2P06A

Crystal structure of a predicted coding region af_0060 from archaeoglobus fulgidus dsm 4304
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
84
structure length
84
Chain Sequence
MDYFRLAEKFLREMHAKYMKRVSRPGNTPRPWFDFSEERLLSRLFEEMDELREAVEKEDWENLRDELLDVANFCMYLWGKLSVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a predicted coding region AF_0060 from Archaeoglobus fulgidus DSM 4304
rcsb
source organism Archaeoglobus fulgidus dsm 4304
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein AF_0060
total genus 28
structure length 84
sequence length 84
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03819 MazG MazG nucleotide pyrophosphohydrolase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1080 Mainly Alpha Orthogonal Bundle Helix Hairpins MazG-like 2p06A00
1YXBA 2A3QA 3C90A 5IE9A 2OIGA 2GTAA 1Y6XA 2YXHA 3CRCA 2Q73A 2OIEA 4QGPA 2Q5ZA 2A7WA 2Q4PA 2Q9LA 3CRAA 1VMGA 2P06A 1YVWA
chains in the Genus database with same CATH superfamily
1YDXA 2VRZA 4PA9A 2IBZH 4DR7B 2H94A 1THZA 2XHBA 1Y74A 1VQKV 1N36B 3S3WA 3B09A 1JFFB 3PJSK 1XMQO 2WWWA 3L9DA 2GHYA 4BAYA 4YY3O 3HPLC 1Q81W 1FXKB 4O4HB 3FB8C 4B7KA 4ZKIA 1WN7A 3KG2A 4KL1A 4X62O 1YHQV 4FLYA 1YVWA 4AILC 3OTFA 2AHZA 3ZX6A 5BXZA 2UU9B 1VQPV 1G8MA 4GX1A 3N2KA 4DR4B 2UXBO 3UQ8A 2EIJB 5JVDB 2JS5A 1QVGU 3F7VC 4DR5O 5KX5B 2KSDA 3A8TA 3BRCA 4UVCA 4O2AB 3OMAB 5IYBO 3FFQA 2VQFB 1GN2A 3L70H 1GMGA 4IIJA 2ZXWC 4IGGA 5J2UA 1NR1A 3L75H 1IX9A 5LMNB 4B3RO 1H2KA 2A9HA 2R70A 4X64B 4DV0B 4DR1B 3Q4HA 4X9QA 4AI8A 4HZ3A 3RYCA 3H9VA 2JJ2G 3HB3B 4MTFA 5DN6G 2JJ1G 3ZN0A 1M4UA 2E75B 1P84F 1J5EO 3RYHB 1VF6C 1ORQC 3ZMTA 2Q4PA 1XHZA 1F23A 2OCHA 3ASNB 4OPAA 4EKWA 4IIJB 5BR8B 4X64O 4DV0O 2PY5A 3SGIA 1RP3B 1T5EA 1F4NA 3UM7A 4BIOA 1COWG 4PELA 1KD1W 3CJHA 3FAVA 3B2EE 1NQTA 3IC7A 5IDJA 1JR9A 2V1DA 2ZDIC 4O2BA 4RO2A 4U7OA 1N32B 5B3SC 1FFXB 1P7GA 1AP6A 3CRCA 4DV1B 4NTXA 2UUBO 2OWOA 1GAXA 1N33O 1SS3A 2RQ6A 1WA8B 2P7TC 2YICA 1I94O 2XAHA 2JK5C 4NXNB 3OGIB 2A7WA 3AEIA 4I4TB 1W0KG 2W6IG 5EYPA 3BHPA 3UO3A 3B77A 5JJNB 1H8EG 3OEEG 4NB5A 3T1HO 1PKXA 3D36C 1HWYA 1MZEA 3SYQA 5ITZB 1D5NA 1K8AW 3UCSC 3BABA 5EC1C 4C7UA 1MA1A 1BGYH 2QTOA 3IFXA 1TVKB 1VQLV 5IWAB 3UT5A 2Y4UA 1DK1A 4MW3A 4JV5B 3LSQA 1N0JA 2VWKA 5EBWC 1V55B 1WPBA 2GDSA 1N33B 3CCEV 2QKSA 5HFLA 2HEPA 3D36A 4AQYB 1XDCA 3RT3C 3DC5A 5FLXN 2BSKB 4TQDA 4RAIA 1VP7A 1FXHA 1Y4MA 2JEXA 3JCZA 4NYKA 4BR6A 3UKMA 1US6A 3DGEA 1DF4A 3GB7C 1Q6HA 2IU3A 1AROP 1VF6A 4DR6O 5JH7B 3H1KH 1Y76B 2D3OW 1O9HA 1KU9A 5JJEB 3QO5A 4BWAA 1BSMA 3FB7C 2RN9A 2ARHA 4K3AA 1UFIA 1IXBA 2MW2B 4UVAA 1YTFB 4G27B 5J2TA 3CXHF 4XDLA 2VQEB 3D3IA 3K58A 2LW1A 3JCUZ 1Q8IA 3MHSC 2ZT9B 3WB1A 1OV9A 4LNUA 4NXMB 4FIPC 3CPWU 3LDEA 1FD9A 1SERA 3BPZA 4EB6B 2UUAO 3FAVB 3F7YC 1IURA 3OTOO 3ZIAG 3OM3B 1K4DC 4I0XB 5KHIA 2EJRA 3ASOB 4GKKO 3OUFA 2CH7B 4I55A 3ZMSA 5KUMA 4DV7O 2XAJA 5EIBD 2NNUA 4EFEA 1BT8A 1TA8A 3G4SV 1FAFA 1PL0A 1JOYA 2A06H 1NJIW 5LXTA 3JAMN 3CP1A 2IJJA 4F4LA 4DV6B 1OCRB 2CTQA 1DGSA 1JMKC 2QWPB 1XMOO 2EX3A 1KC8W 1R3LC 4GKKB 3J7AU 2ZDIA 1I0HA 1ZAUA 3X2QC 3APQA 4JYBA 5EIBC 5GTHZ 3P30A 3LNNA 2ETNA 3C3SA 3CSXA 1PNKA 1AI6A 2E76B 2Q0OC 3TETA 3A2FA 2PZSA 1N34O 3CCRV 1I5XA 4B3MO 5BY1A 4X62B 1AR4A 5FNVA 5JQGB 1Z5VA 1NBMG 2ZR2A 4J80A 1FXVA 2DJVA 2VQEO 4DV5B 2RNBA 1M57C 3J80N 2YEVB 3FYEB 1V55C 2M7WA 3ZHUA 2IJHA 4CS4A 2F66C 4JI1B 1DLBA 3WG7C 5KAIZ 5FL7G 5GONA 1YZBA 1SQBH 4OPHA 4FJCC 2DW4A 3DC6A 4G2KA 1JJOA 4FVMA 2X6CA 3M7MX 2CDYA 3G67A 1IBLB 1NVPB 4U7NA 4YJ2B 4NXMO 3G80A 1E79G 1IBLO 4QGPA 3MHHC 1H8HG 5LHIA 1JX9A 4JF3A 1BMFG 3I5DA 2Q73A 4N23A 1ZSPA 4MVRA 2PI4A 3N2GA 3UO2A 2CGOA 3CC4V 1R6TA 3ASOC 1HDJA 3N2GB 4ZI7A 2ITCC 2WPDG 4I0XA 1VQ9V 2LW7A 1ZX3A 3KCXA 3CXCU 2BOBC 1Z2GA 3SPJA 3TJTA 1S5LZ 4WBNA 2BOCC 3CX5F 4P2ZA 2YDEA 1XNQB 2RJZA 2HVJC 3W7WA 1I7FA 1MOFA 1K97A 1HW7A 1FFXA 1B06A 2HFEC 3T1YB 5DEDA 2KQXA 1L1FA 1FKAO 3ASNC 3BCCH 1SKVA 4BW9A 2R9AA 4JI7B 2Q6AA 1QVFU 1TUBB 1OJHA 2B1GA 4X65B 4WFEA 4JI1O 4DV3B 4JTDB 4J7JA 5B66Z 2Q7GA 1XEQA 3CHXA 1PV0A 1SQPH 3R66A 4OXSA 1K34A 5L3FA 1KBHA 2YXHA 4TV8A 4FLZA 4QE7A 4FLVA 2LO1A 4LF7O 2DWEC 5J2UB 1E1QG 2QE7G 3H1HH 4MTOA 1YJWV 3W7XA 1KMIZ 5LP6B 4FM2A 3E8HA 2GTSA 3K9AA 1YITV 3BEHA 1BQZA 2WA4A 1N32O 4GX2A 3CEIA 4J7KA 4QE9A 4KP4A 1LUWA 2N05A 4O4JA 2ZNJA 4KHPO 3RFRA 2DYSB 2FB5A 5CBFA 2VWJA 1YIJV 1R6KA 1R3IC 3JARB 2QKAA 3QG5A 1VQOV 5B1AC 3BA9A 1P4RA 3ZRSA 4CS3A 2XAQA 5C8YB 4JI8B 1URFA 5BR8O 2PGGA 4Z1VA 1GN6A 1R3JC 2AZ0A 2UUBB 1BE3H 2A79B 1ZUQA 3N2KB 1XREA 4I4TA 1XUQA 4TQFA 4UFZA 2P90A 2Z5UA 1ZWIC 3K0DA 4I9WA 4MVSA 1NVPD 2WLHA 4RQEA 3E35A 3JD3A 1R3KC 3A0HZ 3OTOB 1QR8A 4O4IB 4MVZA 4X66B 1EBOA 5KMGA 3QF7A 5CA3A 4ZBMA 3H1JH 5A9GA 5LBQA 3E86A 4JI0B 3ZHRA 1HNXB 1MSDA 4TT3G 2HLDG 2LQTA 4TV9A 1FFTB 3DXRB 1W59A 4P9OA 1NH2B 4DW0A 4O4IA 1FJGB 4O2BB 4K0KB 4R8CA 4LR3A 4MTGA 2RCVA 4P30A 2BE3A 2YI9A 1G6UA 3CCMV 3ZBHA 2GV9A 3CRQA 2CTPA 1SQQH 4DR6B 1IBKO 3VOUA 1YXBA 1KUQA 2XOKG 4DV2O 4LH7A 4I50A 3SJQC 4FLUA 4GUNA 4LF6O 4DV3O 4B7EA 2UUCB 5F2VO 4ICGA 1H38A 3JAKA 4B3TB 4DR7O 4PA7A 1RM1B 4LFAO 4OX9B 4I50B 3GVMA 1VARA 4GCZA 2JRIA 1GM7A 1HP8A 4CH5A 5IJ0B 1TUEB 1CEZA 4GYCB 2JDIG 1LUVA 3RYCB 1YF2A 4O2AA 2EIMC 4DV4O 5D5QA 4FZ0A 4DV4B 2CAZC 2X0LA 4DXWA 5IWAO 3ABLB 5JVDA 1QLNA 4LCUC 2BTOA 3D3QA 2E5LO 4PI0A 3CS5A 4IT5A 4MVQA 2IW5A 1BL8A 5H5NA 4KXRA 5BMVA 4U3FH 5KX5A 2H3OA 3R65A 1PNMA 1VQ8V 5B5EZ 4HAMA 3OD4A 5GTIZ 1HNXO 1PP9H 3L72H 1AR1B 4DV2B 2FMLA 5L3GA 5IT9N 1PD3A 1VF7A 2YIAA 4UV8A 3OUSA 2QWQB 3CCQV 1GRJA 1YJ9V 1UJWB 2JGDA 2ZQMA 3BY6A 1I94B 5CB4B 3M99B 4YJ2A 2ATKC 3THOA 4Z2WA 4DR3O 4K8ZA 1BZKA 2AHYA 3MAQA 1Y74B 1J5EB 2UXDO 3F5WC 4KFMA 2E74B 2OTLV 3K79A 4MT8A 4JI6B 3ZJZA 1WB7A 1S72V 4LF9B 1NT2B 2KB1A 2XUMA 3P3PA 4DR1O 2CTWA 4LP8A 1OCOB 2O57A 4ZI7B 3T1CA 5CBGA 1GH6A 3OR6C 1QNMA 4K8XA 1OCZB 2EILB 4LH6A 1R6NA 4DRXB 2XAGA 4MS2A 1M90W 3ABMC 3K5NA 2V7QG 3ABTA 2OCCB 4LFCO 3QTCA 5K1PA 1KB9F 2EINB 4JI5B 3F5TA 3T4ZA 4UCTA 4ZHQB 2ADPA 1LR1A 2ZCEA 3ZHQA 3L74H 4D7TA 4DYLA 3STLC 1NTMH 1K4CC 4H13B 4NVPA 3RYIB 3SJAC 3EVKA 4CC5A 2QDOA 2QR4A 1CPYA 4IYIA 4YY3B 4JI4B 3KKYA 4HBNA 4ZIBA 1XOUA 1JA8A 1A32A 1Q43A 3K9SA 4JYAO 1OCOC 2YEVA 4W4LA 1GM9A 2OT5A 4N21A 1S76D 4TOIA 2GBOA 1B04A 4JTCB 2ZE6A 4XDJA 2EZPA 4PI2A 3ETQA 4PA6A 1SESA 2EIKB 1WAZA 1VQ7V 2UUAB 5B1OA 2QEXV 4D6TH 4ZOLB 2EJ7A 3L73H 3AG2B 5LGNA 5EZYB 2Q7EA 1YI2V 4LF5O 5H2FZ 1XNQO 2WA3A 5LYJA 2B5UA 5L3CA 1EN4A 2ZINA 4FMTA 1XQ8A 2ZR3A 4L8JA 1HNWO 1KP2A 3A0BZ 1JPXA 3KZIZ 3G6BA 2WSSG 4G28B 2YC0A 3E2EA 1XILA 4X65O 4GKJO 1K9MW 1NS1A 3T4DA 1N4CA 4QPJA 1K5QA 3AK1A 4DUYO 2QGNA 1TAEA 1SQFA 3SDLA 2D2CB 2B1IA 2XNDG 3CCLV 2WLIB 1MNGA 3HKBA 3MDSA 2F4VB 2PUSA 2JS3A 2OIEA 4I9QA 3EFFK 4TUYA 1L8DA 3JD1A 4F6RB 5LOVA 4DK1A 4EFBA 1WJZA 4X20A 1EZJA 2DQ0A 3ABMB 2LFSA 3OMIB 4UV9A 1QR9A 1UPGA 4MSWC 5E79Z 5KHJA 3O65A 2JIZG 1GM8A 1HNWB 1GK9A 3JATA 4GZRB 4MVOA 1SZTA 4DV5O 1WB8A 3HKDB 4TV8B 1YTFD 4BW5A 4UB8Z 2N04A 2F4VO 5B1AB 3TCUA 2DYRC 5FPRA 4WFBV 3SYAA 3JAWA 1YCIA 1AVMA 1QU7A 4KUMA 4DUYB 1GN3A 1PNLA 4GX5A 1IBMB 4B3TO 3K5OA 2B9ZA 4AQYO 3IGAC 2HG5C 1V54C 3O9OA 4JZGA 2P22C 2R9IA 3B8MA 3P3NA 5IYDO 5A2QN 2UXNA 1J95A 2ZIOA 3AG7A 4JV5O 3K5MA 3ZEDA 4UVBA 4HYOA 4NTWA 3OR7C 1NI8A 4EB6A 3CRRA 2UXCB 3LDCA 2Y48A 1XNRO 4XDKA 3SJBC 2ITDC 2IJIA 4O4LA 3TXSA 2QM8A 1W0JG 3LDDA 2GTAA 3OFNG 4P9PA 3AG3B 1X59A 4Z1MG 4J42A 1SZXA 5J9PC 4JI3B 3E8FA 1Y67A 4R7CA 1NTZH 1FYJA 2ZD9A 2GUZB 4IYHA 4B3SB 4ABMA 3SYCA 3IC9A 1QLEC 3FYIB 2WAMA 2EULA 1Y76A 5B1NA 3STZC 4LFBB 3ABKB 4IHJB 3C3TA 3CJHB 4YXWG 5IYZB 3OW2U 3VBBA 1FJGO 2DN9A 4TSFG 2XT9A 4DV1O 1PM9A 2WLNA 5HFMA 5IYZA 2L6LA 3ZHSA 1EN5A 5LHGA 1I5YA 1N0NA 4DV7B 1D5AA 3RYFB 2AGAA 1Z5WA 5LA6A 4JI0O 1Q90D 2QWOB 5AG2A 4CC6A 4DK0A 5JH7A 2BCCH 4RQFA 1V54B 4JZ2A 2DWDC 4PDVA 1NH2D 3AK3A 2JGDB 2X7RB 1OCZC 1M1KW 2P5OA 2LGQA 3E83A 2Q7HA 4KHPB 4UCOA 4RUEA 4DR4O 1BS3A 3ZRWB 2V4DA 4WCEV 2Y69C 4FFBA 2KKWA 4LFBO 5LXTB 2WLLA 1KYOF 2E5LB 1DTOA 4JI8O 2FTKA 3JAWB 1M9NA 1H2MA 2EINC 5LMNO 3CRMA 1EN6A 2G38A 2HR3A 2IH1C 4J9YB 4JGSA 3CD6V 3LSUA 3JAKB 1YSCA 2VQFO 4FFKA 3ZRVA 5JCOC 2W6JG 1IXMA 3CYOA 3RGBA 2IH3C 3OEHG 4UCSA 4LF8B 2UXBB 4LF8O 2YIDA 3J81N 5KAFZ 1EM1A 4JYYA 2UU9O 1JFFA 3T1YO 1S3JA 3CRAA 2EIMB 1M5IA 5EK0A 3RBZA 1M56C 4PD4F 1AI4A 3CC2V 1IBKB 1DF5A 4LBEC 3ZHTA 5H6QA 4YJ3B 2OTJV 2A0LA 4NXNO 3QVNA 2K1EA 4JYCA 3E22A 5KLVH 3ZCCA 1K5SA 4R50A 4XBFA 3E22B 2WLKA 5K1XA 3HKBB 1M57B 5TISZ 3BVOA 3T1HB 4LWSA 5BMVB 2IU0A 5IY5B 3M8AA 2WLJA 2R9RB 1K92A 2CTRA 5J2TB 2PI5A 1R1BA 1Q6UA 3RVYA 4CBCA 2Z3YA 3ABUA 1SQVH 5LGUA 2AXTZ 4MW8A 2Q8VA 1R73A 2Q9LA 2A3QA 2DOSA 1JQ0A 1QBZA 1K73W 4GLXA 1TGOA 4UCVA 1L0LH 1BHAA 1S5JA 2E3CA 2FKXA 4MTXA 3LSSA 5B3SB 3CCJV 2DMXA 4BIUA 1X4TA 4B3MB 4FLWA 1H2NA 3I56V 3VQWA 1RPOA 3VQVA 4DRXA 1Q7YW 3SPCA 4W4KA 2Z0AA 3QNEA 4H0LB 2QWNB 1Q82W 1HR0O 5KHGA 2YXLA 1ENVA 2PYJA 4FM0A 3G6EV 5IYCO 1OCCC 3WG7B 4YHHO 3OGCC 2QM4A 3EHBB 2VS0A 4YIOA 2CK3G 3FB5C 3KCYA 2X6AA 2ZE8A 4ZHQA 3TK1A 2RDCA 1RM1C 1S0VA 3K0GA 1H2GA 5IY5C 2HJDA 1GTOA 5LMUO 4J10A 3CMEV 1P49A 2BTQA 5EBMC 5GW7A 4JASA 2BTQB 5EYPB 4JYAB 2EIKC 2ZNIA 4NKGB 1XL6A 4X1YB 5LMUB 1XNRB 3ZRXA 3K5LA 1HNZB 1XHXA 2JVDA 1VF5B 3EXAA 1VEWA 3CC7V 1PL4A 3ETGA 3ZMUA 1O9GA 3AG4B 5DECA 3JD4A 2LP7A 3W7SA 3OAAG 4J7ZA 3JSNA 4JI6O 4X1KB 1MABG 3RYHA 2EIJC 4X89A 1H2SB 2ZE7A 4BIZA 4JI2B 2DE0X 1RFYA 2QJ1A 5CMUA 3A0RA 3TGUH 3WU2Z 1AR5A 4E4EA 4JAVA 2GUZA 1BCCH 2M6YA 3N27A 3VQYA 3U11A 1VQNV 5FNVB 3GWOA 3LUTB 1G1XB 1SQGA 2HHHO 2NR5A 2XASA 1OZ0A 3D8CA 3E8BA 1CXZB 1WLEA 2UXXA 1NTKH 4CH4A 2KG7A 1NR7A 3T2MA 3Q4HB 2OCCC 2GSMB 1KP3A 3DTUB 3G71V 4WFHA 3JATB 1V9PA 4TWKA 4Q6GA 1VQ5V 3JSLA 3E89A 1CP9A 2EILC 5LP6C 4MVUA 4CH6A 5KUKA 4EEQA 2CE4A 2OYQA 5CN0A 2HVKC 1TUBA 4WFAV 4JTAB 4ASUG 3H1LH 5CA1B 4X88A 5LOVB 1N34B 2P6JA 1HNZO 4UCRA 1MZFA 4A5UB 2HHHB 1AB3A 5LA6B 4J41A 2XAFA 3ML0A 4YIPA 4WFGA 1WP7A 3JALB 2ZE5A 1KKCA 4LFAB 3OE7G 2YS8A 4PDRA 3I55V 1OCCB 5EBLC 2Y0PA 5FPOA 3SPHA 1AP5A 3ABKC 4YJ3A 4F6EA 5LHHA 4DV6O 5JCOA 3U0ZA 4X1KA 4GX0A 1VQMV 1JCHA 5L3BA 4LNUB 3ETDA 1U96A 4LF5B 1XL4A 4PV1B 3RVZA 3BA8A 2YIBA 3CCSV 1SA0A 4K0KO 4I5SA 3CCUV 3AG3C 1WPXA 4LWSB 4Q20A 4IHJA 3IJ4A 2DQ3A 2UUCO 1GO3F 3OT7A 2AZ2A 2DYRB 1MG1A 2H8PC 4LF6B 5LYJB 1HR0B 2QSAA 4O4JB 1EZVH 1D2DA 4QNHB 5EC2C 1SA0B 3DSQA 3JALA 1JJ2U 4B08A 3FX7A 3RWRD 4JAAA 1RSOA 4JPRA 1WP8A 2LJ2A 3IAYA 1FXKC 3AG1C 1U97A 2UXDB 4CS2A 3P32A 4K35A 5GONB 3U10A 4DW1A 4LFCB 3ETEA 2P4KA 2Q68A 1VQ4V 3ZRWA 2ADQB 4X66O 5LP6A 1VIBA 4X8AA 4FFBB 4WF9V 1P7BA 2HJFC 5IJ9B 3GWKC 4UUJC 3H01A 5B1BB 4NR1A 3TXQA 5JQGA 1WNSA 5CA1A 3RYFA 3AG2C 5CBHA 2YUAA 1SC5B 1GKFA 1SRYA 4WBNB 2Q5ZA 4H37A 3K03A 5CA0B 1W2BU 3B40A 2UXCO 3C90A 3ICXA 3BFRA 5IJ9A 1K7DA 5ITZA 3MD0A 3AG4C 1L0NH 2FYUH 4B3SO 2WLIA 1PPJH 3JD2A 3ZS8C 4FZ1A 4B3RB 2JGUA 2NLJC 2W0XA 2EBOA 4JI3O 1RPRA 3RN4A 3UT5B 3OMNB 5LGTA 2WLMA 1BHBA 5L3DA 1AJQA 1ZL8B 1TVKA 4HNAA 4U3JA 2NN4A 5KHKA 3WB0A 4DR5B 4HNAB 4U3JB 3E8GA 1IBMO 1S77D 4FPPA 4JI7O 1ZL8A 1WA8A 3SYPA 2LFRA 1MSWD 1Q3EA 4ZOLA 4UCUA 4O4LB 4LC1A 2W0FC 4R6ZA 4LF7B 1XBLA 1IVSA 4FM1A 3FB6C 1ZTEA 4AHCA 4D7SA 2DYSC 2Q0AA 5H6RA 2ZM6B 3ZN1A 5CB4A 3HKCA 5E1AC 2ZXWB 2ZIMA 2PF4E 1E1RG 4OX9O 1F7YA 2LGWA 5IJ0A 3K06A 2YSUB 2EZOA 3W7TA 2ODMA 5KA5A 4UB6Z 1GN4A 1SF9A 1NU1H 2P67A 2Y0IA 2ILMA 1QCEA 2L35A 4PHZA 1Q86W 3AG1B 2RMKB 5CA0A 2Y4TA 3CB2A 3JYCA 2HP8A 1QLEB 1XI1A 1RSOB 5LL6Y 4FLXA 4L87A 3SJCC 3H1IH 1JVMA 1NKDA 1B3QA 2YIBD 1M56B 5C93A 4J9ZB 3HKCB 4H44B 1KQSU 4PJ0Z 4FK5C 2R72A 4LF4O 2YI8A 3SR2C 1KKDA 4RUFA 1VQ6V 3QO8A 4TUYB 4JI2O 3LNMB 1AJNA 3HKDA 3JD0A 4JAUA 1K3EA 1NZ6A 2CH7A 4I55B 3W7UA 2Q69A 3VQXA 2X6BA 1Q6IA 4DUZO 3JASB 4UXNA 2OIGA 1B6QA 4X20B 1BQ0A 4PA3A 1FPOA 2F1MA 1ZLZA 3SPGA 1OHHG 1VMGA 4GKJB 4TV9B 5BZBA 3CCVV 3HR0A 1FXKA 4O4HA 2FL4A 3NR7A 1XMOB 2AW9A 4GT1A 1SQXH 1QHTA 4IL6Z 4QIWF 2IJKA 2PYLA 2JEUA 3BAAA 1N8RW 1ROPA 2P06A 4QPKA 2QWRB 3FD9A 3WFVA 1AI5A 2CGNA 2F93B 1H2LA 4J11A 3SYOA 3APOA 4PA4A 3CWBH 3NXSA 1Y66A 1Y6XA 2ZKOA 3ABLC 3AK2A 4YHHB 2QTSA 1SETA 5IE9A 2MK3A 3ZMVA 2F23A 1YEWA 1N36O 1LNQA 2F95B 4X1YA 4X1IA 4DR2B 2QA4V 4DR2O 4PDMA 2YXYA 1I08A 3K04A 3B8NA 3RW0A 5D5PA 3K57A 4JI4O 3CE2A 3JASA 3X2QB 1AILA 3RYIA 4E2LA 5KHHA 1AI7A 4H33A 3JARA 3K3WA 1IZ3A 2PTMA 1FS0G 3FKSG 5EZYA 2C2AA 1K33A 5DM6V 1QQCA 3HKEB 2Y69B 1XMQB 3K08A 4JI5O 4LF4B 2IM9A 1IDSA 4MVMA 3ZMZA 2CUGA 4DR3B 2BSKA 3HKEA 5C8YA 1G4YB 3CMAV 2K9PA 4NTYA 5H9CA 5KA6A 3K59A 4FLTA 3B4SA 1M93A 2Q67A 1F4MA 4DUZB 1MMMA 5B1BC 1S5HC 4CZZA 2QM7A 3WB2A 2KG7B 2P4VA 4LF9O 2HKOA 1KECA 3DXRA 4QJFB 1Q5OA 4PDLA 2WLLB 3S3XA 5L3EA 3ZHVA 1EFRG 1YJNV 4I7ZB 4OGQB 2ZM6O 4CH3A 3L71H 2N74A 3QO7A 4RWUA 1OCRC 3SPIA 1F51A 5KMGB 5JWPA 3PN1A 4WFFA 2QKCA 4F6RA 1AJPA 4X1IB 5JJJB 2F43G 2XTAA 4DO2A
chains in the Genus database with same CATH topology
1YXBA 2A3QA 3C90A 5IE9A 2OIGA 2GTAA 1Y6XA 2YXHA 3CRCA 2Q73A 2OIEA 4QGPA 2Q5ZA 2A7WA 2Q4PA 2Q9LA 3CRAA 1VMGA 2P06A 1YVWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YXB A;  2A3Q A;  3C90 A;  5IE9 A;  2OIG A;  2GTA A;  1Y6X A;  2YXH A;  3CRC A;  2Q73 A;  2OIE A;  4QGP A;  2Q5Z A;  2A7W A;  2Q4P A;  2Q9L A;  3CRA A;  1VMG A;  2P06 A;  1YVW A; 
#chains in the Genus database with same CATH topology
 1YDX A;  2VRZ A;  4PA9 A;  2IBZ H;  4DR7 B;  2H94 A;  1THZ A;  2XHB A;  1Y74 A;  1VQK V;  1N36 B;  3S3W A;  3B09 A;  1JFF B;  3PJS K;  1XMQ O;  2WWW A;  3L9D A;  2GHY A;  4BAY A;  4YY3 O;  3HPL C;  1Q81 W;  1FXK B;  4O4H B;  3FB8 C;  4B7K A;  4ZKI A;  1WN7 A;  3KG2 A;  4KL1 A;  4X62 O;  1YHQ V;  4FLY A;  1YVW A;  4AIL C;  3OTF A;  2AHZ A;  3ZX6 A;  5BXZ A;  2UU9 B;  1VQP V;  1G8M A;  4GX1 A;  3N2K A;  4DR4 B;  2UXB O;  3UQ8 A;  2EIJ B;  5JVD B;  2JS5 A;  1QVG U;  3F7V C;  4DR5 O;  5KX5 B;  2KSD A;  3A8T A;  3BRC A;  4UVC A;  4O2A B;  3OMA B;  5IYB O;  3FFQ A;  2VQF B;  1GN2 A;  3L70 H;  1GMG A;  4IIJ A;  2ZXW C;  4IGG A;  5J2U A;  1NR1 A;  3L75 H;  1IX9 A;  5LMN B;  4B3R O;  1H2K A;  2A9H A;  2R70 A;  4X64 B;  4DV0 B;  4DR1 B;  3Q4H A;  4X9Q A;  4AI8 A;  4HZ3 A;  3RYC A;  3H9V A;  2JJ2 G;  3HB3 B;  4MTF A;  5DN6 G;  2JJ1 G;  3ZN0 A;  1M4U A;  2E75 B;  1P84 F;  1J5E O;  3RYH B;  1VF6 C;  1ORQ C;  3ZMT A;  2Q4P A;  1XHZ A;  1F23 A;  2OCH A;  3ASN B;  4OPA A;  4EKW A;  4IIJ B;  5BR8 B;  4X64 O;  4DV0 O;  2PY5 A;  3SGI A;  1RP3 B;  1T5E A;  1F4N A;  3UM7 A;  4BIO A;  1COW G;  4PEL A;  1KD1 W;  3CJH A;  3FAV A;  3B2E E;  1NQT A;  3IC7 A;  5IDJ A;  1JR9 A;  2V1D A;  2ZDI C;  4O2B A;  4RO2 A;  4U7O A;  1N32 B;  5B3S C;  1FFX B;  1P7G A;  1AP6 A;  3CRC A;  4DV1 B;  4NTX A;  2UUB O;  2OWO A;  1GAX A;  1N33 O;  1SS3 A;  2RQ6 A;  1WA8 B;  2P7T C;  2YIC A;  1I94 O;  2XAH A;  2JK5 C;  4NXN B;  3OGI B;  2A7W A;  3AEI A;  4I4T B;  1W0K G;  2W6I G;  5EYP A;  3BHP A;  3UO3 A;  3B77 A;  5JJN B;  1H8E G;  3OEE G;  4NB5 A;  3T1H O;  1PKX A;  3D36 C;  1HWY A;  1MZE A;  3SYQ A;  5ITZ B;  1D5N A;  1K8A W;  3UCS C;  3BAB A;  5EC1 C;  4C7U A;  1MA1 A;  1BGY H;  2QTO A;  3IFX A;  1TVK B;  1VQL V;  5IWA B;  3UT5 A;  2Y4U A;  1DK1 A;  4MW3 A;  4JV5 B;  3LSQ A;  1N0J A;  2VWK A;  5EBW C;  1V55 B;  1WPB A;  2GDS A;  1N33 B;  3CCE V;  2QKS A;  5HFL A;  2HEP A;  3D36 A;  4AQY B;  1XDC A;  3RT3 C;  3DC5 A;  5FLX N;  2BSK B;  4TQD A;  4RAI A;  1VP7 A;  1FXH A;  1Y4M A;  2JEX A;  3JCZ A;  4NYK A;  4BR6 A;  3UKM A;  1US6 A;  3DGE A;  1DF4 A;  3GB7 C;  1Q6H A;  2IU3 A;  1ARO P;  1VF6 A;  4DR6 O;  5JH7 B;  3H1K H;  1Y76 B;  2D3O W;  1O9H A;  1KU9 A;  5JJE B;  3QO5 A;  4BWA A;  1BSM A;  3FB7 C;  2RN9 A;  2ARH A;  4K3A A;  1UFI A;  1IXB A;  2MW2 B;  4UVA A;  1YTF B;  4G27 B;  5J2T A;  3CXH F;  4XDL A;  2VQE B;  3D3I A;  3K58 A;  2LW1 A;  3JCU Z;  1Q8I A;  3MHS C;  2ZT9 B;  3WB1 A;  1OV9 A;  4LNU A;  4NXM B;  4FIP C;  3CPW U;  3LDE A;  1FD9 A;  1SER A;  3BPZ A;  4EB6 B;  2UUA O;  3FAV B;  3F7Y C;  1IUR A;  3OTO O;  3ZIA G;  3OM3 B;  1K4D C;  4I0X B;  5KHI A;  2EJR A;  3ASO B;  4GKK O;  3OUF A;  2CH7 B;  4I55 A;  3ZMS A;  5KUM A;  4DV7 O;  2XAJ A;  5EIB D;  2NNU A;  4EFE A;  1BT8 A;  1TA8 A;  3G4S V;  1FAF A;  1PL0 A;  1JOY A;  2A06 H;  1NJI W;  5LXT A;  3JAM N;  3CP1 A;  2IJJ A;  4F4L A;  4DV6 B;  1OCR B;  2CTQ A;  1DGS A;  1JMK C;  2QWP B;  1XMO O;  2EX3 A;  1KC8 W;  1R3L C;  4GKK B;  3J7A U;  2ZDI A;  1I0H A;  1ZAU A;  3X2Q C;  3APQ A;  4JYB A;  5EIB C;  5GTH Z;  3P30 A;  3LNN A;  2ETN A;  3C3S A;  3CSX A;  1PNK A;  1AI6 A;  2E76 B;  2Q0O C;  3TET A;  3A2F A;  2PZS A;  1N34 O;  3CCR V;  1I5X A;  4B3M O;  5BY1 A;  4X62 B;  1AR4 A;  5FNV A;  5JQG B;  1Z5V A;  1NBM G;  2ZR2 A;  4J80 A;  1FXV A;  2DJV A;  2VQE O;  4DV5 B;  2RNB A;  1M57 C;  3J80 N;  2YEV B;  3FYE B;  1V55 C;  2M7W A;  3ZHU A;  2IJH A;  4CS4 A;  2F66 C;  4JI1 B;  1DLB A;  3WG7 C;  5KAI Z;  5FL7 G;  5GON A;  1YZB A;  1SQB H;  4OPH A;  4FJC C;  2DW4 A;  3DC6 A;  4G2K A;  1JJO A;  4FVM A;  2X6C A;  3M7M X;  2CDY A;  3G67 A;  1IBL B;  1NVP B;  4U7N A;  4YJ2 B;  4NXM O;  3G80 A;  1E79 G;  1IBL O;  4QGP A;  3MHH C;  1H8H G;  5LHI A;  1JX9 A;  4JF3 A;  1BMF G;  3I5D A;  2Q73 A;  4N23 A;  1ZSP A;  4MVR A;  2PI4 A;  3N2G A;  3UO2 A;  2CGO A;  3CC4 V;  1R6T A;  3ASO C;  1HDJ A;  3N2G B;  4ZI7 A;  2ITC C;  2WPD G;  4I0X A;  1VQ9 V;  2LW7 A;  1ZX3 A;  3KCX A;  3CXC U;  2BOB C;  1Z2G A;  3SPJ A;  3TJT A;  1S5L Z;  4WBN A;  2BOC C;  3CX5 F;  4P2Z A;  2YDE A;  1XNQ B;  2RJZ A;  2HVJ C;  3W7W A;  1I7F A;  1MOF A;  1K97 A;  1HW7 A;  1FFX A;  1B06 A;  2HFE C;  3T1Y B;  5DED A;  2KQX A;  1L1F A;  1FKA O;  3ASN C;  3BCC H;  1SKV A;  4BW9 A;  2R9A A;  4JI7 B;  2Q6A A;  1QVF U;  1TUB B;  1OJH A;  2B1G A;  4X65 B;  4WFE A;  4JI1 O;  4DV3 B;  4JTD B;  4J7J A;  5B66 Z;  2Q7G A;  1XEQ A;  3CHX A;  1PV0 A;  1SQP H;  3R66 A;  4OXS A;  1K34 A;  5L3F A;  1KBH A;  2YXH A;  4TV8 A;  4FLZ A;  4QE7 A;  4FLV A;  2LO1 A;  4LF7 O;  2DWE C;  5J2U B;  1E1Q G;  2QE7 G;  3H1H H;  4MTO A;  1YJW V;  3W7X A;  1KMI Z;  5LP6 B;  4FM2 A;  3E8H A;  2GTS A;  3K9A A;  1YIT V;  3BEH A;  1BQZ A;  2WA4 A;  1N32 O;  4GX2 A;  3CEI A;  4J7K A;  4QE9 A;  4KP4 A;  1LUW A;  2N05 A;  4O4J A;  2ZNJ A;  4KHP O;  3RFR A;  2DYS B;  2FB5 A;  5CBF A;  2VWJ A;  1YIJ V;  1R6K A;  1R3I C;  3JAR B;  2QKA A;  3QG5 A;  1VQO V;  5B1A C;  3BA9 A;  1P4R A;  3ZRS A;  4CS3 A;  2XAQ A;  5C8Y B;  4JI8 B;  1URF A;  5BR8 O;  2PGG A;  4Z1V A;  1GN6 A;  1R3J C;  2AZ0 A;  2UUB B;  1BE3 H;  2A79 B;  1ZUQ A;  3N2K B;  1XRE A;  4I4T A;  1XUQ A;  4TQF A;  4UFZ A;  2P90 A;  2Z5U A;  1ZWI C;  3K0D A;  4I9W A;  4MVS A;  1NVP D;  2WLH A;  4RQE A;  3E35 A;  3JD3 A;  1R3K C;  3A0H Z;  3OTO B;  1QR8 A;  4O4I B;  4MVZ A;  4X66 B;  1EBO A;  5KMG A;  3QF7 A;  5CA3 A;  4ZBM A;  3H1J H;  5A9G A;  5LBQ A;  3E86 A;  4JI0 B;  3ZHR A;  1HNX B;  1MSD A;  4TT3 G;  2HLD G;  2LQT A;  4TV9 A;  1FFT B;  3DXR B;  1W59 A;  4P9O A;  1NH2 B;  4DW0 A;  4O4I A;  1FJG B;  4O2B B;  4K0K B;  4R8C A;  4LR3 A;  4MTG A;  2RCV A;  4P30 A;  2BE3 A;  2YI9 A;  1G6U A;  3CCM V;  3ZBH A;  2GV9 A;  3CRQ A;  2CTP A;  1SQQ H;  4DR6 B;  1IBK O;  3VOU A;  1YXB A;  1KUQ A;  2XOK G;  4DV2 O;  4LH7 A;  4I50 A;  3SJQ C;  4FLU A;  4GUN A;  4LF6 O;  4DV3 O;  4B7E A;  2UUC B;  5F2V O;  4ICG A;  1H38 A;  3JAK A;  4B3T B;  4DR7 O;  4PA7 A;  1RM1 B;  4LFA O;  4OX9 B;  4I50 B;  3GVM A;  1VAR A;  4GCZ A;  2JRI A;  1GM7 A;  1HP8 A;  4CH5 A;  5IJ0 B;  1TUE B;  1CEZ A;  4GYC B;  2JDI G;  1LUV A;  3RYC B;  1YF2 A;  4O2A A;  2EIM C;  4DV4 O;  5D5Q A;  4FZ0 A;  4DV4 B;  2CAZ C;  2X0L A;  4DXW A;  5IWA O;  3ABL B;  5JVD A;  1QLN A;  4LCU C;  2BTO A;  3D3Q A;  2E5L O;  4PI0 A;  3CS5 A;  4IT5 A;  4MVQ A;  2IW5 A;  1BL8 A;  5H5N A;  4KXR A;  5BMV A;  4U3F H;  5KX5 A;  2H3O A;  3R65 A;  1PNM A;  1VQ8 V;  5B5E Z;  4HAM A;  3OD4 A;  5GTI Z;  1HNX O;  1PP9 H;  3L72 H;  1AR1 B;  4DV2 B;  2FML A;  5L3G A;  5IT9 N;  1PD3 A;  1VF7 A;  2YIA A;  4UV8 A;  3OUS A;  2QWQ B;  3CCQ V;  1GRJ A;  1YJ9 V;  1UJW B;  2JGD A;  2ZQM A;  3BY6 A;  1I94 B;  5CB4 B;  3M99 B;  4YJ2 A;  2ATK C;  3THO A;  4Z2W A;  4DR3 O;  4K8Z A;  1BZK A;  2AHY A;  3MAQ A;  1Y74 B;  1J5E B;  2UXD O;  3F5W C;  4KFM A;  2E74 B;  2OTL V;  3K79 A;  4MT8 A;  4JI6 B;  3ZJZ A;  1WB7 A;  1S72 V;  4LF9 B;  1NT2 B;  2KB1 A;  2XUM A;  3P3P A;  4DR1 O;  2CTW A;  4LP8 A;  1OCO B;  2O57 A;  4ZI7 B;  3T1C A;  5CBG A;  1GH6 A;  3OR6 C;  1QNM A;  4K8X A;  1OCZ B;  2EIL B;  4LH6 A;  1R6N A;  4DRX B;  2XAG A;  4MS2 A;  1M90 W;  3ABM C;  3K5N A;  2V7Q G;  3ABT A;  2OCC B;  4LFC O;  3QTC A;  5K1P A;  1KB9 F;  2EIN B;  4JI5 B;  3F5T A;  3T4Z A;  4UCT A;  4ZHQ B;  2ADP A;  1LR1 A;  2ZCE A;  3ZHQ A;  3L74 H;  4D7T A;  4DYL A;  3STL C;  1NTM H;  1K4C C;  4H13 B;  4NVP A;  3RYI B;  3SJA C;  3EVK A;  4CC5 A;  2QDO A;  2QR4 A;  1CPY A;  4IYI A;  4YY3 B;  4JI4 B;  3KKY A;  4HBN A;  4ZIB A;  1XOU A;  1JA8 A;  1A32 A;  1Q43 A;  3K9S A;  4JYA O;  1OCO C;  2YEV A;  4W4L A;  1GM9 A;  2OT5 A;  4N21 A;  1S76 D;  4TOI A;  2GBO A;  1B04 A;  4JTC B;  2ZE6 A;  4XDJ A;  2EZP A;  4PI2 A;  3ETQ A;  4PA6 A;  1SES A;  2EIK B;  1WAZ A;  1VQ7 V;  2UUA B;  5B1O A;  2QEX V;  4D6T H;  4ZOL B;  2EJ7 A;  3L73 H;  3AG2 B;  5LGN A;  5EZY B;  2Q7E A;  1YI2 V;  4LF5 O;  5H2F Z;  1XNQ O;  2WA3 A;  5LYJ A;  2B5U A;  5L3C A;  1EN4 A;  2ZIN A;  4FMT A;  1XQ8 A;  2ZR3 A;  4L8J A;  1HNW O;  1KP2 A;  3A0B Z;  1JPX A;  3KZI Z;  3G6B A;  2WSS G;  4G28 B;  2YC0 A;  3E2E A;  1XIL A;  4X65 O;  4GKJ O;  1K9M W;  1NS1 A;  3T4D A;  1N4C A;  4QPJ A;  1K5Q A;  3AK1 A;  4DUY O;  2QGN A;  1TAE A;  1SQF A;  3SDL A;  2D2C B;  2B1I A;  2XND G;  3CCL V;  2WLI B;  1MNG A;  3HKB A;  3MDS A;  2F4V B;  2PUS A;  2JS3 A;  2OIE A;  4I9Q A;  3EFF K;  4TUY A;  1L8D A;  3JD1 A;  4F6R B;  5LOV A;  4DK1 A;  4EFB A;  1WJZ A;  4X20 A;  1EZJ A;  2DQ0 A;  3ABM B;  2LFS A;  3OMI B;  4UV9 A;  1QR9 A;  1UPG A;  4MSW C;  5E79 Z;  5KHJ A;  3O65 A;  2JIZ G;  1GM8 A;  1HNW B;  1GK9 A;  3JAT A;  4GZR B;  4MVO A;  1SZT A;  4DV5 O;  1WB8 A;  3HKD B;  4TV8 B;  1YTF D;  4BW5 A;  4UB8 Z;  2N04 A;  2F4V O;  5B1A B;  3TCU A;  2DYR C;  5FPR A;  4WFB V;  3SYA A;  3JAW A;  1YCI A;  1AVM A;  1QU7 A;  4KUM A;  4DUY B;  1GN3 A;  1PNL A;  4GX5 A;  1IBM B;  4B3T O;  3K5O A;  2B9Z A;  4AQY O;  3IGA C;  2HG5 C;  1V54 C;  3O9O A;  4JZG A;  2P22 C;  2R9I A;  3B8M A;  3P3N A;  5IYD O;  5A2Q N;  2UXN A;  1J95 A;  2ZIO A;  3AG7 A;  4JV5 O;  3K5M A;  3ZED A;  4UVB A;  4HYO A;  4NTW A;  3OR7 C;  1NI8 A;  4EB6 A;  3CRR A;  2UXC B;  3LDC A;  2Y48 A;  1XNR O;  4XDK A;  3SJB C;  2ITD C;  2IJI A;  4O4L A;  3TXS A;  2QM8 A;  1W0J G;  3LDD A;  2GTA A;  3OFN G;  4P9P A;  3AG3 B;  1X59 A;  4Z1M G;  4J42 A;  1SZX A;  5J9P C;  4JI3 B;  3E8F A;  1Y67 A;  4R7C A;  1NTZ H;  1FYJ A;  2ZD9 A;  2GUZ B;  4IYH A;  4B3S B;  4ABM A;  3SYC A;  3IC9 A;  1QLE C;  3FYI B;  2WAM A;  2EUL A;  1Y76 A;  5B1N A;  3STZ C;  4LFB B;  3ABK B;  4IHJ B;  3C3T A;  3CJH B;  4YXW G;  5IYZ B;  3OW2 U;  3VBB A;  1FJG O;  2DN9 A;  4TSF G;  2XT9 A;  4DV1 O;  1PM9 A;  2WLN A;  5HFM A;  5IYZ A;  2L6L A;  3ZHS A;  1EN5 A;  5LHG A;  1I5Y A;  1N0N A;  4DV7 B;  1D5A A;  3RYF B;  2AGA A;  1Z5W A;  5LA6 A;  4JI0 O;  1Q90 D;  2QWO B;  5AG2 A;  4CC6 A;  4DK0 A;  5JH7 A;  2BCC H;  4RQF A;  1V54 B;  4JZ2 A;  2DWD C;  4PDV A;  1NH2 D;  3AK3 A;  2JGD B;  2X7R B;  1OCZ C;  1M1K W;  2P5O A;  2LGQ A;  3E83 A;  2Q7H A;  4KHP B;  4UCO A;  4RUE A;  4DR4 O;  1BS3 A;  3ZRW B;  2V4D A;  4WCE V;  2Y69 C;  4FFB A;  2KKW A;  4LFB O;  5LXT B;  2WLL A;  1KYO F;  2E5L B;  1DTO A;  4JI8 O;  2FTK A;  3JAW B;  1M9N A;  1H2M A;  2EIN C;  5LMN O;  3CRM A;  1EN6 A;  2G38 A;  2HR3 A;  2IH1 C;  4J9Y B;  4JGS A;  3CD6 V;  3LSU A;  3JAK B;  1YSC A;  2VQF O;  4FFK A;  3ZRV A;  5JCO C;  2W6J G;  1IXM A;  3CYO A;  3RGB A;  2IH3 C;  3OEH G;  4UCS A;  4LF8 B;  2UXB B;  4LF8 O;  2YID A;  3J81 N;  5KAF Z;  1EM1 A;  4JYY A;  2UU9 O;  1JFF A;  3T1Y O;  1S3J A;  3CRA A;  2EIM B;  1M5I A;  5EK0 A;  3RBZ A;  1M56 C;  4PD4 F;  1AI4 A;  3CC2 V;  1IBK B;  1DF5 A;  4LBE C;  3ZHT A;  5H6Q A;  4YJ3 B;  2OTJ V;  2A0L A;  4NXN O;  3QVN A;  2K1E A;  4JYC A;  3E22 A;  5KLV H;  3ZCC A;  1K5S A;  4R50 A;  4XBF A;  3E22 B;  2WLK A;  5K1X A;  3HKB B;  1M57 B;  5TIS Z;  3BVO A;  3T1H B;  4LWS A;  5BMV B;  2IU0 A;  5IY5 B;  3M8A A;  2WLJ A;  2R9R B;  1K92 A;  2CTR A;  5J2T B;  2PI5 A;  1R1B A;  1Q6U A;  3RVY A;  4CBC A;  2Z3Y A;  3ABU A;  1SQV H;  5LGU A;  2AXT Z;  4MW8 A;  2Q8V A;  1R73 A;  2Q9L A;  2A3Q A;  2DOS A;  1JQ0 A;  1QBZ A;  1K73 W;  4GLX A;  1TGO A;  4UCV A;  1L0L H;  1BHA A;  1S5J A;  2E3C A;  2FKX A;  4MTX A;  3LSS A;  5B3S B;  3CCJ V;  2DMX A;  4BIU A;  1X4T A;  4B3M B;  4FLW A;  1H2N A;  3I56 V;  3VQW A;  1RPO A;  3VQV A;  4DRX A;  1Q7Y W;  3SPC A;  4W4K A;  2Z0A A;  3QNE A;  4H0L B;  2QWN B;  1Q82 W;  1HR0 O;  5KHG A;  2YXL A;  1ENV A;  2PYJ A;  4FM0 A;  3G6E V;  5IYC O;  1OCC C;  3WG7 B;  4YHH O;  3OGC C;  2QM4 A;  3EHB B;  2VS0 A;  4YIO A;  2CK3 G;  3FB5 C;  3KCY A;  2X6A A;  2ZE8 A;  4ZHQ A;  3TK1 A;  2RDC A;  1RM1 C;  1S0V A;  3K0G A;  1H2G A;  5IY5 C;  2HJD A;  1GTO A;  5LMU O;  4J10 A;  3CME V;  1P49 A;  2BTQ A;  5EBM C;  5GW7 A;  4JAS A;  2BTQ B;  5EYP B;  4JYA B;  2EIK C;  2ZNI A;  4NKG B;  1XL6 A;  4X1Y B;  5LMU B;  1XNR B;  3ZRX A;  3K5L A;  1HNZ B;  1XHX A;  2JVD A;  1VF5 B;  3EXA A;  1VEW A;  3CC7 V;  1PL4 A;  3ETG A;  3ZMU A;  1O9G A;  3AG4 B;  5DEC A;  3JD4 A;  2LP7 A;  3W7S A;  3OAA G;  4J7Z A;  3JSN A;  4JI6 O;  4X1K B;  1MAB G;  3RYH A;  2EIJ C;  4X89 A;  1H2S B;  2ZE7 A;  4BIZ A;  4JI2 B;  2DE0 X;  1RFY A;  2QJ1 A;  5CMU A;  3A0R A;  3TGU H;  3WU2 Z;  1AR5 A;  4E4E A;  4JAV A;  2GUZ A;  1BCC H;  2M6Y A;  3N27 A;  3VQY A;  3U11 A;  1VQN V;  5FNV B;  3GWO A;  3LUT B;  1G1X B;  1SQG A;  2HHH O;  2NR5 A;  2XAS A;  1OZ0 A;  3D8C A;  3E8B A;  1CXZ B;  1WLE A;  2UXX A;  1NTK H;  4CH4 A;  2KG7 A;  1NR7 A;  3T2M A;  3Q4H B;  2OCC C;  2GSM B;  1KP3 A;  3DTU B;  3G71 V;  4WFH A;  3JAT B;  1V9P A;  4TWK A;  4Q6G A;  1VQ5 V;  3JSL A;  3E89 A;  1CP9 A;  2EIL C;  5LP6 C;  4MVU A;  4CH6 A;  5KUK A;  4EEQ A;  2CE4 A;  2OYQ A;  5CN0 A;  2HVK C;  1TUB A;  4WFA V;  4JTA B;  4ASU G;  3H1L H;  5CA1 B;  4X88 A;  5LOV B;  1N34 B;  2P6J A;  1HNZ O;  4UCR A;  1MZF A;  4A5U B;  2HHH B;  1AB3 A;  5LA6 B;  4J41 A;  2XAF A;  3ML0 A;  4YIP A;  4WFG A;  1WP7 A;  3JAL B;  2ZE5 A;  1KKC A;  4LFA B;  3OE7 G;  2YS8 A;  4PDR A;  3I55 V;  1OCC B;  5EBL C;  2Y0P A;  5FPO A;  3SPH A;  1AP5 A;  3ABK C;  4YJ3 A;  4F6E A;  5LHH A;  4DV6 O;  5JCO A;  3U0Z A;  4X1K A;  4GX0 A;  1VQM V;  1JCH A;  5L3B A;  4LNU B;  3ETD A;  1U96 A;  4LF5 B;  1XL4 A;  4PV1 B;  3RVZ A;  3BA8 A;  2YIB A;  3CCS V;  1SA0 A;  4K0K O;  4I5S A;  3CCU V;  3AG3 C;  1WPX A;  4LWS B;  4Q20 A;  4IHJ A;  3IJ4 A;  2DQ3 A;  2UUC O;  1GO3 F;  3OT7 A;  2AZ2 A;  2DYR B;  1MG1 A;  2H8P C;  4LF6 B;  5LYJ B;  1HR0 B;  2QSA A;  4O4J B;  1EZV H;  1D2D A;  4QNH B;  5EC2 C;  1SA0 B;  3DSQ A;  3JAL A;  1JJ2 U;  4B08 A;  3FX7 A;  3RWR D;  4JAA A;  1RSO A;  4JPR A;  1WP8 A;  2LJ2 A;  3IAY A;  1FXK C;  3AG1 C;  1U97 A;  2UXD B;  4CS2 A;  3P32 A;  4K35 A;  5GON B;  3U10 A;  4DW1 A;  4LFC B;  3ETE A;  2P4K A;  2Q68 A;  1VQ4 V;  3ZRW A;  2ADQ B;  4X66 O;  5LP6 A;  1VIB A;  4X8A A;  4FFB B;  4WF9 V;  1P7B A;  2HJF C;  5IJ9 B;  3GWK C;  4UUJ C;  3H01 A;  5B1B B;  4NR1 A;  3TXQ A;  5JQG A;  1WNS A;  5CA1 A;  3RYF A;  3AG2 C;  5CBH A;  2YUA A;  1SC5 B;  1GKF A;  1SRY A;  4WBN B;  2Q5Z A;  4H37 A;  3K03 A;  5CA0 B;  1W2B U;  3B40 A;  2UXC O;  3C90 A;  3ICX A;  3BFR A;  5IJ9 A;  1K7D A;  5ITZ A;  3MD0 A;  3AG4 C;  1L0N H;  2FYU H;  4B3S O;  2WLI A;  1PPJ H;  3JD2 A;  3ZS8 C;  4FZ1 A;  4B3R B;  2JGU A;  2NLJ C;  2W0X A;  2EBO A;  4JI3 O;  1RPR A;  3RN4 A;  3UT5 B;  3OMN B;  5LGT A;  2WLM A;  1BHB A;  5L3D A;  1AJQ A;  1ZL8 B;  1TVK A;  4HNA A;  4U3J A;  2NN4 A;  5KHK A;  3WB0 A;  4DR5 B;  4HNA B;  4U3J B;  3E8G A;  1IBM O;  1S77 D;  4FPP A;  4JI7 O;  1ZL8 A;  1WA8 A;  3SYP A;  2LFR A;  1MSW D;  1Q3E A;  4ZOL A;  4UCU A;  4O4L B;  4LC1 A;  2W0F C;  4R6Z A;  4LF7 B;  1XBL A;  1IVS A;  4FM1 A;  3FB6 C;  1ZTE A;  4AHC A;  4D7S A;  2DYS C;  2Q0A A;  5H6R A;  2ZM6 B;  3ZN1 A;  5CB4 A;  3HKC A;  5E1A C;  2ZXW B;  2ZIM A;  2PF4 E;  1E1R G;  4OX9 O;  1F7Y A;  2LGW A;  5IJ0 A;  3K06 A;  2YSU B;  2EZO A;  3W7T A;  2ODM A;  5KA5 A;  4UB6 Z;  1GN4 A;  1SF9 A;  1NU1 H;  2P67 A;  2Y0I A;  2ILM A;  1QCE A;  2L35 A;  4PHZ A;  1Q86 W;  3AG1 B;  2RMK B;  5CA0 A;  2Y4T A;  3CB2 A;  3JYC A;  2HP8 A;  1QLE B;  1XI1 A;  1RSO B;  5LL6 Y;  4FLX A;  4L87 A;  3SJC C;  3H1I H;  1JVM A;  1NKD A;  1B3Q A;  2YIB D;  1M56 B;  5C93 A;  4J9Z B;  3HKC B;  4H44 B;  1KQS U;  4PJ0 Z;  4FK5 C;  2R72 A;  4LF4 O;  2YI8 A;  3SR2 C;  1KKD A;  4RUF A;  1VQ6 V;  3QO8 A;  4TUY B;  4JI2 O;  3LNM B;  1AJN A;  3HKD A;  3JD0 A;  4JAU A;  1K3E A;  1NZ6 A;  2CH7 A;  4I55 B;  3W7U A;  2Q69 A;  3VQX A;  2X6B A;  1Q6I A;  4DUZ O;  3JAS B;  4UXN A;  2OIG A;  1B6Q A;  4X20 B;  1BQ0 A;  4PA3 A;  1FPO A;  2F1M A;  1ZLZ A;  3SPG A;  1OHH G;  1VMG A;  4GKJ B;  4TV9 B;  5BZB A;  3CCV V;  3HR0 A;  1FXK A;  4O4H A;  2FL4 A;  3NR7 A;  1XMO B;  2AW9 A;  4GT1 A;  1SQX H;  1QHT A;  4IL6 Z;  4QIW F;  2IJK A;  2PYL A;  2JEU A;  3BAA A;  1N8R W;  1ROP A;  2P06 A;  4QPK A;  2QWR B;  3FD9 A;  3WFV A;  1AI5 A;  2CGN A;  2F93 B;  1H2L A;  4J11 A;  3SYO A;  3APO A;  4PA4 A;  3CWB H;  3NXS A;  1Y66 A;  1Y6X A;  2ZKO A;  3ABL C;  3AK2 A;  4YHH B;  2QTS A;  1SET A;  5IE9 A;  2MK3 A;  3ZMV A;  2F23 A;  1YEW A;  1N36 O;  1LNQ A;  2F95 B;  4X1Y A;  4X1I A;  4DR2 B;  2QA4 V;  4DR2 O;  4PDM A;  2YXY A;  1I08 A;  3K04 A;  3B8N A;  3RW0 A;  5D5P A;  3K57 A;  4JI4 O;  3CE2 A;  3JAS A;  3X2Q B;  1AIL A;  3RYI A;  4E2L A;  5KHH A;  1AI7 A;  4H33 A;  3JAR A;  3K3W A;  1IZ3 A;  2PTM A;  1FS0 G;  3FKS G;  5EZY A;  2C2A A;  1K33 A;  5DM6 V;  1QQC A;  3HKE B;  2Y69 B;  1XMQ B;  3K08 A;  4JI5 O;  4LF4 B;  2IM9 A;  1IDS A;  4MVM A;  3ZMZ A;  2CUG A;  4DR3 B;  2BSK A;  3HKE A;  5C8Y A;  1G4Y B;  3CMA V;  2K9P A;  4NTY A;  5H9C A;  5KA6 A;  3K59 A;  4FLT A;  3B4S A;  1M93 A;  2Q67 A;  1F4M A;  4DUZ B;  1MMM A;  5B1B C;  1S5H C;  4CZZ A;  2QM7 A;  3WB2 A;  2KG7 B;  2P4V A;  4LF9 O;  2HKO A;  1KEC A;  3DXR A;  4QJF B;  1Q5O A;  4PDL A;  2WLL B;  3S3X A;  5L3E A;  3ZHV A;  1EFR G;  1YJN V;  4I7Z B;  4OGQ B;  2ZM6 O;  4CH3 A;  3L71 H;  2N74 A;  3QO7 A;  4RWU A;  1OCR C;  3SPI A;  1F51 A;  5KMG B;  5JWP A;  3PN1 A;  4WFF A;  2QKC A;  4F6R A;  1AJP A;  4X1I B;  5JJJ B;  2F43 G;  2XTA A;  4DO2 A; 
#chains in the Genus database with same CATH homology
 1YXB A;  2A3Q A;  3C90 A;  5IE9 A;  2OIG A;  2GTA A;  1Y6X A;  2YXH A;  3CRC A;  2Q73 A;  2OIE A;  4QGP A;  2Q5Z A;  2A7W A;  2Q4P A;  2Q9L A;  3CRA A;  1VMG A;  2P06 A;  1YVW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...