2OZKA

Structure of an n-terminal truncated form of nendou (nsp15) from sars-coronavirus
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
306
structure length
306
Chain Sequence
b'INNAVYTKVDGIDVEIFENKTTLPVNVAFELWAKRNIKPVPEIKILNNLGVDIAANTVIWDYKREAPAHVSTIGVCTMTDIAKKPTESACSSLTVLFDGRVEGQVDLFRNARNGVLITEGSVKGLTPSKGPAQASVNGVTLIGESVKTQFNYFKKVDGIIQQLPETYFTQSRDLEDFKPRSQMETDFLELAMDEFIQRYKLEGYAFEHIVYGDFSHGQLGGLHLMIGLAKRSQDSPLKLEDFIPMDSTVKNYFITDAQTGSSKCVCSVIDLLLDDFVEIIKSQDLSVISKVVKVTIDYAEISFMLW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uridylate-specific endoribonuclease
molecule tags Viral protein
source organism Sars coronavirus
publication title Crystal structure of a monomeric form of severe acute respiratory syndrome coronavirus endonuclease nsp15 suggests a role for hexamerization as an allosteric switch.
pubmed doi rcsb
total genus 65
structure length 306
sequence length 306
chains with identical sequence B, C, D
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2007-02-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.360 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2ozkA01
3.40.50.11580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2ozkA02
4RS4A 2H85A 2RHBA 2GTIA 2OZKA 2GTHA 4S1TA
chains in the Genus database with same CATH superfamily
4G0YA 4U7HA 1DL5A 2PZEA 3UHJA 3S29A 4HD8A 3ZR4B 2QD3A 1EGVB 4RK0A 4C4RA 3LDUA 2O6HA 1QCYA 1U8EA 3G85A 4ALMA 5AVZA 2DTDA 4TKVB 3DULA 5JY6A 3HCAA 2AWOA 3LFUA 3PFGA 4MRSA 1NLMA 3NT2A 5E9WA 2NVUA 2VNIA 3LCMA 2IIBA 3X2FA 5H9WA 3OQOA 1PZXA 1FVFA 4DJDC 1AQJA 5AW5A 2VKQA 3RSCA 3SCZA 1DJMA 2V54A 4PLPA 2X8JA 3UMCA 4ZRNA 3EEQA 2CD7A 5AOBA 5KDLA 1KEUA 1Z75A 2V4MA 3HVUA 2EDCA 2HJWA 3IHWA 4FD2A 1BW9A 3BS4A 3A1TA 3JQ8A 3PK0A 3PIRA 1OLSB 3OO0A 1A72A 1CQIA 2F1JA 3EXIB 4QXRA 5LYJA 2XZPA 3IE2A 1PSDA 2PT9A 3LUCA 2OTJ1 2MYNA 1VQ71 4IFIA 4B0PA 5F23A 3CMA1 4OA5A 1AA6A 4WNYA 2XMCA 3URMA 1E3WB 5ES4B 4KAJA 2W71A 4IIFA 1MHTA 1KQSY 5CAEA 3N6RA 4MMYB 4M1KA 3IDQA 3JAMA 1X1EA 2ZB2A 3C8UA 4I6JA 3S5UA 3WGKA 4CFYA 1EXVA 4WXPA 821PA 3K09A 3I3OA 3IR5A 2IUTA 1NRWA 3VOAA 4HUTA 2HJVA 2IF0A 4QDXA 3MIZA 4U02A 3R7WA 1AK1A 2AEMA 5AJXA 4W5NA 1ORWA 5CDTA 3PNLA 2FWMX 1VZ2A 1IK6A 3CPWY 3T6KA 3WQQA 4BAUA 5BRJA 5CD9A 1ZUNB 1JJ7A 2VF5X 2VBGA 3MTEA 4WK0B 1T9GS 5E4TA 1HT1E 3A6EA 4UASA 3UAXA 3V9PA 4XWAA 4QU5A 5CR9A 3C6KA 4L9WA 4Y2TA 1RXVA 4HY3A 4ZVKA 1DBWA 3SYKA 3QBJA 4GRIA 1OXSC 1IHPA 2OFOA 3LP6A 5DTEA 5JAPA 2BKVA 2O5RA 4DKJA 3FPEA 1W5AA 3F5DA 1VP9A 1VP3A 1QMPA 3IEIA 4NK4A 2BFEB 2R751 1QBGA 3MHPA 3TPFA 1UP4A 4RE5A 3EQ7A 3VV2A 1ABFA 1L5OA 3WNVA 4EHKA 1V8BA 2ZJFA 3HCRA 1VJ5A 1GTVA 2O2YA 2P68A 3AEXA 5E1DA 1SBQA 5I5EA 2REBA 5EI5A 1G18A 4MVJA 4GIBA 2V0CA 4G8BA 2HLPA 2WY2D 2PG3A 3O9MA 1VCIA 2ZI6A 5EPOA 2DGDA 4EW1A 1O6ZA 2E82A 1I6HI 3U4IA 1T9GR 2D5BA 1NVVQ 1QVZA 1U0GA 4KLAA 4MKRA 5EJ9A 1U2DA 2CXRA 4Q24A 2V03A 4XJVA 4YJ2A 3P52A 4UUPA 3SQMA 1NJI2 3OWXA 1HG1A 2I6FA 3EMDA 4L07A 3W78A 2FZ4A 3GNTA 1BU8A 4ZQCB 3ASUA 4N7RA 1DFIA 1DCTA 4FOPA 4BBJA 3WZ2A 1F1BA 4CEIA 3UGTA 3RAJA 4XYMA 5B1SA 3KAQA 5I7SA 1J5EB 3L93A 1CY4A 3PA6A 2YHIA 1L7EA 1OFVA 3IJ5A 5KX5B 3ESQA 4XRGA 2QRGA 5JMTA 4PEVA 3B8HA 1L1FA 5C5CA 2VP9A 5I01A 5JAHA 5C8DA 1II0A 1ESMA 1VHDA 5BQOA 4LRUA 1A77A 1J23A 2V8OA 1U7XA 2IP1A 2O1SA 4BQSA 1K68A 1M72A 5T5QA 2HXGA 4BFSA 1CRPA 1WUKS 1RAFA 1FP6A 3ZE7A 1SB8A 3KKPA 4KXQA 3NV7A 1ZB9A 1W94A 2DQYA 2RIQA 4R2MA 4ZVRA 3PXEA 2PBZA 2YHSA 1UBOS 2WF7A 3C2QA 3QMWA 5G4KA 5EINA 3QPWA 5JCOC 4PC2A 1DTSA 4QT0A 4RCZA 2Q27A 4P35A 4URWR 3LAWA 1W5BA 4OYLA 2GPTA 2DKNA 4X44A 5IP5A 3FLAA 3DV2A 2RCNA 4XQCA 2I6GA 2AOUA 4AKEA 3QKWA 2QDKA 2VPYA 5JW6A 1E1DA 1NUPA 2H1IA 4EW3A 1VHTA 3WSWA 3D7KA 1VLHA 4N9WA 5AKJA 4CLRB 3KR2A 4LHYA 4WKCA 1P73A 5LR6A 1QIGA 3LBAA 2HOQA 4QBHA 4DMLA 3B1KA 2QA4Z 3UUEA 5KNCD 2K2QB 2L19A 1HNZB 1BDHA 4CG3A 2FLWA 3RHFA 1TCAA 1U5AA 1QHXA 2AG1A 3HA2A 4XJTA 1IN8A 3EC2A 2NTJA 2PT6A 3F3KA 1LSSA 2C82A 3HADA 1SCIA 4L28A 4OCZA 1XVAA 2G5CA 2ZW9A 3VPXA 3GKQA 3KAKA 3PPXA 2VNAA 4ZRMA 3NT4A 3L5KA 4DEXA 4DCPA 1HZZA 5HNKA 3LY9A 4IP0A 1KARA 3C1AA 3D8RA 4LYFA 3EJWA 3HE3A 5FOXA 1XZIA 2I3AA 2JFZA 1MAAA 1TU0A 2CXSA 5FLXf 3CNNA 4KMOA 4OHVA 1GUAA 4WVFA 3ZWBA 2O3SA 1PJCA 4MYTA 3C6BA 2MYUA 2JH3A 3TCNA 1DEKA 4E03A 3VJMA 3PYLA 1ZJJA 1MZVA 4P4UA 2F7SA 4B09A 4B2LA 4UBIA 4EHBA 4LISA 4BQPA 4PQRA 3RV3A 3K1AB 4FU0A 3H5RA 1PAUA 1IEQA 2IA5A 1DQRA 1BWPA 5H68A 2O4HA 1ELOA 1WV0A 2ODNA 5IJAA 4CM7A 5J2TA 2OXRA 2XA1A 2IV2X 1X8JA 2P9HA 4LG1A 5CCBA 3B9BA 1O77A 1RC8A 2HFJA 4G8CA 3VJRA 3CWQA 1XEAA 4HB3A 5CB6A 5EL0A 2NO7A 2F9MA 2F3UA 2HIAA 2NX2A 4QOHA 1N6IA 3WGYA 3WISA 2AFHB 1E98A 4IMRA 4MVJF 3COWA 1V0JA 1GXSB 4KRYA 2X1VA 3L1KA 2Z2XA 4G1FA 4WBNA 1VSQA 4MS3B 4YRGA 4K9SA 2JHFA 2AXNA 5GGXA 4W5TA 1BA3A 1BMFA 2DU8A 2Q41A 3JYQA 1ADJA 4LDZA 3DJYA 4OOEA 1QDEA 3KDSE 4RA6A 4D5GA 4M9RA 3OT1B 4EPWA 1R4MB 3H0GI 1SUIA 2YFYA 5CA1F 4EQZA 3MTQA 3FZNA 4RLSA 1YK1A 3TE7A 4KWTA 3EVDA 2EX0A 1J07A 2E4WA 1NNUA 3I9V1 2WW8A 2ZJ3A 4EJFA 3BF8A 1CJTC 2IYUA 1D0SA 1TRKA 2ZATA 1G6KA 3TS1A 3BD9A 1T1GA 3NYRA 3EF1A 1A5ZA 1H1TA 2NSHA 4J3FA 3R7FA 4X6AI 3A3KA 3F4KA 4BLQA 1ZO8A 1XVTA 2D3WA 1W75A 3QTBA 4PFKA 1TUEA 3DMPA 3RM3A 2B8TA 3ZUGA 3D6HA 4KC0A 1WB5A 4G0UA 5HA5A 5J2UF 4KGXA 5F78A 3F0TA 3V4ZA 1KJWA 5AHOA 2JFUA 3RUFA 2ZPTX 1NUHA 4R5HA 2WJPA 2RGRA 2AKLA 3KPUA 4L08A 3TOSA 2NADA 4G4JA 1U5BB 3LW7A 1ZJ4A 3BIXA 3DMFA 2AFVA 4D80A 1QK3A 4QIHA 2CNLA 1Y1VI 1KU0A 1NUUA 5AJTA 1UAAA 1O58A 1PX0A 5JVDA 4LZWA 1TTPB 1R4ZA 2FCAA 4M21A 1EP1B 3OESA 3QVUA 5IJWA 1G8KA 3AR4A 1A9XB 1TIBA 2O7SA 1EGMB 1LPBB 4A16A 4YUXA 3UENA 3PU6A 2AH5A 4MQMA 3BGWA 3V8PA 3VR3A 1X7HA 3CX8A 4D1YA 1QZZA 1UIRA 3OZDA 5ICMA 1IEWA 5I51A 1OXBB 4HYTA 1HKHA 1YAJA 1T15A 1ZUNA 1Z7GA 2CBGA 4AL4A 2WNIA 1U8AA 4AJKA 3VO2A 2C5LA 3FB4A 2FKNA 1F12A 3DDSA 3EVNA 1KEKA 4JP5A 2PRYA 2RARA 3B3FA 4A3GI 2GHQA 2HNBA 3WL4A 4LJRA 2LWIA 1D9ZA 4HWTA 2R6HA 3N2GB 5CDHA 4GOMD 3HO1A 1P5FA 3GIDA 4OHPA 3PPVA 4POAA 3PFKA 3K0FA 4QUIA 5AKGA 3LBIA 4JUCA 3T7AA 3QWUA 4YT8A 2SCUA 2C94A 3PFWO 2VTVA 5JTTA 1SOWA 2Q2QA 2JFPA 3CEJA 2XQGA 4UU8A 2CZCA 2D74A 4UUQA 3I2KA 4RHFA 4C2AA 4JA0A 4DUGA 4Z6KA 3U9TA 2ORWA 2Y6UA 4M7WA 3CD61 1N5RA 2DWCA 2QX6A 3SDZA 4B83A 1G7RA 1N6KA 3P9SA 1MW9X 4EGJA 8ATCA 3TLGA 3M8KA 1SPBS 2IEBA 1GCGA 3GTGI 3IXLA 1T4DA 2DR0A 1PZEA 3CLTD 3G5LA 3LSTA 1EG7A 4KWIA 1CUWA 4ZGBA 4B3XA 1DBVO 1UOEA 2PX0A 3UJ9A 1ZD8A 2D4AA 3KFVA 3VI3B 2BEUA 2R1TA 1JR3D 5JYBA 1HRKA 3K5IA 1N1DA 4JLPA 4YY3B 2YIJA 1V26A 2NU6B 1GKIA 2I7DA 2LNDA 3EQ9A 4IUYA 4MJXA 5TDHA 3THXB 4C01A 2WUWE 4IO1A 1T5BA 3DCIA 5EIBD 4H7PA 4RCYA 3QVGB 1CEXA 4QOFA 3NVMB 4K40A 1QVWA 4JQZA 4D4GA 2CNWA 1LPPA 2ZR0A 1M2KA 1R9MA 2IF2A 3CF0A 2GXAA 5EYPA 3UOWA 2Q1YA 1VIDA 3BB3A 2AK3A 4BS9A 1SCQA 3C1TA 3EOAI 4JOBA 4OO3A 4Q66C 3RVNA 2J30A 4AC9A 3K31A 4N54A 3NDPA 3RVSA 4CEHB 1X3SA 3G1WA 5C0OE 2EFCB 2BM0A 4JMLA 1KXJA 4O08A 4TLMB 1BC5A 2I7XA 3D3QA 2Q2WA 2EYUA 3NANA 4MV1A 2QE7D 2CLFB 3JZFA 4NH4A 4RKFA 1E0AA 2VXBA 4BRWA 2F1IA 3OEHA 4L0MA 1OX4B 3RREA 3KR0A 4QWWA 1O0BA 5FPHA 4D8WA 4YDQA 1ZK0A 5AW6A 2PUWA 4BAZA 4MXUA 3L7CA 1XU4A 3FUWA 4EUEA 4EJ2A 3B9QA 4NE9A 4P08A 2R0QC 3P5JB 2H7CA 2ZITA 1VQOZ 2B4RO 5D3ZA 3A4LA 4IDAA 5ITWA 2ERYA 1M34E 2W6OA 3T1YB 2YS6A 4LJ5A 3W2HA 4Q4LA 3UHOA 1RLMA 1X7XA 2VJQA 4HDAA 4Q6BA 4KITB 3UOGA 1JSLA 4JIMA 5HIAA 4RHEA 2IXDA 4AWBA 4DNFA 3FOAA 2O19A 5AVOA 2JIZD 2P35A 4B81A 2P4UA 1QQBA 3B38A 1L1QA 2C92A 3EFEA 2VTKA 4NHOA 1RP7A 4M89A 4R71A 1CZUA 5FWYA 1N0VC 4Q9AA 4JFAA 3V1KA 2A9OA 3Q3EA 3GLFE 1WJ2A 1AUXA 1J2TA 3AB7A 3NDJA 2VSOA 3EVGA 1T2VA 3JYPA 5EE5B 3M82A 4ZT3A 5IC5A 4RU1A 2J0VA 2YCLA 1GITA 2QT9A 2YDXA 3PZRA 3UV7A 5COBA 4Q39A 1ZA2A 2I5PO 2QSYA 3N7UA 2EQBA 3WLLA 3WFZA 4M54A 1CJBA 4R9VA 2JVJA 2A86A 3HXLA 1JL3A 2O0JA 2QR2A 4LOAA 2HI0A 3OBIA 4TLLB 4P83A 2NVYI 3OU2A 4EUNA 3VVBA 4P7JA 1ZZEA 1N6NA 4Q18A 1ML3A 2P77A 4QQRA 5FPPA 5LMUB 4HHEA 4FI3F 2CHFA 4CG0A 5A9RA 3ZY4A 3EUAA 4GLJA 3U16A 1OBFO 3G17A 4HUQA 3DM5A 4MCJA 4TUYB 1GTMA 3M1IA 3OUZA 3I4NI 3I9KA 3KVNA 4C0JA 4MQLA 1GSIA 5D85A 1R0RE 3M5DA 5FO0A 3JVUA 1Q7Y1 3NU1A 4OQNA 4YQFA 3A1NA 4BQEA 1L5HB 4KV7A 1N5MA 2IOQA 3H5IA 3A58B 2PX4A 2VK8A 5HE8A 3FAZA 5DCUA 5EMMA 4V3BA 3NP9A 3A14A 1V5WA 3CO5A 2WT9A 3PKIA 2XSZD 3UAVA 1W5SA 3A6HA 4CLOB 3TXXA 1ZJ6A 5TY0A 1A04A 2HSJA 3FZQA 3AGQA 4LQCA 5B3AA 1Z5UA 3OEEA 4ED9A 5CDFA 4JYZA 4DC1A 1FUEA 1V6SA 2HHLA 4I4TA 4KZPA 5IBRA 3SKYA 3RIYA 4QULA 4CG1A 5IBCA 4DQXA 2OZPA 3ACDA 5L6LB 2ZXUA 3WQHA 3GLUA 1U9YA 2BP7A 4I5FA 1VQ1A 3L04A 4OYYA 5H7XA 5BV8A 2OGWA 3CCS1 2JGRA 4RA9B 4O2LA 2Q6IA 1N2GA 3TTYA 1WW3A 1R3DA 1CVRA 3ZCUA 3AM1A 2L42A 4RSRA 5G0TA 3UUWA 4JGIA 3RZOI 5A5VA 2CB0A 1JA1A 5A4JA 2CXNA 3THYB 2X6TA 4NBNA 5DLEA 2R5WA 3PWZA 5HZKA 3RO7A 5KNLA 1TQ6A 2CHQA 2A5LA 2C9MA 4YN3A 4LF8B 1UWKA 1J9GA 1UL1X 4R8MA 4YRDA 1U7HA 2BMEA 2G04A 4BNWA 3SQXA 4XUCA 5I7FA 1G60A 5IT4A 1CIVA 1Q0HA 1HEUA 2Y92A 4MI6A 3UAGA 1IRIA 1S89A 4Q3LA 3ORHA 5AW0A 4NBAA 3EXG1 5BNTA 4CM8B 3F6YA 4J8PA 4BGDA 2AQHA 4GGMX 3ND6A 2E6KA 3C5EA 1T8TA 1DKMA 1YH3A 3VHLB 4X66B 3KOWA 4D9NA 3BJEA 2VBIA 3E7DA 2HIHA 5CT4A 4FEGA 3ML1A 3DKPA 3S2IA 5FEUA 4PO9A 1WSWA 2LP4Y 3LGXA 2ZAGA 3F74A 4X85A 1K2WA 3X44A 5FIUA 3AUXA 1BHO1 1KZ6A 2I4OA 1QIEA 2LTAA 4JXJA 5HWSA 1ZUIA 5E6SB 3W3AH 3O8OB 1DRJA 2J7PD 4Y7CA 3BIFA 2E1PA 2C0QA 2W8BA 3SEFA 4YQZA 1AE1A 3D3JA 4J76A 5U4QA 1P8JA 1L5WA 1T1JA 4Q3CA 1XPJA 1QTRA 4KQ2A 3LPLA 1FFEA 1KI1A 2QL7A 3WFJA 2ZULA 5HKLA 1VGQA 5D6OA 1H6DA 3IH5A 1LNZA 3OIVA 2NYAA 4AECA 2YQZA 5A5GA 3U7GA 1T24A 1NW5A 1G20A 4ZWNA 1E4OA 4OPMA 3HWWA 3PHBE 3UJ6A 3UTDA 4G0VA 4D4HA 1TO2E 3ETHA 3NAGA 1RI5A 5LFAA 4C0BA 2OCAA 2HK7A 4HG2A 2BLLA 4JJFA 5HOQA 3TR0A 4X65B 4CLXA 3KIPA 2A78A 2Y66A 1MBZA 4TWIA 3RSHA 3UF0A 1TYZA 2V55B 1J00A 1YVEI 2ZKLA 1OUMA 1KC1A 3AR2A 3DDWA 4J3JA 1QRSA 2I2XB 2P27A 5I4CA 1OZFA 4M60A 2NNLD 1OU4A 2FPIB 4GM0A 5B3KA 4W6ZA 4PY2A 5LWQA 3HKCA 4LBVA 3ABRB 3RUEA 4Q3BA 2PT5A 2CCGA 5EWJA 4F1WA 1Q811 4FBGA 2G28A 3L8ZA 3U39A 3TVTA 4GOND 1GQYA 2IKSA 2OHXA 2B4AA 3H6KA 1TDJA 1I9GA 3I1IA 3NRJA 2R3SA 2TS1A 1H8EA 5AVTA 1SCKA 5AUPB 2BLNA 1B3BA 1O95C 2I54A 2QRZA 4MI3A 2QWXA 5K8CA 1KQGA 2I1VB 4B3TB 2DPMA 2I91A 4KKVA 3FMOB 3ZGNA 1VQLZ 3BIJA 5EP4A 4BDTA 3OD1A 5KQRA 1Z03A 2HB6A 3A2NA 1XNJA 3HZRA 4Y1RB 5A4KA 1CY0A 3MAAC 1FMFA 3DE0X 4JYPA 1FFCA 1X1SA 1QGDA 2Q46A 2YN4A 3N6VA 4UTOA 3V1TC 2W2LA 4YS6A 1M5UA 5KAPA 3QPCA 5LIRA 2XCTB 1PQ4A 1AVTA 4CLRA 2X23A 1XZDA 3UWMA 3ZDBA 2Y6VA 4M83A 1GQ2A 4A0FA 1SXJE 2VNSA 5CFPA 3W5BA 2DJIA 4V0KA 4Z0TA 2NNWB 4I1PA 5BSWA 1ZB8A 1X0TA 2YZ2A 4NZYA 1SAYA 1YONA 2JLRA 3S2SA 3ZX4A 4HGRA 4R1TA 1XKQA 3UATA 2I8LA 4DUYB 4UAVA 2FUCA 5KJCA 1SIUA 5LYJF 2P3QA 4HTFB 1WXFA 5IEJA 4ZYXA 1YA6A 1P1RA 2B1GA 4YWJA 1O87A 1PFYA 4Q82A 1F8UA 2ZEJA 2QMYA 3OCVA 2J1LA 3NVKI 4GI3A 1YHQ1 1GPH1 1W73A 3O1IC 4UQPA 3NHMA 4X64B 1XMJA 5FCDA 5IFLA 2B4TO 4KLZA 1U8UA 4EG4A 1LI5A 1PQPA 1WVIA 5JMWA 1KIAA 3ZY5A 2GCIA 3FPBA 3JR7A 3LZ6A 4CMIA 2ECFA 4CM9D 2DPGA 1U0EA 1WDTA 1KI7A 3SYTA 3DAHA 3A1WA 3ET4A 3RBVA 1P19A 4B7UA 1H4TA 2XRYA 4GQIA 3WGNA 2G0AA 5ALPA 4R2JA 5F5NA 1GFZA 1YDWA 2V6MA 4JENA 5CM2Z 3SFVA 2I99A 3WIOA 5IS2A 1T3SA 1ADCA 4UFOA 3VNSA 1D5CA 1XEWY 4QSMA 3QEKA 5HZMA 2HYIC 3FLMA 4L0DA 1GUFA 4FJ0A 4NY1A 3SM9A 5MFPA 4F4FA 3RVDA 3R23A 2VZEA 1EE2A 2J5BA 2KE5A 3CC8A 1UOQA 3GK3A 3KWFA 4GVLA 4I66A 4J0HA 4M0CA 9ATCA 1REQA 3WLTA 3V4VB 3VR5D 2DFKB 2OYRA 4A4DA 4A10A 4DJEC 3CZPA 3CF4A 3AOGA 1Q2XA 2WIGA 5IAGA 4JP8A 3SBOA 4B33A 4LOKA 4FHZA 4UUAA 2VH1A 3U7RA 2C7BA 3OEWA 4KAFA 3EXHC 4GZ6A 2ONJA 4DADA 1F7UA 4MR9A 2ENUA 4G1VA 2DE7A 3RZDI 2X5OA 5L3SA 1P7ZA 2IYVA 1UT8A 2DKFA 4KIUA 3S7TA 1TK3A 4BFZA 4ZVSA 4D4IA 4WOBA 1DOHA 3IGFA 4FN5A 4MSUA 4ESOA 4YAKA 4YV1A 3KWJA 3R4CA 4DB2A 3BMNB 2F8LA 3L1VA 2BFFA 3U81A 2HHCA 1GTSA 1RBMA 2EJVA 3QWFA 3W6NA 5DGHA 1VJ0A 2LD4A 3HI6A 2H57A 4U2CA 3EPRA 3TRJA 4Q9LA 4WACA 3AZPA 1I1QB 4QLOA 2V6IA 4O4HF 2GM3A 3U3MA 4IOJA 5DGXA 2W6ID 1H42A 5LSAA 3HA5A 1P0CA 1YGPA 4QAJA 4R8SA 3ZD6A 4J90A 2G71A 1DE0A 2R6FA 4OUKX 2X0FA 3GP8A 1N32B 4D9FA 3G2HA 2UU9B 2B1IA 4B32A 2RHTA 2E37A 4R6WA 4M1TA 3VZBA 5DHTA 4HFJA 4E7PA 4LW8A 1WBDA 4UAUA 1Q12A 1XQWA 2P30A 2ZRQA 4P0QB 1CJMA 1OLSA 1TWFI 3RBXA 3DEFA 3RDPA 3S1SA 3IEMA 2YX1A 4FWIB 3TXAA 4HRAA 1Q0TA 1ONOA 1Q95A 1E32A 1S4MA 3PC2A 1JU4A 1T3ZA 2YJGA 3LUSA 3QVLA 2PSFA 2VRCD 2EX4A 2C54A 3AOEA 4R40A 5C8ZA 4Q9IA 3M4XA 3OSUA 4GNKA 6ADHA 1KEPA 1O5TA 2FX3A 2YTZA 1CZLA 2P2GA 3EAQA 3KTAA 1NJ5A 4C6HA 5CFLA 2EHDA 1KE1A 4GMHA 1YA8A 2OPBA 3K30A 2O2DA 1ENYA 1E9EA 3FM9A 3FDXA 3GFFA 4DNQA 1U1FA 4NFRA 1XKTA 2RHOA 4M1WA 5ALUA 3AILA 4JBHA 4DRZA 4PX2A 1XUOA 1G8SA 1OTYA 1AT1A 4O3FA 4EHHA 3W05A 1V48A 2AHOA 4RFLA 4UPVA 3ST7A 1VKHA 4CPDA 3I4FA 1HE2A 4CQJA 1EFLA 3R6TA 2BFCB 1IJKA 1DJNA 1MOPA 4HLQB 3LTEA 3AKZA 1NV9A 3A27A 2OTL1 4B7CA 5EZYB 3ANTA 2Q29A 4GPBA 3AEQB 1JS1X 1XXHB 4QM6A 1H4VB 4LY3A 3ROXA 1KI6B 3DNMA 4A3SA 1H2XA 4Y2SA 2AW5A 4R84A 4PHGA 1JQKA 4FMCF 4PZEA 5C34B 2QF7A 2OCGA 2VJKA 5B6IA 4ZQIA 4F2WA 3V4SA 5AVXA 2X42A 1PEDA 5TS3A 1OB2A 4R3NA 3DP9A 4FFSA 4E5KA 4B3DA 7REQA 2V3CC 1QF7A 1ZD2P 2ZQ5A 4NE7A 1PJ4A 2W58A 1S02A 2Q3FA 3L7LA 5ILGA 4XXHA 1IJEA 4YJHA 4AG5A 1RIIA 4NCIA 3MMPA 4H08A 1M2VB 4FC7A 1YB5A 5JE8A 4ZT6A 2IX3A 3EGDB 4R51A 4TTVA 1K0FA 3GLVA 1BQEA 1Z2EA 2FUG6 2FPLA 4OM7A 1A4IA 1Z7YA 1GLNA 5AW1A 2CHVA 1F6WA 3ZGVA 2JB9A 3KKQA 1QFXA 1ODTC 4URYR 4L6CA 1QG6A 3U31A 3F3PC 1ZGAA 3EYAA 3JWPA 4LEIA 2YV5A 3VKGA 1Y3FE 3A0RB 5DRYA 5FPTA 1U5BA 3ACCA 1WO8A 4OG2A 3W9YA 5LKAA 3KQLA 1FNDA 3UVEA 3UH0A 4Q4HA 1NAIA 4MP8A 1YL7A 3L02A 1Z6GA 4MWOA 4NMXB 3TI9A 2IEAA 4TV9F 3DLTA 4KH0A 4BX0A 1XL1A 4LGCA 1RXWA 2JIQA 3AT1A 2IY9A 1ZXXA 4B5LA 4OHXA 3RYIB 3V4LA 1Z83A 3VKVA 4X7PA 1AKVA 3MJTA 1IPHA 5K8VA 1MEEA 5JRZA 4OB8A 5AJHA 1YULA 1A5BB 2PD4A 5LZ4A 1JEJA 4C4ZA 3JQ9C 3FGNA 4EL5A 5HUHA 1L7DA 1HEYA 1XQVA 2CKDA 2QTVA 2PUHA 4G26A 3SC6A 1NMQA 1CEQA 2QLJA 1ZICA 1RLIA 2R87A 3DXZA 2NO1A 1ZU5A 1UDRA 2X5XA 2AN3A 2PS3A 4MVJE 3HXOA 2PXCA 3UKJA 5REQB 2CCJA 2QMOA 2RH8A 3PFFA 4BLOA 1DAEA 2DC1A 3LBNA 1Z0DA 4IQ4A 5K0FA 2Z6UA 4IF6A 4OU4A 2WFMA 2NU8B 4D8YA 3CVVA 1KOGA 2H1FA 2I2FA 1J2EA 3RKSA 3QEAZ 1KSJA 1K3FA 2H3EA 3DDNA 3G8DA 2GILA 5GZ1A 4CU2A 1D6SA 1HY3A 2DFDA 5A7GA 1HTWA 2P4QA 1PWZA 1T2EA 1MUUA 1Y1VS 3KVVA 2FN8A 2LKDA 3DLAA 5JALA 1QVFY 1E64A 1EFCA 1OJLA 3HY4A 4C7XA 4GPIB 4M87A 2QN9A 3HY3A 1REQB 1KSFX 2V8IA 3JWGA 2H7VA 2W0MA 1R0KA 3HDQA 1SVUA 4X1OA 2NPFA 2QRDB 2OOSA 4G09A 4I55F 3L43A 2P9ZA 5A4AA 4I9FA 4KGDA 4LDQA 5T64A 1XZHA 2PMBA 4ZOLA 3T41A 4FHDA 3ZZMA 3BKXA 1Y3DE 2GOYA 4MS1B 1Z5NA 1Z0SA 1L6IA 4OSPA 5LBTA 1QM5A 2LUOA 3DVQX 4H60A 1I6LA 3RJMA 3CU5A 1GT6A 2VBFA 2E49A 3MOIA 5ALKA 3H4MA 1C0LA 2G7ZA 3H1AA 2N75A 3P0FA 1NKTA 3TTWA 4YIKA 4R05A 4EITA 1GPMA 3KYCA 4Y67A 4KPFC 3AM5A 1JKJB 4MVWA 1VHJA 2ZTLA 2KPOA 3V4RA 3LZCA 1DAPA 1P80A 4IHKA 4PG4A 3GO4A 1RJDA 5FI0B 3WAKA 2A1UB 4Q1CA 4RZ2A 4LXQA 3QVVA 2ZTMA 4LXHA 2GHRA 3T9CA 2YJ6A 3PD7A 4AJOA 2AC4A 1DO2A 4CXMA 1ZMXA 1R6XA 1KJ9A 2FWNA 2HF2A 4NABA 4P4SB 3QXXA 2LXNA 2Q8NA 3MGBA 4MWZA 1GU7A 1IMOA 1I0ZA 3RS9A 4EJSA 1WD7A 1QK5A 4CM1A 3L84A 2KLHA 5HRAA 4L8VA 1BRTA 1QLJA 2F43A 1MAUA 1USWA 3C5CA 1OHHD 4MK4A 3D59A 3ZHRA 721PA 4B31A 1XJ0A 3G2IA 1G55A 5ALYA 2EYQA 4HDMB 1GXSA 1N1EA 3V3KA 4C89A 2PAAA 1DQYA 1UKBA 1PJ8A 3UPUA 2P7HA 2OCDA 2X0DA 1GZ5A 2POCA 1RQGA 2XXBA 6CHYA 3U60B 3O4GA 1Z68A 4J7CA 1TU3A 3GJ8A 1WBJB 3KEOA 4L8GA 4OQEA 2FE4A 5C5DA 4OHKA 1TFUA 2G2KA 1IZ0A 1DLJA 3MLEA 3B89A 1PGOA 3MUFA 2J5KA 3KT8A 3NI2A 4D74A 1APBA 2PWPA 1TXGA 2OXEA 2WUGA 3RAEC 1CV2A 2X9QA 1R10A 2LE0A 3VSAA 2HT1A 4QDUA 5LU8A 1AUOA 4II3A 1GADO 4QL3A 1UKEA 3CCQZ 2BW0A 2FA9A 3C43A 1FYWA 2FPPB 3C85A 4MB6A 1F0YA 5EZ5A 2Q8PA 4ZDIA 2WABA 1NX6A 5BRAA 3D8NA 5KSWB 3DO6A 3LA6A 3LX5A 1R5NA 4JBXA 5F2EA 3HNPA 3VM6A 3K9WA 1A95A 1E3TA 1PE0A 2ZSHA 3P97A 5FA6A 4AFNA 2OV6A 3M6AA 5ITZA 1XTPA 4BXOA 2IYWA 1WULS 5JWHA 4PGGA 3CZMA 3ZLUA 1JHQA 3DHWC 2WIBA 1M1NA 4IYJA 1RLYA 2I33A 1F0KA 1PTJC 5TQ2A 4E46A 3SC3A 1X80B 1Q822 1PWEA 1V9CA 3AJDA 4FFVA 4QYIB 4M36A 4ZU1X 4DCVA 5B4TA 5FL7A 1PK9A 2FN3A 2PR2A 2RG1A 4UFNA 3TSAA 2OO5C 2GZ2A 4BO3A 1ECPA 1G5FA 5B55A 1BDJA 3RWBA 1FTGA 4G1MB 4JKYA 1M0WA 1A82A 3MBOA 5A9SA 5I9NA 1XA4A 3VU8A 4HNAA 2PKWA 3N75A 1DX4A 1JJIA 2X8WA 2GVNA 3N0WA 1QPZA 1HE4A 1JT9A 2N1BA 2VHVA 3R3JA 4ERNA 3A3PA 3TD6A 2HK6A 4OXYA 4AF8A 1VQKZ 3PL5A 1ZH1A 1F5SA 1ZQ1A 2JFXA 2FSVA 4IIJF 3ZHCA 1G66A 4D9GA 2FSFA 4ATNA 4IRUB 1SELA 3EEYA 3PIIA 4IEEA 4N5MA 4TTTS 4DBVO 1BX3A 2V7QA 4D3ZA 1O9GA 5LQSA 3ADPA 1PDOA 3VTAA 3IB6A 4WLEA 4MUNA 5FOTA 2J3EA 3CUUA 3P9ZA 3TEJA 1XDUA 4RFVA 3KQTA 1K6XA 5TR9A 1U6KA 3ND9A 5ARBA 1RKBA 2IX9A 1Z4OA 3GMTA 3ESAA 2IPLA 3CX4A 3IQGX 3E1KA 4DMCA 2XUHA 4MVJI 2JLCA 2VDMB 3DHVA 1OYVA 1EDBA 1TZBA 3CW2A 3G02A 3N87A 4HZIA 5LZ8A 3RHTA 4LNUB 4OMUA 2RGBA 3V2HA 2RKOA 1KY4A 3KJQA 5CAEB 1MV5A 2X4LA 3CURA 2WP8J 3GNSA 1Z06A 1YRHA 5IBQA 1UXGA 2FR8C 4I46A 4GVPA 4MIKA 2VXCA 4ODIA 3E3MA 4BYMA 2NSJA 1QVRA 1NDQA 2F62A 3S8YA 3RQIA 4EGFA 3U61B 3T7JA 1E79D 2C42A 1NBIA 1PWXA 2HRBA 1ZC4A 2RHHA 3A10A 3MBIA 3STTA 3I62A 1AZTA 4PG7A 4OGGA 5ECYA 4Q47A 5CB0A 2Y71A 3R5JA 1R27A 1GWNA 3PUYA 4CG2A 3L8HA 1SQ0A 3KNZA 4QYTA 4TS4A 3A36A 1YR2A 3DOHA 3QA9A 4XIIA 3Q7PA 1QS0B 1ORIA 5FI5A 1WPRA 1JQAA 3LT0A 4FD3A 2O2SA 4LMRA 1MU0A 1IWPB 2X4IA 2ZR8A 2A1TR 3NETA 4WT7A 3WNZA 2Z57A 5AKYA 4G8JA 3KFLA 1ULZA 2OHOA 4G4GA 3ZQUA 4GR9A 2PUTA 5IKMA 2FEPA 4FFBB 2XKBA 4QJBA 2J4FA 1YNSA 3G9ZA 4IIEA 2FSUA 2PGIA 1UKVY 1LD3A 4P22A 4UU1A 5K0LA 1EX7A 1VDZA 3AI3A 4AM8A 1JG1A 4A1OA 4RD2A 5HF9A 3KHKA 1CKEA 2Z5VA 4CM9A 2N46A 1RYYA 1T0PA 3VR0A 3OT5A 1JDBB 5FNVB 3V4PB 3UGQA 4AZ3A 1VL6A 2H5IA 2DFVA 4Z49A 1WDMA 3P0EA 4NYJQ 5C1OA 5IM4A 2AOTB 2BGJA 4MLZA 3GTPI 4CNQA 4MJ7A 4BVFA 1THZA 4I4NA 1UANA 2JA1A 5K05A 4MJ3A 1VLJA 1UPAA 4FT2A 4R8LA 4I55A 3HKEB 1MO2A 1R2QA 4X7BA 2WWYA 1E61A 1LVHA 4R83A 2Y0BA 4CKBB 1FFYA 1MVOA 1RYEA 2AZDA 3BEOA 4PINA 4RYDA 3QLJA 5CIYA 3EXIA 4DLVA 1F9AA 1R1DA 4V0NA 1GQQA 5EJFA 3TM4A 4R4JA 1QANA 4R1OA 1J39A 4L85A 2C4HA 4KTVE 2ETVA 2PLAA 3WQSB 3PLAE 1P4JA 1QKKA 4GSYA 1BMDA 2BCEA 1FSGA 1WL8A 2FZ5A 1T43A 2W00A 3FD8A 3OZWA 4AUKA 3SE0A 4LMBA 4OL9A 2Y2UA 2C4TA 2OCPA 2J6BA 4D0RA 4MUYA 1PFQA 3FGZA 1MJHA 1IN7A 1Y1WI 4F3CA 2LIVA 2X9NA 1T3HA 4AICA 2XYHA 1NDHA 2P7IA 1R0LA 1EUCA 5BV7A 3VX3A 4UCXA 4X6XA 1YFKA 2PRZA 2WZBA 3CH5A 4D8XA 1Z22A 2WQ6A 3RYFB 5EKSA 1BWSA 3U80A 3R7AA 4DIEA 3DTVD 1N8R2 3FTEA 5LIPA 1NURA 2OY0A 4YTEA 1GPNA 3A1EA 4GWLA 4B6PA 2QE6A 4KB5A 3NEAA 3RJTA 1UDWA 1O96B 1ECBA 1Y4AE 3GCDA 3QUQA 1PEKE 2P2NA 4R1NA 4Y9TA 4NDNE 5BYJA 5TMPA 3U6KA 3FYTA 4RSGA 3IELA 2X2EA 1RP1A 4K3UA 1RQXA 2AE1A 2BFBB 2BZGA 4ENUA 5FTLA 1T13A 3VMHA 1QQ5A 3MGAA 3FYUA 3PQCA 4GI5A 4GUAA 4KQ9A 4Q01A 1PLJA 4RSHA 1A9ZA 2XW6A 3E9ZA 3SXUA 4BFCA 3IIIA 1J9ZA 2XBLA 5GV8A 4BL5A 5C8XA 3WLRA 3QFCA 5TPZD 3WK7A 4ER6A 3QVOA 4G36A 1QQ7A 3ND7A 1RNLA 2Q4RA 3IQXA 5FLKA 4D3XA 1M0EA 2G09A 2V7TA 4OKSA 3SOPA 3T3GA 3PSHA 4B6RA 4XTRA 3B82A 4CMBA 5H3CA 4GKAA 2AKYA 1U2QA 1YHNA 2PKXA 4Y9RA 4ARBA 1U99A 2IWRA 3UV3A 3EXFA 1Z6QA 2X0IA 3DDUA 3QV2A 2G70A 5EY5B 5ALQA 3QWBA 3F9CA 4RABA 2XEXA 5DDIP 3ZDQA 1MP0A 1UADA 2REXB 1OE0A 3HKBA 4O2BB 4BYGA 1SH7A 1YJQA 2NO0A 3GRUA 3IP8A 6Q21A 3C15C 2CW5A 4EMBA 1CZKA 2B2CA 2IXEA 3CV3A 2A0WA 1H3FA 5F5XA 2C3MA 4I50F 4ZO9A 5J1TB 3ZHQA 2QENA 4EB6A 1KBOA 1VQP1 1TF2A 3ISVA 2JA5I 1Q3TA 3PUWA 3S2YA 2D2VA 2FP4B 4FZ5A 1JFFB 3OJ0A 1N6RA 3B6KA 4J0GA 2CXXA 3FH0A 5FWXB 4NCBA 1P31A 5I45A 3EDRA 3DZBA 2WF6A 4Y1FA 3I4CA 1U0OC 2R8YA 3TRIA 1T9HA 3UWPA 3MZKB 2OTCA 1RABA 3KJZA 4MV7A 4K05A 3HMQA 4XFJA 3SXJA 4DV3B 3FE2A 2GA9A 1XX6A 2XGGA 1SXQA 1OXUA 3CX6A 2F59A 4MI1A 4YCLA 2QW8A 4KQKA 2CUKA 2D2FA 1WE2A 5K01A 5JCJD 1ACJA 1UPXA 2R9VA 1FW8A 2JGIA 4IY1A 1JVSA 1QP8A 5E9QA 1UXIA 1LDBA 2AYXA 2CLHB 1W1IA 2HLHA 2OVBA 4K9LA 4V2IA 2VHEA 3UW1A 3QXSA 1AKEA 3A32A 1CUGA 2VAXA 4Q05A 4C6TB 2BEVA 3RUAA 2HIMA 4LDNA 1JAYA 2IPXA 3RIHA 5B6JA 2WM2A 3IDZA 3NC4A 2QP4A 5CT9A 2F3SA 4Q1BA 1BCSB 1QOZA 1TW3A 4YK7A 4YECA 3TOVA 5IZ4A 4KLCA 3AF2A 1CYEA 2CMHA 1ISJA 4DDMA 2GJAA 5IZCA 1TWHI 1ULUA 2ZYRA 4O4IA 3VNVA 3TLMA 4CJXA 3WX0A 4XWGA 1P0PA 2DUWA 3ONWA 1GQRA 5EXTA 4CKEB 4PPNA 3GLGE 1ZX1A 3VYVA 1XTKA 4GZ3A 1KAHA 2HCRA 5T57A 4H7DA 4DABA 1FRVA 1ORRA 4G25A 5CYPA 3KUXA 5BURA 3JQBA 3N0VA 3LPDA 6NULA 3CVYA 5BR7A 3T5CA 5JZSA 1H66A 1UBJS 2O23A 4Q4CA 5AVWA 1YZFA 4YJHB 2DRIA 4C3ZA 3KOMA 1Z74A 2VRWA 2VSFA 5BN4B 2WI8A 4J0CA 3OPYI 3R9XB 1YMUA 3BAZA 1NQAO 5CLJA 2ZT8A 2F1HA 1S8OA 2CT8A 2GKOA 4YRBA 1O08A 2I55A 1WKBA 4QBIA 5ESWA 4MW4A 4IRXA 5FT9A 5FO1A 1TEHA 4ZYLA 4JZYA 5KVAA 5P21A 4PQYA 2VK4A 5EZYA 3X1JA 2A1IA 5KWVA 1OWNA 1N6PA 1WHTB 3C8DA 3K1ZA 4X3OA 3RT1A 5K8JB 4HLCA 2I6SA 3SVLA 2DQZA 3QTLA 3O8BA 4YDHB 1Y4DE 3WI7A 4ZP1A 3K6JA 2DWPA 3E9YA 3NATA 4R1PA 3QU2A 2PEYA 2IHTA 2OE2A 3E15A 4O0MA 4IF4A 1O6BA 4MP3A 4IZOA 3RSFA 4BU0A 3WG9A 2FW8A 1EX9A 1H2YA 1X3LA 5B1EA 3FTPA 2W93A 3KTAB 1ZVVA 3KPJA 5DKFA 5JQGB 3GRRA 2ZIGA 2VJOA 5I4KA 3KYBA 1UT6A 3QVSA 1SVIA 2H1CA 3Q5GA 2PYZA 3CUEF 4YAOA 3R76A 2X0NA 1BS1A 4MQBA 4WCVA 2WVJA 4RK7A 3U3ZA 1G5TA 4XX0A 1I94B 1PJ3A 3K7EA 1S72Z 1AKMA 1E1NA 1WZEA 2NU7B 2F3RA 2R1ZA 1X7ZA 3FPSA 3HA7A 4NBTA 4UEQA 1EK5A 3NO4A 3OAAA 4RZSA 4D46A 5ELXA 1N25A 4FGSA 4L3WA 1LX6A 2ZRFA 4ZZ1A 7AT1A 1DUVG 1AXRA 3K7AI 1R6UA 4L7VA 4WKOA 5JS1A 3JTEA 1YDMA 2F3QA 3H5LA 4A3MI 4E5NA 4G07A 1XHLA 3AH8A 3BK7A 2BFWA 4O29A 3WXMA 4D3FA 3QFFA 4CTMA 1EIWA 1HX7A 4J49A 4PU0A 4QEZA 4RQUA 4UKDA 4X71A 5PNTA 2PV0A 5JSKA 4O8CA 4CF7A 1VQPZ 1LZLA 4OLFA 1D8AA 3KJGA 2PK7A 3ZU5A 1OHHA 1NLZA 4IUDS 1SMKA 4LGVA 4CTNA 2I4IA 4DZZA 4GF5A 3CLTC 3C98A 1ODSA 3EXAA 4L9AA 1OOEA 4Z4EA 1E2NA 1RM4A 1Z5ZA 1IPFA 1YE8A 3H3XA 4PLHA 2XGSA 5E0KB 1SKBA 1KOLA 4MDHA 2NSLA 4XARA 4YRMA 1EUQA 1K7EB 2O05A 4QASA 1BXGA 3JXEA 4AF7A 4MONA 5IM4F 3TAUA 1GG5A 1XU9A 1N77A 2P8JA 2WYIA 4HADA 4MJLA 1JTEA 3D3EA 2JRLA 3F6SA 3ROEA 4P9NA 3INTA 1X38A 5EHIA 1HQYE 2WNHA 1ZNZA 3KVYA 1D4ZA 1PSWA 1Z16A 5TQ0A 4GSKA 2GVDC 3EZ2A 3HB9A 3SZLA 1TVKA 3Q8MA 4LNHA 1UZUA 3ZK8A 1DS6A 1NP7A 2HBRA 1DEXA 2HA3A 2F3PA 4LY9A 1SURA 4GEKA 3HJRA 5IAEA 2VSNA 4ID9A 1OV4A 5AIAA 3K9GA 4A3JI 3QRWA 2CLMB 1J0CA 2W98A 4N18A 3MWJA 5KNDA 2GN4A 1IY2A 1NOIA 2W4MA 2Q99A 2F1RA 3SS8A 1SXIA 1D6NA 4KFTA 1QIFA 1I4EB 2DTEA 5F51A 5AHWA 4J4HA 4YO8A 2ODQA 2QD4A 2BFPA 1E20A 3FTFA 3IIJA 1RFGE 1MJFA 4C87A 3N5CA 3H84A 3M6XA 4XR9A 1NSFA 3OEHD 1NNI1 4JGGA 1J70A 3BG0B 2QMUA 3EVBA 3FSGD 3PX3A 1XT6A 3Q85A 4GBED 1TPZA 4OHOA 1Q57A 2J9GA 3HBAA 3OE5A 4A0QA 5U1PA 1RQPA 1CVLA 1BJRE 1T9DA 2BZSA 3RODA 3HXTA 5ALXA 3HCBA 2HHHB 4Y2YA 1ZN9A 5KSZA 5KNDD 3IOMA 1XCMA 4E4YA 3RTCA 3AKDA 4Q19A 5KJEA 4DSZA 3X1WA 1RACA 3M3HA 1O5IA 2H5JA 3HFJA 4YAUA 3HYCA 3VH2A 1R6AA 4CT5A 3HCOA 2JFGA 5DCLA 1IJFA 1W36B 3FNIA 1USGA 1AH2A 2A92A 3REOA 2FPWA 2GYVA 2JIPA 3GTKI 1JAXA 2VDKB 2ZYWX 2BI8A 2BI7A 3G7NA 5IT0A 3KQNA 4QUEA 1YBAA 3BWMA 4YA6A 2QRMA 1SVMA 2QVXX 1U0SY 3F49S 3QE0A 2Y05A 2E4VA 1VXOA 3LUFA 4G0ZA 5I7WA 3TL3A 5HW0A 1U4NA 4HXYA 5HCUA 4ALLA 2WF9A 2Q3CA 4Q4DA 1JJ2Z 1Q0QA 3DDCA 3QWAA 1L8OA 4K46A 3VTKA 4L5JA 4MYHA 3LD9A 5I5GA 5TVGA 4JBLA 4IQFA 2QLVB 1RHJA 4OP3A 5GQSA 2OHVA 1F0NA 3OOHA 2ANCA 1LX7A 3DHNA 1XEFA 4H9GA 421PA 4DCMA 1TFIA 2OBNA 4HC4A 4U6SA 3JVDA 5CLHA 3T15A 3M3PA 1O9HA 2SICE 2Y27A 1PW5A 7MDHA 3AVQA 1LBEA 5LYYA 1LY1A 4KG7A 3R7DA 1HDCA 1E9AA 2JFVA 1XK7A 1IZ8A 3KQQA 3M9XA 3FZYA 5E6RA 3PQ4A 3BWDD 2VDRB 1L5ZA 1FS6A 2R6MA 2QZZA 3L7KA 3O3OB 1W47A 1R00A 2DCMA 2OXIA 5TLSA 2Y1EA 4MA0A 1RZRD 2R7AA 1UM9A 2GA8A 4EUFA 1R8YA 5ICSA 1TUGA 2XTMA 3GZTB 4EPXA 5FOUA 3EA5A 1UR5A 3TVDA 1ZIOA 1TMYA 1F51E 1XXHE 4ZO4A 2H2DA 1Q1AA 2CDCA 2X9LA 2P3LA 3PJGA 3WRYC 4GP9A 3G2LA 4BY1I 4F60A 3VR6A 4Y6LA 5L4LA 1PL6A 1NKVA 2WWTA 4EGCB 4FLMA 3AFMA 5AK0A 3AMVA 5AP9A 3LT4A 4I36A 3AVUA 3H8WA 2REOA 4W63A 2VA8A 3DVRX 2PUDA 1DRUA 3ICWA 3LVBA 2PKQP 5JV5A 1E1QD 3BTSA 2WWIA 4XCXA 5I9SA 3WQRA 5JDCA 3FCUB 4EBFA 1T4GA 1WMEA 1EPUA 1VM6A 3L4KA 1ZH6A 3IUYA 4GLOA 5JLJA 2IRWA 1IHYA 3HKEA 3IOBA 3CNQS 3B5JA 4C03A 3OZEA 2R7ZI 1EWRA 3EZ7A 3PRKE 1NI3A 4F7WA 2WRZA 4ND8A 3LECA 3VV3A 3U56A 2D3TA 3RU3A 2NU9A 5TGTA 1GRNA 3OZSA 2QI9F 4D6XA 1AGRA 4RV5A 2OYCA 3EUEA 1C3OB 3T4NB 2P9JA 4DWOA 1Q862 4WZ6A 1U2RA 3L0SA 4N6NA 5DCWA 4BWVA 5BV0A 2QAJA 1JFLA 4CLDA 3TMAA 3ZHXA 4Y2JA 1I2ZA 1GNPA 4LOLA 3QE2A 3NH9A 4Q21A 1XVLA 5DK6A 4F1KA 4BP3A 4U2KA 4XLTA 3GJ4A 1JH9A 2KSQA 3GFBA 3ABSB 3U0BA 1FQKA 2WAYA 3FROA 3IP3A 3PWTA 5LP6C 4BQOA 2WG1A 2XZLA 1YI8A 3E7XA 1XJQA 1I1OA 5IBPA 4RTLA 3K2EA 2Z2JA 4I2VA 2GJSA 2OGZA 3VZQA 4BCCA 1JEOA 1O4VA 4OX9B 3BRQA 3PVSA 4FI3C 1CW2B 3N70A 1UF9A 5LMNB 3HKZA 1H23A 4QDKA 3DVLA 2BIFA 4HDKA 3WE7A 5BWLA 5M5BA 5D3QA 4G5QA 1AF4A 4QG7A 3D4IA 4IEIA 3X1YA 4WERA 1LU9A 2ERCA 3H2IA 4LHWA 4YWHA 4COOA 1IYZA 3O8NA 3SWWA 1AHHA 2UXCB 1FFXA 3IFSA 3KOZA 5B1YA 1Y8CA 4Z0PA 3CE6A 4EG7A 2PX6A 4PXYA 4JV5B 2IS1A 1DKPA 4KHPB 4FEEA 5IKXA 5I7HA 1SK8A 2VIIA 3S44A 3WGZA 3Q7SA 3CPJB 1NM5A 2OVFA 2X0RA 3GVXA 4E6EA 2TMKA 4PC7A 1C50A 2AQ8A 4KQFA 4O5AA 5J40A 2WYWA 4MXDA 3COPA 2XLCA 1NU6A 1XD2B 2V59A 4NS4A 4Q03A 4DDUA 3ZBUA 2IK8A 5CNJA 1NSYA 4UMFA 3CLRC 1DB3A 1XLVA 3HLYA 4B4OA 4YV7A 3ZVRA 5FULA 1P2SA 3AQ4A 4L76A 1PJAA 2D00A 1LA2A 5AI6A 1E62A 1QGAA 3ANSA 4L4RA 1SBIA 4OAQA 1Y4UA 3BX1A 3NCTA 4HDSB 1SC1A 4JJ6A 5CB8A 1T4CB 2FN4A 3LP8A 2YW9A 1YS2X 3HRKA 4C04A 3RV4A 3AHCA 5B7NA 3L7YA 2Z98A 1R66A 1CY7A 2QUJA 5LZ5A 5DM0A 5ENVA 4PX9A 1GV0A 1DJOA 1ZJ5A 2Y0DA 1T3GA 2YFHA 4J0EA 2O8CA 4AG3A 5HJ5A 1KMNA 3PC6A 4ARZB 1Z38A 4D8VA 1A98A 3GT0A 4FX5A 3WLIA 3OBBA 2R8BA 1EXMA 9ABPA 2DWOA 5JLAA 2WM8A 1W8IA 2IZOA 2IC5A 2L0XA 5LDGA 3EGDA 2G67A 2WJAA 3C97A 4DLRA 1G7TA 3JQGB 5SZKB 1RAHA 4TKUA 3CC4Z 1RC1A 4Q9HA 3A6LA 1D8TA 3H5AA 5G41A 4N6GA 4E15A 2AX3A 5DMHA 3DWIA 5HTOA 2XHEA 3SIWA 2GESA 1YTUA 1SVLA 4OYHA 2ZUEA 4FLEA 4ZHQB 1U9JA 4XIGS 3BZUA 1VLAA 1O6CA 3QY9A 2RH5A 4DV5B 4NEHB 3WRXC 1L4LA 4IQGA 4EB3A 3HUTA 5FJIA 2DMRA 3URKA 5CFNA 3NFZA 4PAOA 4G1CA 1I7DA 1PR9A 2PKCA 4MI9A 4XDYA 4YPFA 1MTZA 3BC1A 4JD5A 2P28A 4NJMA 5A2GA 1I6KA 2AFIE 3EDYA 3JARA 4UHCA 2G83A 3EMKA 4WESA 4A3FI 1XTUA 1U8TA 5BV2P 4EKNB 3GA0A 1R50A 3NKVA 1YRQA 2FPPA 4M1YA 3NDIA 3CG0A 3FW1A 3E18A 3NEJA 5EE0A 5FEMA 3TLAA 5HKBA 3U44A 2IUYA 1H0SA 2GN0A 4ZT7A 1G17A 1QG2A 3BMXA 4GKVA 1D7OA 1YUMA 2FMHA 3HHEA 4JJ4A 1A9SA 4R1LA 3WR5A 2FEAA 2JJ8A 3A9VA 5PGMA 3OHMA 4BO6A 4D9MA 4NESA 3W1VA 1O97C 3O7MA 5JYCA 3O84A 2DHCA 1VCHA 3C0KA 1NJ1A 5LJIA 5GVRA 1ZH0A 3PQDA 3ZUPA 3THWA 4CZ2A 1N5JA 1Q15A 3GY0A 4ZMBA 4C2TA 3TEMA 2X2OA 5JXGA 5KVCA 1N1MA 4RENA 4I3HA 1Q7Y2 2FN9A 4LMAA 3CGGA 2DBYA 2X4GA 3DE5X 3BRWD 2AFIA 5H0IA 1D2CA 1WVGA 5INTA 4L6IA 4B45A 3G79A 1EWYA 3O31A 4G0XA 2QSZA 1PHRA 2EFHB 1V8OA 2CDBA 1ZXLA 3GPDG 3M6VA 3NXSA 5CA0A 3LQRA 2VJMB 1GNQA 2QZPA 4MDYA 2AMYA 4PPFA 4YJGB 4QZVA 1B6GA 1BCSA 1CEEA 4NBLA 4P3NA 3UGKA 4DMGA 4RTJA 3BYZA 1AGXA 1XD9A 1P75A 1SR8A 2BFMA 4BOYA 2PSJA 3P9XA 4ENQA 1KTVA 4DT1B 4KSBA 2DFLA 3UT0A 3WC4A 1MD9A 1YDHA 2Q1XA 4OB6A 5ALMA 4D9JA 4G9EA 5KU1A 3THYA 1GYPA 2B35A 2X76A 1ZUWA 4JVOA 1NF9A 4FVTA 2OGTA 3AESA 3OF5A 4TKMA 4CETA 2BKAA 2CHGA 4RJIA 2AF3C 2FMFA 3PDWA 1V16A 5E95A 3NUGA 1Y9ZA 4UJ3A 5K0CA 3TECE 3F5MA 1XMSA 5AFSA 2R8OA 4GSLA 4GOJA 4CI0B 1U9CA 1ZMBA 1T1SA 1NT4A 3GWGA 3JAKA 1ZD4A 4FP9A 3OFNA 4H3SA 3UXMA 3EGXB 3E9MA 1KE2A 3SF8A 3WIVA 1DKLA 2HWYA 2PMEA 4E12A 1SOMA 2VT3A 2WF5A 4K28A 3VTFA 2AI3A 4EATA 5JFGA 5JSHA 1Z28A 1JHAA 1HWYA 3RC7A 4E5DA 4R3WA 2O1WA 3CRW1 1XZAA 4ZEWA 4BNKA 4J0IA 4NHEA 3AVXA 4B6GA 4BNVA 4YXWD 3G1UA 2RHWA 4K8RB 3S2FA 3EDOA 2O5VA 2GD1O 2J3KA 3L0YA 4ZXPA 5IULC 1QGUB 5KNCA 3MPOA 1ZNWA 1ZSYA 1DXQA 3PPIA 2QM3A 5K4GA 3BJRA 3HKBB 4O2BA 5L3RA 2AI2A 2ID7A 2ZUCA 1PR0A 1PU2A 4E2XA 3EGXA 4X1YB 1G4UR 1NATA 3FCXA 4KBGA 5KQSA 2K4MA 3EGWA 3EMBA 5TMBA 1AKYA 3I37X 1YJW1 2OC4A 4UFPA 2J87A 1OWPA 1IB6A 1SCAA 2FEMA 4BE4A 5F98A 3DZGA 1JB1A 1MO5A 3VR2D 3JQQA 1CE8B 3IA7A 3AIIA 4NPHA 4C6RA 1LUAA 1WB4A 2D1RA 4QATA 3ZZNA 5J4LA 1DKOA 2C2WA 2HIGA 2J4CA 1PD0A 1ZG3A 1BD3A 1P91A 5D7NA 1AO0A 1B73A 3RT9A 1TWGI 1NQWA 2YUTA 5KHLB 4NZ9A 5WRFA 3R3VA 3WLFA 1JEDA 5E1OA 1XRPA 1INLA 4W1QA 1GPJA 1NVKA 3JYLA 3WOHA 5A4DA 5JMOA 4OMFG 1P2GA 4XFKA 1G0NA 4AZTA 2RT9A 1NQUA 2VHTA 3EISA 4EMUA 2C77A 4FWBA 4ISBA 3DKVA 4X8HA 5EUCA 2JKYA 3UV6A 4R41A 3PGLA 2CFOA 4AX4A 3BL5A 1VL0A 3PGJA 3ZHUA 3FIUA 1NGSA 3FR8A 4H6XA 1R8QA 2FAXA 1G1MA 1OXKB 2INGX 3GNQA 1H8ED 2XGOA 3KUCA 4FBMA 4JB0A 3EQ6A 4H1UA 3PWSA 1VQ9Z 1QH8A 3K8YA 4UW9A 5JO9A 1TWCI 3SKVA 5BQFA 4HDCA 3LLSA 1V1JA 2XDAA 2XV1A 3GA7A 5GM2A 3LUPA 5AI8A 5AVQA 1EWKA 1A2OA 1V7ZA 2V4UA 3HB0A 4IIUA 1II8B 4NPAA 1B2LA 1IHDA 3B6JA 1T5SA 2DE0X 3HB4X 2Z8ZA 2H2AA 4G0PA 3RSZA 3NHJA 2IY8A 1ISPA 3S0JA 3TFWA 1YS1X 1WPGA 1FUYB 3QKRB 2Q21A 4MYRA 3IMFA 1ECJA 3BORA 5GJVC 4DC0A 2DPHA 2W2VA 1AGPA 4N8SA 1POXA 2GRJA 4LN1A 4QTTB 4OP2A 2VYND 2IUEA 3DZIA 4L8LA 2C99A 4N49A 2GVZC 2HFKA 1ULTA 3DXYA 3NCHA 1Z47A 3LHDA 1QZUA 1YVRA 2Y1GA 4C4AA 5H4GA 4XD7A 4QHYA 3OFJA 2C7RA 1U0BB 1XZCA 3TB4A 3L8MA 3LUKA 3VISA 4CCYA 5GZ3A 1CUFA 5B4UA 3IRVA 1HKUA 4WESB 4XAQA 3JV7A 4P2GA 4H31A 1P6XA 2GETA 2GKSA 3J81b 3F3MA 4I55B 4JLDA 4Q0MA 4X54A 1OIXA 1IOWA 4KX5A 4U63A 4TLCA 2NT4A 3KOYA 4QWMA 2HDNB 1YFZA 3ZVNA 3U9LA 3TPCA 4A23A 1JHOA 2BR5A 4LC0A 3I64A 4NICA 5KYVA 3VO9A 5H16A 3R41A 2G5GX 2KMLA 3D3KA 2HJRA 2Z5GA 3GLGA 1DC4A 2XKJE 5D00A 1V4BA 2PWZA 1TK9A 5GONB 4BQNA 4PAGA 2H52A 1J0XO 1Q7GA 2P9CA 4K1XA 2CF6A 4NNJA 4MB0A 3VSEA 1FLNA 3T5GA 5C7IO 1V16B 1T9AA 3KLBA 4WPGA 5CX1A 3N53A 4YRRA 2RBLA 1IUPA 4HWGA 3F4BA 1BROA 1WMAA 1M2OB 2PGAA 2JLSA 1IQPA 4F45A 4XYGA 1OBHA 2Q3EA 3G7UA 4QUJA 3REGA 3FF1A 1RO0A 1B14A 1KBQA 1IE3A 1IOVA 4JEUA 4NG5A 4MX8A 3GEDA 3RG8A 3WJ2A 5L51A 4KRFA 2P6PA 3EVCA 1WMBA 4PR0A 4Q4JA 4RJLA 2A4KA 2Q5QA 2JDIA 3PXXA 3VNAA 5IAOA 5DWDA 4PRKA 4XEUA 5E6SA 1YGYA 2WAAA 4CIDA 4KTTE 3VMIA 1XZNA 2PA0A 4A0RA 1XF9A 1MDBA 2P9QA 4DYHA 4ZIRA 4I0WB 1OVMA 1J8QA 3O03A 3STUA 3ZE8A 4RKQA 5MN6A 2J48A 2WSSD 4N4AA 3V55A 1M74A 1BYIA 1V4NA 4DQLA 3H9GA 2IH2A 3NWPA 2Q9UA 2QJOA 5KYYA 4I2NA 3WICA 1G9XA 2WMYA 3BIOA 3GGCA 1ODKA 4D3YA 1JECA 3O4RA 1I2AA 4RGBA 5F4BA 2FSPA 3O4VA 1YI0A 2AQIA 3O4JA 4DM3A 3OPYA 4JY7A 5HZGA 1T2UA 3DOUA 2GARA 3PGXA 2C98A 4ZV9A 3Q15C 4PZ9A 4BKQA 1PQWA 3AR6A 2O3RA 5AO9A 3WFIA 5KJ6A 1JWBB 1OGJA 3CVJA 3SSAA 3AL0C 4GXNA 5LQDA 1IVYA 2G6TA 3HVJA 2ZSJA 1R5BA 2C1ZA 5SV2A 2ZQZA 4Y7DA 4IJ5A 3HCCA 3X2SA 1OY1A 2E89A 4UE2A 4E88A 3QSGA 3K0CA 1GIAA 3Q5EA 5JSZA 4YMIA 3V5NA 2JIRA 2HBZA 3QEMB 2EEPA 4MWTA 5IC6A 3ZU6A 1ST2A 1PFUA 3BA6A 3L0CA 1CY8A 5F1OA 1DXHA 2XKKA 2A0FA 2NXJA 3PD0A 5ALIA 1NP6A 3Q98A 3DB1A 5JD5A 1PVVA 1PG0A 1X15A 3E8MA 3NHLA 3AJAA 2Y4OA 3NHRA 1OZAA 2XDQB 3PFHA 4KAAA 4OTZA 3P19A 1BG6A 3ZS9A 2WTUA 3RHZA 1SQSA 1S3GA 4D0LB 4QSHA 5EWLB 1NNEA 2Q9AA 3FKII 3PC8A 5FOVA 1UDBA 2P9FA 3FFBA 2RI0A 4JB2A 2O8DB 5LVAA 5FV7A 1O0SA 1VQ8Z 1KK1A 2ES4A 2O1EA 5ELLA 1RIFA 4MUIA 1ZU4A 4LE1A 5DGTA 4CMIB 2P2SA 4ZA2A 3ESRA 4BKRA 3KC2A 1YBMA 1GRRA 5ESRA 3OU7A 1E94E 5SY6A 2QM8A 2UXDB 3WMEA 1X80A 3BA1A 1D7AA 4Y30A 2FR1A 4ZFNA 1M1YB 3ONNA 3NOQA 1C7FA 2HZ7A 4FZVA 4JELA 4UXHA 1GKUB 5L8VA 2XUFA 3N8GA 5JNVA 1M6EX 1XDWA 3U4QB 4M2LA 1U11A 1VHLA 3HDYA 4MW7A 3L6CA 3P32A 4KNVA 1NJ2A 1UMDA 1CERA 3HDHA 4QGGA 3VC1A 4RXUA 2O7RA 4ZVVA 1WKCA 2GEJA 3CIOA 3MZLB 4UOQA 4D6PA 2VWGA 3EZYA 1T4CA 3JSXA 1I7QB 1Z8DA 2NZVG 4WIAA 3I12A 4DIBA 4XR4A 1ZOOA 3OUUA 1WB6A 2PPVA 1ISGA 4M1SA 5IDXA 3AEQA 5GZ6A 4GPZA 2H4WA 3ZH2A 1KMMA 1M2GA 1C8BA 1L5RA 1YJ91 1FMCA 1LC0A 1L7BA 3H42B 3HCNA 3GPBA 3INNA 2IIQA 1G19A 2WAXA 3SX4A 3T95A 3DP7A 4ZI5A 3L9WA 1Q7EA 3RTBA 1HMPA 1ORTA 4HAVA 1H5UA 3VH1A 3IJRA 4P7KA 4N47A 3C7KA 2RHRA 1R8SA 4F97A 1KZ4A 2H3HA 2VNKA 1V3UA 4EG8A 1UAYA 2ZYHA 2H4HA 1HEIA 1K7XB 4MV3A 3THSA 3R8FA 4YI3A 1B15A 5BPHA 1B2RA 3KSZO 1I32A 3CN7A 2HTFA 5ALHA 3FZGA 3LCCA 4IJUA 3ZNPA 4RF4A 1FTSA 2NP7A 2HXSA 2O53A 1W0KD 2YN2A 3T34A 2N1MA 2YASA 1MQSA 5JROA 2WJVA 3NBQA 4KLNA 2NU9B 4LHSA 4DV0B 9GPBA 3LC1O 1Y1SA 4KJZA 1CR4A 4JVLA 1AQLA 2VQDA 1V43A 2YOHA 3IDOA 4Q1VA 5CLQA 4CTKA 4ALIA 2C7QA 1P61B 2AYYA 2QY6A 4PLCA 3UJCA 4CN9A 3GOHA 1Z45A 4V39A 4JUBA 2WFAA 4BJ6A 2E4AA 3HP7A 3DFFA 2MSLA 4XSGA 1UJ5A 3M3DA 2GN2A 1T4MA 2V65A 3A1FA 1U2EA 3VHQA 1BAPA 1GDDA 1CP2A 2E21A 1XGKA 3ERCA 4UVEA 2LW7A 1Z2OX 4FEAA 4B7ZA 4BMVA 4M37A 1W46A 4LQLA 1AHPA 2PU7A 2JMOA 3P8ZA 1H22A 3WRYA 4YAEA 2O9JA 5B6PA 3EIEA 5JRJA 4MQUA 5HJEA 2Q7XA 2MMCA 3K0KA 3W2TA 1E58A 1XA3A 4OXKA 1DCKA 1J97A 1DPGA 3AYXB 3X0DA 1J8YF 3VR1A 1N33B 3NTXA 3TUJC 3LVRE 4RANA 2PMZA 3SEQA 1I7PA 2P1ZA 2OGSA 2GBPA 4ISCA 2FMIA 5JXHA 1NFFA 3HQ4O 5DX0A 1ADBA 4PVDA 4WL0A 5TEVA 1YR7A 2YFKA 1NG1A 1WLSA 1E2DA 3RUCA 2HKIA 5KTYA 5FXMA 2RDMA 4DANA 3GN1A 2ZRAA 6YASA 2WIJA 3BQMB 5LLDA 2ISCA 2V4ZA 4TVBA 4XGRA 3IXMA 4CCAA 5ALZA 1E6CA 1R88A 1RJWA 2QVCA 2NZUG 2V45A 1JDVA 1PS8A 2R4UA 5AKIA 1G5QA 4IM7A 1W581 3WB0A 1RAIA 1SHJA 3UJ8A 3WYGA 4IOLA 4JB3A 1D2NA 4QE3A 3CRVA 2OR3A 4X61A 2IL1A 1FXSA 3UUFA 2PL5A 1XNRB 2EFDB 3D2LA 1DOAA 1B74A 1D9XA 1X0XA 3K6KA 1HURA 4GZ5A 4X1KA 5K1ZA 1XNGA 3CUYA 4IG4A 4JC4A 4LXIA 5ERYA 1ONNA 3S40A 2Z4SA 1T8YA 1W6RA 3L2OB 3G8AA 2B61A 2NO6A 2VZ0A 4UBKA 3KD3A 5FPQA 3SLGA 4G67A 1P4SA 3NH5A 4ZI3A 3BEDA 4BC0A 4D3DA 2FOIA 2HCFA 2H1SA 2HL6A 2QLMA 3EOBI 1ZDMA 1EUDA 2CVHA 4FN4A 4HKTA 4NEQA 5DP1A 4J6FA 4NF2A 5DZSA 3BICA 5FTNA 2G9NA 3RSLA 1X2BA 4EZEA 1UXJA 2QRUA 5CK4A 1OW3B 3DE3X 3K4PA 3NUZA 3RG2A 1G6OA 3M89A 3V6MA 4XIFA 3BGIA 1TZCA 2WOJA 4FYKA 5AD1A 3OTOB 4JUIA 1HETA 4Q4HB 3QKTA 5KJFA 3QEJA 4E3ZA 5KTOA 1MFPA 1C4OA 1YVPA 3PCTA 2PN1A 1SCUB 3L3BA 2QKDA 1H2FA 2FMKA 2IEYA 3DM9B 4QVKA 4RCVA 2G5TA 4RYLA 2BI4A 1MG0A 4UC0A 2WJYA 5DBGA 3TWOA 3ZDAA 1DZ3A 4XYEA 1N92A 4UVGA 1T8SA 4FHFA 4HGQA 2NVUB 4EKEA 5B37A 5FP0A 2WSIA 4F84A 5L3QA 3EPPA 5BWCA 2LZ0A 1G20E 1U8ZA 1K2VN 3ZDFA 4O63O 4F3RA 4QRIA 3WJ7A 3UG7A 2EP8A 1TKAA 4Z2AA 1BVHA 4B43A 1JR4A 2BZ0A 2ODEA 2YFQA 1U1IA 3GJ6A 4S3MA 3MINA 3PNSA 4ASUD 3LBHA 5CBKA 1G8YA 4ITUA 3IBGA 4PGAA 2EFYA 3WGLA 3I92A 1XHFA 5F3WB 2OV8A 4L51A 3FYSA 3O8QB 2H4XA 3CNHA 1XZGA 5EWMB 4UBNA 1JR6A 3CCJZ 4RMIA 1BHJA 4INAA 1ZMTA 1EI9A 5I9TA 3I83A 2VDPB 4K6HA 3VU9B 5G3ZA 1Z9BA 1XE3A 2E9HA 3BMOB 2VTDA 1MH1A 3FPFA 1F8GA 2GTHA 3GJ5A 3C48A 4MW9A 4PCLA 3PIDA 3PJDA 4M49A 4FB5A 5IYZA 4B17A 3WV5A 1JI0A 3EXHB 1HXHA 3MRVA 4MWDA 4YMSA 1JA9A 3ZHVA 1EP3B 4G5YA 2YIMA 2ODPA 4MUEA 4X1KB 1BE0A 1VRWA 1LWOA 2IYQA 1LRLA 3K6RA 4PZPA 1Z4MA 4NARA 2WTBA 3CC41 1FCJA 2Y1OA 3CEPB 3ESXA 1EG2A 4URUR 4XUGB 5IUKC 3GDOA 5IHXA 1IB0A 5JR3A 4RHXA 3T5AA 3AB3A 4WZAA 1TJNA 5TGZA 3K05A 3HN7A 1RWXA 2WIFA 4FS3A 3C1UA 1DTEA 3QMPA 1UPUA 2OMKA 2VYQA 2FUNB 4PZYA 2W04A 4HO1X 1WY7A 1M7HA 1MGPA 3SI7A 2O48X 2HRQA 1A5TA 3GW8A 4U8GA 4A0HA 5CPFA 3DZCA 3VGJA 4W99A 1JIJA 5EPEA 3ORQA 1SKYB 4A8JA 1GG8A 2D0IA 4HSEA 1VA4A 2HN9A 3C8HA 1R12A 4G5RA 2ZRMA 4DNXA 1S1MA 1O95D 3KL2A 2H1WA 3EW9A 4HDOB 1PR6A 4MQ5A 4TL6A 4ME6A 2ZRIA 2PYIA 3WLQA 1NY6A 3WIEA 3FYCA 3QG1A 3MN1A 1HYGA 4P82A 4DY6A 1MC1A 2QI9C 1F7VA 3HLKA 3ISJA 4TSRA 1EVKA 1U98A 1K6MA 4F9FA 1A9TA 1IBMB 3TNLA 4CHTA 4E07A 3DB2A 4ZJZA 3KIHA 2E4UA 3F6BX 3QM1A 3WKAA 3B12A 1IY8A 1E4EA 2F55A 2A57A 4KUGA 3HHPA 3HI4A 3WADA 1KJYA 3BUSA 1JKXA 1E9VA 2MDTA 5EQJB 4UNPA 1SQ5A 2ZUTA 2J6AA 3LUGA 3DNFA 1O96A 2ET6A 1GAXA 1E2IA 1V8DA 2QYOA 3QHAA 4KXFB 2H8KA 1SZCA 3IS3A 2J9FB 4QRHA 5DNWA 4NMWA 2YMLA 4V24A 1JXQA 4WOKA 5DI3B 1J9EA 3SYRA 2EKQA 4KZKA 3QHPA 1A9QA 4ZVPA 1MJGA 3Q0EA 1QP4A 3T9DA 1RYZA 1XF1A 1YR6A 3JX9A 2D5AA 3DAGA 2BY4A 2EWMA 4HGNA 4W9NA 4OQMA 5JXJA 5KYXA 3A6PC 3NYWA 1JJ2Y 5DYIA 3AFOA 1QYWA 3C7TA 3GHYA 3FOBA 3INYA 5E2AA 5AQEA 2CFSA 4K9OA 1Z6AA 4TTIA 5C1IA 1HDYA 3VUFA 4KO4S 2R85A 3Q7IA 4EDHA 3ETNA 1Y3IA 3CKMA 3WA6A 4BTLA 1BTOA 1SHTX 2ZQYA 3IA2A 4AO6A 4B44A 2Z09A 1FDUA 4L5IA 1KQ3A 1VXRA 1SIWA 2AMLA 2Q0QA 2Z58A 3KWMA 3PGVA 1E9CA 3PPYA 4JX9A 4MULA 4TSKA 3W7BA 5G4KB 1U9IA 3Q1KA 4G0NA 1USPA 3TLKA 5JH7A 2AA3A 5CUQA 4FFLA 1LEHA 1JALA 2DFNA 3L4EA 3NHBA 3T7CA 4YRTA 5DHQA 6AT1A 5G1PA 2JA8I 1NJ8A 4LA4A 4FK8A 4UE6A 1L7OA 2BMAA 3AUJB 1UJNA 1Z13A 4BLVA 1ZBQA 2PGNA 3KPWA 3PITA 4EB6B 3WAGA 1X1BA 3LCJA 1E6KA 3OWHA 1G21E 3HFSA 4HNGA 5A3VA 3GLIE 2QPAA 3VZRA 3DAFA 3CW9A 3OFND 4PIPA 2YVQA 5GGYA 3EF0A 4NQZA 1QNFA 4ZOQI 1LPMA 3D3NA 4CEIB 2IU6A 3TDNA 3FJ1A 3TEFA 3QY0A 5E6UA 1JQ5A 2Z3ZA 8MHTA 4G0WA 4TT3A 1A4UA 3N58A 4TV8A 1HYBA 1YZ3A 4I3FA 4UTRA 1C8KA 4GPEA 1UK8A 1CD5A 2CJFA 2XNSA 1GUYA 3V1NA 1Y82A 1B76A 1E1CB 1FYEA 3E84A 3DZKA 1W0KA 4KXNA 1EMDA 2WM3A 3BM5A 4DJTA 3CEMA 2XA2A 1DJLA 1MGOA 2OLJA 3O8DA 3NHKA 4QOIA 3IURA 1N2FA 4HCJA 2COUA 2D0PB 5FL7D 4AS3A 1FFSA 3I42A 2AMJA 3OJFA 1R9GA 1WY5A 1EE9A 1J5PA 2Z5LA 4L4SA 2HQSA 4Q4JB 3REQB 1VJTA 2QN6A 1CB7A 1JLRA 1D09A 2J4DA 2I62A 3CUSA 2MMGA 2XD9A 2VT6A 3HPRA 2VJNA 4QXOA 4FE4A 5KOJA 2OP0A 1KDYA 3RVBA 1FFAA 1WDLA 2QA5A 2NUPA 3N07A 2CBZA 4JL6A 5HBGA 2GRAA 4PZ0A 3VC7A 4B3CA 3ZD7A 3OIWA 1S8FA 1WW2A 2ZG6A 2XYPA 2FRDA 3NBAA 1EDOA 2FX2A 3QP9A 4L5CA 4TMFA 5GONA 4YRNA 3NHWA 3NEPX 2IH4A 1G291 3D02A 4ZV7A 2VP3A 2B3DA 3ETGA 3I6IA 2LV8A 1KYWA 4Z0NA 4QKQA 3FI0A 1MAVA 2GEUA 2OOXB 3RS7A 2ZS7A 4KPUA 4AO8A 1ZM4A 1IBKB 1FDVA 1PJLA 1RKQA 3EIWA 4MTCA 3PF8A 5ITSA 1FFWA 5TT0A 2RGNA 1SWVA 1R5JA 2ZKIA 1RYHA 2OGUA 2WZDA 4M4SA 1EA7A 1YIT1 1GPYA 5HSGA 5FHRA 3S2ZA 3ZV3A 1FRFS 1UFVA 3BBPA 3LL4A 3RVRA 1DFGA 1HI9A 3BXGA 8ABPA 3B6EA 3KEGA 5HS6A 3H05A 3DV0A 1E9SA 3Q2OA 5AWFC 5I8ZA 4DWJA 5JU6A 3C6QA 3AEUA 2MU1A 4W5JA 2LCIA 5IDWA 1ZK4A 2YXBA 4OH7A 4TKLA 1LDGA 2PX3A 3C39A 2WWHA 1HYHA 3SSMA 1PW7A 2ZCUA 3UN1A 2VAVA 2Z2KA 5KWSA 1OTXA 5I9LA 1XMVA 3PLNA 5SYMA 4Q7QA 3NWBA 4TS9A 3IQIX 4G3XA 2HRDA 4CEHA 3WLMA 2IKQA 2ZB7A 3PEUA 2ZBVA 3GP3A 1OYOA 5JJBA 2W2KA 1NT2A 2C2BA 3IB3A 3PXUA 3A6ZA 3FX2A 4UM7A 5LD2B 4B2PA 3G4S1 3WJ1A 5ARCA 1KHHA 1T1EA 2NVWA 2X5KO 4FOTA 4BV9A 4YUYA 4OVKA 1KJZA 3VC3A 4RTPA 1B00A 4V0QA 1L7PA 2QVBA 5KOHB 1TT5A 2OXTA 2WC1A 3K2BA 1K06A 3O74A 1ETUA 3UKOA 4ZEOA 1YS7A 4YC7A 1R74A 5D1NA 3T0IA 4BO5A 4EK9A 4DQKA 2XCSB 1N3IA 7ABPA 3IBYA 1FTQA 3EIXA 3AESB 3JATA 1L7MA 5A3RA 5KTKA 4ZYYA 3T9FA 1R6DA 3AU8A 1A9YA 1X8KA 3KR9A 3L01A 3L7OA 4M0DA 1UQRA 3FUUA 4EMSA 1V5GA 1ISRA 4QU0A 3QX7A 4IJMA 5BNFA 2VL7A 1PNVA 2QTGA 1GYQA 1Z4PX 3A7EA 5JBNA 1QS0A 2AOVA 1LK5A 3MK31 3PTAA 1M6NA 2NUAB 2AG0A 2HPHA 3IXQA 2ZUFA 1GTZA 3NVAA 5LNK1 3KJIA 2OB2A 3QWIA 5EAIA 2YV4A 2A9PA 2OAEA 4HAXA 4Q9DA 1KU6A 4LQ4A 3AM3A 4EVRA 5HK9A 1W7AA 4HNSA 1UP6A 2RG7A 5ALWA 1DLIA 3BD8A 2I1WA 3HTXA 4ZYWA 1EXWA 1G8GA 5DTJA 3UWDA 2CXHA 4BNUA 2W6QA 1VKRA 2NACA 4DKXA 3GGDA 5GV7A 3T99A 4EENA 1QR6A 1FFGA 2NXCA 1DG3A 4JI3B 4LNUA 1B8OA 2I1QA 3FKQA 1T26A 3OURA 2GEVA 2ALJA 1DAGA 4Y2UA 4FDUA 2EG9A 2GJ9A 4MB2A 4QFCA 3TSCA 3D81A 4GICA 2WJGA 4UNSA 5FHQA 3SN6A 4KR3A 1ZD3A 3FBWA 2CDAA 2CFIA 4Q7JB 4WQMA 2WU1A 2ZIXB 3FAKA 5TPZA 1EUZA 2VT7A 2LRHA 4YNBA 1AG9A 3G71Z 3JASB 1JPUA 2RCYA 1YOBA 2YXEA 3HV2A 3Q88A 4DNOA 4JGBA 3DKIA 3TOCA 2RKWA 3AFHA 4OA8A 2FEOA 3KRTA 3PQ8A 3G2QA 5CCXA 4UREA 4DIMA 3OQ1A 2X19A 1TCCA 1Z29A 4EDFA 1I6WA 2J7KA 4HLUC 2DT5A 1E6LA 3LFTA 5KQPA 5IVHA 2IBTA 1VQL1 2GEBA 5A2Qf 4BO7A 1VB3A 2K7FA 1XWFA 2VHYA 3NOVA 1NHGA 1AQYA 1AS0A 4IJ6A 2AB0A 2FJUA 5E4JA 4WKGA 3EFOB 3TZKA 3Q8KA 1KRLA 3FCSB 4A2WA 4CIAA 1DKQA 4G9GA 3KLNA 2E5FA 3V32A 2JCSA 4U0KA 4EFKA 3D2CA 1T6XA 3K2IA 2UYHA 4AUMA 1QWSA 5DH9A 1Y8QB 2OFPA 1BKDR 4FSHA 4HDMA 3I73A 3BD7A 4YAGA 1B42A 2JS7A 3F3SA 3AUAA 4FHGA 5KOHA 4O2AA 2M6KA 2VZ9A 2Q4OA 4EPRA 1B0AA 4MV5A 3LC2O 4YJGA 4BBAA 3WRVA 2VWPA 4J2OA 4OQPA 3GFOA 4BB6A 3O9VA 2Q3MA 3T54A 1DX6A 4UZSA 5AKZA 4AZWA 5JASA 1HT2E 1BCRB 1N8SA 4DLZA 2DF8A 2YKGA 3I9NA 2H4YA 2XOKA 2PD3A 4BRSA 1CVIA 2I4NA 4TYNA 2AGVA 5BSVA 3JRXA 4EYGA 1U2TA 2DHQA 2HU2A 1WIIA 1DWUA 2X2PA 1DELA 2C96A 4KFSA 3BXFA 3PHLA 1ZQ9A 3QITA 4UEJA 5AR1A 2VP2A 4TVKA 2ISSD 2H9AA 2QRNA 4L4XA 2P78A 2XZDA 3JQ7A 4DRXB 3FB1A 4OIFA 2YV1A 4WH0A 1BXRB 1Z39A 5COQA 3TLZA 3B8EA 5C1DA 1X1TA 1IAVA 1JZTA 1QQ6A 3K35A 1E1KA 3ADOA 4AK9A 1IN4A 2JPDA 4NH1C 3QMMA 3I9MA 2VFAA 2XUQA 4N8DA 4IZIA 1Z2CA 3EA0A 1DBRA 1E63A 2ON6A 5DPMA 1P2FA 1XR3A 3KHTA 3ANLA 5ILOA 4KXWA 3CM0A 4BMDA 4D2IA 1XSEA 4LKOA 5TE9A 1R7RA 1VG9B 2E4YA 3GEGA 3OZXA 2Q5FA 2HWXA 2YZGA 3CME1 3NJRA 4IILA 1K75A 4TWAA 1Y8ZA 3OO1A 1OREA 1PUIA 3G5UA 3Q1LA 4B6SA 4PHHA 2FB9A 1WPXA 1NYLA 1DMRA 2SECE 1AK9A 2ODBA 3H9QA 4ZODA 1PVDA 4Y2VA 2B4YA 3GUZA 4N40A 4MLCA 1CF9A 1R37A 2YQ5A 3ORRA 1YQWA 4AY6A 3KHUA 3KXKA 3GLSA 4KQCA 2EU8A 3R7SA 3OLWA 3HGQA 1O03A 4QFBA 1K88A 3SBDA 3J80A 1LXCA 3IIMA 5KX5F 3RC8A 1CUZA 4MWBA 5B30A 1CP3A 3E2IA 3V42A 3L1IA 3BAFA 4ARZA 5FA8A 3OFKA 4ZTBA 1WCIA 2F00A 2RGAA 2E7ZA 4P53A 5DASA 4DMRA 2C8LA 1ISIA 1KYVA 3FA2A 2UVDA 5G53C 3T06B 4KQJA 4DVJA 4NBHA 3NTQA 3S81A 3HB5X 1WUIS 2RBKA 2ZSBA 3UXHA 3P9KA 5HQ3B 4MV8A 3KTOA 3W0LB 3K53A 4OGLA 3UFBA 4M99A 3UT6A 3PUKA 3VAAA 5E8RA 3SJAA 1C30B 4DA6A 1XLUA 1QGUA 4LYHA 1D6JA 4KPYA 5FTJA 3C3BA 2WVGA 4FMPA 4M9SA 2MTBA 1QOPB 3NWEA 1IG3A 1C9MA 1N7GA 1RJGA 1A8HA 1SN7A 3OA0A 3GRCA 1LBHA 4P7GA 1UXOA 1VE9A 3KSBC 4LWPA 5LZ2A 1FXWF 2PZJA 3M1LA 1R9NA 2DUJA 2WZQA 4KDCA 5KTMA 4TZTA 3SC2B 3TQOA 8OHMA 3FFAA 1IIRA 1LLFA 1SXHA 3KU1A 1J2RA 1EKXA 1YMQA 3NBMA 1ZONA 1NV8A 1R0WA 3MT8A 5AI4A 4DJFC 3T3HA 2DM6A 3TRDA 3LDAA 2H92A 1X13A 2HV8A 1J1ZA 2GXQA 5L6MB 2G25A 5HP4A 2DFPA 3JTMA 1CNMA 4TT8A 4BHTA 1ZR2A 4C4OA 3NJ4A 3MA0A 4RTMA 5IG2A 2J6HA 2QLLA 2OENG 3NC1C 4C0SA 4OU5A 1K86A 8LDHA 3L8YA 4FFOA 2X3FA 3AI7A 4KSYA 2VDVE 5FX2A 4WZBB 5IUJC 7ADHA 1STOA 4R2LA 3TDMA 3LOUA 3HACA 4H27A 4MAAA 4N0DA 4RS4A 5JQWA 3ZE1B 4Z4QA 4L2IA 5EIOA 2GZHA 3CN9A 5TB5A 1QLWA 2BTOA 1SQGA 3KT0A 1V96A 3M6MD 4IGIA 4P3YA 4TMTA 4PN3A 4EUKA 1CQIB 3L79A 5KSOA 3ONVA 2ORYA 2HH9A 3KB2A 5FOWA 2F4MA 2OB1A 3RTAA 4BJ5A 1P5ZB 2R92I 3GUUA 1Q7RA 4HMPA 1C3VA 4WAUA 1VA5A 2XRZA 3GYGA 3LIPA 4YCSA 3D8HA 1DGQA 3E9CA 5KC9A 5F1YA 2BFEA 3C4VA 3GVHA 4X9XA 5IXYA 3UO8B 3THRA 4O4LA 3LQFA 4PSVA 2RJ3A