2P04A

2.1 ang structure of the dimerized pas domain of signal transduction histidine kinase from nostoc punctiforme pcc 73102 with homology to the h-noxa/h-noba domain of the soluble guanylyl cyclase
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
107
structure length
107
Chain Sequence
b'MAPPHLTLSPELLAKAFPFHFAFSRNREIVQTGEVLERISPEPLVGKLIEQHFQINRPKILIDFDAISKQPRALFILEFLHNGMQLKGQMMYQPEEEVIFFLGSPWI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords signal transduction histidine kinase
publication title PAS-mediated dimerization of soluble guanylyl cyclase revealed by signal transduction histidine kinase domain crystal structure.
pubmed doi rcsb
source organism Nostoc punctiforme
molecule tags Transferase
total genus 22
structure length 107
sequence length 107
chains with identical sequence B
ec nomenclature ec 2.7.3.-:
pdb deposition date 2007-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07701 HNOBA Heme NO binding associated
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.260 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2p04A00
2P08A 4GJ4A 2P04A
chains in the Genus database with same CATH superfamily
4Q8IA 1FOFA 1K56D 4OLGA 3NOTC 4R70A 2G2WA 1PWGA 2WZZA 3TW8A 2P04A 2WK0A 3QP5A 2JE5A 2XQZA 1BLPA 4EBNA 5DKKA 3MZDA 4O7DA 1BUEA 3HLWA 2FFFB 1MBLA 3NHQA 4K91A 2HJ9C 1PWDA 4GOGA 2QWSA 2ZMVA 3MXSA 3UB6A 2WGWA 3VP1A 4EERA 2V2FF 1VB6A 4I38A 3OZHA 5A92A 1G28A 4DDSA 4Y0OA 3TOIA 4MCWA 2JKRM 3ZDJA 2NUTC 2K31A 4N1HA 3UPOA 1BYWA 5HAPA 3FKVA 4DE0A 2FFYA 2Y2OA 4EBLA 3S7OA 1VM1A 1S0WA 2EX2A 1JTDA 1STZA 3Q7VA 2XSSA 1QMFA 3F1NA 4B93A 2Y2QA 3K3DA 2W3DA 3T12B 1IOUA 4DF6A 5J8XA 5F82A 3OPPA 3VSLA 2PYRA 4Z1WA 2ZQCA 3MJQA 3NECA 5CX7A 5KSHA 3N7WA 2CMNA 4HH2A 1K55A 2A24A 1ERQA 3HUOA 1PZOA 1AXBA 4NXGA 2Y2JA 1FIKA 2DMWA 3KYQA 3VE3A 3E4OA 4LRZE 3VV4A 2YKFA 3BW6A 5LBRA 1Y28A 3QNCA 5FQQA 2GX5A 3P98A 5CHUA 2ZMFA 4KZ6A 4FH2A 1NY0A 4Y2FA 3CWFA 2V1AA 1O07A 3ZNYA 4OLDA 5BOHA 5F69A 3ZG5A 5FQIA 1YLTA 5GLAA 3TE8A 5CEBA 4G3VA 3MKEA 3QHYA 2P08A 4GHIB 5E2FA 1T19A 4P0MA 3UPNA 3LEZA 2B02A 3VFFA 2OLUA 3PBSA 1K6SA 3T4QA 2Y2IA 3GR2A 4DDYA 2G7UA 5FAOA 4HP9A 4OQIA 3HJKA 2KLIA 1KE4A 3LI8A 4JBFA 3PBRA 4HESA 4ME4A 5FQ9A 2H10A 4KZ3A 5IU1A 4WL9A 3IWOA 2PT7A 3WS1A 3B42A 1CI8A 2XGNA 4X69A 1MWRA 3LUQA 1E3UA 1PI5A 4NKPA 3HREA 2JKFA 4ARZA 3LO7A 1IKGA 5EPHA 1FCNA 3QP2A 5KZHA 1TS8A 4U0TA 3IBRA 1DJBA 5GHZA 1CK3A 1NRJA 4S2MA 1LLBA 2VGLS 1PW8A 4EU0A 4EUVA 3NY4A 5KIZA 3UE6A 3UMDA 3WS5A 1OPXA 3V3SA 5FQMA 2Y91A 3PR6A 3G2ZA 1I2SA 3ICYA 1NZUA 4JF5A 3UE1A 4GW9A 4C3QA 3FWLA 2WGWB 2L1MA 4NETA 1VQQA 1M6KA 1ES4A 1LL8A 3WRZA 3RH8B 3IHAA 2ZQDA 2A2LA 3BWLA 3T1RA 2MJ6A 2XR0A 5FATA 3UE3A 3VOLA 1MKMA 5E2HA 2VX8A 4NG2A 5DTTA 3HL9A 3K3CA 1LSVA 2P9VB 3Q7VB 1O7EA 5TFQA 4ZBEA 1MZUA 3DAVA 3CPTA 1L0FA 5EV0A 4JF4A 4E6WA 2FZ0A 3HLBA 5F1FA 5EOEA 3ZVTA 3KYEA 1WE4A 1P9RA 5EE8A 5FI7A 1FR6A 4D60A 4EEUA 3UPPA 1PYYA 4E3NA 5L07A 3A0RA 1F98A 3CAXA 3M6BA 3LR4A 4GLQA 1ALQA 3LIEA 4KUKA 1E25A 2VGKA 3NC8A 1TVFA 2Z2MB 4PKYG 3LGOA 1X0OA 2OOLA 4WM9A 4I3JA 3DTEA 4P85A 4WELA 1ERMA 1W63M 3C38A 3R4KA 3IWQA 3MZEA 4MN5A 2H5SA 3CITA 3P7NA 3CUEA 4Q0JA 4HIAA 4YOFA 3D3OA 1EI5A 2A49A 5FAQA 3EOIA 5J7EA 1JTGA 4R3JA 4EQIA 2UWXA 3M2KA 1TF1A 1G68A 1TDGA 1P9WA 1UWNX 1H5XA 4KZBA 1SKOA 1F5MA 5EVEA 4DJ3A 2ZBBA 3PBTA 4NEED 3C5AA 2Y79A 3NBLA 4R38A 4JGQA 1ODVA 2C5WB 3RXXA 5EM0A 4X56A 4B9OA 2L4RA 4BLMA 5L8MA 3MBZA 3QP1A 5EVIA 3B33A 3BY9A 4OPRA 1ONHA 3IXDA 2V1BA 3C30A 3K2NA 4PM5A 4XT2B 2Z2LB 1ESUA 3VFHA 2J80A 4JGRA 3VP2A 4B4ZA 3SS5A 3AGFA 1K54A 3UDIA 4ZDXA 2BG1A 4HH3A 4IJGA 3OBFA 1DY6A 1KGGA 1F9IA 2PBDP 2WYXA 4LCLA 4MEZA 4PHTA 1SCWA 1FQGA 4X1LA 3ZFZA 4CLCB 3BFCA 5JYOA 4LFUA 1V9YA 2JBFA 4Z9QA 4F94A 4S2NC 2EX9A 5L09A 5FEFA 2EWWA 3ITAA 1SZVA 3I7JA 3CMZA 3W4PA 3ISGA 4X55A 2Z6DA 3T4TA 2HGVA 5EVID 2JKTI 3HJIA 4QHCA 4IBXA 4DN0A 3C7VA 4R4RA 1PRQA 2VV6A 5E43A 4RX2A 3S22A 1XXMA 2E8JA 3E2KA 4GKUA 3VSKA 2WKRA 1W8YA 4IHQA 3T4SA 1J9MA 3A3IA 2XFSA 4MBHA 1YM1A 2X71A 4UQIM 2J3TC 4H6JA 4GNUA 1N4OA 3IT9A 3ZG9B 1NXYA 3EEHA 4K08A 4N9LA 4LLOB 3H82A 1VEUA 1HTZA 3LEQA 2PR6A 2ZOHA 2Y2KA 4G3KA 4PM6A 1K56A 3RJUA 1G6AA 1CEGA 4LPZA 5CEDA 4PM8A 2ZC5B 5GLCA 2Y2LA 3LFVA 4E3IA 5A90A 2VLGA 2W3HA 3PBQA 1OTIA 2KX6A 4QPRA 1YSPA 3GECA 3IXBA 3KO6A 5TR7A 3SH7A 3T4OA 3NOPC 2ZMAA 3ZYTA 3IH9A 1K0KA 2IA2A 3CZDA 4HI4A 2Q9MA 2XK1A 1P97A 2ACGA 1NRFA 1CJFA 3KSHA 1DP9A 4OPQA 1N9OA 1GA9A 1TS0A 2I9VA 1G5UA 2O0YA 4D2OA 1VHMA 4U3TA 1BULA 3G4PA 2W1TB 1ACFA 1PI4A 3ZG7B 4WEJA 5F6AA 3PYPA 2KOIA 2EXBA 4FSFA 4F3LB 4O8GA 3FC7A 1ZG4A 5GLBA 1K4FA 1KVMA 1K38A 3Q7ZA 4B4XA 1YPRA 4MBKA 2BASA 1YLYA 3W2ZA 4M3KA 1SKOB 2RL3A 5HD3A 2XLNA 3LIBA 1YMXA 1L0GA 5CHMA 2FH5A 3G35A 1K6RA 2OWJA 1ESIA 1U60A 1QMEA 3GVBA 5CRFA 4B88A 5DJTA 3UY6A 4GJ4A 1Z6FA 1S1YA 4PKYA 3VP4A 4OP5A 2EXAA 5F5YA 3H7WA 2XRNA 4DE2A 3BLSA 5HPFA 3LR5A 3D4FA 1HD8A 1W5DA 3MQ0A 1YSQA 3G6OA 4WZ4A 3BM6A 2ZL1A 2HV1A 3TG9A 4DRTA 1BT5A 2INWA 3O86A 1LHYA 3MQOA 2XFTA 2HPBA 4I5SA 1TD5A 3TSGA 1IYSA 3T4JA 3TRCA 2PDRA 2VZWA 3Q1FA 5DVAA 3IS2A 3W4OA 5HFOA 2OAP1 2WADA 2R78A 2ZM2A 1EW0A 1IYOA 3D72A 3KYZA 1LL9A 5KMWA 2JKRI 3ZG0A 2V1ZA 1MWUA 4WYYA 4RVAA 1BLHA 2XROA 4KQDA 1K57C 4HBUA 4QJGA 3LY4A 4O01A 3G32A 2VEAA 1D1JA 4CLCC 4HY8A 3UDFA 4IEDA 2PD7A 1W8QA 2XD1A 1VETA 3BFEA 4IVIA 2C6WB 4BBTA 1KOUA 2Y2PA 5TBMA 3UNWA 3AGEA 5A93A 1XA1A 2W1RA 4LV0A 4E3JA 3EGXC 4M4XA 3IXHA 2DNSA 1K4EA 4S2LA 4JXVA 3MMHA 4KG2A 1YLJA 3BJNA 3H82B 3UDXA 3S4XA 2D02A 3BQ8A 2Y2HA 3MXRA 1WYCA 2YKHA 4P6ZM 5HL1A 4IUHA 3VOZA 3L9KA 5GLDA 2KDKA 1V9ZA 4IUKA 4EBPA 3T4KA 3UB8A 5E2EA 3MFDA 3PBNA 5DFXA 4WZ5C 4H8RA 3DTKA 2ZJ9A 2WZXA 2ZM8A 2WKIA 3ITBA 3IXGA 4WEKA 3EQVA 4EQ1A 2EX6A 5A8BA 3FPWA 3T1QB 1BZAA 1KDSA 5AQBA 4Q0HA 5HW3A 1JVJA 2VKSA 4LRYC 4HBTA 4E3OA 1GSVA 1SKFA 3SH9A 2X02A 3GQZA 4KZAA 2IWBA 3E0YA 4AFIA 1Q2QA 4MNRA 1Y54A 1OTAA 2ZQ7A 5FSRA 4WN5A 3OPLA 1FR1A 3B47A 1KE3A 4O0PA 4DJ2A 3UMEA 5FAPA 1JNUA 1MY8A 1D06A 1OTDA 4CJNA 4QY5A 2HDRA 4HJ3A 3OPRA 3SOIA 2B95A 5GHYA 2PU4A 1NYYA 5CTNA 5E2GA 5HWTA 4BL3A 1IKIA 4LV3A 2CC1A 5FQKA 3LIFA 1NLYA 4EEPA 5AVFA 1YQSA 5DF9A 5HZHA 4LV1A 3WWXA 3PBOA 5FEGA 2IWDA 3G2YA 4X53A 1GSWA 3BRMA 3CI6A 3LR3A 3QP8A 3PTEA 4MN6A 4LCMA 4X25A 3G30A 5MC7A 4WBGA 2Y59A 4KG6A 4GZBA 4NXFA 4HP4A 5K5BA 4MLLA 3F1NB 2GZAA 3SH8A 5AQ9A 2V20A 3DWKA 2HP9A 2UV0E 3KSIA 1K54C 4QY6A 4XXRA 4GCZA 3UB9A 2ZLYA 4FD8A 4S2JA 5DF8A 2XD5A 1ES3A 2OWHA 1XFQA 1ZG6A 3N8SA 2EA9A 5F68A 1ES5A 3NI9A 2A24B 4PPRA 3MS6A 4DXBA 4UAAA 4WF0A 2WKQA 3NULA 2P7JA 4BENA 1Z09A 2Y55A 5CXWA 3DW0A 1S66L 3A0SA 3L7HA 3OOVA 3NOUC 1LI0A 4RA7A 5CERA 3DWZA 4GS9A 3ZHHA 5KSCA 1LL5A 1KVLA 4OVDA 4BWIA 2M7UA 4FH4A 3OPHA 4KG5A 5L10A 1NLZA 2JHEA 1MC0A 2X01A 5AQAA 3LYXA 1NYMA 3UB7A 2ZQ9A 2K2NA 3ZCZA 3KSFA 4KQRA 1UWPX 3T4LA 2A3UA 2K7SA 4JXWA 2O99A 5DTSA 1TS6A 4LV2A 3EGDC 3O5YA 1TDLA 2O9CA 2Y2NA 4Y17A 4N9KA 1SDNA 4HNBA 5CECA 3H9WA 3IBJA 2AVXA 1YMSA 4IVKA 3BYDA 1PIOA 3OCNA 2LB9A 1CI9A 3IX8A 3MR0A 1GHPA 2VV7A 3WRTA 3O88A 2B5RA 3N8RA 1OTBA 4ZRRA 2EFXA 5TJJA 3MFXA 2Y2GA 1XP4A 2VK3A 2JKGA 4RX3A 2V9AA 5HAIA 4JKTA 2WGIA 4ARZB 4P6ZS 1XA7A 4N92A 1L0DA 3WS0A 2VGJA 4OONA 5F83A 2BTFP 2HJEA 2JC7A 4Y0UA 2XH9A 4JXSA 4E3LA 4JXGA 1T1AA 3LR0A 3VP0A 1DP8A 1W7FA 3A0VA 3HLDA 3HBRA 3P01A 1OT6A 3PXPA 3QNBA 3GSGA 1XGIA 5M19A 3BQAA 4S2OA 2H0TA 5D3OA 1TS7A 4OQGA 2PBYA 2P74A 4LRXC 3EWKA 5FDHA 4WLAA 5HD5A 4L9FA 1H0MA 1M40A 2LB5A 3M6HA 4QB8A 1IYPA 3E98A 3LIDA 3MXQA 4IBRA 4WMCA 4X6TA 3CG5A 3G34A 4Y13A 3V67A 4ESPA 2WGVA 2W0NA 3CPTB 1PNEA 2W3FA 1WYBA 3S7NA 3F1OA 1AWIA 1XX2A 2PRFA 1IELA 3FKWA 4L9GA 3VOYA 1GSXA 1LT0A 2HDSA 2QHKA 1N9LA 4R4SA 1S4RA 3DBAA 3ZG8B 4CQHA 1UGUA 1G6OA 1Q2PA 1F2KA 1L2SA 5CGXA 3CJMA 2QYBA 1JWZA 3HLGA 4BD1A 4QWOA 3WS2A 1JWPA 2Y8HA 3CHWP 4OPYA 1K55C 5DTKA 4ZJ2A 4OQHA 4GS9B 4YINA 4EWFA 4BQMA 1XJ4A 4UA9A 1PFLA 5I94A 3S7QA 4ID4A 4ZAMA 1OTEA 1CQAA 5G18A 3IX4A 4WMCD 1FCMA 1YKDA 3W4QA 2VA0A 3VP3A 2D01A 2ZOIA 4OOMA 5HDSA 3HLCA 4OOLA 1T1BA 5JYPA 1IEMA 2PHYA 2OLVA 3V5MA 3U4LP 1PZPA 5FQJA 1BLSA 2H0YA 5HDCA 3V3RA 3GRJA 3ZGAB 5FI6A 2QKPA 3BEBA 1NJ4A 1XFNA 3VMAA 4LENA 2WKEA 3OCLA 4JF6A 4Y5FA 1D7EA 1WA9A 1Y4OA 3FYZA 4R1GA 5M18A 4OOYA 3BFDA 4GD6A 4R3AA 1CEFA 1S1ZA 2Z6CA 5F1GA 5EVIB 2RCXA 1N9BA 3HCYA 2V0UA 4S2NA 3JVVA 4MDZA 4KQQA 1S4SA 2PYPA 1RGZA 3A3DA 3Q07A 4YWZA 2ZM0A 5EFWA 1XKZA 3C8CA 3AGDA 4PM9A 4GDNA 1MWSA 3IF6A 4K0WA 4S2PA 4OH0A 1BSGA 3BFFA 2PR5A 1ES2A 3SS3A 1H3QA 2J9PA 3N6IA 5HX9A 3LCEA 3LIAA 4OP8A 1GCEA 2ZD8A 3NCKA 5EECA 4OQ0A 5M1AA 3F1PA 4UHUA 5FI2A 4JLFA 2O9BA 3UE0A 5HPIA 1GHMA 2P9VA 4EW7A 5GHXA 3UN7A 1PWCA 1ZTUA 4KZ8A 1IFQA 4DXCA 3MKFA 3IH8A 4CPKA 1P0ZA 4FOFA 3SZTA 4RQ9A 2QPNA 1DJAA 3LI9A 5G4ZA 5CGSA 4E3MA 3C4PA 2QZ6A 4HJ4A 3SS4A 3ULFA 1KDWA 4ZTKA 1TEMA 2XA7M 4ETZA 2I72A 2HDUA 2E8IA 3M2JA 5G4YA 3EEAA 3VE4A 3F1OB 4H6JB 4ETXA 1VEUB 1DRMA 1I2WA 3C2WA 4BD0A 2WAFA 4P6BA 2GJ3A 2Y4AA 4QD4A 4DKIA 1SHVA 1N9NA 2ZC4B 2J3TD 4JPMA 2J3WA 2J8YA 3Q82A 1BTLA 2DCFA 3OC2A 4L9EA 4ZJ3A 3C7UA 2GNXA 4KENB 2VJWA 2O9AA 1OMEA 1L0EA 4HJ6A 4OPZA 3HVFA 2Q0OA 1FSWA 3NIAA 2BLSA 1I5QA 3UB5P 1C3BA 1T1CA 2G2UA 4R3BA 3DTMA 1XPBA 4GDBA 3CLOA 4Q0IA 1KE0A 4R6LA 1XJ6A 1ZKJA 1W79A 4UQIS 5AQ7A 1YLZA 2JN7A 1YAXA 3FZCA 1H8MA 2J9OA 3V50A 4HQAA 5CTMA 3CUEC 3IHBA 2W3EA 1OT9A 5CHJA 1LSWA 1MWTA 4MMNA 5HAQA 4XT2A 3A3FA 2WKHA 4E3KA 3NDEA 4DE3A 3JVUA 3GV9A 3FPVA 3PHYA 3IF5A 4KZ5A 2OSUA 2OV5A 3H7WB 1XJ3A 4PAUA 5A91A 1HVBA 3NJAA 1K57A 4KUOA 4CLCA 4E04A 2ZL1B 5EVIC 5HSQA 3IF6B 1RP5A 5HARA 3KX0X 4KZ4A 4ZJ1A 3U2AA 5L2FA 3BFGA 5DF7A 1LI9A 3IX3A 3G31A 3HUMA 1NZOA 4KQOA 3IS2B 4K0XA 4FTXA 4X1MA 4U0XA 4UEYA 1EWZA 1W63Q 4OKPA 3JPUA 3F1PB 1E3UD 1FSYA 1GA0A 2OAQ1 1MPLA 4BL2A 3N8LA 4DE1A 3O87A 3C4OA 1LSXA 2XEPA 1ZC2A 5FDSA 2XF3A 2M1CA 5IHVA 2HP6A 4Y15A 3D9YA 4MN7A 5EUAA 2DRWA 2Y2MA 2W3GA 2PU2A 1VETB 5GL9A 5FASA 4R23A 4CLCD 3FV7A 1S6RA 4WZ5A 5FA7A 3P09A 5TGFA 5CGWA 5TBMB 4BBVA 3S7PA 1OJGA 3R7WA 4EV4A 1HLUP 4Y7PA 2R9WA 3ZQ5A 2XDMA 2ZC3B 2JCHA 2IWCA 3KSGA 3MF0A 2EWVA 3MSHA 2GDNA 3NDGA 1J3WA 2B18A 5I5LA 4C6YA 1S67L 3E4PA 1NWZA 2WKPA 4NXBA 1T18A 4PMAA 4P87A 2W1TA 3Q81A 4LGWA 1PW1A 3E2LA 1SDEA 4F3LA 4NK3A 2W27A 5HL6A 1EROA 4EUZA 4EXOA 1H8YA 5EVLA 1MXOA 1YT4A 3MZFA 4UA6A 1KGFA 1OJ5A 2R9XA 4G3WA 4KZ7A 3PAEA 3BY8A 3RXWA 3TJZC 2XA7S 4N1XA 1YLPA 4CLCE 4EESA 2VV8A 2WUQA 3MQQA 5HWVA 3JYIA 1K25A 3OLOA 3A3JA 5J3WA 4L0LA 2PAVP 4GD8A 4YNRA 3IQAA 4I3AA 3S1YA 1ZHHB 5IT5A 1A0KA 2QMIA 2NUPC 1DJCA 2Q9NA 2PD8A 3T1XA 4R0QA 5DKLA 4DMZA 3UO9A 4PM7A 3QP4A 2JKTM 5J4EA 3RFBA 2HP5A 5FL3A 4JGOA 3W8KA 4KZ9A 2EX8A 3HUNA 3BECA 1XJ2A 3B3XA 3RTYA 4XUZA 2QJ7A 1KGEA 3HLFA 2M7VA 1L3LA 1RGYA 4GN2A 2HDQA 4BJPA 2HF6A 4HHDA 4BMWA 5HDDA 3IF6C 5AVEA 2EFUA 4Y0TA 1HZOA 3T50A 5HWWA 4I3IA 4HEFA 2ZQAA 1H8ZA 4YFMA 3LICA 3QP6A 4EETB 5AJGA 5C5KA 2ZQ8A 1E4DA 3GDIA 4HOIA 1MKIA 4A5RA 2V8FA 3O3VA 3EQUA 3V39A 4I39A 5DFYA 4QU3A 4WUJA 3GTCA 5EM1A 2ZC7A 4Y3IA 2QJ5A 3BLMA 1FCOA 4BBUA 3A3EA 4C75A 4RYEA 1GHIA 2H28A 2WAEA 1FILA 2VGLM 4GHIA 3R7WB 4X68A 3T1SA 5EOOA 1RCJA 2V8CA 4GB7A 4XUXA 4E6XA 4MBFA 3IWIA 3WS4A 1BLCA 3N4IA 4FCFA 1DP6A 2J7VA 2V0WA 1CF0A 3PAGA 4S2KA 3SW1A 2HZ5A 4S2IA 4II7A 5IS1A 3LY3A 4NXEA 2ZC6B 4UA7A 3ZVWA 3DTIA 2L0WA 3E4QA 1IYQA 1YLWA 3FG8A 3HLEA 1XGJA 5DJUA 1ONGA 4JGPA 3ZNTA 4FUWA 3GMWA 1JWVA 5U47A
chains in the Genus database with same CATH topology
3OC2A 4L9EA 2OWHA 2GNXA 4R70A 3NOTC 1XFQA 2EA9A 5F68A 4CLCB 2VJWA 3TW8A 2O9AA 2P04A 2A24B 1V9YA 4HJ6A 4WF0A 2WKQA 2P7JA 2EWWA 5DKKA 1T1CA 1S66L 3A0SA 3OOVA 2Z6DA 3NOUC 3T4TA 2HGVA 3CLOA 4Q0IA 2JKTI 3HJIA 3NHQA 4GS9A 4R6LA 1XJ6A 2HJ9C 4DN0A 2QWSA 4UQIS 2ZMVA 4BWIA 3UB6A 2JN7A 2VV6A 1YAXA 2M7UA 1VB6A 4I38A 4EERA 1H8MA 1G28A 4HQAA 4MCWA 3CUEC 2JKRM 2WKRA 1NLZA 2JHEA 4IHQA 1MC0A 3T4SA 2W3EA 1OT9A 3LYXA 2NUTC 2K31A 1LSWA 3UB7A 4MMNA 4UQIM 2J3TC 1BYWA 4XT2A 4H6JA 2K2NA 3KSFA 1UWPX 3T4LA 2K7SA 3EEHA 4K08A 3S7OA 2O99A 4LLOB 3H82A 3JVUA 3FPVA 1STZA 3PHYA 2PR6A 1TS6A 2XSSA 3F1NA 3EGDC 4B93A 2ZOHA 3K3DA 4G3KA 2W3DA 3O5YA 2O9CA 1IOUA 4LPZA 2PYRA 4Z1WA 4HNBA 3H9WA 3IBJA 3H7WB 1XJ3A 3LFVA 3MJQA 4PAUA 2VLGA 2W3HA 3PBQA 1OTIA 2KX6A 1YSPA 3OCNA 3GECA 3KO6A 2LB9A 4QPRA 3T4OA 3NJAA 3NOPC 3MR0A 3ZYTA 4KUOA 5CX7A 2VV7A 5KSHA 2IA2A 4CLCA 4E04A 4HI4A 2CMNA 4HH2A 1P97A 5HSQA 2A24A 1OTBA 4ZRRA 3KX0X 3U2AA 3KSHA 1DP9A 5TJJA 1N9OA 1TS0A 3MFXA 4NXGA 2I9VA 2O0YA 2DMWA 1VHMA 3KYQA 3VE3A 2V9AA 2W1TB 3E4OA 4LRZE 4KQOA 3VV4A 3IS2B 2YKFA 3BW6A 5LBRA 1Y28A 4WEJA 5F6AA 4ARZB 3PYPA 2KOIA 4UEYA 4P6ZS 1W63Q 2GX5A 4FSFA 4F3LB 4O8GA 3FC7A 2ZMFA 3F1PB 4Y2FA 3CWFA 2V1AA 2OAQ1 2BASA 2HJEA 3W2ZA 1LSXA 5HD3A 2M1CA 5F69A 1T1AA 3LR0A 1DP8A 3LIBA 2FH5A 3A0VA 3P01A 4MN7A 1OT6A 2OWJA 3PXPA 3TE8A 2W3GA 4G3VA 5DJTA 2P08A 4GHIB 4GJ4A 1S1YA 4PKYA 3BQAA 1T19A 4CLCD 1TS7A 2B02A 5F5YA 4LRXC 5TBMB 3PBSA 3H7WA 3EWKA 2XRNA 4BBVA 5HPFA 3S7PA 4WLAA 1OJGA 3LR5A 3T4QA 3R7WA 5HD5A 4L9FA 2G7UA 3MQ0A 1YSQA 2LB5A 3ZQ5A 3G6OA 4HP9A 3E98A 3LIDA 3MXQA 3KSGA 2HV1A 3MF0A 3HJKA 2EWVA 2INWA 2KLIA 3LI8A 3MQOA 3V67A 3PBRA 4I5SA 4ME4A 5IU1A 4WL9A 2PT7A 2B18A 5I5LA 3B42A 2W0NA 1S67L 2W3FA 1TD5A 3E4PA 3S7NA 1NWZA 3F1OA 3LUQA 2WKPA 4NXBA 3T4JA 4NKPA 1T18A 2PDRA 3TRCA 2VZWA 4L9GA 1GSXA 1LT0A 2W1TA 3IS2A 2QHKA 4ARZA 1N9LA 1S4RA 2OAP1 3DBAA 4CQHA 4F3LA 2R78A 1UGUA 2W27A 5HL6A 1EW0A 1G6OA 4EXOA 1TS8A 3D72A 3IBRA 3KYZA 2JKRI 1NRJA 2QYBA 2VGLS 4EU0A 4EUVA 1OJ5A 5KIZA 2XROA 4KQDA 4G3WA 3UE6A 3UMDA 4O01A 1OPXA 3BY8A 2VEAA 2Y8HA 4CLCC 4HY8A 3TJZC 2XA7S 3PR6A 4CLCE 4GS9B 4EESA 2VV8A 3ICYA 3MQQA 2PD7A 5HWVA 1XJ4A 3OLOA 4GW9A 3S7QA 2L1MA 5J3WA 1OTEA 4L0LA 4BBTA 1LL8A 1KOUA 1YKDA 3RH8B 2VA0A 4YNRA 2A2LA 5TBMA 3BWLA 2D01A 2ZOIA 4OOMA 5HDSA 2MJ6A 2W1RA 4I3AA 3EGXC 4OOLA 4M4XA 1T1BA 2PHYA 3UE3A 3VOLA 1MKMA 3MMHA 2VX8A 1ZHHB 5IT5A 2NUPC 5HDCA 2PD8A 3BJNA 3H82B 3K3CA 1LSVA 2D02A 5DKLA 3BQ8A 2QKPA 2YKHA 4P6ZM 4IUHA 1MZUA 4DMZA 1XFNA 2KDKA 1V9ZA 2FZ0A 3OCLA 4IUKA 4Y5FA 1D7EA 1WA9A 3T4KA 3UB8A 2JKTM 5J4EA 3RFBA 1P9RA 5FL3A 4JGOA 3PBNA 4R3AA 5DFXA 4EEUA 1S1ZA 2Z6CA 1XJ2A 3A0RA 4WEKA 1F98A 3EQVA 2V0UA 3HCYA 3RTYA 4EQ1A 2QJ7A 3JVVA 3CAXA 4MDZA 3LR4A 4GLQA 1S4SA 2PYPA 4YWZA 2M7VA 5A8BA 3LIEA 5EFWA 3FPWA 4KUKA 3C8CA 4Q0HA 4BJPA 2HF6A 4HHDA 4BMWA 4PKYG 2VKSA 5HDDA 1X0OA 4LRYC 5AVEA 2OOLA 4I3JA 1GSVA 3T50A 4WELA 5HWWA 1W63M 4I3IA 3C38A 3R4KA 3E0YA 4AFIA 4MN5A 2PR5A 3P7NA 3CITA 1OTAA 3CUEA 4Q0JA 4WN5A 4HIAA 4YOFA 3D3OA 1H3QA 3LICA 4EETB 3B47A 3LIAA 4O0PA 5AJGA 4DJ2A 3EOIA 5J7EA 5C5KA 3UMEA 3F1PA 1JNUA 3GDIA 2O9BA 1D06A 1OTDA 4HOIA 1TF1A 1P9WA 1UWNX 4HJ3A 5HPIA 3EQUA 4I39A 4EW7A 1F5MA 5DFYA 1ZTUA 1IFQA 4WUJA 4DJ3A 1P0ZA 2ZBBA 4FOFA 3PBTA 4RQ9A 5HWTA 4NEED 2QJ5A 4Y3IA 4BBUA 2Y79A 3LI9A 5G4ZA 4R38A 4JGQA 3LIFA 1NLYA 2H28A 4EEPA 2VGLM 1ODVA 4GHIA 5AVFA 3R7WB 4HJ4A 4B9OA 5DF9A 5HZHA 2L4RA 3ULFA 3PBOA 5L8MA 2XA7M 1GSWA 3B33A 3BY9A 3CI6A 3LR3A 4ETZA 4MN6A 1DP6A 5MC7A 2V1BA 5G4YA 2V0WA 3C30A 3SW1A 3EEAA 3K2NA 4XT2B 3VE4A 3F1OB 4H6JB 4II7A 4NXFA 4ETXA 2J80A 4HP4A 4JGRA 5K5BA 3F1NB 5IS1A 2GZAA 1DRMA 3C2WA 3KSIA 4NXEA 4GCZA 2GJ3A 2L0WA 3E4QA 4HH3A 4IJGA 1N9NA 3OBFA 3UB9A 2J3TD 3FG8A 5DJUA 2J3WA 4JGPA 1F9IA 4PHTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P08 A;  4GJ4 A;  2P04 A; 
#chains in the Genus database with same CATH topology
 4Q8I A;  1FOF A;  1K56 D;  4OLG A;  3NOT C;  4R70 A;  2G2W A;  1PWG A;  2WZZ A;  3TW8 A;  2P04 A;  2WK0 A;  3QP5 A;  2JE5 A;  2XQZ A;  1BLP A;  4EBN A;  5DKK A;  3MZD A;  4O7D A;  1BUE A;  3HLW A;  2FFF B;  1MBL A;  3NHQ A;  4K91 A;  2HJ9 C;  1PWD A;  4GOG A;  2QWS A;  2ZMV A;  3MXS A;  3UB6 A;  2WGW A;  3VP1 A;  4EER A;  2V2F F;  1VB6 A;  4I38 A;  3OZH A;  5A92 A;  1G28 A;  4DDS A;  4Y0O A;  3TOI A;  4MCW A;  2JKR M;  3ZDJ A;  2NUT C;  2K31 A;  4N1H A;  3UPO A;  1BYW A;  5HAP A;  3FKV A;  4DE0 A;  2FFY A;  2Y2O A;  4EBL A;  3S7O A;  1VM1 A;  1S0W A;  2EX2 A;  1JTD A;  1STZ A;  3Q7V A;  2XSS A;  1QMF A;  3F1N A;  4B93 A;  2Y2Q A;  3K3D A;  2W3D A;  3T12 B;  1IOU A;  4DF6 A;  5J8X A;  5F82 A;  3OPP A;  3VSL A;  2PYR A;  4Z1W A;  2ZQC A;  3MJQ A;  3NEC A;  5CX7 A;  5KSH A;  3N7W A;  2CMN A;  4HH2 A;  1K55 A;  2A24 A;  1ERQ A;  3HUO A;  1PZO A;  1AXB A;  4NXG A;  2Y2J A;  1FIK A;  2DMW A;  3KYQ A;  3VE3 A;  3E4O A;  4LRZ E;  3VV4 A;  2YKF A;  3BW6 A;  5LBR A;  1Y28 A;  3QNC A;  5FQQ A;  2GX5 A;  3P98 A;  5CHU A;  2ZMF A;  4KZ6 A;  4FH2 A;  1NY0 A;  4Y2F A;  3CWF A;  2V1A A;  1O07 A;  3ZNY A;  4OLD A;  5BOH A;  5F69 A;  3ZG5 A;  5FQI A;  1YLT A;  5GLA A;  3TE8 A;  5CEB A;  4G3V A;  3MKE A;  3QHY A;  2P08 A;  4GHI B;  5E2F A;  1T19 A;  4P0M A;  3UPN A;  3LEZ A;  2B02 A;  3VFF A;  2OLU A;  3PBS A;  1K6S A;  3T4Q A;  2Y2I A;  3GR2 A;  4DDY A;  2G7U A;  5FAO A;  4HP9 A;  4OQI A;  3HJK A;  2KLI A;  1KE4 A;  3LI8 A;  4JBF A;  3PBR A;  4HES A;  4ME4 A;  5FQ9 A;  2H10 A;  4KZ3 A;  5IU1 A;  4WL9 A;  3IWO A;  2PT7 A;  3WS1 A;  3B42 A;  1CI8 A;  2XGN A;  4X69 A;  1MWR A;  3LUQ A;  1E3U A;  1PI5 A;  4NKP A;  3HRE A;  2JKF A;  4ARZ A;  3LO7 A;  1IKG A;  5EPH A;  1FCN A;  3QP2 A;  5KZH A;  1TS8 A;  4U0T A;  3IBR A;  1DJB A;  5GHZ A;  1CK3 A;  1NRJ A;  4S2M A;  1LLB A;  2VGL S;  1PW8 A;  4EU0 A;  4EUV A;  3NY4 A;  5KIZ A;  3UE6 A;  3UMD A;  3WS5 A;  1OPX A;  3V3S A;  5FQM A;  2Y91 A;  3PR6 A;  3G2Z A;  1I2S A;  3ICY A;  1NZU A;  4JF5 A;  3UE1 A;  4GW9 A;  4C3Q A;  3FWL A;  2WGW B;  2L1M A;  4NET A;  1VQQ A;  1M6K A;  1ES4 A;  1LL8 A;  3WRZ A;  3RH8 B;  3IHA A;  2ZQD A;  2A2L A;  3BWL A;  3T1R A;  2MJ6 A;  2XR0 A;  5FAT A;  3UE3 A;  3VOL A;  1MKM A;  5E2H A;  2VX8 A;  4NG2 A;  5DTT A;  3HL9 A;  3K3C A;  1LSV A;  2P9V B;  3Q7V B;  1O7E A;  5TFQ A;  4ZBE A;  1MZU A;  3DAV A;  3CPT A;  1L0F A;  5EV0 A;  4JF4 A;  4E6W A;  2FZ0 A;  3HLB A;  5F1F A;  5EOE A;  3ZVT A;  3KYE A;  1WE4 A;  1P9R A;  5EE8 A;  5FI7 A;  1FR6 A;  4D60 A;  4EEU A;  3UPP A;  1PYY A;  4E3N A;  5L07 A;  3A0R A;  1F98 A;  3CAX A;  3M6B A;  3LR4 A;  4GLQ A;  1ALQ A;  3LIE A;  4KUK A;  1E25 A;  2VGK A;  3NC8 A;  1TVF A;  2Z2M B;  4PKY G;  3LGO A;  1X0O A;  2OOL A;  4WM9 A;  4I3J A;  3DTE A;  4P85 A;  4WEL A;  1ERM A;  1W63 M;  3C38 A;  3R4K A;  3IWQ A;  3MZE A;  4MN5 A;  2H5S A;  3CIT A;  3P7N A;  3CUE A;  4Q0J A;  4HIA A;  4YOF A;  3D3O A;  1EI5 A;  2A49 A;  5FAQ A;  3EOI A;  5J7E A;  1JTG A;  4R3J A;  4EQI A;  2UWX A;  3M2K A;  1TF1 A;  1G68 A;  1TDG A;  1P9W A;  1UWN X;  1H5X A;  4KZB A;  1SKO A;  1F5M A;  5EVE A;  4DJ3 A;  2ZBB A;  3PBT A;  4NEE D;  3C5A A;  2Y79 A;  3NBL A;  4R38 A;  4JGQ A;  1ODV A;  2C5W B;  3RXX A;  5EM0 A;  4X56 A;  4B9O A;  2L4R A;  4BLM A;  5L8M A;  3MBZ A;  3QP1 A;  5EVI A;  3B33 A;  3BY9 A;  4OPR A;  1ONH A;  3IXD A;  2V1B A;  3C30 A;  3K2N A;  4PM5 A;  4XT2 B;  2Z2L B;  1ESU A;  3VFH A;  2J80 A;  4JGR A;  3VP2 A;  4B4Z A;  3SS5 A;  3AGF A;  1K54 A;  3UDI A;  4ZDX A;  2BG1 A;  4HH3 A;  4IJG A;  3OBF A;  1DY6 A;  1KGG A;  1F9I A;  2PBD P;  2WYX A;  4LCL A;  4MEZ A;  4PHT A;  1SCW A;  1FQG A;  4X1L A;  3ZFZ A;  4CLC B;  3BFC A;  5JYO A;  4LFU A;  1V9Y A;  2JBF A;  4Z9Q A;  4F94 A;  4S2N C;  2EX9 A;  5L09 A;  5FEF A;  2EWW A;  3ITA A;  1SZV A;  3I7J A;  3CMZ A;  3W4P A;  3ISG A;  4X55 A;  2Z6D A;  3T4T A;  2HGV A;  5EVI D;  2JKT I;  3HJI A;  4QHC A;  4IBX A;  4DN0 A;  3C7V A;  4R4R A;  1PRQ A;  2VV6 A;  5E43 A;  4RX2 A;  3S22 A;  1XXM A;  2E8J A;  3E2K A;  4GKU A;  3VSK A;  2WKR A;  1W8Y A;  4IHQ A;  3T4S A;  1J9M A;  3A3I A;  2XFS A;  4MBH A;  1YM1 A;  2X71 A;  4UQI M;  2J3T C;  4H6J A;  4GNU A;  1N4O A;  3IT9 A;  3ZG9 B;  1NXY A;  3EEH A;  4K08 A;  4N9L A;  4LLO B;  3H82 A;  1VEU A;  1HTZ A;  3LEQ A;  2PR6 A;  2ZOH A;  2Y2K A;  4G3K A;  4PM6 A;  1K56 A;  3RJU A;  1G6A A;  1CEG A;  4LPZ A;  5CED A;  4PM8 A;  2ZC5 B;  5GLC A;  2Y2L A;  3LFV A;  4E3I A;  5A90 A;  2VLG A;  2W3H A;  3PBQ A;  1OTI A;  2KX6 A;  4QPR A;  1YSP A;  3GEC A;  3IXB A;  3KO6 A;  5TR7 A;  3SH7 A;  3T4O A;  3NOP C;  2ZMA A;  3ZYT A;  3IH9 A;  1K0K A;  2IA2 A;  3CZD A;  4HI4 A;  2Q9M A;  2XK1 A;  1P97 A;  2ACG A;  1NRF A;  1CJF A;  3KSH A;  1DP9 A;  4OPQ A;  1N9O A;  1GA9 A;  1TS0 A;  2I9V A;  1G5U A;  2O0Y A;  4D2O A;  1VHM A;  4U3T A;  1BUL A;  3G4P A;  2W1T B;  1ACF A;  1PI4 A;  3ZG7 B;  4WEJ A;  5F6A A;  3PYP A;  2KOI A;  2EXB A;  4FSF A;  4F3L B;  4O8G A;  3FC7 A;  1ZG4 A;  5GLB A;  1K4F A;  1KVM A;  1K38 A;  3Q7Z A;  4B4X A;  1YPR A;  4MBK A;  2BAS A;  1YLY A;  3W2Z A;  4M3K A;  1SKO B;  2RL3 A;  5HD3 A;  2XLN A;  3LIB A;  1YMX A;  1L0G A;  5CHM A;  2FH5 A;  3G35 A;  1K6R A;  2OWJ A;  1ESI A;  1U60 A;  1QME A;  3GVB A;  5CRF A;  4B88 A;  5DJT A;  3UY6 A;  4GJ4 A;  1Z6F A;  1S1Y A;  4PKY A;  3VP4 A;  4OP5 A;  2EXA A;  5F5Y A;  3H7W A;  2XRN A;  4DE2 A;  3BLS A;  5HPF A;  3LR5 A;  3D4F A;  1HD8 A;  1W5D A;  3MQ0 A;  1YSQ A;  3G6O A;  4WZ4 A;  3BM6 A;  2ZL1 A;  2HV1 A;  3TG9 A;  4DRT A;  1BT5 A;  2INW A;  3O86 A;  1LHY A;  3MQO A;  2XFT A;  2HPB A;  4I5S A;  1TD5 A;  3TSG A;  1IYS A;  3T4J A;  3TRC A;  2PDR A;  2VZW A;  3Q1F A;  5DVA A;  3IS2 A;  3W4O A;  5HFO A;  2OAP 1;  2WAD A;  2R78 A;  2ZM2 A;  1EW0 A;  1IYO A;  3D72 A;  3KYZ A;  1LL9 A;  5KMW A;  2JKR I;  3ZG0 A;  2V1Z A;  1MWU A;  4WYY A;  4RVA A;  1BLH A;  2XRO A;  4KQD A;  1K57 C;  4HBU A;  4QJG A;  3LY4 A;  4O01 A;  3G32 A;  2VEA A;  1D1J A;  4CLC C;  4HY8 A;  3UDF A;  4IED A;  2PD7 A;  1W8Q A;  2XD1 A;  1VET A;  3BFE A;  4IVI A;  2C6W B;  4BBT A;  1KOU A;  2Y2P A;  5TBM A;  3UNW A;  3AGE A;  5A93 A;  1XA1 A;  2W1R A;  4LV0 A;  4E3J A;  3EGX C;  4M4X A;  3IXH A;  2DNS A;  1K4E A;  4S2L A;  4JXV A;  3MMH A;  4KG2 A;  1YLJ A;  3BJN A;  3H82 B;  3UDX A;  3S4X A;  2D02 A;  3BQ8 A;  2Y2H A;  3MXR A;  1WYC A;  2YKH A;  4P6Z M;  5HL1 A;  4IUH A;  3VOZ A;  3L9K A;  5GLD A;  2KDK A;  1V9Z A;  4IUK A;  4EBP A;  3T4K A;  3UB8 A;  5E2E A;  3MFD A;  3PBN A;  5DFX A;  4WZ5 C;  4H8R A;  3DTK A;  2ZJ9 A;  2WZX A;  2ZM8 A;  2WKI A;  3ITB A;  3IXG A;  4WEK A;  3EQV A;  4EQ1 A;  2EX6 A;  5A8B A;  3FPW A;  3T1Q B;  1BZA A;  1KDS A;  5AQB A;  4Q0H A;  5HW3 A;  1JVJ A;  2VKS A;  4LRY C;  4HBT A;  4E3O A;  1GSV A;  1SKF A;  3SH9 A;  2X02 A;  3GQZ A;  4KZA A;  2IWB A;  3E0Y A;  4AFI A;  1Q2Q A;  4MNR A;  1Y54 A;  1OTA A;  2ZQ7 A;  5FSR A;  4WN5 A;  3OPL A;  1FR1 A;  3B47 A;  1KE3 A;  4O0P A;  4DJ2 A;  3UME A;  5FAP A;  1JNU A;  1MY8 A;  1D06 A;  1OTD A;  4CJN A;  4QY5 A;  2HDR A;  4HJ3 A;  3OPR A;  3SOI A;  2B95 A;  5GHY A;  2PU4 A;  1NYY A;  5CTN A;  5E2G A;  5HWT A;  4BL3 A;  1IKI A;  4LV3 A;  2CC1 A;  5FQK A;  3LIF A;  1NLY A;  4EEP A;  5AVF A;  1YQS A;  5DF9 A;  5HZH A;  4LV1 A;  3WWX A;  3PBO A;  5FEG A;  2IWD A;  3G2Y A;  4X53 A;  1GSW A;  3BRM A;  3CI6 A;  3LR3 A;  3QP8 A;  3PTE A;  4MN6 A;  4LCM A;  4X25 A;  3G30 A;  5MC7 A;  4WBG A;  2Y59 A;  4KG6 A;  4GZB A;  4NXF A;  4HP4 A;  5K5B A;  4MLL A;  3F1N B;  2GZA A;  3SH8 A;  5AQ9 A;  2V20 A;  3DWK A;  2HP9 A;  2UV0 E;  3KSI A;  1K54 C;  4QY6 A;  4XXR A;  4GCZ A;  3UB9 A;  2ZLY A;  4FD8 A;  4S2J A;  5DF8 A;  2XD5 A;  1ES3 A;  2OWH A;  1XFQ A;  1ZG6 A;  3N8S A;  2EA9 A;  5F68 A;  1ES5 A;  3NI9 A;  2A24 B;  4PPR A;  3MS6 A;  4DXB A;  4UAA A;  4WF0 A;  2WKQ A;  3NUL A;  2P7J A;  4BEN A;  1Z09 A;  2Y55 A;  5CXW A;  3DW0 A;  1S66 L;  3A0S A;  3L7H A;  3OOV A;  3NOU C;  1LI0 A;  4RA7 A;  5CER A;  3DWZ A;  4GS9 A;  3ZHH A;  5KSC A;  1LL5 A;  1KVL A;  4OVD A;  4BWI A;  2M7U A;  4FH4 A;  3OPH A;  4KG5 A;  5L10 A;  1NLZ A;  2JHE A;  1MC0 A;  2X01 A;  5AQA A;  3LYX A;  1NYM A;  3UB7 A;  2ZQ9 A;  2K2N A;  3ZCZ A;  3KSF A;  4KQR A;  1UWP X;  3T4L A;  2A3U A;  2K7S A;  4JXW A;  2O99 A;  5DTS A;  1TS6 A;  4LV2 A;  3EGD C;  3O5Y A;  1TDL A;  2O9C A;  2Y2N A;  4Y17 A;  4N9K A;  1SDN A;  4HNB A;  5CEC A;  3H9W A;  3IBJ A;  2AVX A;  1YMS A;  4IVK A;  3BYD A;  1PIO A;  3OCN A;  2LB9 A;  1CI9 A;  3IX8 A;  3MR0 A;  1GHP A;  2VV7 A;  3WRT A;  3O88 A;  2B5R A;  3N8R A;  1OTB A;  4ZRR A;  2EFX A;  5TJJ A;  3MFX A;  2Y2G A;  1XP4 A;  2VK3 A;  2JKG A;  4RX3 A;  2V9A A;  5HAI A;  4JKT A;  2WGI A;  4ARZ B;  4P6Z S;  1XA7 A;  4N92 A;  1L0D A;  3WS0 A;  2VGJ A;  4OON A;  5F83 A;  2BTF P;  2HJE A;  2JC7 A;  4Y0U A;  2XH9 A;  4JXS A;  4E3L A;  4JXG A;  1T1A A;  3LR0 A;  3VP0 A;  1DP8 A;  1W7F A;  3A0V A;  3HLD A;  3HBR A;  3P01 A;  1OT6 A;  3PXP A;  3QNB A;  3GSG A;  1XGI A;  5M19 A;  3BQA A;  4S2O A;  2H0T A;  5D3O A;  1TS7 A;  4OQG A;  2PBY A;  2P74 A;  4LRX C;  3EWK A;  5FDH A;  4WLA A;  5HD5 A;  4L9F A;  1H0M A;  1M40 A;  2LB5 A;  3M6H A;  4QB8 A;  1IYP A;  3E98 A;  3LID A;  3MXQ A;  4IBR A;  4WMC A;  4X6T A;  3CG5 A;  3G34 A;  4Y13 A;  3V67 A;  4ESP A;  2WGV A;  2W0N A;  3CPT B;  1PNE A;  2W3F A;  1WYB A;  3S7N A;  3F1O A;  1AWI A;  1XX2 A;  2PRF A;  1IEL A;  3FKW A;  4L9G A;  3VOY A;  1GSX A;  1LT0 A;  2HDS A;  2QHK A;  1N9L A;  4R4S A;  1S4R A;  3DBA A;  3ZG8 B;  4CQH A;  1UGU A;  1G6O A;  1Q2P A;  1F2K A;  1L2S A;  5CGX A;  3CJM A;  2QYB A;  1JWZ A;  3HLG A;  4BD1 A;  4QWO A;  3WS2 A;  1JWP A;  2Y8H A;  3CHW P;  4OPY A;  1K55 C;  5DTK A;  4ZJ2 A;  4OQH A;  4GS9 B;  4YIN A;  4EWF A;  4BQM A;  1XJ4 A;  4UA9 A;  1PFL A;  5I94 A;  3S7Q A;  4ID4 A;  4ZAM A;  1OTE A;  1CQA A;  5G18 A;  3IX4 A;  4WMC D;  1FCM A;  1YKD A;  3W4Q A;  2VA0 A;  3VP3 A;  2D01 A;  2ZOI A;  4OOM A;  5HDS A;  3HLC A;  4OOL A;  1T1B A;  5JYP A;  1IEM A;  2PHY A;  2OLV A;  3V5M A;  3U4L P;  1PZP A;  5FQJ A;  1BLS A;  2H0Y A;  5HDC A;  3V3R A;  3GRJ A;  3ZGA B;  5FI6 A;  2QKP A;  3BEB A;  1NJ4 A;  1XFN A;  3VMA A;  4LEN A;  2WKE A;  3OCL A;  4JF6 A;  4Y5F A;  1D7E A;  1WA9 A;  1Y4O A;  3FYZ A;  4R1G A;  5M18 A;  4OOY A;  3BFD A;  4GD6 A;  4R3A A;  1CEF A;  1S1Z A;  2Z6C A;  5F1G A;  5EVI B;  2RCX A;  1N9B A;  3HCY A;  2V0U A;  4S2N A;  3JVV A;  4MDZ A;  4KQQ A;  1S4S A;  2PYP A;  1RGZ A;  3A3D A;  3Q07 A;  4YWZ A;  2ZM0 A;  5EFW A;  1XKZ A;  3C8C A;  3AGD A;  4PM9 A;  4GDN A;  1MWS A;  3IF6 A;  4K0W A;  4S2P A;  4OH0 A;  1BSG A;  3BFF A;  2PR5 A;  1ES2 A;  3SS3 A;  1H3Q A;  2J9P A;  3N6I A;  5HX9 A;  3LCE A;  3LIA A;  4OP8 A;  1GCE A;  2ZD8 A;  3NCK A;  5EEC A;  4OQ0 A;  5M1A A;  3F1P A;  4UHU A;  5FI2 A;  4JLF A;  2O9B A;  3UE0 A;  5HPI A;  1GHM A;  2P9V A;  4EW7 A;  5GHX A;  3UN7 A;  1PWC A;  1ZTU A;  4KZ8 A;  1IFQ A;  4DXC A;  3MKF A;  3IH8 A;  4CPK A;  1P0Z A;  4FOF A;  3SZT A;  4RQ9 A;  2QPN A;  1DJA A;  3LI9 A;  5G4Z A;  5CGS A;  4E3M A;  3C4P A;  2QZ6 A;  4HJ4 A;  3SS4 A;  3ULF A;  1KDW A;  4ZTK A;  1TEM A;  2XA7 M;  4ETZ A;  2I72 A;  2HDU A;  2E8I A;  3M2J A;  5G4Y A;  3EEA A;  3VE4 A;  3F1O B;  4H6J B;  4ETX A;  1VEU B;  1DRM A;  1I2W A;  3C2W A;  4BD0 A;  2WAF A;  4P6B A;  2GJ3 A;  2Y4A A;  4QD4 A;  4DKI A;  1SHV A;  1N9N A;  2ZC4 B;  2J3T D;  4JPM A;  2J3W A;  2J8Y A;  3Q82 A;  1BTL A;  2DCF A;  3OC2 A;  4L9E A;  4ZJ3 A;  3C7U A;  2GNX A;  4KEN B;  2VJW A;  2O9A A;  1OME A;  1L0E A;  4HJ6 A;  4OPZ A;  3HVF A;  2Q0O A;  1FSW A;  3NIA A;  2BLS A;  1I5Q A;  3UB5 P;  1C3B A;  1T1C A;  2G2U A;  4R3B A;  3DTM A;  1XPB A;  4GDB A;  3CLO A;  4Q0I A;  1KE0 A;  4R6L A;  1XJ6 A;  1ZKJ A;  1W79 A;  4UQI S;  5AQ7 A;  1YLZ A;  2JN7 A;  1YAX A;  3FZC A;  1H8M A;  2J9O A;  3V50 A;  4HQA A;  5CTM A;  3CUE C;  3IHB A;  2W3E A;  1OT9 A;  5CHJ A;  1LSW A;  1MWT A;  4MMN A;  5HAQ A;  4XT2 A;  3A3F A;  2WKH A;  4E3K A;  3NDE A;  4DE3 A;  3JVU A;  3GV9 A;  3FPV A;  3PHY A;  3IF5 A;  4KZ5 A;  2OSU A;  2OV5 A;  3H7W B;  1XJ3 A;  4PAU A;  5A91 A;  1HVB A;  3NJA A;  1K57 A;  4KUO A;  4CLC A;  4E04 A;  2ZL1 B;  5EVI C;  5HSQ A;  3IF6 B;  1RP5 A;  5HAR A;  3KX0 X;  4KZ4 A;  4ZJ1 A;  3U2A A;  5L2F A;  3BFG A;  5DF7 A;  1LI9 A;  3IX3 A;  3G31 A;  3HUM A;  1NZO A;  4KQO A;  3IS2 B;  4K0X A;  4FTX A;  4X1M A;  4U0X A;  4UEY A;  1EWZ A;  1W63 Q;  4OKP A;  3JPU A;  3F1P B;  1E3U D;  1FSY A;  1GA0 A;  2OAQ 1;  1MPL A;  4BL2 A;  3N8L A;  4DE1 A;  3O87 A;  3C4O A;  1LSX A;  2XEP A;  1ZC2 A;  5FDS A;  2XF3 A;  2M1C A;  5IHV A;  2HP6 A;  4Y15 A;  3D9Y A;  4MN7 A;  5EUA A;  2DRW A;  2Y2M A;  2W3G A;  2PU2 A;  1VET B;  5GL9 A;  5FAS A;  4R23 A;  4CLC D;  3FV7 A;  1S6R A;  4WZ5 A;  5FA7 A;  3P09 A;  5TGF A;  5CGW A;  5TBM B;  4BBV A;  3S7P A;  1OJG A;  3R7W A;  4EV4 A;  1HLU P;  4Y7P A;  2R9W A;  3ZQ5 A;  2XDM A;  2ZC3 B;  2JCH A;  2IWC A;  3KSG A;  3MF0 A;  2EWV A;  3MSH A;  2GDN A;  3NDG A;  1J3W A;  2B18 A;  5I5L A;  4C6Y A;  1S67 L;  3E4P A;  1NWZ A;  2WKP A;  4NXB A;  1T18 A;  4PMA A;  4P87 A;  2W1T A;  3Q81 A;  4LGW A;  1PW1 A;  3E2L A;  1SDE A;  4F3L A;  4NK3 A;  2W27 A;  5HL6 A;  1ERO A;  4EUZ A;  4EXO A;  1H8Y A;  5EVL A;  1MXO A;  1YT4 A;  3MZF A;  4UA6 A;  1KGF A;  1OJ5 A;  2R9X A;  4G3W A;  4KZ7 A;  3PAE A;  3BY8 A;  3RXW A;  3TJZ C;  2XA7 S;  4N1X A;  1YLP A;  4CLC E;  4EES A;  2VV8 A;  2WUQ A;  3MQQ A;  5HWV A;  3JYI A;  1K25 A;  3OLO A;  3A3J A;  5J3W A;  4L0L A;  2PAV P;  4GD8 A;  4YNR A;  3IQA A;  4I3A A;  3S1Y A;  1ZHH B;  5IT5 A;  1A0K A;  2QMI A;  2NUP C;  1DJC A;  2Q9N A;  2PD8 A;  3T1X A;  4R0Q A;  5DKL A;  4DMZ A;  3UO9 A;  4PM7 A;  3QP4 A;  2JKT M;  5J4E A;  3RFB A;  2HP5 A;  5FL3 A;  4JGO A;  3W8K A;  4KZ9 A;  2EX8 A;  3HUN A;  3BEC A;  1XJ2 A;  3B3X A;  3RTY A;  4XUZ A;  2QJ7 A;  1KGE A;  3HLF A;  2M7V A;  1L3L A;  1RGY A;  4GN2 A;  2HDQ A;  4BJP A;  2HF6 A;  4HHD A;  4BMW A;  5HDD A;  3IF6 C;  5AVE A;  2EFU A;  4Y0T A;  1HZO A;  3T50 A;  5HWW A;  4I3I A;  4HEF A;  2ZQA A;  1H8Z A;  4YFM A;  3LIC A;  3QP6 A;  4EET B;  5AJG A;  5C5K A;  2ZQ8 A;  1E4D A;  3GDI A;  4HOI A;  1MKI A;  4A5R A;  2V8F A;  3O3V A;  3EQU A;  3V39 A;  4I39 A;  5DFY A;  4QU3 A;  4WUJ A;  3GTC A;  5EM1 A;  2ZC7 A;  4Y3I A;  2QJ5 A;  3BLM A;  1FCO A;  4BBU A;  3A3E A;  4C75 A;  4RYE A;  1GHI A;  2H28 A;  2WAE A;  1FIL A;  2VGL M;  4GHI A;  3R7W B;  4X68 A;  3T1S A;  5EOO A;  1RCJ A;  2V8C A;  4GB7 A;  4XUX A;  4E6X A;  4MBF A;  3IWI A;  3WS4 A;  1BLC A;  3N4I A;  4FCF A;  1DP6 A;  2J7V A;  2V0W A;  1CF0 A;  3PAG A;  4S2K A;  3SW1 A;  2HZ5 A;  4S2I A;  4II7 A;  5IS1 A;  3LY3 A;  4NXE A;  2ZC6 B;  4UA7 A;  3ZVW A;  3DTI A;  2L0W A;  3E4Q A;  1IYQ A;  1YLW A;  3FG8 A;  3HLE A;  1XGJ A;  5DJU A;  1ONG A;  4JGP A;  3ZNT A;  4FUW A;  3GMW A;  1JWV A;  5U47 A; 
#chains in the Genus database with same CATH homology
 3OC2 A;  4L9E A;  2OWH A;  2GNX A;  4R70 A;  3NOT C;  1XFQ A;  2EA9 A;  5F68 A;  4CLC B;  2VJW A;  3TW8 A;  2O9A A;  2P04 A;  2A24 B;  1V9Y A;  4HJ6 A;  4WF0 A;  2WKQ A;  2P7J A;  2EWW A;  5DKK A;  1T1C A;  1S66 L;  3A0S A;  3OOV A;  2Z6D A;  3NOU C;  3T4T A;  2HGV A;  3CLO A;  4Q0I A;  2JKT I;  3HJI A;  3NHQ A;  4GS9 A;  4R6L A;  1XJ6 A;  2HJ9 C;  4DN0 A;  2QWS A;  4UQI S;  2ZMV A;  4BWI A;  3UB6 A;  2JN7 A;  2VV6 A;  1YAX A;  2M7U A;  1VB6 A;  4I38 A;  4EER A;  1H8M A;  1G28 A;  4HQA A;  4MCW A;  3CUE C;  2JKR M;  2WKR A;  1NLZ A;  2JHE A;  4IHQ A;  1MC0 A;  3T4S A;  2W3E A;  1OT9 A;  3LYX A;  2NUT C;  2K31 A;  1LSW A;  3UB7 A;  4MMN A;  4UQI M;  2J3T C;  1BYW A;  4XT2 A;  4H6J A;  2K2N A;  3KSF A;  1UWP X;  3T4L A;  2K7S A;  3EEH A;  4K08 A;  3S7O A;  2O99 A;  4LLO B;  3H82 A;  3JVU A;  3FPV A;  1STZ A;  3PHY A;  2PR6 A;  1TS6 A;  2XSS A;  3F1N A;  3EGD C;  4B93 A;  2ZOH A;  3K3D A;  4G3K A;  2W3D A;  3O5Y A;  2O9C A;  1IOU A;  4LPZ A;  2PYR A;  4Z1W A;  4HNB A;  3H9W A;  3IBJ A;  3H7W B;  1XJ3 A;  3LFV A;  3MJQ A;  4PAU A;  2VLG A;  2W3H A;  3PBQ A;  1OTI A;  2KX6 A;  1YSP A;  3OCN A;  3GEC A;  3KO6 A;  2LB9 A;  4QPR A;  3T4O A;  3NJA A;  3NOP C;  3MR0 A;  3ZYT A;  4KUO A;  5CX7 A;  2VV7 A;  5KSH A;  2IA2 A;  4CLC A;  4E04 A;  4HI4 A;  2CMN A;  4HH2 A;  1P97 A;  5HSQ A;  2A24 A;  1OTB A;  4ZRR A;  3KX0 X;  3U2A A;  3KSH A;  1DP9 A;  5TJJ A;  1N9O A;  1TS0 A;  3MFX A;  4NXG A;  2I9V A;  2O0Y A;  2DMW A;  1VHM A;  3KYQ A;  3VE3 A;  2V9A A;  2W1T B;  3E4O A;  4LRZ E;  4KQO A;  3VV4 A;  3IS2 B;  2YKF A;  3BW6 A;  5LBR A;  1Y28 A;  4WEJ A;  5F6A A;  4ARZ B;  3PYP A;  2KOI A;  4UEY A;  4P6Z S;  1W63 Q;  2GX5 A;  4FSF A;  4F3L B;  4O8G A;  3FC7 A;  2ZMF A;  3F1P B;  4Y2F A;  3CWF A;  2V1A A;  2OAQ 1;  2BAS A;  2HJE A;  3W2Z A;  1LSX A;  5HD3 A;  2M1C A;  5F69 A;  1T1A A;  3LR0 A;  1DP8 A;  3LIB A;  2FH5 A;  3A0V A;  3P01 A;  4MN7 A;  1OT6 A;  2OWJ A;  3PXP A;  3TE8 A;  2W3G A;  4G3V A;  5DJT A;  2P08 A;  4GHI B;  4GJ4 A;  1S1Y A;  4PKY A;  3BQA A;  1T19 A;  4CLC D;  1TS7 A;  2B02 A;  5F5Y A;  4LRX C;  5TBM B;  3PBS A;  3H7W A;  3EWK A;  2XRN A;  4BBV A;  5HPF A;  3S7P A;  4WLA A;  1OJG A;  3LR5 A;  3T4Q A;  3R7W A;  5HD5 A;  4L9F A;  2G7U A;  3MQ0 A;  1YSQ A;  2LB5 A;  3ZQ5 A;  3G6O A;  4HP9 A;  3E98 A;  3LID A;  3MXQ A;  3KSG A;  2HV1 A;  3MF0 A;  3HJK A;  2EWV A;  2INW A;  2KLI A;  3LI8 A;  3MQO A;  3V67 A;  3PBR A;  4I5S A;  4ME4 A;  5IU1 A;  4WL9 A;  2PT7 A;  2B18 A;  5I5L A;  3B42 A;  2W0N A;  1S67 L;  2W3F A;  1TD5 A;  3E4P A;  3S7N A;  1NWZ A;  3F1O A;  3LUQ A;  2WKP A;  4NXB A;  3T4J A;  4NKP A;  1T18 A;  2PDR A;  3TRC A;  2VZW A;  4L9G A;  1GSX A;  1LT0 A;  2W1T A;  3IS2 A;  2QHK A;  4ARZ A;  1N9L A;  1S4R A;  2OAP 1;  3DBA A;  4CQH A;  4F3L A;  2R78 A;  1UGU A;  2W27 A;  5HL6 A;  1EW0 A;  1G6O A;  4EXO A;  1TS8 A;  3D72 A;  3IBR A;  3KYZ A;  2JKR I;  1NRJ A;  2QYB A;  2VGL S;  4EU0 A;  4EUV A;  1OJ5 A;  5KIZ A;  2XRO A;  4KQD A;  4G3W A;  3UE6 A;  3UMD A;  4O01 A;  1OPX A;  3BY8 A;  2VEA A;  2Y8H A;  4CLC C;  4HY8 A;  3TJZ C;  2XA7 S;  3PR6 A;  4CLC E;  4GS9 B;  4EES A;  2VV8 A;  3ICY A;  3MQQ A;  2PD7 A;  5HWV A;  1XJ4 A;  3OLO A;  4GW9 A;  3S7Q A;  2L1M A;  5J3W A;  1OTE A;  4L0L A;  4BBT A;  1LL8 A;  1KOU A;  1YKD A;  3RH8 B;  2VA0 A;  4YNR A;  2A2L A;  5TBM A;  3BWL A;  2D01 A;  2ZOI A;  4OOM A;  5HDS A;  2MJ6 A;  2W1R A;  4I3A A;  3EGX C;  4OOL A;  4M4X A;  1T1B A;  2PHY A;  3UE3 A;  3VOL A;  1MKM A;  3MMH A;  2VX8 A;  1ZHH B;  5IT5 A;  2NUP C;  5HDC A;  2PD8 A;  3BJN A;  3H82 B;  3K3C A;  1LSV A;  2D02 A;  5DKL A;  3BQ8 A;  2QKP A;  2YKH A;  4P6Z M;  4IUH A;  1MZU A;  4DMZ A;  1XFN A;  2KDK A;  1V9Z A;  2FZ0 A;  3OCL A;  4IUK A;  4Y5F A;  1D7E A;  1WA9 A;  3T4K A;  3UB8 A;  2JKT M;  5J4E A;  3RFB A;  1P9R A;  5FL3 A;  4JGO A;  3PBN A;  4R3A A;  5DFX A;  4EEU A;  1S1Z A;  2Z6C A;  1XJ2 A;  3A0R A;  4WEK A;  1F98 A;  3EQV A;  2V0U A;  3HCY A;  3RTY A;  4EQ1 A;  2QJ7 A;  3JVV A;  3CAX A;  4MDZ A;  3LR4 A;  4GLQ A;  1S4S A;  2PYP A;  4YWZ A;  2M7V A;  5A8B A;  3LIE A;  5EFW A;  3FPW A;  4KUK A;  3C8C A;  4Q0H A;  4BJP A;  2HF6 A;  4HHD A;  4BMW A;  4PKY G;  2VKS A;  5HDD A;  1X0O A;  4LRY C;  5AVE A;  2OOL A;  4I3J A;  1GSV A;  3T50 A;  4WEL A;  5HWW A;  1W63 M;  4I3I A;  3C38 A;  3R4K A;  3E0Y A;  4AFI A;  4MN5 A;  2PR5 A;  3P7N A;  3CIT A;  1OTA A;  3CUE A;  4Q0J A;  4WN5 A;  4HIA A;  4YOF A;  3D3O A;  1H3Q A;  3LIC A;  4EET B;  3B47 A;  3LIA A;  4O0P A;  5AJG A;  4DJ2 A;  3EOI A;  5J7E A;  5C5K A;  3UME A;  3F1P A;  1JNU A;  3GDI A;  2O9B A;  1D06 A;  1OTD A;  4HOI A;  1TF1 A;  1P9W A;  1UWN X;  4HJ3 A;  5HPI A;  3EQU A;  4I39 A;  4EW7 A;  1F5M A;  5DFY A;  1ZTU A;  1IFQ A;  4WUJ A;  4DJ3 A;  1P0Z A;  2ZBB A;  4FOF A;  3PBT A;  4RQ9 A;  5HWT A;  4NEE D;  2QJ5 A;  4Y3I A;  4BBU A;  2Y79 A;  3LI9 A;  5G4Z A;  4R38 A;  4JGQ A;  3LIF A;  1NLY A;  2H28 A;  4EEP A;  2VGL M;  1ODV A;  4GHI A;  5AVF A;  3R7W B;  4HJ4 A;  4B9O A;  5DF9 A;  5HZH A;  2L4R A;  3ULF A;  3PBO A;  5L8M A;  2XA7 M;  1GSW A;  3B33 A;  3BY9 A;  3CI6 A;  3LR3 A;  4ETZ A;  4MN6 A;  1DP6 A;  5MC7 A;  2V1B A;  5G4Y A;  2V0W A;  3C30 A;  3SW1 A;  3EEA A;  3K2N A;  4XT2 B;  3VE4 A;  3F1O B;  4H6J B;  4II7 A;  4NXF A;  4ETX A;  2J80 A;  4HP4 A;  4JGR A;  5K5B A;  3F1N B;  5IS1 A;  2GZA A;  1DRM A;  3C2W A;  3KSI A;  4NXE A;  4GCZ A;  2GJ3 A;  2L0W A;  3E4Q A;  4HH3 A;  4IJG A;  1N9N A;  3OBF A;  3UB9 A;  2J3T D;  3FG8 A;  5DJU A;  2J3W A;  4JGP A;  1F9I A;  4PHT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...