA 5SZIA 5HX7A 1WD5A 2VPPA 2HU9A 1JECA 3CTMA 4PZAA 3UBTA 4ZU1X 3D3NA 5H02A 2GHTA 4MLZA 3ZHXA 3UXMA 5BSRA 4CLDA 1DKQA 1USVA 5C3EI 3GRZA 4D9JA 5ITSA 1OH6A 3CRRA 5AUOB 1F20A 3W1VA 3O2JA 3JD3A 5JAUA 2PYIA 1K8ZB 2O06A 3PYMA 3HJNA 5F1KA 4A8TA 4NFRA 1K92A 3HPQA 3DOIA 1MOSA 1ZGHA 2JH3A 1R88A 3OQIA 5C34B 2QLJA 4EG3A 4F3RA 5BV0A 1C2TA 4I1VA 3LUSA 1QHYA 4RVUA 5EHNA 4C0WA 2A0FA 2R00A 4E2WA 2FWAA 4E07A 1NQWA 3VISA 3E4CA 4AFNA 5IDVA 1PJLA 3W1WA 1E4YA 4AURA 3R76A 3CBGA 4BKRA 3LBNA 1SVNA 3NKFA 5JBQA 1RLUA 2RSLA 4ND7A 1M1YE 2EW8A 3FKJA 1H6DA 3FRIA 1MIOA 4ZT7A 5IBPA 3VZPA 4DJTA 1MOQA 3VDRA 1R0XA 4CODB 2H4FA 1P9WA 1TEVA 2PYDA 2GCGA 4J0IA 5B5SA 4YASA 3SVZA 4Q7QA 2PXCA 1NE7A 2J46A 4HK4A 2ZJ2A 3EF0A 1LSUA 3QEOA 2E4WA 4K9NA 4C22A 1BS9A 3ET5A 5B2FA 2AEMA 1D1PA 2LWIA 3HZHA 4G0UA 1YTUA 1IEQA 1QIDA 2BJHA 5KTTA 3OZTA 4WOPA 3IEKA 2EATA 1BX0A 3LRPA 3MWJA 3ADDA 5FWAA 5JLAA 2IZ3A 1KTVA 1WP9A 1PR0A 3SR0A 5JC8A 1XA0A 2XQGA 3AR2A 4J0QA 3AFGA 5BMVF 1TK2A 4ND8B 1VKZA 3NTXA 4G1EB 4KN9S 4UNNA 5CX1B 1W0KD 2R8YA 3CD61 5DM70 4CM9A 3GUCA 3LCCA 4R98A 4JI8B 4ZO9A 4ZEVA 4DIKA 2C3OA 5JTTA 4G0PA 1ZWKA 1UPFA 4OKNA 1U5BA 1P1BA 4IIGA 1OZGA 4FWTA 1IN7A 1RWWA 1EZ4A 1X0XA 2MINA 1U28A 1Z37A 3EDMA 1JLHA 5TIIA 5JJIA 1JR3A 4D02A 1IQUA 2Q5IA 1YRWA 3REQB 1QRUA 4DUZB 4FMCF 2PSHA 3EFBA 1QHFA 1VMKA 1ODIA 3V7NA 1B00A 1LGYA 1MNQA 4LPKA 2QPAA 3O4HA 1KFJB 2ZROA 1QLJA 2GD1O 1OC2A 2P6MA 1GYRA 1U8AA 1GARA 1ZXLA 1W4RA 1WE2A 2CGEA 1Q7EA 2OBNA 4G0MA 1JF8A 3COVA 2X4LA 3IAXA 1RI5A 2WQZA 4LZNA 4DV3B 3PRJA 2PMCA 3OZVA 5LQUA 3VSBA 4QSHA 1KD11 2PUTA 2WHQA 1GVNB 3HVIA 3E9RA 4N5HX 4NENA 5EVJA 1K83I 4DRXB 3UK1A 4LI0A 2QQEA 1OVGA 4TZ0A 2YJ3A 2QSYA 1D5CA 5I7AA 1YRBA 4Q4HA 3LP8A 3J81f 1ZIXA 4F4FA 5DX1A 5L3SA 2J8ZA 1Z38A 1D4AA 1SBTA 5AVKA 1XVIA 1NIJA 5KPDA 1A2KC 4LGVA 1MB4A 2FPIB 3HXTA 5KMGB 3WAGA 4ADSG 4NDZA 1NXSA 4L4YA 1PGPA 2QHXA 1HL7A 4CIVA 2CL7X 1GKUB 2A92A 3FKSA 4PC6A 1YJXA 5GADl 2J6AA 2NQTA 1TTPB 1GTRA 2Q2VA 3MXOA 4QNMA 4JUDX 2GMWA 3P20A 3R40A 1IY9A 2R6R1 4OXKA 3VC2A 2DBQA 4A93I 1XB2A 1XKLA 4DADA 4JJ4A 4LY3A 2ZRFA 1JQ5A 5I5EA 2FY8A 3H6GA 3OPYI 2DYKA 4M0DA 3ZTYA 5JNLA 2A58A 3ZE0B 1XDBA 1TGYA 3HXLA 1OIWA 2QE7A 2OZVA 3UWDA 3GTMI 2QNIA 5BNZA 3CCE1 4LI3X 2NWQA 4IFIA 1P3DA 4RJ2A 4ARSA 5KX5B 4YJGB 1I1OA 4MROA 1CUUA 4ID3A 2RD2A 4CF3A 3DWEX 2GAJA 2PKEA 3ACCA 5FI5A 1G9TA 1NDHA 1YI0A 4KRYA 1WUIS 2G71A 2ZCUA 4JQYA 5EHQA 5AVOA 5GP1A 3VO8A 4BLOA 2VTEA 1QTQA 4KN6A 2H1SA 1OKKA 1KA9H 4IUDS 1NVDA 4ZHQA 2L69A 4E2FA 1JGTA 4MGHA 5EN4A 3HVKA 3ND8A 4D4MA 3VFDA 2QZ9A 4LGMA 3AK4A 3G2NA 4WASA 1YE5A 3FXAA 3TMYA 1NA5A 2Q0XA 2GSWA 4A1FA 5EIBD 5AHXA 3WXBA 4WZAE 4GLBA 2D2FA 4NBKA 3OIVA 3HUUA 4O63O 1VJTA 3DNPA 5HE8A 2Y4OA 4ND8A 2OAQ1 3LBFA 1TWAI 2YOHA 4Q3DA 2PZMA 4JYCA 3PFBA 4L15A 4FZJA 1ZM7A 4X8MA 5AW1A 1YVDA 3EUAA 4GOKA 4WCDA 5ARCA 3PQ6A 4N5IX 4C43A 1Y6JA 5L7WA 9MHTA 4M21A 3C1UA 2WWWA 4DG9A 1SBIA 1AZWA 1PK9A 2IPNA 3HM9A 2Z4RA 1GUBA 3H6KA 3HOWI 1JHXA 3CLSD 4GWKA 2OLJA 4FW9A 3REQA 3ZHSA 4PGAA 2H17A 3U48A 4JJAA 1XLWA 1WW3A 3IPLA 3UWMA 4R3UC 2INGX 4J7XA 3TBKA 5EA2A 3DR3A 2YINC 4NSNA 3WQBA 1SA0A 2HHLA 2GZ1A 1DXOA 3KOYA 3P0HA 1A9XB 1P80A 4B4DA 5JC1A 1UXGA 4H60A 5BWLA 3A6PC 1E64A 4UTXA 2WYIA 1IN5A 4IIDA 1GUZA 3DVRX 2XB4A 1PW5A 1YZYA 4YYZA 2P9ZA 2XDYA 2DCUA 2RH5A 4R8SA 3B2QA 3P9QA 2IT1A 3DAGA 3GLGA 4AROA 1HLPA 4LE0A 1H4SA 1Y3BE 1YTLA 3N8IA 4CG2A 2I6UA 5L3ZA 4XYEA 3VZDA 2V03A 1UQTA 2CBXA 1YQGA 4HX2A 3R5JA 4JROA 4F4UA 4QLAA 2HMYB 4XASA 1ZL2A 3UHFA 4C89A 1ATZA 2JLXA 4U2DA 3K0BA 5IF3A 5IW8A 1P9OA 4LOKA 3AYZB 3R7AA 2LCFA 4M7WA 2QMHA 4BNWA 3C7KA 2JJ2A 3FNHA 3Q40A 1M0EA 4BC0A 3I58A 2PY6A 1CP2A 3GLFE 4AD8A 2W2LA 4LDNA 2H65A 5AJVB 3TZKA 1I3NA 2W2QA 3Q2OA 1MDFA 2I3GA 3RNLA 4KQMA 2JFYA 2OP0A 4Q48A 4BP9A 1NJ1A 4YXWD 2F4VB 2QV0A 1XA4A 4HQOA 1WCYA 1R3DA 4MEAA 4OATA 5I8ZA 1ZVVA 4MGZR 1USUA 3T4PA 4BZPA 5JAHA 2XXJA 2Y92A 1CUGA 5CG2A 3DHWC 1E1MA 2HTFA 1I7LA 1K86A 4RY9A 2R92I 1O5TA 4I4TF 1T0BA 4B40A 3G5TA 5DXJA 5DTQA 4EHLA 1QYIA 2JA5I 3BDVA 4PC3A 2Z8YA 4N47A 2EW1A 2Q5JA 4R1OA 1U7DA 4MDEA 1BEUB 1V7QA 2DULA 3UA4A 5D1OB 2ZRKA 1MUUA 1Z74A 2DLDA 2RGNC 2X13A 1BGVA 4K8OA 2W6JA 4UPDA 1PYOA 1QANA 4YRAA 4DV6B 1OFVA 4F85A 4FYVA 4IQ8A 4EVQA 5C1IA 1OXSC 3AC0A 3P2OA 2CNKA 1A27A 2XDQB 4WKNA 4UNQA 3K70D 1QP0A 1I36A 1EXVA 2EZ4A 3RUCA 3KD3A 1W94A 1L8OA 3A6DA 1JQBA 1O94D 2QD4A 3O3NB 5HS6A 3ZK7A 4JLVA 4WGGA 4EG1A 4GF5A 1GCIA 1L6RA 3R5SA 3FOEC 2XDAA 3JXEA 2IOYA 1GQOA 4LSWA 2Q3EA 4OH1A 3DL4A 2QQ0A 1SJ9A 2IOFK 4G67A 1Z8HA 3VC7A 2ZBPA 3ZH9B 2YADA 1B74A 1X8JA 3JVUA 2ARKA 3K2EA 5JDCC 2JLVA 1F0KA 1GTVA 1RU3A 2XGOA 4DT1A 4M6WA 1UJ4A 2ZIZA 1FJGB 2QLFA 5EUBA 5KYWB 2ZAGA 4TMYA 2BEJA 1G6OA 4MV6A 4DVJA 4QVIA 5CDHA 1CYDA 2FMKA 4PRZA 4I1PA 2WVHA 5E0KB 1ISHA 2C5HA 1D07A 2FLKA 4LZOA 3I2GA 5KYXA 1L9KA 2IEDA 1L9XA 2JCGA 1PVOA 3G9XA 4Q9HA 1GR0A 1X15A 2LPMA 4L75A 3WLKX 1S9DA 2VTBB 4W1QA 1C29B 1RJDA 3T15A 3NBAA 5HF8A 5FBLB 5LVAA 3QVXA 1UBGA 1Y6QA 1MO4A 1Z5NA 1RRCA 1P75A 1T8PA 3C0KA 1N2OA 4HAZA 2BMVA 4KL8S 4NZZA 3UVEA 4ZXPA 2NZXA 4I6EA 4CCSA 2OFPA 2Q1TA 3KXKA 5C80A 2RGRA 4AKIA 4PNZA 3QWFA 3PDHA 4YRKA 2PZJA 5ER6A 2JDIA 2E2II 2PSSA 2R7ZI 1BGXT 4R83A 2PLFA 2VI5A 3OFSA 2Y0EA 2O6HA 5CNMA 1HT0A 1KVUA 4H7HA 5T4FA 3BGIA 4B1FA 4RTNA 4NEQA 2D2VA 3RTAA 4MK4A 1LW7A 3AF3A 2VP4A 3OJCA 1UINA 2FN8A 4D9HA 4F5ZA 1Y1RA 3TOZA 3HRHA 4LRTB 4PX2A 3HI4A 2ESRA 1E2BA 3I4NI 3W8DA 2QZJA 1EEXB 4UCWA 5CIYA 3OOYA 1N2CB 3CCM1 3K0EA 1Z4KA 5JO9A 1VLAA 1U65A 1R2QA 4RK4A 1HLDA 5GOTA 4H7PA 5EXDA 5KSWB 3FCYA 4OMCA 3QXXA 3T6KA 4AJKA 1MHPA 3R0JA 3NRJA 3NBYC 5EIOA 1GY8A 4KUHA 1PHRA 1CJTC 5BURA 2BZSA 2WFLA 4W82A 4PSVA 1SXJD 2YU9I 4MVJF 3D6TB 3V3TA 3GNLA 4M55A 5JU6A 2C7BA 3TD9A 1GIAA 2JFPA 3SC6A 2OCGA 2DE5A 4R51A 3FQMA 1FU7A 1D1TA 2EFGA 4KE8A 4WJZA 1TE2A 1UPBA 4CI9A 2NO6A 2O14A 4NBSA 3HLKA 2ZIUB 1V41E 3CYFA 3D9QX 4WK4B 2XECA 2HIAA 3GZTB 4O2BF 3H4IA 5B4VA 4DKJA 4LCJA 3H7AA 3TTXA 4NKRA 4RANA 5JQGB 2QN1A 3ABSB 1Z18A 5LKRA 1T3TA 4RQAA 4AO7A 2P6UA 2O52A 4R0NA 4HGQA 4U2FA 3SLRA 1XMQB 3V8RA 1B8VA 2CF5A 1GUAA 5JPCA 1TMKA 1YHYA 5EJ5A 4GZLA 1BHSA 1FXWA 2R4QA 3FYUC 1ZGAA 3DC2A 4OX9Y 1XPJA 3JYLA 4MMXB 1GO2A 1ZC3A 2B36A 1FYXA 1ABFA 2E85A 5THKA 4XZ3A 2XTZA 3V2HA 4B3FX 2YDXA 2OMKA 4AJOA 4IR7A 3GYGA 4YMSA 3ETGA 3RBZA 3ESRA 4BLTA 1PBTA 1RABA 2X15A 3RYIA 1E9EA 1E62A 2JLYA 1U5AA 2GCPA 2HQBA 3FDXA 2GD6A 3CLTD 4PAGA 2HK6A 3LXMA 2J9ZB 4IDOA 3A6GA 2WHYA 2ZAYA 4HH1A 4OSEA 3R7WB 4LK3A 5H9VA 1GPYA 3OLXA 3R6LA 3WVNA 4AJ4A 1KIMA 3S1AB 1PCXA 5T6MA 1WXEA 2HW8A 1ZMBA 1PI3A 4OGKA 1YB6A 2QVGA 2Q1YA 3OVMA 2J0UB 4Q1DA 5JMPA 4YP6A 3IFUA 1N5OX 4JLPA 3WYFA 3FKII 2V7QD 3D8BA 3PFFA 4NYJQ 4KPYA 3Q9LA 2ZWMA 5J2TF 1OBFO 1X42A 1ZOPA 2EQBA 1U8EA 3PFIA 4WFKA 3RABA 4M1WA 5IH3A 3VKWA 1X1EA 2CNOA 4Y1GA 1G20B 1HX7A 3OESA 3PWSA 5G0WA 4EQ6A 4F9GA 1LC3A 2GVNA 2VUHB 2O53A 5DSZA 1G8KA 4I9NA 1R5OA 1XCBA 2XUGA 4L5IA 2YMQA 4NCNA 4W5HA 4WW0A 1WL8A 4BMPB 3OPQA 3P4UA 4ZKDA 5LD2B 1EFPB 4MIOA 2P41A 1NM5A 1T9CA 1TC1A 5DGCA 3UHAA 5IP9I 4B85A 4ZU6X 3BJRA 2YHSA 4JH0A 1V3VA 4LSMA 1W59A 2B1QA 4EKIA 3Q7PA 5MGBA 2P35A 1VPVA 1Z36A 1E1QD 3UAVA 2AFHB 4HLUC 4A3CI 3BJIC 5DCYA 3KWFA 3MFQA 2NW6A 1VQ61 1XGKA 1ZFNA 5DHTA 3I2HA 2V6BA 2XSZA 3TCKA 2VWHA 1H69A 2FPSA 2W8BB 5EE3A 2I4TA 3WYNA 2BTEA 4LNAA 4OK5A 1W6RA 1NV9A 1DQNA 3COYA 3GNTA 3QNUA 3VR4H 3I9NA 4KXNA 4TMWA 1N2CA 4N6GA 5AHKA 2P2YA 3B9PA 3UH1A 3UTCA 1UK7A 2YW9A 4YJDA 5KSYA 3I0ZA 4ARCA 1G18A 3C4VA 4NAVA 2Q2OA 3MPUA 5KNCH 4JI4B 4GQIA 1R9NA 4P9NA 4TXHA 2FEKA 2BGRA 4LOIA 2DBRA 3CUTA 5KQRA 3UJCA 1CR4A 5DHFA 3RWBA 2CCGA 4RHUA 2ISCA 3F2VA 2EF1A 2GZRA 4BU1A 1NV8A 5K0CA 5LXTF 2JLRA 1N5KA 1E98A 1PP4A 4MKHA 3IVXA 3GB9A 4R31A 1YE3A 4EKYA 5JATA 5JVDF 4H17A 5EYPB 2HPVA 1KZ9A 4NBCA 1YZ3A 1B2RA 1DV2A 5B1EA 5FLXA 1QVFZ 5FO1A 1P1CA 1ZJYA 1XJCA 3KVYA 1GG9A 4ND2A 4PXYA 4RENA 1XLUA 3U3ZA 5DTEA 2NVBA 2CUKA 3NCHA 4D43A 2R6AA 5K0JA 1QF6A 5JXHA 5IT5A 4A26A 2XMCA 1QQ5A 1EX6A 3EGEA 2ZR8A 4X6XA 4LF4B 2V8KA 2BJVA 4OU4A 4AICA 2UVDA 1GTSA 4GOND 3EQ7A 3ZCTA 5H59A 4UEWA 3VZSA 4MHTA 3LXUX 4JD5A 2QRVB 1DX9A 2L82A 4MR9A 3K15A 1JAYA 2ZAIA 3IHWA 1I50I 4CZ2A 3EEQA 2O8NA 1TCBA 5AESA 1J5EB 1U8ZA 4TKVA 1W0JD 3DKRA 3PX2A 5GVRA 3E1GA 3VSEA 4RVGA 3KB8A 3QPAA 4RADA 3NUGA 4BQPA 3R6TA 1P0CA 4M46A 1FX0A 2W6IA 1Z4IA 3S1AA 3ZU4A 4BX3A 2R1ZA 1WXQA 1C0PA 1B8OA 3ORQA 1OX6A 1ZI6A 4L72A 1N2EA 2O05A 3UGKA 2H5LA 3RJZA 2O2DA 2I1LA 2IYNA 3KIHA 2G76A 2OGWA 4FE3A 1KSGA 3ESCA 1RO0A 4KXLA 4ZPXA 4Y7DA 3KQUA 2O8FB 2J6IA 3DDZX 4OP1A 4P5EA 1KDPA 3WLRA 3WGUA 3G85A 3IEVA 2XOXA 1UM9B 2VHZA 3RAEC 3T1OA 3TLEA 5EJFA 4N5LA 4COKA 1NQ5A 3AEUA 3BSYA 3FG9A 4FYWA 4R84A 3VHXA 3BOSA 4L0QA 5FR1A 3KZNA 1KSHA 2VPYA 1EFPA 2F1RA 2IUSA 1J0BA 1W4CA 3C5CA 5LP6C 4A2PA 2OZKA 1J9GA 1E2NA 4AQYB 3R3SA 1OHHA 1PZNA 4WXRA 1E9BA 2Z09A 4WKBA 5L51A 5AHOA 1G1MA 1L3BA 4PWYA 2FUCA 5DKFA 2XCSB 3CQ9A 3L0BA 4BEJA 1QU2A 4DEVA 4HEA6 4RZSA 4MO9A 2ID4A 4KOEC 1C7QA 2WSBA 5IDWA 3ILYA 4H6XA 2BMJA 4Q3LA 5GV7A 1ZZGA 1KMCA 2HPAA 4G89A 4BY9E 4MA4A 2BN4A 1FFDA 2HL6A 2VK8A 5JE8A 4XYBA 1U9ZA 3LY8A 3TLKA 1YIT1 2PBFA 2FW6A 2I0FA 2XH8A 3LUCA 1PRYA 4PYRA 2WD7A 1ENZA 1H8HA 3G8AA 3S1SA 1EFAA 3BXOA 2HJVA 4G0WA 4KR6A 3INRA 5JY6A 2HRDA 3SICE 3EXEB 1AS2A 3FWKA 5KDDA 3QA3E 2UVQA 3IYLW 4TLBA 4MKZA 1TLLA 4C3VA 2LVBA 3G88A 4BLVA 1TOAA 2IZ7A 5MDHA 1GU0A 1UBNA 4HC4A 3V8MA 3ZY2A 5LR6A 4G5YA 3E7DA 4D3ZA 1E5LA 3VA7A 2NUAA 1DP4A 1I0ZA 3OA2A 3KTDA 1X8KA 2VSOA 3IDSA 5LCXA 5IM4F 1JN0A 1G8HA 1SUEA 1FQKA 2O57A 1TD9A 4WAUA 4WVLA 4ZK2A 1WMEA 3JWGA 3G7UA 2ZBFA 3GY0A 1G42A 1ZCFA 5CYOA 4J8PA 5J9FA 2UUBB 1NMXA 4PBRA 1ISJA 4FR5A 3GP5A 5FWXA 4PAMA 4Q9JA 1GKYA 3VR3A 3ZDAA 1CY6A 1ECPA 3EVCA 1JAZA 2HEGA 2PT6A 4GR5A 4TSRA 5DNAA 2WVGA 3C6YA 3TMAA 3UKJA 2UYQA 3K1YA 3AT1A 1V16A 1OASA 4E12A 1I80A 3BEDA 4WOKA 2ZJ5A 3A1NA 1WX1A 1A82A 3IXLA 3NC4A 6NULA 5EY5B 3LQKA 3VTAA 4HH4A 4F38A 2B61A 4RZIA 5I9TA 4IQGA 1ISPA 2QRVA 1T6BY 3BTSA 1SOMA 4REQB 4R6WA 3ZCQA 4JI1B 3II6X 2X8JB 1TUEA 3K0CC 4H7JA 4NEGA 3TTWA 5D3QA 4AXBA 4V1CB 2JGKA 3R44A 1K732 3DE3X 1MH9A 2HWUA 1C3VA 3NS7A 4EUEA 1Z83A 1GILA 4JSYA 1N0VC 3C41J 4C5BA 4CM8A 1NUSA 1UT8A 1T36B 1VJ0A 2DMRA 2XUKA 5GJVC 2JLAA 1NT2A 3P5SA 4J2TA 1GSOA 1NBME 1X74A 2F48A 3DO8A 4OP2A 4BFTA 3P9KA 4EW3A 4JGIA 4JJGA 3V3KA 4A5SA 1A5TA 4CW7A 2GU2A 1ZWLA 3B78A 2BBOA 4A03A 4U9HS 4EJMA 5JNVA 3EGOA 1WXWA 3LC2O 4HGYA 3AHEA 2BHRA 2J0SA 4NBAA 4TKUB 4LZAA 3EARA 4IJQA 1GSIA 4PFQA 1ZR2A 1U2TA 5TGTA 4CMJA 3K71B 3I8XA 4AECA 2OZEA 3LL4A 4HDMA 1JWAB 1L4UA 4D82A 1F6BA 4PFKA 4RXUA 2ZR0A 1A2QA 2E4UA 1BC5A 1ZUNB 2B1JA 4D0NA 4P0TA 3KJXA 4DLXA 4PINA 5DOZA 3FTPA 3IIIA 4HLDA 2P0EA 3GNQA 3PNBA 2KE5A 3AKYA 4OYHA 3FI0A 3T12A 2R5WA 3RROA 3AU9A 2FG6C 3MUFA 4X62B 3R8FA 2DQ4A 2D62A 3AY3A 3EISA 1LV8A 5K0BA 4G1VA 4UU0A 4L74A 3AP3A 1OA1A 4YXFA 2CBGA 3T3GA 4EH1A 5LQCA 5BSFA 2WZCA 5ES4B 1AMNA 3FJ1A 4WOJA 2NUTB 2EFCB 3GTLI 2BOVA 1FE8A 1CNMA 1JJIA 4F9FA 1RHKA 2JGDB 3BL6A 2VJYA 3G8BA 3E5NA 1BFKA 4NYJR 4EX7A 4ZCIA 3M5CA 2Y2VA 3BXPA 1XRLA 1S3GA 1XRNA 5HTOA 2DPLA 2WZBA 4TL6A 4KVAA 4IJMA 4TN1A 1NW8A 2ZJ6A 2CXRA 3VMIA 1RRPA 4FEGA 1QHIA 3CN7A 3HR8A 5IVDA 4CQMA 1GRCA 3VSCA 3TUZC 1MAVA 1QBKC 1NXQA 4JODA 1JPJA 3Q41A 1O1YA 4ZQCB 4PSDA 3RADC 2NSHA 3B38A 4B44A 1N5LA 2VDLB 3TNFA 3EQZA 1NF9A 3NHMA 4HS9A 4Q6BA 4J7UA 4WEQA 2R60A 4L0MA 4DV4B 1YB7A 3CPSA 5FULA 1RVV1 2FRDC 4G81A 1I2BA 2VCYA 2WD8A 4G01B 2H7XA 4TT8A 4YCAA 5DM2A 3TX2A 3BC1A 3CY6A 3ZY5A 4QLOA 1O2DA 2QU7A 3NEAA 1RQNA 3L7JA 4BECA 1KNQA 4ZAFA 4ZTBA 3D6VA 4H3VA 3OH8A 4L5AA 5AOCA 3PNLA 1QH9A 4R8KA 4E6EA 1E9RA 3S7ZA 1IE3A 1BA2A 3BKXA 3PGLA 4DPLA 1PUXA 2A6PA 1K1EA 2AKYA 4DIMA 1NU8A 1PU2A 2I6TA 3FOZA 5DBFA 1VZ3A 5TRTA 4ZI3A 1FC0A 2ZBDA 2N75A 4RZXA 1Z2CA 3RRBA 1ORIA 1FB5A 4ZGWA 3RFXA 3JPWA 3KR1A 3I8OA 3K2BA 1OXVA 1RXUA 3MT8A 1QIEA 2X7HA 3ROMA 2X6RA 4DCVA 4ZO6A 1IHPA 1WMBA 3FOFC 3AY7A 4REQA 4ZYZA 5F2OA 1GA4A 4UMVA 3LPNA 1JIJA 3UCFA 5CITA 2X8JA 1Q22A 5ENZA 3DCNA 4V1CA 1YA6A 10MHA 1H9AA 5ALIA 1Z4NA 3IPCA 4GQAA 2BL4A 3HCCA 4K28A 4A8JB 4E7OA 1A9OA 1HQYE 3H2SA 4FEAA 3IAFA 4GOOD 2X1MA 1VPWA 2FSVA 1SG0A 3R3WA 4OLJA 4RDCA 2QJFA 5DBOA 3L6OO 3RUPA 4JEUA 5L53A 3FMOB 4OHMA 3MQ4A 4IXNA 1V1JA 3VMMA 2WQ7A 2C54A 2HLPA 5U4XA 2ZRMA 3VR2A 3T1YB 4HWKA 1USWA 1M75A 1T91A 4Y1EA 1ZHOA 1IY1A 2QRPA 5ALWA 4G5SA 3LYHA 1Y3IA 1YBAA 5CB0A 3SKXA 4RZQA 1IM5A 4HNHA 2FQYA 4YTEA 3PQ2A 3N07A 4UHBA 1EGAA 1KIAA 4Q9LA 1X3LA 1XCPA 4RKFA 1HR0B 4TVKA 1CUDA 3ZJUA 1ZSVA 3KEQA 1ZUNA 2A0YA 2Q3HA 2W6PA 3W9SA 2JI7A 3MWDB 1A9PA 3EWIA 5T4EA 2I1QA 2NO1A 5IVHA 1SB8A 1R6UA 2HMSA 3O3CA 4UXJA 3I64A 1SC4A 1E9CA 4F8JA 5BYKA 1X7HA 5TVGA 3ZDFA 2XAUA 5DHSA 2EKPA 5HKOA 2P9CA 3F3YA 4MINA 4C7OB 5KKNB 1Q91A 4A0QA 4DMKA 4LX0A 2JNWA 3BMQA 1YB2A 4CEIB 1A95A 4J3JA 1PO7A 4MDYA 1UANA 4N8DA 1JVBA 1V1RA 3HQ4O 2NUTA 2AG1A 4TQUS 1FBTA 3E4DA 3ZZ0A 3A9VA 2QR5A 4DY4A 5C8DA 2ZIFA 3G9UA 2PSDA 3KWLA 4D9KA 2QAIA 5THQA 1DQPA 3I76A 1QRAA 2GPNA 1ILWA 3H5LA 4Y6PA 1MFZA 1QP4A 2II6A 2D0PB 4UULA 4JHXA 4KQCA 1EYZA 1NFFA 4ZP1A 3IP8A 3O47A 3O9VA 1GPWB 1UFOA 3I42A 4N12A 4O4LF 1PR9A 2VDQB 3I9V1 5HGJA 3RJMA 4B75A 3EIOA 4BRZA 1FP4A 5K2OA 1RWOA 2YYSA 3L0YA 4GYYA 4IXTA 1E9SA 5DI3A 2G1UA 1LTQA 1ZGZA 1E7QA 1G5RA 2C88A 2VNHA 2WYWA 2ZWAA 3ADPA 4PE5B 3TZBA 1UF9A 2DEUA 5IAJA 1JSCA 1XOIA 2QRQA 2WIKA 2GBGA 4OB7A 3SJ7A 2HJ9A 4DCSA 4Y18A 1RTKA 1OLXB 2GA9A 1D2AA 2NVTI 2PV0A 3AHIA 1LZLA 4HWOA 4LVUA 1VQ91 4FKMA 4XUGB 4YDRA 1BJTA 4R1NA 3T3MB 5BWNA 4KUEA 5HOEA 5KTOA 3HKEB 2ZB4A 4JP2A 5TS2A 2FFJA 1WHTB 3GUZA 4EG7A 5JJCA 2HWKA 3BD8A 4F1JA 1ZMXA 2O8EB 3B1VA 1Q2UA 3CPHA 2VQDA 3ADKA 3RU3A 3R6WA 5TMEA 5JEEA 3WKBA 4XARA 2I1VB 4JELA 3GXBA 1L1EA 1G16A 4EGSA 2ZBUA 2WY2D 4WESB 3NJRA 1SPBS 2HKIA 3G13A 3TIXB 1D7OA 5LNK6 1VG0B 4R2IA 4L16A 2BCJQ 4ZOLA 4E5PA 2LRHA 3AFNA 4N4AA 4U7JA 1UT6A 1Z16A 2ILVA 3GRAA 4MVJH 3FRHA 1PWYE 3ABIA 2ZYSA 3P9XA 2CLEB 3PYXA 3RQSA 5CTAA 4CFSA 2FK8A 2GI4A 4U5XA 3K2IA 5IASA 4FEYA 3INNA 5H1YA 3IOCA 3S4YA 1U9IA 3FPBA 3C8MA 1A5ZA 2OBMA 2PUJA 5HDBB 3JD0A 3X3HA 2QLBA 1JI3A 4FUQA 4O4IB 5DSXA 2DC1A 1OLUB 1NVFA 3LS2A 4Q7MB 3K8ZA 1PZEA 1QOQB 2C7RA 4LOAA 3FLMA 4FFDA 3UV6A 3KP1A 1ZQ1A 1MVLA 3A26A 4M8IA 5FTKA 5JO0A 5EPOA 4RULA 3UAGA 4B31A 4EMUA 4MRMB 4A92A 1H2ZA 1QO0A 4M49A 4RJTA 1SOWA 4BLSA 2B35A 3T5CA 3L7AA 3I73A 4WZBA 1V3QE 3NGXA 1DKLA 1ML3A 1NVEA 4JBIA 5SYMA 3GLUA 4DREA 1SIUA 1RZRD 3EZ7A 1JLKA 1QTIA 2JEYA 2HC9A 4YY3B 2ZJ8A 1C0IA 2HHCA 1DRUA 2VNIA 3MWDA 2ID7A 1F4VA 4L85A 1VQ4Z 1UZUA 2XMSA 3T1QA 3H42B 3BDIA 4NJEB 3RVLA 1XTBA 4PG8A 5C1PA 5IHXA 3L1KA 5LWHA 2H54A 3R9XB 2B7CA 4CLOB 2UXDB 4J49A 2QTLA 1DU4A 1WW8A 1UZLA 3MNFA 5EE9A 3MRVA 3CCQ1 1Q1AA 2AA3A 1GA1A 4LS3A 4W1RA 3IURA 4PLZA 1C8LA 1IONA 3HN6A 1M8PA 4C6HA 3WHKA 1GYPA 1TCCA 1HXHA 1N2GA 3P2IA 5A62A 1NVXQ 3ZE1B 1U04A 4B3HA 2PM8A 3FX2A 2BFNA 4HWSA 4EGCB 2FJPA 4E70A 4HQ6A 4YAEA 2YZGA 3TAUA 4DR5B 1W87A 1KBQA 4BVAA 1QGDA 3QE2A 5I5GA 5JWOA 2VPZA 1PR6A 4KNYA 1UK8A 3FJYA 4FDVA 3TL2A 1PL8A 1NLZA 4MWZA 4HH3C 1ZOIA 1D9ZA 3DMFA 4L27A 7AT1A 1GQQA 1FDTA 3EBPA 3OE7A 2C7PA 3SHQA 2H6EA 2QUIA 1G8MA 4TS4A 5IDQA 4NWIA 3O73A 4DANA 2E82A 3H99A 1RWPA 2C2XA 3IPAA 4TTAA 4YLEA 5BMOA 5BOSA 3TECE 1Q7CA 1KQOA 5I7EA 4WECA 2I8AA 1TYZA 4J6FA 3WWZA 2JD2A 3RWMB 3DE0X 1DIOB 4B83A 5JQWA 2G08A 3CLUD 3JR7A 3LHFA 4URUR 3PJGA 2DQYA 3ZDYB 1ISIA 4KVGA 1NN0A 3PWKA 1UR5A 5U9CA 1FP7A 1TAGA 2G5GX 3VOSA 2GEFA 5B3AA 4URVR 2O8EA 1UMDB 4QPCA 1FSFA 1Z35A 2J31A 3RQIA 5JANA 4HNTA 2YWCA 4DSAA 1JWLA 4NNJA 2MSKA 5DI9A 3VR0A 1TQ6A 3PGKA 4R5MA 2EHDA 1ZGJA 2WVAA 1YR8A 2QEQA 1N0IA 2Y6VA 4NZOA 1RDFA 3A1WA 2I4RA 1H8ED 1W52X 3QLEA 4QHYA 4LV5B 4MJLA 3W7VA 5KJ1A 3KNZA 3KFVA 4DAEA 2CD9A 5HKLA 2FXVA 4ZREA 3S81A 3G1WA 3ZVRA 2BEVA 3DNFA 2QAJA 4KDEA 1OXKB 2ICAA 1EVYA 3CVJA 3ZQKA 6REQA 3B53X 3OEHA 2ZYHA 4IM7A 4HNVA 3AEKA 4GS5A 5LYJB 2VSXA 2ID9A 2PSJA 1GLVA 4OSPA 3L06A 1OLUA 4JFRA 4OHKA 1Y3CE 3RJ5A 1AGNA 4R1SA 3CONA 4CMIB 5JASA 1V95A 1CS0B 1NFQA 2BKAA 2NXNA 3PHJA 1UZAA 4KX5A 4O25A 4DFDA 2D13A 3RUDA 4E5VA 5JAQA 4PONA 1B3RA 1CETA 3P0JA 5AI5A 4W1SA 4D8UA 3WAJA 4A7PA 2R62A 5FHRA 1UJCA 4E3ZA 4OGFA 5GGXA 1FJHA 3JW8A 4MS4B 2OUKA 2X0KA 3ESDA 2XE7A 4QPNA 3MF4A 2PLWA 4FGUA 2JIPA 2BBTA 2VPQA 3MJDA 4RIGA 1S02A 4Y1FA 5LPNA 1W49A 4U7GA 4UDYX 5K3BA 4YQFA 2ZRDA 1PJAA 1Q0LA 3AVPA 3OFND 2XUZA 3SK0A 4DDVA 1JAIA 2NZ8A 2R6CA 3ZU2A 4FFBB 4LRQA 1Y7TA 4D2IA 5K1ZA 3JQAB 1NVUQ 2DTDA 3GTKI 2PCLA 5JWRA 2IP1A 1NPDA 3MBIA 3RRMA 2B3TA 2GCNA 4WX2B 1YDEA 2KBEA 1GG8A 3QEMA 3VKHA 1P6QA 3MBKA 4DDMA 4JENA 4A3EI 1KY4A 3LX4A 3RUAA 1IUPA 2C7VA 3WWDA 3AF2A 4EO4A 4TS1A 1J2JA 2BLNA 4NMHA 3PRKE 4NOMA 1Y8QB 4B6FA 3O4GA 1U4SA 1N4AA 5E6SA 2O0JA 2V6IA 4EFLA 5AW2A 2KPOA 3I5AA 3AXTA 1CUXA 4B7AA 1W5EA 2I87A 2AEFA 2JLSA 2ST1A 4QXMA 1MJHA 1O94C 4MP8A 1N34B 4MHOA 2OUIA 3UGTA 4FGSA 2FSUA 3NASA 4ETIA 2QROA 2E55A 3H5AA 2OK8A 2XV1A 5EEHA 3FBWA 1D1QA 4MYRA 1DNPA 1R7RA 5JNTA 4GEKA 1OFUX 3L6UA 5KOIA 3I5UA 1JIVA 1QG0A 2FW7A 1HK7A 2FF7A 3KT3A 3RRYA 4EY7A 2C7GA 3IMEA 2J87A 2PWYA 5F3WB 3T0GA 4BL5A 2JL1A 1BYIA 4DCOA 3NTOA 2W00A 3QTLA 1XHEA 2XITA 5FUXA 1L5KA 2HSWA 5BSVA 5CHEA 3RZDI 2IKQA 1X7WA 3HVRA 1A4IA 2FQWA 5KNDD 1YDMA 2Z57A 3GGSA 4JASB 2EERA 1DBSA 4OBWA 3D4BA 1YB1A 1SRQA 1G9SA 3NP7A 3BB4A 4LY9A 1X2BA 5K2MA 1CPYA 1PEYA 3DQPA 4OTZA 5MGNA 4G85A 2AUNA 1ZI9A 3LUGA 4ZYWA 1SXPA 3FN4A 3RVKA 4H18A 3C1AA 3BF7A 3UNXA 4N9QA 1XROA 3PXXA 4AKSA 2H1OA 1NBMD 1ZZEA 1J2UA 5DTIA 5BN3B 5CVCA 5I4IA 5DK4A 1IBMB 1LQTA 2MHCA 2NP7A 3GCGA 4C07A 2FFQA 3AL0C 2ZI6A 3ZUPA 1XWWA 3A58B 4GMHA 3UJ9A 4MGYR 5B7PA 5IEBA 1SBQA 4RMJA 5D85A 3V4ZA 4DUPA 1U3FA 5KWEA 2W93A 2P28A 1RKXA 4QU8A 5DWDA 5LYJA 1RYZA 2HQ1A 3JAKB 3SVLA 3PNPA 4CMIA 4Q05A 2IHBA 3ZV6A 1MZVA 5FYQA 1CS0A 3B85A 4E1VA 1XNJA 4Z4GA 1GUFA 4D74A 5HVNA 4Y9DA 1IXYA 1PW7A 3RHSA 4PV7A 2AEJA 4EFKA 1U6JA 2G8NA 2YVLA 4BKPA 2VQ6A 2FN7A 3PUXA 2FQQA 3BILA 3FNGA 2X7XA 4MS4A 5JV5A 3NHKA 2QBYB 3KELA 3DT9A 4ZQBA 1GEGA 4IJ5A 2I65A 3BCUA 3H8VA 4JDPA 4A8HA 1PL0A 4MVJI 1CQZA 2JKVA 3C4QA 2HCBA 4QUIA 1DL5A 1FK8A 1H2EA 1KDOA 1QFMA 1TQ8A 4J91A 4N39A 1BYUA 3C3EA 3MGBA 3ZNOA 4BJ6A 4ZYYA 1J07A 1EP3B 5E9JA 3V8VA 3S8YA 1E3SA 2I99A 3IIKA 3GDFA 4FFBA 1TLTA 3QKIA 4Q3OA 5AKHA 5FWYB 1U0FA 1A8HA 3ICEA 1XXLA 4JVOA 4KACA 1AKMA 3M6MD 5T5QA 4G23A 2AMJA 4MIYA 5DV9A 1T9KA 2IY8A 1RKUA 5ADWA 1USPB 5KNBA 1MMFB 4PCAA 1ZONA 4DK1A 2WWIA 3X2FA 2FEMA 4MQ5A 2P8SA 3GK3A 3E2MA 3QVOA 4YJ3B 4KEAA 3PYLA 4FHDA 3RC2A 1Y8QA 4EDFA 1E2LA 1MW9X 1EWVA 5D3KA 5CA0F 4LC9A 4R9NA 4D80A 2VP2A 2PWZA 1NQOA 1EUCA 1UOQA 2RIQA 3K0FA 3CWZA 1X80B 4C3OB 4LZWA 5CB8A 4I6GA 2IJGX 3MW8A 3Q0TA 1X38A 5CD1A 2VJDA 1VGVA 5CNKA 1JR3E 3HSSA 5FORA 3JQEA 1GPAA 3T94A 3CLTC 5NULA 2PUGA 2ZXEA 4JY7A 4PC7A 3KLOA 3WK7A 4XGNA 4KHZA 3OEED 1KXZA 3WLNA 2PLRA 4TMFA 4V2UA 4DM3A 5K45A 3L8FA 3SD7A 2X8LA 3A9CA 4D9CA 1XZJA 5C1BA 1N77A 1Z2NX 4ENPA 4QGFA 1YUBA 4D92A 1M902 4YQEA 3THWA 1ISGA 1DOAA 5FTWA 4PSKA 3ZH2A 2O8DA 3ILHA 4TM7A 2FPLA 2WWHA 1F06A 1P18A 4HWRA 1X3WA 5FFMA 3ITDA 2X0EA 1MOPA 1W5SA 2E4AA 3HA3A 4TTJA 2OL4A 1LEHA 3HGTA 3E3AA 3GRPA 1OH8A 4LEIA 1IHDA 2ZI9A 5IJ0B 4PVDA 4AJPA 1P45A 3N2YA 1U9JA 4HS4A 1VTKA 3VVLA 5BV8A 4GWLA 2A9FA 5BN3A 4LMAA 1PEAA 3WIVA 2VQ3A 3ESZA 2WPNA 3AKEA 2B99A 5JD6A 5L3VA 1R37A 3THXB 2EFJA 2HSEA 4ZYVA 3SSAA 1W5FA 1W5TA 4L5YA 1BDJA 3KZVA 3QWBA 1YZNA 4AIIA 1U1GA 3UA3A 2Q07A 1MG0A 4TV8F 3P9CA 4B9EA 2WAMA 3AU8A 2PZEA 3D3JA 4LTDA 4PR0A 1E96A 1Q7RA 2WP8J 3EFOB 3MVEA 5F1YA 1ZD1A 5G3ZA 1TM5E 3C74A 4K6OA 5I8PA 3R3VA 4KAAA 1NF2A 3UJPA 1T9HA 2B4AA 2J9FB 4N3CA 3NFYA 4P4UA 2NVXI 1PJRA 3HK2A 3PPVA 2BEUA 2XNDA 2YJZA 4QREA 1G2OA 1CR0A 1M34A 4RY0A 1DAFA 5LA6F 1GGJA 1W19A 5CVDA 5D6NA 4YX9A 2JLBA 2VOJA 4KK4A 3EGDA 3TD6A 4BO3A 1T3SA 3JQBC 3GTPI 3BREA 5HBRA 5B37A 1JXQA 1QLWA 2OG1A 3OTWA 4R81A 1QWOA 4UHFA 1Q95A 1YZUA 2JKYA 4RKYA 1BS1A 4ZT5A 4EIWA 4ENTA 4TTRA 1U0HC 1XHFA 3CKLA 4BX2A 1CS4C 5TMPA 4NF2A 3CO5A 3WWYA 5D3ZA 4JGBA 3VM6A 3G3EA 4A0GA 4BZQA 5FWYA 1X0VA 1GQYA 2IHUA 1YIAA 1EVLA 2JLCA 2C98A 4IVRA 3IESA 1FA9A 2A0XA 3T7DA 1P2BA 5JDCA 4NZ9A 1ZISA 1UKAA 1NVAA 2QP4A 3TGLA 1R8SA 4BFVA 3OX4A 2WM9B 3W4JA 1VQ1A 2IBSA 2XGJA 4YJ3A 1F17A 3RHTA 4E6PA 5BMVA 4I1UA 4B5KA 5HSGA 3CRVA 3RREA 2EEZA 4G1UC 1ACMA 4BGDA 4RVNA 3LT4A 2F3SA 3L0SA 2L18A 1JMYA 2NVOA 3CN9A 1X80A 2CLOB 2XUJA 3PC8C 2HMTA 4YT2A 1FPMA 1GKIA 1K7EB 2I1WA 1Q50A 3VRHA 4II2A 5M29A 1CTQA 1L4GA 1T2VA 1Z08A 2GRAA 2MMGA 3DBIA 3PS9A 4ZRDA 5DGTA 3TB4A 1E1RD 1R9JA 4KYUA 4P2GA 1LS6A 1QDLB 2X5OA 3A06A 4DWOA 1XYGA 3QRWA 2F1HA 4FEEA 3D7MA 4R7TA 3KYDA 3MCAA 2ZAEB 3KDSE 2XVZA 5H0IA 2ORYA 1V11A 1PL7A 1Z9BA 2FFRA 2GLXA 4P1ZA 4BNXA 2QN2A 4ZDIA 1O96B 1H6AA 1T5LA 2GTHA 3DFZA 1VQOZ 4ZI2A 4F46A 5T8KC 4ND4A 2JANA 3H3XA 5AI8A 4XDHA 2EGGA 2LGJA 2OBFA 3EDCA 4LBYA 2R4UA 3QUCA 5JR3A 5CR9A 4MRAA 2EYQA 4LQDA 1XVLA 3ESXA 3U40A 2W42A 1OWMA 2D2EA 2QRNA 2JJYA 2VDOB 3O83A 4L8WB 1YZQA 4C0XA 4C7BA 1JFRA 1RBYA 4WLUA 1M33A 2D54A 1TW3A 1QKJA 1SHTX 2VZEA 1QFYA 2AKAB 2HK9A 2P2CA 2IV2X 1CIPA 4RH3A 4XUEA 3VAAA 2P7HA 4YI5A 2QTHA 3NWBA 2JFXA 2I7VA 2EF0A 2Q1SA 4MYSA 4G4IA 4E2XA 2XYQA 3W78A 1KVRA 1MRZA 4WNCA 4YALA 1HOTA 3BSWA 3IPRA 5K8UA 3THXA 2VDNB 3H7IA 3MSCA 2XQJA 5EXSA 1QYCA 2K4MA 1HSZA 5IJAA 2HIMA 5AMXA 4RTQA 3PT9A 1ZQ9A 3OQ1A 1Q0QA 1YZVA 4G6ZA 4G1BA 1W36C 4HOYA 4LFBB 2QYOA 1OREA 3EFOA 3MIIA 3HOUI 3AEZA 1V39A 2Z3WA 2EZ8A 3TW4A 4GEGA 2OFXA 2P69A 4K86A 1FEZA 3IDFA 1NJI1 4MW1A 4NFLA 1QZTA 3PCTA 2I78A 3MJEA 4IO1A 4PFSA 3EC2A 4F3YA 1NMYA 2Q4RA 4RMGA 4MKRA 4B6QA 1OY1A 1OVMA 3DOJA 3N58A 4YAJA 2KJQA 5ELMA 1DX6A 3FYUA 3ECCA 1Z7GA 5DGXA 2CLLB 4DBLE 4Z4HA 1OV4A 4TXLA 3EGXB 4BKOA 1FTYA 2ENUA 2Z2KA 1EFVB 5HXAA 5IAOA 1AURA 5DXFA 2VDVE 2XUFA 2E4ZA 4XA8A 1G8SA 4E5KA 3EG9B 4FFLA 4JYZA 2B83A 3G82C 3NIBA 2VBFA 1US8A 2C1EA 1KWKA 4IPTA 3N2GB 1NR5A 4EABA 2O3TA 3M4JA 1CZRA 1QHGA 1W73A 2OOSA 3Q0IA 4IEFB 4K9QA 5G0SA 3WGNA 4CNQA 1HDCA 3GWGA 4M4SA 4ZHSA 1YJ9Z 4GPD1 5JRJA 1TEXA 1UBLS 4KG7A 3QIAA 4OD0A 4FOLA 4KAXA 2F62A 4LY6A 3GEEA 4IUBS 5H7XA 1SFRA 1T6NA 3AR6A 3GD5A 4UD6A 4IHJB 3BIJA 2DTEA 4K9PA 5IXYA 1T0JB 2JC3A 2QVXX 1HE2A 3BTVA 3OIDA 1RYMA 1CG6A 1PKEA 4GVXA 1KI9A 1SEPA 3KM0A 5ERGB 4AWAA 5KPJA 1PT8A 3A04A 2XB6A 4AXXA 3WBJA 3EY9A 4OFXA 1DO2A 4I55A 2R86A 4LZZA 1KDYA 4ZRMA 5JAMA 1NUIA 2J0EA 3HBFA 1UEJA 2H31A 3V4PB 3WK8A 4CM6A 4E0BA 3W3AA 4CXMA 3C3WA 5DN6A 3UHPA 4EG6A 4ESHA 5ESRA 1F4LA 2QTWB 1T0HB 2XEXA 2R97A 4QFDA 4ZAGA 1MF7A 3VYWA 4QOSA 2QEX1 3DE5X 2EBFX 3R0IA 3LTEA 4XSHA 1QF8A 1HG0A 1XWIA 3ND6A 1ZVMA 2A0UA 1WSDA 4KPGA 3L79A 3BWCA 2ZSHA 3LY5A 2B94A 4CFYA 5BVHB 3PHBE 4F12A 4KO8A 4N41A 1G7SA 3LUFA 4J29A 3GL9A 3HCRA 3CH4B 3ZGOA 1FNSA 5AVRA 1O96A 4H3HB 1CUZA 1WB4A 4HLUA 4ER6A 3TRHA 1E1CB 1DTEA 3DP9A 1FQJA 1CX9B 4OBEA 3FCEA 3JALA 4U39A 4TS9A 4YGXB 1TYEB 1M6EX 3FOWA 5DYWA 2COEA 3LJKA 3FTCA 4TT3D 4BNZA 2VYND 4AJIA 3A25A 2IYQA 1AU9A 2K2WA 2CXSA 2VNSA 3BD7A 2Z1DA 3RC1A 3RSSA 3KKMA 4EB6B 3L0PA 4CTJA 1R6BX 3RF7A 1P7ZA 5A4KA 4HAVA 3G2QA 1USIA 1WKVA 2FF5A 4BTEA 4PO8A 5I51A 4LZPA 1JE0A 1C9EA 1SCUA 3T38A 4BO7A 3IUEA 4G65A 3Q3CA 1NURA 1T2CA 1ADBA 1V6AA 3NU1A 2VUSA 1AKVA 3QI2A 3E58A 3L6DA 5B3LA 3PGJA 1R5JA 1TNDA 3K2QA 1I10A 1UWLA 2B1RA 3LY7A 4J07A 4K9RA 1ZA2A 1MO5A 1J25A 4IIHA 5IWAB 1N1EA 3ASZA 3ZI7A 2D7DA 1QAOA 5EGSA 4Z9YA 3QBJA 4S1NA 1TJNA 1FYEA 1KPHA 1MXHA 3A1TA 1M2EA 4LRUA 2C3PA 3GIDA 5FO0A 4TWBA 2SICE 3RGGA 1F0PA 2CNWA 1GZUA 3I2IA 3PNQA 5ECWA 5LP1A 3CUEF 4A3DI 2PQ6A 3COZA 4OMFG 4I4TA 3LBIA 2OV3A 1JG7A 2BDUA 2P6PA 3CNQS 3S28A 3G5UA 4L4RA 3TR0A 2QYHA 4ARUA 4XWOA 4A3BI 1XAJA 1XCOA 1ORDA 2RGCA 5LZ7A 2PKRA 3WLAA 1ULHA 5ALDA 1S8FA 3LLUA 2SKDA 1RFLA 1VKNA 1VE6A 5KSOA 1SUIA 3EG9A 5G2OA 5C7YA 1QG4A 2IFTA 2O50A 2JCSA 3PVCA 4MW9A 5EUQB 1UMBB 2OOXB 2H4YA 1X3SA 2VHCA 2JGEA 2FH5B 4M9ZA 3FTEA 4DW8A 1NVVQ 1DDIA 3OQ6A 3R1IA 4ZOCA 4I4LA 3BQMB 4DYDA 3LZCA 3U6KA 2CLCX 2NQ2C 2OXCA 2PS1A 1X0TA 3GH1A 5H3LA 2CYCA 3T3IA 1F60A 2GM4A 2VR1A 2QUHA 2QTBA 3L7YA 4IHJA 2G0TA 2GTIA 1YS2X 1S1CA 3H18A 4J3NA 3E9ZA 4L7QA 4FHGA 1EM8A 3LGAA 1DIRA 2XWSA 3VC3A 3TUIC 3WAKA 1O6CA 1SZJG 2C3YA 4IHAA 4F5EA 2OTJ1 1XF1A 1HDXA 2G3YA 2J9RA 4HXYA 4LA4A 3VKGA 4P7FA 3U1VA 3H2HA 3EH2A 9ATCA 4EUKA 4J9VA 5FF9A 1FMCA 2BC9A 3PC7A 3QYFA 2WUFA 1SUWA 2B7LA 5EJMA 3VR1A 1VL8A 1ATIA 1YIJ1 1H1LB 3R3UA 3KLNA 4OU5A 4W9NC 3U7EB 3SWWA 3ORHA 5BQPA 4X66B 5DCUA 1MQ9A 5KYNA 4HFRA 1XE3A 1JILA 3EC7A 4ZVKA 2W2KB 1WCIB 4ARBA 3GPDG 1Y4ZA 5LP6A 3TTUA 5JDIC 3N8NA 3NI2A 2WYOA 1AKWA 3HYSA 5HEKA 1WXHA 5IYZB 1PVDA 2G1AA 3U3OA 3PDUA 4CEJB 2PR7A 2PEYA 1IWOA 4BQIA 1YQDA 3ELWA 4DSUA 4YRGA 3HV2A 1IH8A 1SVSA 4IILA 4XLLA 1FZQA 4LJLA 4OYLA 1VDMA 1Q1BA 3ROGA 4P0PB 3QGMA 4E4RA 2DU8A 1D9XA 4KXFB 3H13A 4LMBA 1LVGA 1W8IA 2HA5A 4B6GA 4EELA 2A8YA 1MENA 2KB0A 3PI6A 1Z5OA 4IW3B 2FMIA 2QTRA 3D9XA 1M2VB 3QYPA 4QBKA 3IE2A 4AN1A 4EB6A 4QM7A 1MABB 3L41A 3MXTA 3LVRE 3U7JA 2CW5A 4HVLA 1J4AA 1XZIA 2QQ5A 4LBWA 2D59A 1N2CE 5EHZA 4CT4B 1Q7BA 4ND3A 3ZWBA 1FFEA 3T7IA 5EERA 1P9NA 2YTZA 1LLQA 1OC4A 3HP7A 4LTMA 4Q82A 4ZT4A 5DNUA 3PDIB 2JFNA 2OM2A 5E4TA 5DN9A 5C3UA 1K8A2 5F51A 4DJDC 1KRLA 4GHWA 1IDN1 1TVMA 2QMUA 3IO5A 4MWDA 2VT2A 4OOFA 3M7IA 1VDZA 1A7KA 4K6MA 5J58A 4QYIA 1CWUA 3G2MA 4KMMA 3RUIA 1G2PA 3J81A 3KKEA 5HRAA 2GBFA 1IZ7A 4CN8A 3QELA 3R9WA 4KRXA 1NQVA 4KFUA 3NZEA 2WJ4A 1MB2A 4ON9A 2O59A 2BHNA 1LNSA 3BWEA 3R0ZA 3TSWA 1RI4A 4S1TA 1ADJA 3LVFO 1CJKC 3MPOA 3QOXA 4WVFA 3R5XA 1OYWA 4UHKA 1S721 2V97A 2BKEA 1HZZC 4KNWA 3HE3A 2GZ3A 1DBQA 5AXCA 3KO8A 1ZB9A 4X90A 3T7EA 1ECLA 3DBRB 4D1YA 1QE0A 2XVAA 2I2WA 3AVQA 4WXHA 3JR3A 4G56A 3K0CA 5H9WA 1CQIA 1PZFA 2NQ8A 4ZJPA 2I4NA 2PLNA 3STHA 4AZ0A 2PN1A 2I7XA 4MLDA 4NOJA 4MKFA 1UDAA 4GPAA 2BW0A 2C1XA 3ETCA 3TM4A 1SKUA 3P2YA 1ULAA 2YXDA 3I72A 3T3HA 1Q2XA 1IQRA 3QH4A 4HR7A 4ARZA 2SHKA 4IICA 3DE4X 1JR3D 9GPBA 1N57A 3IP9A 3NKLA 3OKAA 4TWJA 3HFSA 2YHBA 2QGNA 2PBLA 3CRQA 5REQB 4LQ4A 3EDRA 1G8YA 3MTDA 1Q14A 2DOKA 3QPDA 2NZWA 4PQRA 4QDKA 3RAFC 1HTTA 2RK6A 3RO7A 3R9IA 1ZH8A 1P1IA 3D4NA 4IIEA 4O2AF 4TWZA 3PA6A 1I5EA 1XALA 2PX6A 4JR0A 1SRRA 1WBJB 3B9BA 4AP9A 5E2IA 4XGRA 2WAXA 3SFVA 2X7JA 4IZOA 5A4IS 4PCVA 2YJ5A 3EXAA 3SHFA 3ESWA 2CV0A 3DA8A 2HCTA 1KFCB 4S2EA 4X8OA 3UC5A 2EW2A 4UTOA 1RAIA 2FP3A 2Q4TA 5WRFA 5TE9A 3DE1X 4ZIRB 1WBBA 4KIWA 2AOTB 1GPDG 3KCQA 1MJGM 1RXCA 3UV7A 1LWNA 4CEJA 3O03A 3L6CA 1EK2A 2Q29A 2V4MA 3DGFC 4TLCA 4WWHA 4FR0A 1RRVA 3EPRA 1C9MA 1BE1A 2LCIA 2QT9A 4WH0A 1NOJA 3SNKA 1FIUA 1O8BA 2H07A 2XVYA 2OWEA 3WLEA 3U7FB 1FQOA 2YWJA 4JX8A 2R48A 3GCXA 1QKKA 3WLLA 3NRCA 1Y1PA 1NSTA 4YMGA 1RPNA 4RNCA 5AK4A 1XL0A 1QRDA 1Q12A 1NONA 2W7TA 5D84A 5DW3A 1ZGCA 3UMMA 4MVCA 1EVEA 1Z5PA 3VSDA 4NBTA 3PQ7A 1WRBA 3NIDB 4LOLA 2Q8PA 2QE7D 4BB9A 3E9NA 2NX2A 3VPSA 2ZIAA 2GBLC 3E15A 3GFRA 3IUMA 3LDAA 4ISCA 5F4ZA 1H93A 4AUEA 1OGYA 4PZ0A 1OWPA 4L22A 4RACA 1AGRA 1M83A 1O4VA 1WV0A 2Y6UA 3HWSA 1FSPA 2DPYA 3KVVA 3QBDA 1TM4E 2F8MA 1S2IA 3CMAZ 1VE9A 1Z0AA 2FRDA 3JWIA 4FX2A 4Q4LA 4WE3A 3RHFA 4QHSA 3GJ0A 3H9EO 4QGHA 1DKRA 5EMNA 3LGXA 3OURA 1FNNA 1JTFA 3D5EA 4MB2A 4C30A 4Z99A 2CNNA 3VGPA 4BU0A 4E3WA 5LXTA 3AR7A 4F6LA 1PJQA 1OKKD 1G0NA 1SB9A 3R7DA 4UMEA 3KSMA 1ISFA 1JG4A 2GN6A 2NO9A 2P5YA 4JMLA 5EZYF 3P7MA 4GI7A 3UUGA 5CDGA 6YASA 4Q9DA 1M1NA 3ETEA 1HF3A 4EO9A 5LLTA 4N0QA 3L5OA 1WABA 4GYKA 4GDMA 2AG5A 2KS6A 1MD9A 1U7XA 2HAEA 3ZBTA 4FMPA 4GC9A 4PN7A 4CIAA 2G04A 3I2JA 3ED1A 2W2OA 3GEPA 3HFGA 2C9CA 2Q2NA 2RARA 2FOLA 3OAAA 2PT5A 2E2HI 4DA4A 4FVTA 2DQKA 2ALJA 3FJOA 4PYQA 3EIHA 2DHEA 3KZOA 4IDEA 4XD2A 1RWQA 2HR1A 2A14A 1TWCI 3AP1A 4Z0NA 3CCEZ 2W6MA 3OECA 5JG7A 4DLKA 3C4JA 2B8EA 4PYIA 4A16A 1NXWA 1JKMA 4HB0A 1Z6YA 4GYWA 4EI7A 4KI0A 1F3OA 3CG0A 2B21A 4Y2UA 3CLUC 4RKWA 2ODEA 4IWNA 5H68A 1SOVA 3BH0A 4B0PA 1U81A 2FE1A 4B3GA 4UVHA 1ES9A 2DY0A 3TLMA 4D6PA 4BMOB 4ZFNA 2OGTA 1GN9A 1QG2A 4BO5A 4YJFB 1NNSA 5A0TA 1H1TA 3G711 5ALJA 2MU1A 2YHUA 5C0OE 2IS1A 5REQA 1OXXK 3MILA 4KXYA 3GKQA 4TMTA 5JXWA 4LHYA 1GZDA 5IAEA 3C2QA 1AF7A 2Q9AA 4LC0A 2QA4Z 2J30A 1C3JA 3X44A 4JOQA 1W85B 4CQJA 4L4XA 2NTYC 5JD5A 3I62A 1SIWA 2IYTA 3IDOA 4CIBA 2FN9A 2JHPA 2BEWB 2NG1A 1QQTA 3NOXA 4Y0AA 4AAYA 3HBLA 5HILA 4X60A 2J3HA 2C83A 2VP0A 5CB4B 2XMPA 3NT2A 3EEIA 4MQ6A 1ZMTA 1W4AA 1DZ3A 3ULKA 3G49A 2JAPA 4WJLA 2EJUA 3K8YA 4AYTA 3SS9X 4HLNA 4WXMA 5J3JA 2ZQYA 3WJ1A 4ZIRA 2IDJA 5GGYA 4B4WA 2O1WA 1OJ7A 2H0QA 5CLFA 4B5LA 2RIRA 2J0VA 3ZWMA 3L4KA 1VHJA 1RRKA 4B2IA 2JJ2D 2ODTX 3OY2A 2Q3JA 4QIHA 4E11A 4JBLA 5JJBA 1Y1WI 1A4RA 4GR4A 1QGOA 2W2LD 3EULA 4EPRA 4IS3A 1LNZA 3KCNA 3SXPA 3WIBA 1LK5A 1Q5PA 1E9DA 1V3TA 5JSYA 1IY2A 2OV1A 1X1BA 1JEYB 3RYHB 4GMKA 1FRNA 1A4XA 2RJ3A 2WBLC 1FNMA 4ZALA 5KYTA 1FP6A 2W70A 4BMXA 2XNHA 4JEIA 1XD9A 4ZCLA 4KITB 4OA8A 2GDZA 2PX2A 2WIGA 3M4NA 1U90A 3Q6NA 2E7ZA 2AQKA 5KVSA 4HGOA 1ESZA 2FZKA 1OH5A 1J1ZA 4ZXFA 3TM5A 3BXEA 4BC1A 1FP2A 1K6MA 1W0KA 2NO0A 5LOVF 1DEOA 3UPTA 3R6DA 1ESDA 4BNMA 5MF6A 4BXOA 1VJGA 2A5GA 3K6RA 3NIGB 4I46A 3E5HA 4NAUA 5HFAA 5IFLA 1SD5A 4DNPA 3CIFA 2W6JD 3WOVA 2CZQA 2OECA 3WYGA 4F8EA 4YAGA 1GPJA 4Q18A 4M98A 5DH9A 4DXAA 1M5RA 4FXOA 5HM6A 3WLFA 1RP1A 2NV0A 1THZA 2ZIXA 4HD8A 421PA 3PUHA 3WLTA 1MG5A 3ZK9A 1LBHA 1L4EA 3AOGA 1LFAA 2BUAA 2YXLA 3DZCA 3PXUA 3M2TA 4CQLB 3JASB 3TLYA 4G0OA 4U1RA 2FPPB 3RSLA 2DSTA 1UKVY 3HU1A 2GBIA 4HEJA 3TAXA 2JK1A 4V0OA 4N5MA 1RLTA 3AESB 4FQ7A 4U2GA 4TTVA 2QI9F 3NV9A 4GXNA 3I34X 2P5SA 4IH4A 4MEBA 1LBIA 2JD0A 1NYQA 4AG3A 3UXEA 3VTFA 1QIJA 3QXGA 4L0DA 3QPWA 5CRIA 2GS9A 1PR5A 1VQLZ 3LX5A 4V2IA 4BB5A 3SQXA 1JQ3A 1NYRA 1YS7A 3T7CA 1G41A 5AVSA 1AV6A 2IS6A 4Y6QA 3D5QA 1RD4A 3PUIA 4CG3A 4HN9A 4YP9A 4RF2A 4BNVA 1PWXA 4MXDA 4JLNA 4FK8A 4HDSB 4NNOA 4G0XA 3FUUA 5H8WA 1F38A 4K03A 3DV0A 1GAJA 1L5WA 2HUPA 4P38A 3YASA 3MAGA 3CZ5A 4MULA 3GPBA 3U09A 4IAOA 2WIBA 1W85A 4UHHA 1SVOA 5AHRA 5IH7A 5MHTA 4AKHA 3L8EA 3LFUA 4XIJA 2BEWA 3R2JA 3O84A 3VOBA 3WK6A 1USKA 4B79A 2OD9A 1K27A 3PR3A 3O94A 4Q93A 1BRTA 1YL7A 2JDID 4I8XA 3IIEA 1XO1A 3DOCA 3K9HA 3PO2I 1DOZA 2WJIA 2ZUSA 2FSSA 3CF4A 4PFJA 1UL1X 4E08A 5JMWA 3KLPX 4P7GA 5FNVF 4FUTA 2R6HA 2QUJA 4MARA 5TEVA 3PE3A 3PVZA 5BR8B 1NBWB 3V9AA 2YWEA 3T9DA 3HNOA 1QYWA 2MTBA 1KMQA 1UDCA 1JDUA 1RRMA 2XCLA 3D0RA 3WBFA 1L2TA 3VAYA 2BKXA 3K0AB 5B30A 4CKWA 4H1VA 1YC2A 4LJ7A 1WKBA 3GFBA 3JYHA 4U9UA 5ALXA 1IEXA 5DGHA 2E49A 5DEIA 5F2NA 1KFKB 3KPYA 5E4FA 3SIRA 1X14A 3EZXA 4TMXA 5BQFA 1Z6XA 2HZ7A 3GMSA 5CX4A 1VJCA 2J67A 2Z2YA 5AP9A 4EGJA 4JBXA 1JJVA 2QLMA 1E69A 1C4WA 3PPWA 4M3NA 3WXMA 1I3CA 4RCYA 4YMTA 5ER9A 1I94B 4CUJA 4MV7A 4QTXA 5AN9F 2J6BA 2XKJE 1W1UA 5GIPE 5DK6A 1OOEA 2C07A 1ZN2A 2J1LA 3ABQB 4R0MA 3M9WA 1IFXA 1OAKA 3Q5GA 2Z1MA 2H2HA 4KKXB 2BR5A 2IHNA 4LJKA 2OR3A 1RYEA 2XMGA 1GZSA 2AE1A 1WSAA 3AMVA 3FRJA 3VPFA 1MEJA 2VAMA 3HU3A 1WEHA 2XT6A 4EK9A 5CEFA 1EVIA 1KQPA 1N2SA 1QCCA 1XVUA 2RHRA 16PKA 1ZD5A 9ABPA 5AVZA 1SKBA 3BUSA 3FHJA 1NVWQ 3LSYA 5AJYA 5JJ5A 3HKZA 1CV2A 1SVLA 3CCMZ 2R7MA 2ZU0C 1UPUA 2YCLA 1DQSA 3DV9A 5EJAA 1FDVA 2JIBA 2CHFA 4QX6A 5I7VA 1TJ5A 2VJMB 2BKUA 5L45A 5DPMA 1PUJA 2CXHA 2GKGA 2WU1A 1GFIA 2ZTVA 1SK8A