2P04A

2.1 ang structure of the dimerized pas domain of signal transduction histidine kinase from nostoc punctiforme pcc 73102 with homology to the h-noxa/h-noba domain of the soluble guanylyl cyclase
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
107
structure length
107
Chain Sequence
MAPPHLTLSPELLAKAFPFHFAFSRNREIVQTGEVLERISPEPLVGKLIEQHFQINRPKILIDFDAISKQPRALFILEFLHNGMQLKGQMMYQPEEEVIFFLGSPWI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords signal transduction histidine kinase
publication title PAS-mediated dimerization of soluble guanylyl cyclase revealed by signal transduction histidine kinase domain crystal structure.
pubmed doi rcsb
source organism Nostoc punctiforme
molecule tags Transferase
total genus 22
structure length 107
sequence length 107
chains with identical sequence B
ec nomenclature ec 2.7.3.-:
pdb deposition date 2007-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07701 HNOBA Heme NO binding associated
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.260 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2p04A00
2P08A 4GJ4A 2P04A
chains in the Genus database with same CATH superfamily
5A8BA 1KDSA 5IU1A 3G31A 1W79A 1PIOA 2YKFA 3KSIA 2FFFB 3LEZA 2Y2QA 4GW9A 3UPPA 3A0RA 5J7EA 4KZBA 2EWWA 2X02A 3BLMA 2JHEA 3OCNA 3S7OA 1VEUA 3LIFA 4KZ9A 1NWZA 1E4DA 5HWVA 1S4RA 3D72A 5F83A 3BY8A 3WWXA 2VLGA 5J4EA 1W5DA 3C38A 4HJ4A 4NXGA 3JVVA 4NEED 1G5UA 1O07A 2W3HA 1YKDA 4GD8A 2XDMA 3N8RA 4HIAA 3ZFZA 5HDDA 4HBTA 2K2NA 1NRFA 1P9RA 1K55C 3SZTA 4GDBA 3MZEA 1GA0A 1TS6A 2J3TC 4NETA 1YLZA 4BJPA 5AQAA 5DJTA 3E4QA 2P7JA 2G7UA 4E6WA 5CXWA 3V67A 4PPRA 3SH7A 3F1OA 4R1GA 4ARZB 1LSVA 2CMNA 1W63Q 2B95A 4MLLA 4QWOA 4B93A 1IELA 1E25A 4MBKA 1H8MA 4LCMA 2XRNA 2GX5A 4RYEA 3KSFA 4DE0A 2H0YA 1FR1A 4R38A 4LENA 3Q7VB 3FZCA 4DDYA 5AQBA 3UDXA 4OONA 2QKPA 4WL9A 2EWVA 2Y2IA 4EXOA 1E3UA 2W27A 1GHMA 3M2KA 3LIDA 5FAQA 5FQIA 2ZL1B 4HP9A 5TBMA 4WMCD 3M6BA 4WUJA 4UAAA 1PI5A 4CJNA 4S2PA 2JN7A 2VV7A 4DXBA 4JXGA 4Q0IA 3E98A 4WN5A 2P74A 3BJNA 5HAPA 1CK3A 2XEPA 3CPTA 4IHQA 3VE3A 5DKKA 4PM5A 4HP4A 2OLVA 4UQIS 5CGSA 1L2SA 3IBJA 1GHIA 3NY4A 2BTFP 3MXSA 3LCEA 4K08A 2VKSA 4OH0A 2L0WA 4EUVA 3CWFA 3CITA 5AQ9A 4R4RA 4DF6A 4QB8A 2C6WB 3IQAA 3WS0A 4S2OA 1RGYA 4RQ9A 5F5YA 3KYZA 2ZMVA 3DAVA 1G6AA 3N4IA 1YAXA 3LGOA 3QNCA 3VOYA 3QP8A 3LUQA 2WAFA 4WMCA 4S2IA 3NBLA 4EW7A 2XQZA 2EX6A 4Y7PA 2KX6A 3G6OA 1L3LA 2LB9A 3DTKA 5CHUA 1H8YA 1PNEA 1DY6A 1T18A 3A3JA 1TDGA 3NOUC 2A49A 5L09A 1JVJA 5L2FA 4BLMA 3UMDA 3OPPA 4EUZA 2J9OA 4MCWA 4CPKA 3BFCA 3G4PA 3IXDA 4Y15A 4FH2A 5CGXA 4CLCA 4P6ZS 1PYYA 2WK0A 3ZG0A 3IBRA 3PBNA 2V20A 4O01A 3N8SA 5TJJA 1AXBA 1T1AA 3CUEA 2DCFA 3E4PA 4WELA 5I94A 5D3OA 4XXRA 1K56A 4F3LA 1KVMA 4KZAA 4KG5A 3GV9A 1OJ5A 1TVFA 3F1PA 3GQZA 2GZAA 3H82A 2V0UA 1ONHA 3ZCZA 4YOFA 2ZQDA 3IX3A 1YLPA 5C5KA 4X55A 3V5MA 3TJZC 1BYWA 1DRMA 3TRCA 3ZDJA 1SKFA 4GHIB 5TR7A 4GCZA 2HV1A 4R0QA 2HDRA 3IF5A 2ZMAA 5F69A 1PWCA 5HAIA 3VSLA 1DP6A 3VFHA 4R3JA 3LY3A 4H6JA 2XK1A 4I5SA 4BD0A 4ZTKA 2ZM0A 3GDIA 5EVID 5HD5A 3QP4A 2WKIA 4X68A 5HWWA 2A2LA 4IUHA 1LL5A 3DW0A 2QWSA 2IWDA 2JKRM 3HREA 2W1TA 3AGFA 4U0TA 1K25A 3T1XA 1W63M 4KUKA 4BQMA 2HP9A 4Q0HA 3NECA 2PD7A 4HESA 4OPZA 2XSSA 1LSXA 5FQ9A 1W8YA 3B42A 3LI9A 2HJEA 3LY4A 1WYBA 1GSVA 2XR0A 1I2SA 3OPRA 3GECA 1K6RA 3R7WB 4UQIM 3VP1A 2KOIA 4E3IA 2VA0A 4EESA 5FQQA 1W7FA 5EE8A 2FFYA 2QZ6A 3T4QA 3NJAA 4PAUA 1J9MA 3A3FA 1NXYA 3ULFA 5A91A 4FOFA 3IF6B 1PI4A 1XJ6A 1BLCA 3G2ZA 3UY6A 3W2ZA 1IYPA 3C4PA 1EROA 3SH9A 4OQIA 2GJ3A 3HLEA 3CMZA 1L0DA 3QHYA 3B47A 2HF6A 3A3EA 2K31A 1F98A 4HQAA 1JWZA 4HBUA 5L10A 5DFYA 4MN7A 2PT7A 2A24B 3FG8A 3S7PA 3UE1A 4DE3A 2VJWA 5DKLA 1TD5A 1F9IA 1Z09A 3SS5A 5HDCA 5L8MA 2K7SA 2J9PA 4N1HA 3PBRA 3N8LA 2INWA 3UPOA 3MZDA 4PM7A 2VZWA 5KSCA 3UN7A 4P6ZM 1YLJA 2UWXA 3VE4A 5CGWA 3O5YA 5IT5A 2QYBA 1S67L 3EGXC 4YFMA 3IHBA 1K38A 2Z2LB 1MY8A 4D2OA 2HDQA 2EXAA 2XGNA 3N7WA 1NLYA 2H10A 3WRZA 3TE8A 4X69A 5CEDA 5FASA 1SDEA 2ZC5B 3G30A 1XFQA 5A93A 4E3NA 3VOZA 1ODVA 1N9NA 3LR5A 2V1BA 3I7JA 1XGJA 4H8RA 1FCNA 3PXPA 4PMAA 2R9WA 5E2EA 1JTGA 3CHWP 4GB7A 5KIZA 2E8IA 2BASA 2V0WA 3Q82A 2H28A 4KZ3A 2H0TA 1S1ZA 3SS4A 2W1RA 4IBRA 2OOLA 2Z6DA 2V1ZA 4JXVA 3JPUA 3FPVA 5DJUA 3GR2A 3GMWA 5AVFA 1L0FA 2GNXA 3SH8A 2EX2A 3EEHA 5KSHA 1KGGA 4BBUA 1ONGA 1MBLA 4ARZA 1A0KA 4GS9B 3IT9A 4GKUA 1MXOA 2JC7A 4OOLA 5JYOA 1I5QA 4JLFA 4E6XA 4ID4A 5J3WA 4LV2A 2FH5A 2JKRI 1KGEA 4HHDA 3W8KA 3IS2B 1S6RA 2Y2KA 1IYQA 3S7NA 3Q7VA 2I9VA 4KQRA 4G3KA 4RA7A 3VV4A 3DTEA 2IA2A 3ITAA 4R23A 2P9VB 4LLOB 1EWZA 2WKEA 1VETB 4HEFA 2JBFA 4JXWA 1STZA 4GJ4A 2ZL1A 4A5RA 3P01A 4R70A 2E8JA 2G2WA 4LFUA 4KQOA 2H5SA 1YMSA 2QJ7A 4E04A 1M6KA 1QMEA 4I38A 3H7WB 5EM1A 3K3DA 2XH9A 3EEAA 1E3UD 3NULA 3LIAA 3T1QB 1XKZA 4QU3A 4GZBA 3HUMA 4DXCA 1ES3A 1MC0A 3NI9A 1WE4A 3UB5P 4JGQA 1N4OA 5DVAA 4R3BA 3K3CA 2OWHA 1JTDA 3AGEA 1YT4A 3NHQA 1LHYA 2Y2MA 3EQVA 1FQGA 4L9FA 4FTXA 2Z2MB 3IXGA 4X56A 4MBHA 3TG9A 4R6LA 1BULA 4EU0A 2IWBA 5DTSA 5DTKA 1X0OA 3ITBA 4JKTA 4RX3A 2OAP1 2J3WA 2VK3A 4ZJ3A 4IBXA 3IX8A 3G2YA 1D1JA 1NJ4A 3TOIA 4K0WA 2Y2OA 3ICYA 3V3RA 5DTTA 1K6SA 1Y54A 1XX2A 3HJIA 5EVEA 2PU2A 3LR3A 4E3OA 4KENB 2XA7M 3E2KA 3UB8A 1KGFA 4EEPA 4C75A 2PBYA 3LIBA 3OBFA 4S2NC 1HVBA 3FKWA 4U3TA 4FD8A 3B3XA 3GTCA 4KQDA 5HZHA 5DF8A 2W3DA 4N9KA 4WF0A 5AJGA 5FDHA 2EFUA 3VP2A 3SS3A 4XUZA 1SCWA 4I3AA 4G3WA 2WKRA 2EA9A 3UDFA 1HTZA 3NDEA 1RP5A 3V39A 4CLCD 5E2FA 4UA6A 1F5MA 2R78A 3R4KA 5CTMA 4S2LA 1N9OA 5E43A 5CERA 3BW6A 5EOOA 1D06A 1K56D 4GHIA 5EVIC 2XD5A 2PDRA 2WZXA 1ERMA 5L07A 4EBNA 5FDSA 4E3LA 4QPRA 5FAPA 1HD8A 2J80A 4GOGA 3LI8A 3OZHA 1GA9A 2PR6A 2J3TD 2JCHA 5HDSA 3WS4A 3BQ8A 3ZG7B 1SKOB 3ZQ5A 4KZ4A 3K2NA 1XFNA 1YMXA 2FZ0A 3KX0X 1NLZA 4UA9A 2Y2HA 3ZHHA 1ZC2A 1SHVA 2DNSA 3TW8A 4P6BA 3FC7A 1VHMA 4EV4A 5EFWA 1H0MA 1XJ3A 2WYXA 1MWSA 5TGFA 2JKTM 4WYYA 2ZM2A 4EETB 3JVUA 1CQAA 4XT2B 4HOIA 5AVEA 3IH8A 5FL3A 3T1SA 1Z6FA 4MN6A 1K4FA 1MWUA 3OLOA 4PM8A 2QHKA 1ES2A 5EECA 1GSXA 2HDSA 4KZ6A 3IXHA 3A3DA 3C5AA 4M3KA 3CI6A 4WEKA 2R9XA 1FILA 4X1MA 5FQMA 5GL9A 1IYOA 2PU4A 4Q0JA 1K55A 3CAXA 1OT9A 3EGDC 4S2KA 4BMWA 4X1LA 3BLSA 1QMFA 3S1YA 2Y8HA 1YLTA 5FI7A 4I39A 1H5XA 3KSHA 1U60A 3N6IA 3FYZA 1GSWA 3PYPA 4NG2A 4YNRA 3IF6A 4GDNA 1VM1A 5FSRA 2O9CA 2Q9MA 4EBPA 1OTAA 5CRFA 3C4OA 4HJ3A 4QY5A 2OLUA 4PHTA 3HLGA 3OPHA 2M7UA 4DDSA 1CI9A 1GCEA 3T4LA 3O88A 4ZRRA 1IKGA 2A24A 1YLWA 3ZYTA 1DJAA 2PYRA 2J7VA 1MKMA 3UB7A 3EOIA 3LEQA 1UWPX 2O9AA 4NXEA 2PRFA 3HBRA 4JBFA 1RCJA 4Y5FA 2ZQ8A 3MFXA 3BFGA 1L0EA 3E4OA 5EOEA 3VSKA 4OPRA 4FSFA 3PBOA 3BQAA 4DN0A 5HX9A 1DJBA 1ZG4A 5FA7A 2Y55A 1KE4A 1TDLA 4LRZE 1Y4OA 1CF0A 4HH2A 3O3VA 5HW3A 4ZJ2A 1FSYA 1OMEA 3MQQA 4EBLA 5EM0A 5EUAA 3PAEA 4CLCE 2D01A 4Q8IA 3UE3A 4OPYA 1PRQA 3QNBA 1ZKJA 2Y79A 3LO7A 5EPHA 5AQ7A 4B9OA 5EVLA 3KYEA 1VQQA 1PW1A 2KDKA 2P08A 1WA9A 4LGWA 4GD6A 2Y2LA 3D4FA 3LICA 3V50A 3L9KA 4P87A 5F1FA 3RH8B 3IH9A 4ZAMA 1TF1A 3BRMA 4E3JA 2I72A 3VP4A 2YKHA 1XGIA 2Y2NA 4XUXA 2QMIA 4L0LA 2OAQ1 4Y0UA 2B5RA 1T1CA 5A92A 5MC7A 1K57A 1XJ4A 2WKHA 1PZOA 4GS9A 3RXWA 1T19A 1W8QA 4N1XA 3BY9A 3P98A 3P7NA 1G28A 4WLAA 2JKFA 3G34A 3IS2A 3DWKA 4R3AA 2JKTI 3UE6A 5HL6A 2RL3A 4AFIA 5CEBA 5GHZA 2B02A 3F1NB 3PTEA 2W0NA 1ACFA 2XA7S 2P9VA 4NKPA 4ETZA 3LYXA 3MFDA 1VETA 4NXBA 2V2FF 3C30A 3LFVA 3OCLA 2XROA 5HL1A 4PM9A 3Q1FA 3MKFA 2ZC4B 4PM6A 1JWVA 1OTBA 1YM1A 3SOIA 4ESPA 2WGVA 2Y4AA 5EVIB 1DJCA 3H7WA 3T4SA 5CECA 1P9WA 2JKGA 3BFFA 5JYPA 4QD4A 1EW0A 3AGDA 2ZQ7A 4ZBEA 2Y59A 3L7HA 2ZM8A 2Y2GA 1M40A 3WS1A 4OPQA 3G32A 3OOVA 4M4XA 4DJ2A 1S4SA 4R4SA 1ES5A 4EQIA 2ZC6B 3MMHA 4Y2FA 2WGWB 4BBTA 3IWIA 3IWOA 1ESUA 1MKIA 3NIAA 3PBTA 1BTLA 3UE0A 3DTIA 4X6TA 4I3IA 5HARA 1NZOA 3BFEA 5M1AA 3HUOA 3V3SA 1PW8A 4BBVA 3LR4A 4OLDA 2W3FA 3RTYA 2EX9A 4B4ZA 4BD1A 4KZ5A 1Y28A 2M7VA 3UPNA 1CJFA 3IX4A 2HP5A 1UGUA 1BLHA 4FH4A 1TS0A 3A0SA 4LV0A 1NRJA 4LCLA 2X71A 1L0GA 3B33A 3UDIA 3PBQA 4S2JA 4DJ3A 3S7QA 4EEUA 3ZG9B 4JPMA 3LR0A 3BYDA 1MWTA 1V9ZA 1IYSA 1OTDA 5DF9A 3U2AA 4HI4A 5FAOA 3NDGA 1IEMA 5CTNA 4NK3A 1IKIA 2ZOIA 2WKPA 1I2WA 1BT5A 5M18A 4NXFA 1LSWA 2XD1A 3MJQA 4MDZA 2O0YA 2O99A 1DP8A 5HPIA 5F68A 4HNBA 1ES4A 1PWDA 1BSGA 4FUWA 1FR6A 3T12B 2OSUA 4CLCC 3GVBA 3P09A 4OOMA 5FQKA 2G2UA 2WADA 2V8FA 3VMAA 4IEDA 4WBGA 1KVLA 3WS5A 3CUEC 5EV0A 4Y3IA 1K54A 3VP0A 3BEBA 3FV7A 1GHPA 2L1MA 3UB9A 1Q2PA 3Q81A 2O9BA 4IVIA 1ESIA 1IOUA 3SW1A 2VGKA 4KUOA 4O7DA 1ZTUA 1FIKA 5LBRA 3O86A 3NOPC 4OQGA 4WZ4A 2HP6A 3PBSA 5FI2A 4DKIA 3EQUA 2VGLM 1BLPA 2JE5A 5G4ZA 2PBDP 2W3GA 4GLQA 3D9YA 1H8ZA 2EXBA 3EWKA 3JYIA 2LB5A 3IF6C 4S2MA 1PWGA 2PD8A 1HLUP 4OQHA 3T4KA 3QP2A 5FATA 4LRXC 5FQJA 4DE2A 4P85A 3QP6A 3O87A 1XA7A 4BL2A 1SKOA 4DE1A 2CC1A 4JF6A 1FOFA 2ZC3B 3KYQA 4WZ5A 2RCXA 1SZVA 4OP5A 2HGVA 1FCMA 3MR0A 4Y0OA 4X53A 5HFOA 1VEUB 3UB6A 4GN2A 4O0PA 2AVXA 4HY8A 2DRWA 1MWRA 1BZAA 4ME4A 4XT2A 1F2KA 2WAEA 3MBZA 1C3BA 4LRYC 3WRTA 1LLBA 3ZVWA 1PZPA 4HJ6A 1CEGA 5GHXA 2KLIA 3IWQA 3BECA 1WYCA 3MZFA 4F94A 3Q7ZA 4UEYA 3HVFA 1KDWA 2ACGA 2WKQA 2NUPC 2ZLYA 5HSQA 4ETXA 1BLSA 5KZHA 3QP5A 2ZQCA 5DF7A 3C8CA 4QY6A 4FCFA 3F1OB 3TSGA 2OWJA 3ZG8B 3UNWA 1P97A 5I5LA 2HDUA 3G35A 4EQ1A 1EI5A 2Y2JA 5GLDA 2VV6A 1OTEA 2VGJA 5U47A 4K91A 5KMWA 1BUEA 5HPFA 4OOYA 1K0KA 2Q0OA 3HLCA 4ZJ1A 5F6AA 1IFQA 4Y17A 4JXSA 4Y0TA 3CG5A 3LIEA 3CJMA 4P0MA 3MKEA 2VEAA 1NY0A 4KG2A 1YSQA 2PR5A 2A3UA 2V1AA 3DWZA 4GNUA 1MZUA 1KE3A 2WGIA 1V9YA 2HZ5A 3OC2A 5TBMB 5CHMA 5CX7A 1G68A 1OJGA 2ZD8A 3A0VA 1UWNX 3A3IA 3IXBA 1K57C 2PAVP 3HLDA 3VFFA 2W3EA 2VX8A 3E0YA 1DP9A 1XJ2A 5HD3A 1P0ZA 3ZVTA 2BLSA 3BWLA 4YINA 4CQHA 1YLYA 4OKPA 3MSHA 3NOTC 3CPTB 3M2JA 3R7WA 4QJGA 2UV0E 4Z1WA 1T1BA 4QHCA 5FEGA 1SDNA 4KZ7A 4O8GA 3W4PA 1FSWA 4LPZA 3C7UA 3HL9A 4OVDA 4G3VA 5TFQA 4OLGA 4X25A 1TEMA 1J3WA 4KZ8A 3ISGA 3NC8A 2J8YA 4OP8A 3ZGAB 4E3KA 3KO6A 3MXRA 1ALQA 5HAQA 2B18A 4JF5A 5GLCA 3OPLA 3NCKA 1VB6A 2ZQAA 2ZBBA 3C2WA 4IUKA 1TS7A 3W4QA 2ZJ9A 4WEJA 3FWLA 4JGRA 2EFXA 1G6OA 5G4YA 5FI6A 1XP4A 2ZOHA 1K4EA 4LV3A 2HJ9C 5DFXA 2NUTC 3HCYA 4Z9QA 2PYPA 1LT0A 2MJ6A 4S2NA 4MN5A 4CLCB 1XXMA 4L9EA 4MBFA 4OQ0A 4C3QA 2XFTA 1OPXA 4ZDXA 1KOUA 3D3OA 3F1NA 2X01A 4F3LB 3MQOA 3HLWA 2VV8A 4C6YA 1O7EA 3DTMA 4B88A 3ZNYA 3F1PB 1H3QA 2XF3A 3PHYA 3M6HA 3H82B 1NYYA 1YSPA 3MXQA 4LV1A 2OV5A 5EVIA 3VOLA 5G18A 4EERA 1YPRA 3FPWA 1OTIA 2WZZA 4RVAA 3MF0A 3E2LA 2Y91A 4II7A 2PHYA 3KSGA 1XPBA 4H6JB 5GLAA 3T1RA 1PFLA 3S4XA 3HJKA 5BOHA 3IHAA 2Y2PA 4MNRA 2ZMFA 3MS6A 5M19A 3HUNA 2V9AA 4YWZA 1FCOA 3H9WA 1K54C 2WGWA 3FKVA 1MPLA 4E3MA 5K5BA 3RJUA 4WM9A 4K0XA 2HPBA 2C5WB 1CEFA 2VGLS 1LL9A 4PKYA 3UMEA 1RGZA 1ZHHB 5FEFA 1S66L 2W1TB 1JNUA 1S0WA 2L4RA 3RFBA 4Y13A 1XA1A 1AWIA 5F82A 4EWFA 1ZG6A 3GSGA 2ZC7A 4U0XA 2D02A 1N9BA 5GHYA 4JGOA 1KE0A 3HLFA 3T4TA 1TS8A 4BL3A 5IHVA 2M1CA 4L9GA 4I3JA 2XLNA 2QJ5A 2XFSA 3CZDA 1HZOA 3T4OA 1LL8A 4WZ5C 5GLBA 4RX2A 1YQSA 4BWIA 1NYMA 5E2HA 3GRJA 1S1YA 2DMWA 4N92A 2QPNA 4KG6A 1N9LA 4BENA 4B4XA 4IJGA 3BM6A 2Q9NA 4HH3A 4JF4A 2V8CA 4JGPA 3T50A 1OT6A 3ZG5A 2IWCA 3C7VA 2WUQA 3S22A 1LI9A 3MQ0A 4UHUA 4DMZA 3DBAA 1NZUA 5IS1A 3PAGA 4PKYG 3PR6A 3RXXA 2P04A 2EX8A 3W4OA 4D60A 3ZNTA 5CHJA 4DRTA 3UO9A 4MMNA 5E2GA 3HLBA 5J8XA 3BFDA 1JWPA 2BG1A 3QP1A 5A90A 3WS2A 4KQQA 3U4LP 4N9LA 3CLOA 4IVKA 1CI8A 1D7EA 3Q07A 2Z6CA 1LI0A 2GDNA 2ZQ9A 1Q2QA 5F1GA 1ERQA 4MEZA 3T4JA 3VP3A 5HWTA 4UA7A
chains in the Genus database with same CATH topology
5A8BA 3B47A 2HF6A 5IU1A 2K31A 4ME4A 4XT2A 2Y8HA 1F98A 4HQAA 4LRYC 4I39A 2YKFA 5DFYA 3KSHA 3KSIA 4MN7A 2PT7A 4HJ6A 1GSWA 2A24B 3PYPA 4YNRA 2KLIA 3FG8A 3S7PA 2VJWA 5DKLA 4GW9A 1TD5A 2O9CA 3A0RA 5J7EA 1F9IA 2EWWA 1OTAA 4HJ3A 5HDCA 2JHEA 3OCNA 4UEYA 3S7OA 3LIFA 1NWZA 5L8MA 2K7SA 3PBRA 2WKQA 5HWVA 2INWA 1S4RA 3D72A 3BY8A 2NUPC 2VLGA 2VZWA 4PHTA 4P6ZM 5HSQA 3VE4A 2M7UA 4ETXA 5J4EA 3O5YA 3C8CA 3F1OB 5IT5A 2QYBA 1S67L 3C38A 4HJ4A 4NXGA 3T4LA 3EGXC 3JVVA 4ZRRA 2A24A 2OWJA 4NEED 2W3HA 1P97A 5I5LA 1YKDA 3ZYTA 4HIAA 2PYRA 1MKMA 4EQ1A 5HDDA 1NLYA 3UB7A 2K2NA 2VV6A 3EOIA 1OTEA 3TE8A 1P9RA 1UWPX 5HPFA 2O9AA 4NXEA 1TS6A 1XFQA 2J3TC 4BJPA 5F6AA 1IFQA 5DJTA 3E4QA 4Y5FA 2P7JA 2G7UA 1ODVA 3LIEA 3MFXA 1N9NA 3LR5A 3V67A 3F1OA 4ARZB 3E4OA 1LSVA 2V1BA 4FSFA 3PBOA 2CMNA 3BQAA 3PXPA 4DN0A 2VEAA 1W63Q 1YSQA 2PR5A 2V1AA 4B93A 4LRZE 1MZUA 1H8MA 4HH2A 5KIZA 1V9YA 3OC2A 2XRNA 5TBMB 2BASA 2V0WA 5CX7A 3MQQA 2H28A 2GX5A 1OJGA 3A0VA 1S1ZA 1UWNX 3KSFA 2W1RA 4R38A 4CLCE 2OOLA 2Z6DA 2D01A 3FPVA 5DJUA 3UE3A 2W3EA 2VX8A 5AVFA 3E0YA 2GNXA 1DP9A 2Y79A 1XJ2A 5HD3A 1P0ZA 4B9OA 3EEHA 5KSHA 2QKPA 4WL9A 2KDKA 2P08A 3BWLA 1WA9A 4BBUA 2EWVA 4ARZA 4CQHA 4EXOA 3NOTC 3LICA 3R7WA 2W27A 4GS9B 3LIDA 4Z1WA 4OOLA 1T1BA 3RH8B 4HP9A 5J3WA 5TBMA 2FH5A 2JKRI 4HHDA 1TF1A 3IS2B 4O8GA 4LPZA 4WUJA 3S7NA 4G3VA 2YKHA 2I9VA 2VV7A 4G3KA 4Q0IA 3E98A 3VV4A 4L0LA 2IA2A 4WN5A 2OAQ1 3BJNA 1T1CA 3KO6A 5MC7A 4LLOB 1XJ4A 4IHQA 4GS9A 3VE3A 1T19A 5DKKA 2B18A 4HP4A 3BY9A 4UQIS 1STZA 3P7NA 3IBJA 4GJ4A 3P01A 1G28A 4WLAA 1VB6A 4R70A 2ZBBA 3C2WA 4K08A 3IS2A 4KQOA 2VKSA 4R3AA 2JKTI 3UE6A 4IUKA 2QJ7A 2L0WA 5HL6A 4E04A 4EUVA 3CWFA 3CITA 4I38A 1TS7A 3H7WB 3K3DA 4AFIA 4WEJA 2B02A 3EEAA 4JGRA 3F1NB 3LIAA 1G6OA 2W0NA 5G4YA 2XA7S 4RQ9A 5F5YA 2ZOHA 3KYZA 2ZMVA 4NKPA 4ETZA 3LYXA 1YAXA 4NXBA 2HJ9C 3C30A 5DFXA 3HCYA 1MC0A 2NUTC 3LFVA 3OCLA 2XROA 3LUQA 2PYPA 1LT0A 2MJ6A 4EW7A 4JGQA 4MN5A 1OTBA 2KX6A 4CLCB 4L9EA 3G6OA 3K3CA 2OWHA 2LB9A 3H7WA 1OPXA 3NHQA 3T4SA 1P9WA 3EQVA 1KOUA 4L9FA 3D3OA 3F1NA 1EW0A 1T18A 3NOUC 4R6LA 3MQOA 4F3LB 2VV8A 4EU0A 3OOVA 4M4XA 4DJ2A 3UMDA 1X0OA 1S4SA 3F1PB 1H3QA 3PHYA 3H82B 4MCWA 3MMHA 2OAP1 2J3WA 4Y2FA 1YSPA 4BBTA 4CLCA 3MXQA 4P6ZS 3PBTA 3VOLA 3IBRA 4I3IA 3PBNA 4O01A 5TJJA 1T1AA 3CUEA 3ICYA 4EERA 3E4PA 3FPWA 1OTIA 4WELA 4BBVA 3HJIA 3MF0A 3LR4A 2W3FA 3RTYA 4II7A 2PHYA 3LR3A 1Y28A 3KSGA 2M7VA 4F3LA 4H6JB 2XA7M 3HJKA 1UGUA 3UB8A 1TS0A 4EEPA 1OJ5A 3A0SA 3F1PA 2ZMFA 2GZAA 1NRJA 3H82A 2V9AA 2V0UA 3B33A 4YWZA 3LIBA 3H9WA 4YOFA 3PBQA 5K5BA 3OBFA 5C5KA 4DJ3A 3S7QA 4EEUA 3TJZC 1BYWA 2VGLS 1DRMA 3LR0A 1V9ZA 3TRCA 4PKYA 3UMEA 1OTDA 4GHIB 4KQDA 5HZHA 4GCZA 2HV1A 1ZHHB 1S66L 5DF9A 2W3DA 4WF0A 3U2AA 4HI4A 5AJGA 5F69A 2W1TB 1JNUA 4I3AA 1DP6A 4G3WA 2WKRA 2EA9A 4H6JA 2L4RA 3RFBA 2ZOIA 2WKPA 4CLCD 4NXFA 1LSWA 4I5SA 3MJQA 4MDZA 2O0YA 2O99A 1F5MA 2D02A 3GDIA 1DP8A 5HD5A 5HPIA 5F68A 4HNBA 2R78A 3R4KA 4JGOA 1N9OA 4CLCC 3T4TA 3BW6A 1TS8A 1D06A 5HWWA 4OOMA 2A2LA 4IUHA 4GHIA 2M1CA 2QWSA 2PDRA 4L9GA 4I3JA 2QJ5A 3CUEC 2JKRM 4Y3IA 2W1TA 4QPRA 2L1MA 1W63M 4KUKA 3UB9A 2J80A 3T4OA 1LL8A 3LI8A 2PR6A 2J3TD 2O9BA 4Q0HA 1IOUA 5HDSA 3SW1A 2PD7A 4BWIA 4KUOA 1ZTUA 1S1YA 2DMWA 2XSSA 5LBRA 3NOPC 1N9LA 3BQ8A 3ZQ5A 1LSXA 3PBSA 4IJGA 3B42A 4HH3A 3LI9A 2HJEA 4JGPA 3T50A 3EQUA 3K2NA 1XFNA 3KX0X 2FZ0A 1OT6A 1NLZA 2VGLM 1GSVA 3MQ0A 5G4ZA 3TW8A 4DMZA 3DBAA 3FC7A 1VHMA 3GECA 3R7WB 4UQIM 2W3GA 4GLQA 5IS1A 5EFWA 2KOIA 1XJ3A 2VA0A 4PKYG 2JKTM 3PR6A 4EESA 3EWKA 2P04A 2LB5A 4EETB 3JVUA 2PD8A 4XT2B 4HOIA 5AVEA 5FL3A 3T4KA 4LRXC 4MN6A 4MMNA 3T4QA 3NJAA 3OLOA 2QHKA 4PAUA 1GSXA 3ULFA 4FOFA 3KYQA 1XJ6A 2HGVA 3CI6A 4WEKA 3CLOA 3MR0A 3W2ZA 1D7EA 2Z6CA 4Q0JA 3CAXA 1OT9A 3EGDC 3UB6A 4O0PA 2GJ3A 3T4JA 5HWTA 2JN7A 4BMWA 4HY8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P08 A;  4GJ4 A;  2P04 A; 
#chains in the Genus database with same CATH topology
 5A8B A;  1KDS A;  5IU1 A;  3G31 A;  1W79 A;  1PIO A;  2YKF A;  3KSI A;  2FFF B;  3LEZ A;  2Y2Q A;  4GW9 A;  3UPP A;  3A0R A;  5J7E A;  4KZB A;  2EWW A;  2X02 A;  3BLM A;  2JHE A;  3OCN A;  3S7O A;  1VEU A;  3LIF A;  4KZ9 A;  1NWZ A;  1E4D A;  5HWV A;  1S4R A;  3D72 A;  5F83 A;  3BY8 A;  3WWX A;  2VLG A;  5J4E A;  1W5D A;  3C38 A;  4HJ4 A;  4NXG A;  3JVV A;  4NEE D;  1G5U A;  1O07 A;  2W3H A;  1YKD A;  4GD8 A;  2XDM A;  3N8R A;  4HIA A;  3ZFZ A;  5HDD A;  4HBT A;  2K2N A;  1NRF A;  1P9R A;  1K55 C;  3SZT A;  4GDB A;  3MZE A;  1GA0 A;  1TS6 A;  2J3T C;  4NET A;  1YLZ A;  4BJP A;  5AQA A;  5DJT A;  3E4Q A;  2P7J A;  2G7U A;  4E6W A;  5CXW A;  3V67 A;  4PPR A;  3SH7 A;  3F1O A;  4R1G A;  4ARZ B;  1LSV A;  2CMN A;  1W63 Q;  2B95 A;  4MLL A;  4QWO A;  4B93 A;  1IEL A;  1E25 A;  4MBK A;  1H8M A;  4LCM A;  2XRN A;  2GX5 A;  4RYE A;  3KSF A;  4DE0 A;  2H0Y A;  1FR1 A;  4R38 A;  4LEN A;  3Q7V B;  3FZC A;  4DDY A;  5AQB A;  3UDX A;  4OON A;  2QKP A;  4WL9 A;  2EWV A;  2Y2I A;  4EXO A;  1E3U A;  2W27 A;  1GHM A;  3M2K A;  3LID A;  5FAQ A;  5FQI A;  2ZL1 B;  4HP9 A;  5TBM A;  4WMC D;  3M6B A;  4WUJ A;  4UAA A;  1PI5 A;  4CJN A;  4S2P A;  2JN7 A;  2VV7 A;  4DXB A;  4JXG A;  4Q0I A;  3E98 A;  4WN5 A;  2P74 A;  3BJN A;  5HAP A;  1CK3 A;  2XEP A;  3CPT A;  4IHQ A;  3VE3 A;  5DKK A;  4PM5 A;  4HP4 A;  2OLV A;  4UQI S;  5CGS A;  1L2S A;  3IBJ A;  1GHI A;  3NY4 A;  2BTF P;  3MXS A;  3LCE A;  4K08 A;  2VKS A;  4OH0 A;  2L0W A;  4EUV A;  3CWF A;  3CIT A;  5AQ9 A;  4R4R A;  4DF6 A;  4QB8 A;  2C6W B;  3IQA A;  3WS0 A;  4S2O A;  1RGY A;  4RQ9 A;  5F5Y A;  3KYZ A;  2ZMV A;  3DAV A;  1G6A A;  3N4I A;  1YAX A;  3LGO A;  3QNC A;  3VOY A;  3QP8 A;  3LUQ A;  2WAF A;  4WMC A;  4S2I A;  3NBL A;  4EW7 A;  2XQZ A;  2EX6 A;  4Y7P A;  2KX6 A;  3G6O A;  1L3L A;  2LB9 A;  3DTK A;  5CHU A;  1H8Y A;  1PNE A;  1DY6 A;  1T18 A;  3A3J A;  1TDG A;  3NOU C;  2A49 A;  5L09 A;  1JVJ A;  5L2F A;  4BLM A;  3UMD A;  3OPP A;  4EUZ A;  2J9O A;  4MCW A;  4CPK A;  3BFC A;  3G4P A;  3IXD A;  4Y15 A;  4FH2 A;  5CGX A;  4CLC A;  4P6Z S;  1PYY A;  2WK0 A;  3ZG0 A;  3IBR A;  3PBN A;  2V20 A;  4O01 A;  3N8S A;  5TJJ A;  1AXB A;  1T1A A;  3CUE A;  2DCF A;  3E4P A;  4WEL A;  5I94 A;  5D3O A;  4XXR A;  1K56 A;  4F3L A;  1KVM A;  4KZA A;  4KG5 A;  3GV9 A;  1OJ5 A;  1TVF A;  3F1P A;  3GQZ A;  2GZA A;  3H82 A;  2V0U A;  1ONH A;  3ZCZ A;  4YOF A;  2ZQD A;  3IX3 A;  1YLP A;  5C5K A;  4X55 A;  3V5M A;  3TJZ C;  1BYW A;  1DRM A;  3TRC A;  3ZDJ A;  1SKF A;  4GHI B;  5TR7 A;  4GCZ A;  2HV1 A;  4R0Q A;  2HDR A;  3IF5 A;  2ZMA A;  5F69 A;  1PWC A;  5HAI A;  3VSL A;  1DP6 A;  3VFH A;  4R3J A;  3LY3 A;  4H6J A;  2XK1 A;  4I5S A;  4BD0 A;  4ZTK A;  2ZM0 A;  3GDI A;  5EVI D;  5HD5 A;  3QP4 A;  2WKI A;  4X68 A;  5HWW A;  2A2L A;  4IUH A;  1LL5 A;  3DW0 A;  2QWS A;  2IWD A;  2JKR M;  3HRE A;  2W1T A;  3AGF A;  4U0T A;  1K25 A;  3T1X A;  1W63 M;  4KUK A;  4BQM A;  2HP9 A;  4Q0H A;  3NEC A;  2PD7 A;  4HES A;  4OPZ A;  2XSS A;  1LSX A;  5FQ9 A;  1W8Y A;  3B42 A;  3LI9 A;  2HJE A;  3LY4 A;  1WYB A;  1GSV A;  2XR0 A;  1I2S A;  3OPR A;  3GEC A;  1K6R A;  3R7W B;  4UQI M;  3VP1 A;  2KOI A;  4E3I A;  2VA0 A;  4EES A;  5FQQ A;  1W7F A;  5EE8 A;  2FFY A;  2QZ6 A;  3T4Q A;  3NJA A;  4PAU A;  1J9M A;  3A3F A;  1NXY A;  3ULF A;  5A91 A;  4FOF A;  3IF6 B;  1PI4 A;  1XJ6 A;  1BLC A;  3G2Z A;  3UY6 A;  3W2Z A;  1IYP A;  3C4P A;  1ERO A;  3SH9 A;  4OQI A;  2GJ3 A;  3HLE A;  3CMZ A;  1L0D A;  3QHY A;  3B47 A;  2HF6 A;  3A3E A;  2K31 A;  1F98 A;  4HQA A;  1JWZ A;  4HBU A;  5L10 A;  5DFY A;  4MN7 A;  2PT7 A;  2A24 B;  3FG8 A;  3S7P A;  3UE1 A;  4DE3 A;  2VJW A;  5DKL A;  1TD5 A;  1F9I A;  1Z09 A;  3SS5 A;  5HDC A;  5L8M A;  2K7S A;  2J9P A;  4N1H A;  3PBR A;  3N8L A;  2INW A;  3UPO A;  3MZD A;  4PM7 A;  2VZW A;  5KSC A;  3UN7 A;  4P6Z M;  1YLJ A;  2UWX A;  3VE4 A;  5CGW A;  3O5Y A;  5IT5 A;  2QYB A;  1S67 L;  3EGX C;  4YFM A;  3IHB A;  1K38 A;  2Z2L B;  1MY8 A;  4D2O A;  2HDQ A;  2EXA A;  2XGN A;  3N7W A;  1NLY A;  2H10 A;  3WRZ A;  3TE8 A;  4X69 A;  5CED A;  5FAS A;  1SDE A;  2ZC5 B;  3G30 A;  1XFQ A;  5A93 A;  4E3N A;  3VOZ A;  1ODV A;  1N9N A;  3LR5 A;  2V1B A;  3I7J A;  1XGJ A;  4H8R A;  1FCN A;  3PXP A;  4PMA A;  2R9W A;  5E2E A;  1JTG A;  3CHW P;  4GB7 A;  5KIZ A;  2E8I A;  2BAS A;  2V0W A;  3Q82 A;  2H28 A;  4KZ3 A;  2H0T A;  1S1Z A;  3SS4 A;  2W1R A;  4IBR A;  2OOL A;  2Z6D A;  2V1Z A;  4JXV A;  3JPU A;  3FPV A;  5DJU A;  3GR2 A;  3GMW A;  5AVF A;  1L0F A;  2GNX A;  3SH8 A;  2EX2 A;  3EEH A;  5KSH A;  1KGG A;  4BBU A;  1ONG A;  1MBL A;  4ARZ A;  1A0K A;  4GS9 B;  3IT9 A;  4GKU A;  1MXO A;  2JC7 A;  4OOL A;  5JYO A;  1I5Q A;  4JLF A;  4E6X A;  4ID4 A;  5J3W A;  4LV2 A;  2FH5 A;  2JKR I;  1KGE A;  4HHD A;  3W8K A;  3IS2 B;  1S6R A;  2Y2K A;  1IYQ A;  3S7N A;  3Q7V A;  2I9V A;  4KQR A;  4G3K A;  4RA7 A;  3VV4 A;  3DTE A;  2IA2 A;  3ITA A;  4R23 A;  2P9V B;  4LLO B;  1EWZ A;  2WKE A;  1VET B;  4HEF A;  2JBF A;  4JXW A;  1STZ A;  4GJ4 A;  2ZL1 A;  4A5R A;  3P01 A;  4R70 A;  2E8J A;  2G2W A;  4LFU A;  4KQO A;  2H5S A;  1YMS A;  2QJ7 A;  4E04 A;  1M6K A;  1QME A;  4I38 A;  3H7W B;  5EM1 A;  3K3D A;  2XH9 A;  3EEA A;  1E3U D;  3NUL A;  3LIA A;  3T1Q B;  1XKZ A;  4QU3 A;  4GZB A;  3HUM A;  4DXC A;  1ES3 A;  1MC0 A;  3NI9 A;  1WE4 A;  3UB5 P;  4JGQ A;  1N4O A;  5DVA A;  4R3B A;  3K3C A;  2OWH A;  1JTD A;  3AGE A;  1YT4 A;  3NHQ A;  1LHY A;  2Y2M A;  3EQV A;  1FQG A;  4L9F A;  4FTX A;  2Z2M B;  3IXG A;  4X56 A;  4MBH A;  3TG9 A;  4R6L A;  1BUL A;  4EU0 A;  2IWB A;  5DTS A;  5DTK A;  1X0O A;  3ITB A;  4JKT A;  4RX3 A;  2OAP 1;  2J3W A;  2VK3 A;  4ZJ3 A;  4IBX A;  3IX8 A;  3G2Y A;  1D1J A;  1NJ4 A;  3TOI A;  4K0W A;  2Y2O A;  3ICY A;  3V3R A;  5DTT A;  1K6S A;  1Y54 A;  1XX2 A;  3HJI A;  5EVE A;  2PU2 A;  3LR3 A;  4E3O A;  4KEN B;  2XA7 M;  3E2K A;  3UB8 A;  1KGF A;  4EEP A;  4C75 A;  2PBY A;  3LIB A;  3OBF A;  4S2N C;  1HVB A;  3FKW A;  4U3T A;  4FD8 A;  3B3X A;  3GTC A;  4KQD A;  5HZH A;  5DF8 A;  2W3D A;  4N9K A;  4WF0 A;  5AJG A;  5FDH A;  2EFU A;  3VP2 A;  3SS3 A;  4XUZ A;  1SCW A;  4I3A A;  4G3W A;  2WKR A;  2EA9 A;  3UDF A;  1HTZ A;  3NDE A;  1RP5 A;  3V39 A;  4CLC D;  5E2F A;  4UA6 A;  1F5M A;  2R78 A;  3R4K A;  5CTM A;  4S2L A;  1N9O A;  5E43 A;  5CER A;  3BW6 A;  5EOO A;  1D06 A;  1K56 D;  4GHI A;  5EVI C;  2XD5 A;  2PDR A;  2WZX A;  1ERM A;  5L07 A;  4EBN A;  5FDS A;  4E3L A;  4QPR A;  5FAP A;  1HD8 A;  2J80 A;  4GOG A;  3LI8 A;  3OZH A;  1GA9 A;  2PR6 A;  2J3T D;  2JCH A;  5HDS A;  3WS4 A;  3BQ8 A;  3ZG7 B;  1SKO B;  3ZQ5 A;  4KZ4 A;  3K2N A;  1XFN A;  1YMX A;  2FZ0 A;  3KX0 X;  1NLZ A;  4UA9 A;  2Y2H A;  3ZHH A;  1ZC2 A;  1SHV A;  2DNS A;  3TW8 A;  4P6B A;  3FC7 A;  1VHM A;  4EV4 A;  5EFW A;  1H0M A;  1XJ3 A;  2WYX A;  1MWS A;  5TGF A;  2JKT M;  4WYY A;  2ZM2 A;  4EET B;  3JVU A;  1CQA A;  4XT2 B;  4HOI A;  5AVE A;  3IH8 A;  5FL3 A;  3T1S A;  1Z6F A;  4MN6 A;  1K4F A;  1MWU A;  3OLO A;  4PM8 A;  2QHK A;  1ES2 A;  5EEC A;  1GSX A;  2HDS A;  4KZ6 A;  3IXH A;  3A3D A;  3C5A A;  4M3K A;  3CI6 A;  4WEK A;  2R9X A;  1FIL A;  4X1M A;  5FQM A;  5GL9 A;  1IYO A;  2PU4 A;  4Q0J A;  1K55 A;  3CAX A;  1OT9 A;  3EGD C;  4S2K A;  4BMW A;  4X1L A;  3BLS A;  1QMF A;  3S1Y A;  2Y8H A;  1YLT A;  5FI7 A;  4I39 A;  1H5X A;  3KSH A;  1U60 A;  3N6I A;  3FYZ A;  1GSW A;  3PYP A;  4NG2 A;  4YNR A;  3IF6 A;  4GDN A;  1VM1 A;  5FSR A;  2O9C A;  2Q9M A;  4EBP A;  1OTA A;  5CRF A;  3C4O A;  4HJ3 A;  4QY5 A;  2OLU A;  4PHT A;  3HLG A;  3OPH A;  2M7U A;  4DDS A;  1CI9 A;  1GCE A;  3T4L A;  3O88 A;  4ZRR A;  1IKG A;  2A24 A;  1YLW A;  3ZYT A;  1DJA A;  2PYR A;  2J7V A;  1MKM A;  3UB7 A;  3EOI A;  3LEQ A;  1UWP X;  2O9A A;  4NXE A;  2PRF A;  3HBR A;  4JBF A;  1RCJ A;  4Y5F A;  2ZQ8 A;  3MFX A;  3BFG A;  1L0E A;  3E4O A;  5EOE A;  3VSK A;  4OPR A;  4FSF A;  3PBO A;  3BQA A;  4DN0 A;  5HX9 A;  1DJB A;  1ZG4 A;  5FA7 A;  2Y55 A;  1KE4 A;  1TDL A;  4LRZ E;  1Y4O A;  1CF0 A;  4HH2 A;  3O3V A;  5HW3 A;  4ZJ2 A;  1FSY A;  1OME A;  3MQQ A;  4EBL A;  5EM0 A;  5EUA A;  3PAE A;  4CLC E;  2D01 A;  4Q8I A;  3UE3 A;  4OPY A;  1PRQ A;  3QNB A;  1ZKJ A;  2Y79 A;  3LO7 A;  5EPH A;  5AQ7 A;  4B9O A;  5EVL A;  3KYE A;  1VQQ A;  1PW1 A;  2KDK A;  2P08 A;  1WA9 A;  4LGW A;  4GD6 A;  2Y2L A;  3D4F A;  3LIC A;  3V50 A;  3L9K A;  4P87 A;  5F1F A;  3RH8 B;  3IH9 A;  4ZAM A;  1TF1 A;  3BRM A;  4E3J A;  2I72 A;  3VP4 A;  2YKH A;  1XGI A;  2Y2N A;  4XUX A;  2QMI A;  4L0L A;  2OAQ 1;  4Y0U A;  2B5R A;  1T1C A;  5A92 A;  5MC7 A;  1K57 A;  1XJ4 A;  2WKH A;  1PZO A;  4GS9 A;  3RXW A;  1T19 A;  1W8Q A;  4N1X A;  3BY9 A;  3P98 A;  3P7N A;  1G28 A;  4WLA A;  2JKF A;  3G34 A;  3IS2 A;  3DWK A;  4R3A A;  2JKT I;  3UE6 A;  5HL6 A;  2RL3 A;  4AFI A;  5CEB A;  5GHZ A;  2B02 A;  3F1N B;  3PTE A;  2W0N A;  1ACF A;  2XA7 S;  2P9V A;  4NKP A;  4ETZ A;  3LYX A;  3MFD A;  1VET A;  4NXB A;  2V2F F;  3C30 A;  3LFV A;  3OCL A;  2XRO A;  5HL1 A;  4PM9 A;  3Q1F A;  3MKF A;  2ZC4 B;  4PM6 A;  1JWV A;  1OTB A;  1YM1 A;  3SOI A;  4ESP A;  2WGV A;  2Y4A A;  5EVI B;  1DJC A;  3H7W A;  3T4S A;  5CEC A;  1P9W A;  2JKG A;  3BFF A;  5JYP A;  4QD4 A;  1EW0 A;  3AGD A;  2ZQ7 A;  4ZBE A;  2Y59 A;  3L7H A;  2ZM8 A;  2Y2G A;  1M40 A;  3WS1 A;  4OPQ A;  3G32 A;  3OOV A;  4M4X A;  4DJ2 A;  1S4S A;  4R4S A;  1ES5 A;  4EQI A;  2ZC6 B;  3MMH A;  4Y2F A;  2WGW B;  4BBT A;  3IWI A;  3IWO A;  1ESU A;  1MKI A;  3NIA A;  3PBT A;  1BTL A;  3UE0 A;  3DTI A;  4X6T A;  4I3I A;  5HAR A;  1NZO A;  3BFE A;  5M1A A;  3HUO A;  3V3S A;  1PW8 A;  4BBV A;  3LR4 A;  4OLD A;  2W3F A;  3RTY A;  2EX9 A;  4B4Z A;  4BD1 A;  4KZ5 A;  1Y28 A;  2M7V A;  3UPN A;  1CJF A;  3IX4 A;  2HP5 A;  1UGU A;  1BLH A;  4FH4 A;  1TS0 A;  3A0S A;  4LV0 A;  1NRJ A;  4LCL A;  2X71 A;  1L0G A;  3B33 A;  3UDI A;  3PBQ A;  4S2J A;  4DJ3 A;  3S7Q A;  4EEU A;  3ZG9 B;  4JPM A;  3LR0 A;  3BYD A;  1MWT A;  1V9Z A;  1IYS A;  1OTD A;  5DF9 A;  3U2A A;  4HI4 A;  5FAO A;  3NDG A;  1IEM A;  5CTN A;  4NK3 A;  1IKI A;  2ZOI A;  2WKP A;  1I2W A;  1BT5 A;  5M18 A;  4NXF A;  1LSW A;  2XD1 A;  3MJQ A;  4MDZ A;  2O0Y A;  2O99 A;  1DP8 A;  5HPI A;  5F68 A;  4HNB A;  1ES4 A;  1PWD A;  1BSG A;  4FUW A;  1FR6 A;  3T12 B;  2OSU A;  4CLC C;  3GVB A;  3P09 A;  4OOM A;  5FQK A;  2G2U A;  2WAD A;  2V8F A;  3VMA A;  4IED A;  4WBG A;  1KVL A;  3WS5 A;  3CUE C;  5EV0 A;  4Y3I A;  1K54 A;  3VP0 A;  3BEB A;  3FV7 A;  1GHP A;  2L1M A;  3UB9 A;  1Q2P A;  3Q81 A;  2O9B A;  4IVI A;  1ESI A;  1IOU A;  3SW1 A;  2VGK A;  4KUO A;  4O7D A;  1ZTU A;  1FIK A;  5LBR A;  3O86 A;  3NOP C;  4OQG A;  4WZ4 A;  2HP6 A;  3PBS A;  5FI2 A;  4DKI A;  3EQU A;  2VGL M;  1BLP A;  2JE5 A;  5G4Z A;  2PBD P;  2W3G A;  4GLQ A;  3D9Y A;  1H8Z A;  2EXB A;  3EWK A;  3JYI A;  2LB5 A;  3IF6 C;  4S2M A;  1PWG A;  2PD8 A;  1HLU P;  4OQH A;  3T4K A;  3QP2 A;  5FAT A;  4LRX C;  5FQJ A;  4DE2 A;  4P85 A;  3QP6 A;  3O87 A;  1XA7 A;  4BL2 A;  1SKO A;  4DE1 A;  2CC1 A;  4JF6 A;  1FOF A;  2ZC3 B;  3KYQ A;  4WZ5 A;  2RCX A;  1SZV A;  4OP5 A;  2HGV A;  1FCM A;  3MR0 A;  4Y0O A;  4X53 A;  5HFO A;  1VEU B;  3UB6 A;  4GN2 A;  4O0P A;  2AVX A;  4HY8 A;  2DRW A;  1MWR A;  1BZA A;  4ME4 A;  4XT2 A;  1F2K A;  2WAE A;  3MBZ A;  1C3B A;  4LRY C;  3WRT A;  1LLB A;  3ZVW A;  1PZP A;  4HJ6 A;  1CEG A;  5GHX A;  2KLI A;  3IWQ A;  3BEC A;  1WYC A;  3MZF A;  4F94 A;  3Q7Z A;  4UEY A;  3HVF A;  1KDW A;  2ACG A;  2WKQ A;  2NUP C;  2ZLY A;  5HSQ A;  4ETX A;  1BLS A;  5KZH A;  3QP5 A;  2ZQC A;  5DF7 A;  3C8C A;  4QY6 A;  4FCF A;  3F1O B;  3TSG A;  2OWJ A;  3ZG8 B;  3UNW A;  1P97 A;  5I5L A;  2HDU A;  3G35 A;  4EQ1 A;  1EI5 A;  2Y2J A;  5GLD A;  2VV6 A;  1OTE A;  2VGJ A;  5U47 A;  4K91 A;  5KMW A;  1BUE A;  5HPF A;  4OOY A;  1K0K A;  2Q0O A;  3HLC A;  4ZJ1 A;  5F6A A;  1IFQ A;  4Y17 A;  4JXS A;  4Y0T A;  3CG5 A;  3LIE A;  3CJM A;  4P0M A;  3MKE A;  2VEA A;  1NY0 A;  4KG2 A;  1YSQ A;  2PR5 A;  2A3U A;  2V1A A;  3DWZ A;  4GNU A;  1MZU A;  1KE3 A;  2WGI A;  1V9Y A;  2HZ5 A;  3OC2 A;  5TBM B;  5CHM A;  5CX7 A;  1G68 A;  1OJG A;  2ZD8 A;  3A0V A;  1UWN X;  3A3I A;  3IXB A;  1K57 C;  2PAV P;  3HLD A;  3VFF A;  2W3E A;  2VX8 A;  3E0Y A;  1DP9 A;  1XJ2 A;  5HD3 A;  1P0Z A;  3ZVT A;  2BLS A;  3BWL A;  4YIN A;  4CQH A;  1YLY A;  4OKP A;  3MSH A;  3NOT C;  3CPT B;  3M2J A;  3R7W A;  4QJG A;  2UV0 E;  4Z1W A;  1T1B A;  4QHC A;  5FEG A;  1SDN A;  4KZ7 A;  4O8G A;  3W4P A;  1FSW A;  4LPZ A;  3C7U A;  3HL9 A;  4OVD A;  4G3V A;  5TFQ A;  4OLG A;  4X25 A;  1TEM A;  1J3W A;  4KZ8 A;  3ISG A;  3NC8 A;  2J8Y A;  4OP8 A;  3ZGA B;  4E3K A;  3KO6 A;  3MXR A;  1ALQ A;  5HAQ A;  2B18 A;  4JF5 A;  5GLC A;  3OPL A;  3NCK A;  1VB6 A;  2ZQA A;  2ZBB A;  3C2W A;  4IUK A;  1TS7 A;  3W4Q A;  2ZJ9 A;  4WEJ A;  3FWL A;  4JGR A;  2EFX A;  1G6O A;  5G4Y A;  5FI6 A;  1XP4 A;  2ZOH A;  1K4E A;  4LV3 A;  2HJ9 C;  5DFX A;  2NUT C;  3HCY A;  4Z9Q A;  2PYP A;  1LT0 A;  2MJ6 A;  4S2N A;  4MN5 A;  4CLC B;  1XXM A;  4L9E A;  4MBF A;  4OQ0 A;  4C3Q A;  2XFT A;  1OPX A;  4ZDX A;  1KOU A;  3D3O A;  3F1N A;  2X01 A;  4F3L B;  3MQO A;  3HLW A;  2VV8 A;  4C6Y A;  1O7E A;  3DTM A;  4B88 A;  3ZNY A;  3F1P B;  1H3Q A;  2XF3 A;  3PHY A;  3M6H A;  3H82 B;  1NYY A;  1YSP A;  3MXQ A;  4LV1 A;  2OV5 A;  5EVI A;  3VOL A;  5G18 A;  4EER A;  1YPR A;  3FPW A;  1OTI A;  2WZZ A;  4RVA A;  3MF0 A;  3E2L A;  2Y91 A;  4II7 A;  2PHY A;  3KSG A;  1XPB A;  4H6J B;  5GLA A;  3T1R A;  1PFL A;  3S4X A;  3HJK A;  5BOH A;  3IHA A;  2Y2P A;  4MNR A;  2ZMF A;  3MS6 A;  5M19 A;  3HUN A;  2V9A A;  4YWZ A;  1FCO A;  3H9W A;  1K54 C;  2WGW A;  3FKV A;  1MPL A;  4E3M A;  5K5B A;  3RJU A;  4WM9 A;  4K0X A;  2HPB A;  2C5W B;  1CEF A;  2VGL S;  1LL9 A;  4PKY A;  3UME A;  1RGZ A;  1ZHH B;  5FEF A;  1S66 L;  2W1T B;  1JNU A;  1S0W A;  2L4R A;  3RFB A;  4Y13 A;  1XA1 A;  1AWI A;  5F82 A;  4EWF A;  1ZG6 A;  3GSG A;  2ZC7 A;  4U0X A;  2D02 A;  1N9B A;  5GHY A;  4JGO A;  1KE0 A;  3HLF A;  3T4T A;  1TS8 A;  4BL3 A;  5IHV A;  2M1C A;  4L9G A;  4I3J A;  2XLN A;  2QJ5 A;  2XFS A;  3CZD A;  1HZO A;  3T4O A;  1LL8 A;  4WZ5 C;  5GLB A;  4RX2 A;  1YQS A;  4BWI A;  1NYM A;  5E2H A;  3GRJ A;  1S1Y A;  2DMW A;  4N92 A;  2QPN A;  4KG6 A;  1N9L A;  4BEN A;  4B4X A;  4IJG A;  3BM6 A;  2Q9N A;  4HH3 A;  4JF4 A;  2V8C A;  4JGP A;  3T50 A;  1OT6 A;  3ZG5 A;  2IWC A;  3C7V A;  2WUQ A;  3S22 A;  1LI9 A;  3MQ0 A;  4UHU A;  4DMZ A;  3DBA A;  1NZU A;  5IS1 A;  3PAG A;  4PKY G;  3PR6 A;  3RXX A;  2P04 A;  2EX8 A;  3W4O A;  4D60 A;  3ZNT A;  5CHJ A;  4DRT A;  3UO9 A;  4MMN A;  5E2G A;  3HLB A;  5J8X A;  3BFD A;  1JWP A;  2BG1 A;  3QP1 A;  5A90 A;  3WS2 A;  4KQQ A;  3U4L P;  4N9L A;  3CLO A;  4IVK A;  1CI8 A;  1D7E A;  3Q07 A;  2Z6C A;  1LI0 A;  2GDN A;  2ZQ9 A;  1Q2Q A;  5F1G A;  1ERQ A;  4MEZ A;  3T4J A;  3VP3 A;  5HWT A;  4UA7 A; 
#chains in the Genus database with same CATH homology
 5A8B A;  3B47 A;  2HF6 A;  5IU1 A;  2K31 A;  4ME4 A;  4XT2 A;  2Y8H A;  1F98 A;  4HQA A;  4LRY C;  4I39 A;  2YKF A;  5DFY A;  3KSH A;  3KSI A;  4MN7 A;  2PT7 A;  4HJ6 A;  1GSW A;  2A24 B;  3PYP A;  4YNR A;  2KLI A;  3FG8 A;  3S7P A;  2VJW A;  5DKL A;  4GW9 A;  1TD5 A;  2O9C A;  3A0R A;  5J7E A;  1F9I A;  2EWW A;  1OTA A;  4HJ3 A;  5HDC A;  2JHE A;  3OCN A;  4UEY A;  3S7O A;  3LIF A;  1NWZ A;  5L8M A;  2K7S A;  3PBR A;  2WKQ A;  5HWV A;  2INW A;  1S4R A;  3D72 A;  3BY8 A;  2NUP C;  2VLG A;  2VZW A;  4PHT A;  4P6Z M;  5HSQ A;  3VE4 A;  2M7U A;  4ETX A;  5J4E A;  3O5Y A;  3C8C A;  3F1O B;  5IT5 A;  2QYB A;  1S67 L;  3C38 A;  4HJ4 A;  4NXG A;  3T4L A;  3EGX C;  3JVV A;  4ZRR A;  2A24 A;  2OWJ A;  4NEE D;  2W3H A;  1P97 A;  5I5L A;  1YKD A;  3ZYT A;  4HIA A;  2PYR A;  1MKM A;  4EQ1 A;  5HDD A;  1NLY A;  3UB7 A;  2K2N A;  2VV6 A;  3EOI A;  1OTE A;  3TE8 A;  1P9R A;  1UWP X;  5HPF A;  2O9A A;  4NXE A;  1TS6 A;  1XFQ A;  2J3T C;  4BJP A;  5F6A A;  1IFQ A;  5DJT A;  3E4Q A;  4Y5F A;  2P7J A;  2G7U A;  1ODV A;  3LIE A;  3MFX A;  1N9N A;  3LR5 A;  3V67 A;  3F1O A;  4ARZ B;  3E4O A;  1LSV A;  2V1B A;  4FSF A;  3PBO A;  2CMN A;  3BQA A;  3PXP A;  4DN0 A;  2VEA A;  1W63 Q;  1YSQ A;  2PR5 A;  2V1A A;  4B93 A;  4LRZ E;  1MZU A;  1H8M A;  4HH2 A;  5KIZ A;  1V9Y A;  3OC2 A;  2XRN A;  5TBM B;  2BAS A;  2V0W A;  5CX7 A;  3MQQ A;  2H28 A;  2GX5 A;  1OJG A;  3A0V A;  1S1Z A;  1UWN X;  3KSF A;  2W1R A;  4R38 A;  4CLC E;  2OOL A;  2Z6D A;  2D01 A;  3FPV A;  5DJU A;  3UE3 A;  2W3E A;  2VX8 A;  5AVF A;  3E0Y A;  2GNX A;  1DP9 A;  2Y79 A;  1XJ2 A;  5HD3 A;  1P0Z A;  4B9O A;  3EEH A;  5KSH A;  2QKP A;  4WL9 A;  2KDK A;  2P08 A;  3BWL A;  1WA9 A;  4BBU A;  2EWV A;  4ARZ A;  4CQH A;  4EXO A;  3NOT C;  3LIC A;  3R7W A;  2W27 A;  4GS9 B;  3LID A;  4Z1W A;  4OOL A;  1T1B A;  3RH8 B;  4HP9 A;  5J3W A;  5TBM A;  2FH5 A;  2JKR I;  4HHD A;  1TF1 A;  3IS2 B;  4O8G A;  4LPZ A;  4WUJ A;  3S7N A;  4G3V A;  2YKH A;  2I9V A;  2VV7 A;  4G3K A;  4Q0I A;  3E98 A;  3VV4 A;  4L0L A;  2IA2 A;  4WN5 A;  2OAQ 1;  3BJN A;  1T1C A;  3KO6 A;  5MC7 A;  4LLO B;  1XJ4 A;  4IHQ A;  4GS9 A;  3VE3 A;  1T19 A;  5DKK A;  2B18 A;  4HP4 A;  3BY9 A;  4UQI S;  1STZ A;  3P7N A;  3IBJ A;  4GJ4 A;  3P01 A;  1G28 A;  4WLA A;  1VB6 A;  4R70 A;  2ZBB A;  3C2W A;  4K08 A;  3IS2 A;  4KQO A;  2VKS A;  4R3A A;  2JKT I;  3UE6 A;  4IUK A;  2QJ7 A;  2L0W A;  5HL6 A;  4E04 A;  4EUV A;  3CWF A;  3CIT A;  4I38 A;  1TS7 A;  3H7W B;  3K3D A;  4AFI A;  4WEJ A;  2B02 A;  3EEA A;  4JGR A;  3F1N B;  3LIA A;  1G6O A;  2W0N A;  5G4Y A;  2XA7 S;  4RQ9 A;  5F5Y A;  2ZOH A;  3KYZ A;  2ZMV A;  4NKP A;  4ETZ A;  3LYX A;  1YAX A;  4NXB A;  2HJ9 C;  3C30 A;  5DFX A;  3HCY A;  1MC0 A;  2NUT C;  3LFV A;  3OCL A;  2XRO A;  3LUQ A;  2PYP A;  1LT0 A;  2MJ6 A;  4EW7 A;  4JGQ A;  4MN5 A;  1OTB A;  2KX6 A;  4CLC B;  4L9E A;  3G6O A;  3K3C A;  2OWH A;  2LB9 A;  3H7W A;  1OPX A;  3NHQ A;  3T4S A;  1P9W A;  3EQV A;  1KOU A;  4L9F A;  3D3O A;  3F1N A;  1EW0 A;  1T18 A;  3NOU C;  4R6L A;  3MQO A;  4F3L B;  2VV8 A;  4EU0 A;  3OOV A;  4M4X A;  4DJ2 A;  3UMD A;  1X0O A;  1S4S A;  3F1P B;  1H3Q A;  3PHY A;  3H82 B;  4MCW A;  3MMH A;  2OAP 1;  2J3W A;  4Y2F A;  1YSP A;  4BBT A;  4CLC A;  3MXQ A;  4P6Z S;  3PBT A;  3VOL A;  3IBR A;  4I3I A;  3PBN A;  4O01 A;  5TJJ A;  1T1A A;  3CUE A;  3ICY A;  4EER A;  3E4P A;  3FPW A;  1OTI A;  4WEL A;  4BBV A;  3HJI A;  3MF0 A;  3LR4 A;  2W3F A;  3RTY A;  4II7 A;  2PHY A;  3LR3 A;  1Y28 A;  3KSG A;  2M7V A;  4F3L A;  4H6J B;  2XA7 M;  3HJK A;  1UGU A;  3UB8 A;  1TS0 A;  4EEP A;  1OJ5 A;  3A0S A;  3F1P A;  2ZMF A;  2GZA A;  1NRJ A;  3H82 A;  2V9A A;  2V0U A;  3B33 A;  4YWZ A;  3LIB A;  3H9W A;  4YOF A;  3PBQ A;  5K5B A;  3OBF A;  5C5K A;  4DJ3 A;  3S7Q A;  4EEU A;  3TJZ C;  1BYW A;  2VGL S;  1DRM A;  3LR0 A;  1V9Z A;  3TRC A;  4PKY A;  3UME A;  1OTD A;  4GHI B;  4KQD A;  5HZH A;  4GCZ A;  2HV1 A;  1ZHH B;  1S66 L;  5DF9 A;  2W3D A;  4WF0 A;  3U2A A;  4HI4 A;  5AJG A;  5F69 A;  2W1T B;  1JNU A;  4I3A A;  1DP6 A;  4G3W A;  2WKR A;  2EA9 A;  4H6J A;  2L4R A;  3RFB A;  2ZOI A;  2WKP A;  4CLC D;  4NXF A;  1LSW A;  4I5S A;  3MJQ A;  4MDZ A;  2O0Y A;  2O99 A;  1F5M A;  2D02 A;  3GDI A;  1DP8 A;  5HD5 A;  5HPI A;  5F68 A;  4HNB A;  2R78 A;  3R4K A;  4JGO A;  1N9O A;  4CLC C;  3T4T A;  3BW6 A;  1TS8 A;  1D06 A;  5HWW A;  4OOM A;  2A2L A;  4IUH A;  4GHI A;  2M1C A;  2QWS A;  2PDR A;  4L9G A;  4I3J A;  2QJ5 A;  3CUE C;  2JKR M;  4Y3I A;  2W1T A;  4QPR A;  2L1M A;  1W63 M;  4KUK A;  3UB9 A;  2J80 A;  3T4O A;  1LL8 A;  3LI8 A;  2PR6 A;  2J3T D;  2O9B A;  4Q0H A;  1IOU A;  5HDS A;  3SW1 A;  2PD7 A;  4BWI A;  4KUO A;  1ZTU A;  1S1Y A;  2DMW A;  2XSS A;  5LBR A;  3NOP C;  1N9L A;  3BQ8 A;  3ZQ5 A;  1LSX A;  3PBS A;  4IJG A;  3B42 A;  4HH3 A;  3LI9 A;  2HJE A;  4JGP A;  3T50 A;  3EQU A;  3K2N A;  1XFN A;  3KX0 X;  2FZ0 A;  1OT6 A;  1NLZ A;  2VGL M;  1GSV A;  3MQ0 A;  5G4Z A;  3TW8 A;  4DMZ A;  3DBA A;  3FC7 A;  1VHM A;  3GEC A;  3R7W B;  4UQI M;  2W3G A;  4GLQ A;  5IS1 A;  5EFW A;  2KOI A;  1XJ3 A;  2VA0 A;  4PKY G;  2JKT M;  3PR6 A;  4EES A;  3EWK A;  2P04 A;  2LB5 A;  4EET B;  3JVU A;  2PD8 A;  4XT2 B;  4HOI A;  5AVE A;  5FL3 A;  3T4K A;  4LRX C;  4MN6 A;  4MMN A;  3T4Q A;  3NJA A;  3OLO A;  2QHK A;  4PAU A;  1GSX A;  3ULF A;  4FOF A;  3KYQ A;  1XJ6 A;  2HGV A;  3CI6 A;  4WEK A;  3CLO A;  3MR0 A;  3W2Z A;  1D7E A;  2Z6C A;  4Q0J A;  3CAX A;  1OT9 A;  3EGD C;  3UB6 A;  4O0P A;  2GJ3 A;  3T4J A;  5HWT A;  2JN7 A;  4BMW A;  4HY8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...