2P06A

Crystal structure of a predicted coding region af_0060 from archaeoglobus fulgidus dsm 4304
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
84
structure length
84
Chain Sequence
MDYFRLAEKFLREMHAKYMKRVSRPGNTPRPWFDFSEERLLSRLFEEMDELREAVEKEDWENLRDELLDVANFCMYLWGKLSVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a predicted coding region AF_0060 from Archaeoglobus fulgidus DSM 4304
rcsb
source organism Archaeoglobus fulgidus dsm 4304
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein AF_0060
total genus 28
structure length 84
sequence length 84
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03819 MazG MazG nucleotide pyrophosphohydrolase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1080 Mainly Alpha Orthogonal Bundle Helix Hairpins MazG-like 2p06A00
2Q73A 2YXHA 1Y6XA 1VMGA 2OIGA 2Q5ZA 2P06A 3C90A 3CRAA 5IE9A 1YXBA 3CRCA 2Q9LA 2Q4PA 1YVWA 2GTAA 4QGPA 2A3QA 2A7WA 2OIEA
chains in the Genus database with same CATH superfamily
3OFNG 5BMVB 4BAYA 4NTWA 1JA8A 3JD2A 4FK5C 5IYBO 5LA6B 1VQPV 4DR7O 2ZD9A 1RPOA 4Q20A 2HJFC 3D36A 3JD4A 1AR4A 4L8JA 1FD9A 2R9AA 1OHHG 1S5LZ 2WLKA 4H13B 5LMUO 2HP8A 3E83A 2HHHO 4IL6Z 1SA0A 1H8HG 2QDOA 3E8HA 3AK3A 3FB8C 2ODMA 1H2SB 2BTOA 5FNVB 4X65B 1YZBA 4Z1MG 2P7TC 3CRRA 4BIOA 3JCZA 5LL6Y 5FL7G 4O4JB 4UFZA 2RDCA 3DXRA 4QIWF 2ZM6B 2VWKA 3ZMUA 2IH3C 1G6UA 1GKFA 3CCEV 1S5HC 1MZEA 4KL1A 1OCOC 4PA7A 1MZFA 2GHYA 3AG1C 3A0HZ 4X66O 1URFA 2BOCC 3OTFA 4DUZO 3ABLB 4PELA 1YJWV 2JS3A 4OPHA 4MSWC 1L1FA 3JATB 2XUMA 3LDCA 1L8DA 4E4EA 3ETQA 5CB4B 3E22B 3SYOA 2HJDA 3MAQA 4DR5B 4PA6A 4KUMA 4GKKB 1HNWB 3L70H 2AW9A 2A3QA 3SDLA 3UT5B 1JX9A 4KHPO 2WLIB 4J9ZB 1LUWA 1S76D 3IC9A 3OE7G 3WB2A 3NXSA 3CMAV 2CDYA 1XHZA 3I5DA 5JCOA 3JSLA 4PD4F 4DR4B 2Z0AA 3TXSA 1KKDA 2WWWA 1H2LA 4X1YB 2KKWA 5CA3A 1N34O 3R66A 3L71H 4B3SO 3CCJV 2G38A 5IWAO 2P6JA 5C93A 4ZI7B 1FKAO 3K9AA 5JCOC 3ABKC 4LF6O 3QO5A 2OIGA 4KP4A 4DUYO 3PN1A 1NU1H 3H1IH 2QR4A 1XMOB 2IJHA 3T1HB 1GTOA 3LNNA 2N74A 4D7SA 3P3PA 4YJ2B 1PL4A 3ZHTA 4P9OA 3W7SA 1YTFB 4KHPB 4JI5O 4NB5A 3OEHG 1K92A 3N2KA 3BRCA 3SYQA 4FLVA 5EC2C 1K33A 3FB5C 1S3JA 3OGIB 1KMIZ 2JJ1G 1QNMA 2YI8A 3CMEV 2FB5A 5LGNA 4MVUA 4F6RA 1OCRC 5CB4A 4HNAB 2ZNJA 2RQ6A 3JAKA 3G4SV 2XAGA 1XILA 1QQCA 1VQ6V 3OGCC 3G6EV 1DK1A 4WFHA 1D5AA 4X66B 2PF4E 3ZRSA 1W0KG 3AG4C 3N2GB 1IBLO 3CD6V 1GH6A 1R3IC 3C90A 3UO2A 2IM9A 4DV0B 4I7ZB 4LF8B 1ZL8A 1OCCB 3L9DA 3OMNB 3JSNA 1ROPA 1N4CA 2P06A 4FPPA 3ZMVA 3RT3C 5B66Z 4JI7O 1IDSA 3FKSG 2UXDB 3ETEA 3HR0A 3WG7B 5LP6B 2IU3A 5KMGA 1HP8A 5KAIZ 1HNZB 4JGSA 3K3WA 3CCLV 1VF7A 1SQPH 1XREA 3OD4A 2EIMC 2VQFB 1JCHA 2R72A 5LOVB 5C8YB 1P4RA 1V55B 3ZRWA 1Q5OA 2N05A 3T4ZA 4MW8A 5B1AB 4MT8A 3OUFA 1OV9A 4U3JA 1YTFD 3ASOC 1PPJH 3RFRA 2R70A 2WLHA 1P84F 4HNAA 4WFGA 5LHIA 4LF4O 3T4DA 3T1CA 1SZTA 1L0LH 4K8XA 2HVKC 3K08A 3ZEDA 4B08A 4K0KB 5E79Z 3H9VA 3K5NA 4EKWA 4ZHQB 2B1GA 5L3GA 1HNZO 5EC1C 4AQYB 1FXVA 1I94O 4DR5O 1XOUA 1JOYA 1VQ9V 2DN9A 2LP7A 3VQXA 2YIAA 1DF5A 1BMFG 4GKJO 4DO2A 4XBFA 1XL4A 1I94B 1LNQA 1K7DA 3SPGA 4NXMO 3L75H 1FFXB 1AP6A 4MTOA 2D3OW 3FAVA 3CCSV 1IXBA 4DXWA 1K4DC 4GX2A 1FPOA 2AHZA 4IHJA 4NYKA 4LF4B 2XOKG 2AXTZ 1QU7A 2W6JG 1IBLB 5L3BA 3DGEA 1N0NA 3T1YB 2BOBC 5LXTB 2ZR2A 4WCEV 3G71V 4JI6B 4I4TA 2GDSA 1WPBA 1EN4A 2DWEC 5D5QA 4O4HB 1N36B 1QHTA 3M8AA 3KZIZ 4PV1B 2UXDO 3JARA 4PDRA 1XI1A 2F43G 3ZMSA 4PDVA 4PA9A 5KUMA 1GRJA 5LHHA 3JASB 2DWDC 4TV9A 2HLDG 2OIEA 2QKCA 4YHHO 3OT7A 4YJ3A 3A8TA 4GCZA 2VQEB 3BCCH 2EX3A 4Z1VA 5JWPA 2QWNB 5LGTA 3HKBB 1AR1B 5B5EZ 3B77A 3J80N 3QTCA 1JMKC 4D7TA 5H9CA 3KKYA 4JTDB 5JVDB 2QJ1A 4GX5A 1Y67A 5EYPA 3GVMA 1YI2V 2YI9A 4CC6A 4DV1O 3STLC 5KHJA 1H2GA 2A79B 1R6TA 5EBMC 2UXNA 1AVMA 3CC4V 3E86A 4CS3A 4I50B 1Q6IA 2R9IA 4FLWA 1XL6A 1BQZA 4TOIA 2YXYA 3SJBC 2JVDA 2BTQB 2JEXA 3RYHA 4ZKIA 1Q6HA 3BVOA 2Q8VA 1H2NA 2HVJC 3RGBA 4W4LA 4N21A 3F5WC 1S5JA 4NXNB 3OM3B 5BMVA 3K57A 1LUVA 4A5UB 4YIOA 2Z5UA 3CSXA 3AG1B 3VBBA 1SRYA 1N33O 4X20A 4JI8B 1AILA 1XBLA 4J80A 2P22C 3IFXA 2B9ZA 4I9QA 3BPZA 4B3TB 4PJ0Z 3G80A 5CMUA 4RAIA 1KECA 1ENVA 1S0VA 3AG2C 2EINB 2CGNA 2GSMB 4O2AB 4MTXA 1WP8A 4UUJC 1JFFA 2CE4A 4LFCB 3LNMB 3JAMN 1K97A 4UCRA 4OGQB 1Z5VA 5KA5A 2LW7A 2W6IG 1B3QA 1X4TA 1Z2GA 5CBGA 1P7BA 4EB6B 4EFBA 5LYJA 3W7XA 3BAAA 2E5LB 2LGWA 4FLZA 1R73A 1EFRG 1WJZA 4PI0A 1N33B 1YVWA 1K8AW 1B04A 1N8RW 4JYAO 4PI2A 1XMQB 3B40A 3G6BA 4FLUA 4LH7A 3CX5F 5DEDA 2XAQA 2ITCC 4FMTA 4O4JA 1XEQA 5B1BC 3SPIA 2GTSA 2HEPA 4R50A 2ZE5A 4QGPA 2BSKB 2CTWA 3OR6C 2W0XA 5IYZA 2X0LA 4I5SA 4O4IB 3H1KH 4GX1A 4JPRA 4DV7O 2FTKA 1XQ8A 4MVMA 4OX9O 1SESA 3JATA 2EZPA 1M90W 1R3LC 1SF9A 3CRAA 2ILMA 2RNBA 1JFFB 3ZRVA 1TUBB 3L73H 4X62B 2EIKB 4LFBB 4IT5A 1JJOA 4JI2O 3JAWA 3UT5A 4EB6A 3FX7A 5LYJB 1PNMA 3E8GA 4LF6B 1M57B 2YS8A 1MSDA 4GT1A 3K5LA 3W7WA 1SQVH 2XASA 4B3MB 2DYRC 5LHGA 4FLTA 3QVNA 4NXNO 4YJ2A 2QSAA 3CWBH 1KBHA 3TGUH 5B3SB 1F51A 2CTRA 5GTIZ 1A32A 1TGOA 2UUAB 1PNLA 2FL4A 2JGDB 3JCUZ 5KHHA 4TV8A 3JD1A 2VRZA 3AK1A 3JAKB 5A9GA 4X1KB 2IJJA 4LF9B 3AG7A 1F4MA 2BSKA 2PUSA 1VARA 4BIUA 5IYZB 3FD9A 4I55A 2ZCEA 4DV4O 1NQTA 3EXAA 2P4KA 4GUNA 2UXCO 3H01A 5IE9A 3KG2A 5LMNB 2IW5A 1TA8A 5L3DA 3Q4HA 1KUQA 4UVCA 4X88A 2WSSG 3S3WA 1XMQO 2ETNA 1XNQO 3S3XA 3K79A 2Y4TA 3B09A 1WB8A 3P30A 1VMGA 4K35A 3MHHC 2ZNIA 2KG7A 1M57C 4LR3A 2JJ2G 3GWKC 2LQTA 1JJ2U 1SQQH 1SKVA 2AGAA 4ZIBA 1XMOO 4JZ2A 4DR6B 1K5SA 2KQXA 2Q0AA 2JGDA 2Q73A 4LFCO 4H37A 1X59A 5KMGB 5JH7A 1RSOA 4QE9A 4FLXA 2E76B 4UV8A 3T1YO 4IYIA 3WB0A 4G28B 4JI8O 4TSFG 3UKMA 1CXZB 1YJNV 1WNSA 4U3JB 5DM6V 1Q43A 3CC7V 2QGNA 1ZX3A 1NVPD 4OX9B 2EULA 3T2MA 4J7ZA 1NTMH 2X6BA 3R65A 1D2DA 1W2BU 4MVZA 4GYCB 1RFYA 1AP5A 3OTOO 3B8MA 3J7AU 1J5EO 2MW2B 4RUEA 3ZHVA 4FJCC 4JI4B 1M4UA 4X89A 1KB9F 1U96A 1O9HA 2C2AA 4R7CA 1Q7YW 3SJCC 1EZJA 5HFLA 4J7JA 4DV3O 4L87A 3ZIAG 4LBEC 2PI4A 3J81N 4FLYA 4AHCA 3ZRXA 4Q6GA 4MW3A 4BWAA 1JPXA 5KAFZ 4I9WA 1FFXA 2QWQB 3B4SA 4FFBB 2K9PA 1SZXA 3FAVB 1S72V 1OJHA 3HPLC 1I5XA 3ICXA 4O4HA 1PP9H 4DV4B 4FZ0A 3RYFB 1GAXA 1HDJA 3E8FA 2X7RB 3A0BZ 2A9HA 2E5LO 3HKDB 2DMXA 3W7TA 3CJHA 2AHYA 1Q86W 1OCOB 4DRXA 3APOA 1AJPA 1BCCH 2OCHA 2RN9A 5IT9N 3D36C 4IIJA 1EN6A 1HW7A 2RJZA 4JAUA 4NTXA 5LBQA 1FS0G 1U97A 3JD3A 3UQ8A 4BR6A 3ZHRA 2WAMA 1FJGB 2LW1A 1VEWA 1SS3A 4JTAB 3K59A 3I55V 4YJ3B 2QWOB 2ZT9B 2V7QG 3DC6A 2EIJB 3FYEB 1Y66A 2F4VO 5H5NA 3K03A 2A0LA 3C3TA 5KUKA 2YUAA 2ZINA 4WFBV 5DN6G 3IGAC 1Z5WA 4TV9B 1R3KC 4JI0B 1M93A 2HG5C 1IZ3A 1VF5B 3DSQA 1BSMA 5CA0A 1US6A 1COWG 5EZYB 4ASUG 2Q0OC 2OWOA 3TK1A 3LSUA 3TCUA 1M9NA 2R9RB 4J9YB 3CRQA 3ABUA 1H8EG 3ETGA 3HKBA 4LF9O 4EEQA 2IJKA 1DF4A 2FKXA 4H44B 4NXMB 3OMIB 5KHIA 3M7MX 3HKDA 2ZIOA 3FB6C 2JEUA 2UUBB 2V4DA 3BEHA 3OTOB 4GKJB 3RVYA 1WB7A 1GN4A 2Q7HA 3T1HO 2ZQMA 1QR9A 5BZBA 2WA4A 1GN2A 1OZ0A 4OXSA 4F4LA 4LWSA 1GN3A 4IIJB 1AI4A 3ML0A 1Q8IA 5IJ9B 4YHHB 1QBZA 1KYOF 4PDLA 3A0RA 3ZMTA 4DV6B 4DR1B 1FXKB 2BTQA 4NVPA 1OCRB 1NS1A 3RYHB 1Q90D 3CP1A 4P2ZA 1P49A 3G67A 3ASNB 3QNEA 4D6TH 1YXBA 1KP3A 1K5QA 3L72H 4ZOLB 5L3EA 4HZ3A 3CRCA 2Q9LA 4DW0A 2OT5A 1Y74A 4WFEA 4DV5B 1UPGA 1NTKH 2X6AA 2JDIG 3AG3C 1V54C 1FXHA 1MSWD 4UCUA 4DV7B 4JF3A 1BGYH 3OW2U 4GKKO 2YXHA 1WLEA 3ZJZA 3RYCB 2Y0PA 2QKAA 2EINC 4MTFA 2F1MA 4LP8A 5B1AC 5EBWC 2YIBA 2F93B 5BXZA 3APQA 1GM7A 2FMLA 2EIMB 1M5IA 1ZWIC 5JJJB 2H3OA 4F6EA 3WB1A 5L3FA 1BS3A 3CXCU 2EIKC 3MDSA 1IBKB 5IYDO 2XNDG 1E1QG 2BE3A 3RBZA 2ARHA 5GONA 2M7WA 4QPKA 2A06H 1KD1W 1P7GA 1KKCA 3VQVA 4F6RB 1LR1A 4P9PA 1W59A 2EILB 1KC8W 2HHHB 2P5OA 4E2LA 1IURA 4DV1B 4HBNA 5KHKA 5KLVH 3AG4B 3CB2A 3ASNC 5EK0A 3ABMB 4CS4A 4XDKA 3BABA 3SYCA 4JYYA 1YHQV 1YIJV 3PJSK 2CH7A 1MABG 3WG7C 4JI0O 4LC1A 1SQXH 1E79G 2OYQA 2NR5A 2BCCH 3IJ4A 4MVRA 1R3JC 4UCTA 1Q3EA 1ZTEA 3H1JH 1TVKA 1NT2B 1M56B 4TV8B 1QVGU 3HKCB 1NH2B 4DR4O 1DGSA 2HFEC 4MVSA 2YEVA 1VQ8V 5FPRA 1HWYA 1CPYA 2WLMA 1B6QA 4R8CA 4JI3B 2OTJV 2YC0A 4FZ1A 5J2UA 2PGGA 1ZAUA 3CE2A 2DW4A 3AK2A 3AG2B 2Y69C 4ZBMA 4DV0O 1RP3B 3ZHUA 3E89A 1N32B 1IBMB 4BW5A 4CH4A 3SYAA 1I5YA 3JALB 3KCXA 4O2BA 3CC2V 4LF7B 2GUZB 4MS2A 3MHSC 2DOSA 4MVQA 2UXCB 3EHBB 4R6ZA 1IBKO 2EIJC 1AROP 3QO7A 2WLIA 1NR7A 2DJVA 1N32O 3U0ZA 2CH7B 5JQGA 3L74H 2CK3G 2LFSA 4FM1A 3RYIB 3CRMA 4U7NA 4LFAB 3BY6A 3ASOB 4DV2O 3OMAB 4XDJA 3VOUA 4JASA 5D5PA 1FJGO 4YY3B 5KHGA 4JI4O 3TXQA 4JAAA 4ABMA 4X1IA 2A7WA 2QTOA 2ADQB 1MNGA 1V55C 3ZBHA 1WN7A 3OR7C 2XAJA 1GM8A 3HKCA 3JD0A 5H2FZ 3E35A 5JH7B 2UXBO 5JJEB 5TISZ 1VQ4V 4PHZA 2XAFA 5FLXN 1G8MA 4IYHA 3SPHA 4B3SB 4FM2A 1Y6XA 1F7YA 3CHXA 5LXTA 3THOA 4H33A 4CH6A 3ABMC 1J95A 1N34B 5J2UB 4JYBA 4I4TB 1TUEB 1BQ0A 1ORQC 3LUTB 3EFFK 5B3SC 4FIPC 3TETA 1HR0O 4JI2B 5IY5B 5EIBC 3W7UA 1S77D 4JAVA 2Y48A 3K9SA 2Q4PA 4JZGA 5L3CA 1AI7A 4O4LA 1D5NA 5IDJA 4C7UA 1OCZC 4CH5A 1H2MA 2ZIMA 5CN0A 1NR1A 3LSQA 3JASA 1M1KW 1H38A 1BE3H 3RYIA 3CXHF 3SJAC 2ZE8A 4DK1A 1W0JG 4DV2B 4TT3G 1VQOV 2YSUB 2UUCO 4X1IB 5J2TB 2ZDIA 1F23A 5DECA 4RO2A 4DK0A 3ZHSA 5LP6A 3CCRV 2E3CA 2RMKB 2QWRB 1NI8A 3F5TA 3CCVV 1IX9A 1K4CC 2ZXWB 3K5OA 2PZSA 4X65O 1Y4MA 3BA9A 1V9PA 4LCUC 4G27B 1E1RG 2IBZH 2GV9A 2IU0A 3GB7C 4I50A 2IJIA 3X2QC 3CEIA 4QPJA 1EM1A 1SETA 2EZOA 4WFFA 2WLNA 4K8ZA 3CJHB 3E2EA 2JK5C 4DYLA 4JI7B 1YCIA 2QM7A 4DR7B 2VWJA 3BFRA 4O4LB 1CP9A 2QWPB 3D8CA 1YITV 2DQ3A 2AZ2A 2OCCC 2ZE6A 2E75B 4I0XB 4ZHQA 2ZXWC 3SJQC 4IGGA 4LNUB 3LDDA 4LF8O 1K73W 1AI6A 4CS2A 5IWAB 4UB8Z 5CA0B 3QG5A 4UV9A 3LSSA 4BW9A 1JR9A 2WPDG 2UXXA 3K0DA 3QO8A 5KX5B 1XUQA 1WA8B 4LFBO 4N23A 4YIPA 5BR8B 2O57A 1THZA 4TQFA 1YDXA 3EVKA 2WA3A 4KXRA 4PDMA 5LP6C 2YIBD 4DV3B 1OCZB 1GO3F 2HKOA 1NKDA 4JTCB 2Q5ZA 4J10A 4LWSB 1K9MW 4UCSA 4K3AA 1RM1B 4CC5A 4WF9V 4RWUA 2PYLA 4CH3A 2EILC 4MTGA 1QLNA 2EBOA 2K1EA 4EFEA 2DYRB 3E8BA 2QTSA 1NZ6A 2LJ2A 1JVMA 4JI1O 2L35A 4TUYB 5ITZB 1G1XB 3H1LH 2D2CB 1NVPB 3K04A 4B3MO 2H94A 4ZOLA 3UCSC 2X6CA 3FB7C 1PNKA 1MG1A 4B3RB 2ZDIC 4O4IA 4RUFA 1HR0B 2B5UA 1FXKA 5GTHZ 3CCQV 4QE7A 3P3NA 4X64O 3RYCA 3NR7A 2QEXV 1RM1C 4UB6Z 2XTAA 4UVAA 1H2KA 2Y0IA 3ZN0A 3CS5A 2L6LA 1VP7A 2YIDA 3DXRB 3ABKB 5EYPB 2Y4UA 2OCCB 3AEIA 1T5EA 4B3TO 1PKXA 4LH6A 1SA0B 1ZSPA 4B3RO 4ICGA 1MMMA 2LGQA 5FNVA 1XNQB 5GW7A 1QCEA 1HNXO 3FFQA 1BHAA 3IC7A 2DYSC 5GONB 2DYSB 2LO1A 4NTYA 4TQDA 1I0HA 1WPXA 2Q68A 2HR3A 4HYOA 4TUYA 2WLLB 5ITZA 1UJWB 2JS5A 1R1BA 2NN4A 3C3SA 4MVOA 2WLJA 1IBMO 3B8NA 2UUBO 4X20B 1QLEC 4QJFB 1AB3A 5BY1A 4O2AA 2YICA 2QA4V 3ABLC 1G4YB 4JI5B 4JI3O 1JQ0A 3SPCA 5BR8O 3LDEA 1IXMA 3N27A 2F95B 1YF2A 3VQWA 1Q6UA 1F4NA 3RVZA 1NJIW 4ZI7A 1TAEA 5CBHA 3KCYA 4LF5B 2N04A 4UCVA 1GN6A 2YDEA 3RWRD 2MK3A 1EBOA 2KG7B 3CCUV 4UVBA 2VS0A 1VQKV 4AI8A 3UO3A 4DR6O 3H1HH 5FPOA 2CAZC 5HFMA 4LF5O 4X1YA 4DR3O 5IYCO 2JRIA 1FYJA 3N2KB 1QR8A 1Q81W 4YXWG 5KA6A 4WBNA 2CTPA 1TVKB 1UFIA 2IH1C 4X9QA 2Q6AA 3BA8A 4YY3O 5CA1B 1BL8A 1BT8A 4U3FH 3P32A 1WP7A 2YEVB 3M99B 2UU9B 3ZN1A 3VQYA 2WLLA 4DR2B 1DTOA 2ZKOA 1BHBA 1I08A 2GUZA 3U10A 3HKEB 5JJNB 2QE7G 3ZMZA 2Z3YA 1AJQA 2B1IA 2Q69A 4JV5O 5JQGB 1KP2A 5LMNO 4UXNA 1SQGA 2QKSA 2KSDA 1EZVH 5K1XA 4LF7O 2F23A 4WFAV 1TUBA 2ZE7A 1FAFA 2KB1A 1XDCA 3JALA 4O2BB 1QLEB 3SPJA 3JAWB 1PV0A 4JYAB 5IJ0B 1GMGA 1V54B 3SR2C 3HB3B 3AG3B 2UU9O 3N2GA 3CCMV 5B1NA 1PD3A 2LFRA 5A2QN 2XHBA 2E74B 3WU2Z 3GWOA 2UUAO 2PI5A 3MD0A 1ZL8B 4FVMA 1KQSU 2AZ0A 1MA1A 5C8YA 3RW0A 3O65A 4AQYO 4DR3B 2DQ0A 1MOFA 2ITDC 1N36O 1BZKA 5LMUB 4FFBA 1SQBH 2P67A 4WBNB 5F2VO 1K34A 1XHXA 4X64B 2JIZG 4DV5O 1FXKC 1QVFU 3UM7A 5CA1A 3RN4A 5J9PC 2GBOA 4W4KA 1WAZA 4X1KA 4FFKA 3OUSA 3K58A 3IAYA 3D3IA 3I56V 1VF6A 1YSCA 3A2FA 3HKEA 4DRXB 4H0LB 1XNRO 5LOVA 3OAAG 3ZRWB 4NR1A 3FYIB 1I7FA 2FYUH 3K06A 3F7VC 2XT9A 4RQFA 1NH2D 3DTUB 3QF7A 4I55B 4NKGB 4AILC 2M6YA 3K0GA 4DR1O 2OTLV 4X8AA 2VQFO 2NLJC 4J7KA 4GZRB 3TJTA 2UUCB 4JI1B 1VQ7V 2ADPA 4J41A 5B1BB 1PL0A 1HNWO 4J11A 4BIZA 3Q4HB 1J5EB 4FM0A 5J2TA 2Q67A 3BHPA 5IJ0A 3ZS8C 4IHJB 1ZUQA 4DUZB 1DLBA 1VQLV 2F66C 2CTQA 2GTAA 4K0KO 4PA4A 4B7EA 1HNXB 5EBLC 5H6RA 1VQMV 4KFMA 5EZYA 5LGUA 4JYCA 3O9OA 1NBMG 2ZR3A 1XNRB 1CEZA 1AJNA 1FFTB 1Y76B 2VQEO 4OPAA 3U11A 2DE0X 3WFVA 4DW1A 4JV5B 3CPWU 4TWKA 4Z2WA 2XAHA 1RSOB 1O9GA 1N0JA 1VF6C 3SGIA 1SERA 2UXBB 2EJRA 4DR2O 4I0XA 1K3EA 3B2EE 1GK9A 4LNUA 5IJ9A 3ZCCA 1ZLZA 2YXLA 1PM9A 1OCCC 3DC5A 5E1AC 1L0NH 5IY5C 4DUYB 1IVSA 1AI5A 4PA3A 5B1OA 4LFAO 5K1PA 3JARB 4J42A 2CUGA 1NTZH 3ETDA 2Q7GA 5KX5A 4DV6O 1WA8A 5LA6A 2PY5A 2W0FC 4JI6O 3ZX6A 1VQNV 1Y74B 4HAMA 2RCVA 2P4VA 3D3QA 1SQFA 3SYPA 3ZHQA 3JYCA 4G2KA 1B06A 4X62O 1GM9A 1R6NA 1KU9A 4P30A 3F7YC 4XDLA 2PTMA 2V1DA 2NNUA 1Y76A 2QM8A 2ATKC 2Q7EA 2Y69B 4RQEA 4CBCA 3RYFA 1VQ5V 4UCOA 3OEEG 1AR5A 1VIBA 3CYOA 3STZC 5JVDA 2QM4A 2H8PC 4B7KA 5AG2A 5H6QA 1Q82W 4CZZA 5EIBD 4GLXA 1M56C 1YEWA 4GX0A 3ABTA 2CGOA 1RPRA 1SC5B 2EJ7A 2P90A 2JGUA 4QNHB 1YJ9V 1EN5A 2F4VB 1R6KA 2ZM6O 3X2QB 4U7OA 3E22A 3K5MA 2PYJA 5CBFA
chains in the Genus database with same CATH topology
2Q73A 2YXHA 1Y6XA 1VMGA 2OIGA 2Q5ZA 2P06A 3C90A 3CRAA 5IE9A 1YXBA 3CRCA 2Q9LA 2Q4PA 1YVWA 2GTAA 4QGPA 2A3QA 2A7WA 2OIEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q73 A;  2YXH A;  1Y6X A;  1VMG A;  2OIG A;  2Q5Z A;  2P06 A;  3C90 A;  3CRA A;  5IE9 A;  1YXB A;  3CRC A;  2Q9L A;  2Q4P A;  1YVW A;  2GTA A;  4QGP A;  2A3Q A;  2A7W A;  2OIE A; 
#chains in the Genus database with same CATH topology
 3OFN G;  5BMV B;  4BAY A;  4NTW A;  1JA8 A;  3JD2 A;  4FK5 C;  5IYB O;  5LA6 B;  1VQP V;  4DR7 O;  2ZD9 A;  1RPO A;  4Q20 A;  2HJF C;  3D36 A;  3JD4 A;  1AR4 A;  4L8J A;  1FD9 A;  2R9A A;  1OHH G;  1S5L Z;  2WLK A;  4H13 B;  5LMU O;  2HP8 A;  3E83 A;  2HHH O;  4IL6 Z;  1SA0 A;  1H8H G;  2QDO A;  3E8H A;  3AK3 A;  3FB8 C;  2ODM A;  1H2S B;  2BTO A;  5FNV B;  4X65 B;  1YZB A;  4Z1M G;  2P7T C;  3CRR A;  4BIO A;  3JCZ A;  5LL6 Y;  5FL7 G;  4O4J B;  4UFZ A;  2RDC A;  3DXR A;  4QIW F;  2ZM6 B;  2VWK A;  3ZMU A;  2IH3 C;  1G6U A;  1GKF A;  3CCE V;  1S5H C;  1MZE A;  4KL1 A;  1OCO C;  4PA7 A;  1MZF A;  2GHY A;  3AG1 C;  3A0H Z;  4X66 O;  1URF A;  2BOC C;  3OTF A;  4DUZ O;  3ABL B;  4PEL A;  1YJW V;  2JS3 A;  4OPH A;  4MSW C;  1L1F A;  3JAT B;  2XUM A;  3LDC A;  1L8D A;  4E4E A;  3ETQ A;  5CB4 B;  3E22 B;  3SYO A;  2HJD A;  3MAQ A;  4DR5 B;  4PA6 A;  4KUM A;  4GKK B;  1HNW B;  3L70 H;  2AW9 A;  2A3Q A;  3SDL A;  3UT5 B;  1JX9 A;  4KHP O;  2WLI B;  4J9Z B;  1LUW A;  1S76 D;  3IC9 A;  3OE7 G;  3WB2 A;  3NXS A;  3CMA V;  2CDY A;  1XHZ A;  3I5D A;  5JCO A;  3JSL A;  4PD4 F;  4DR4 B;  2Z0A A;  3TXS A;  1KKD A;  2WWW A;  1H2L A;  4X1Y B;  2KKW A;  5CA3 A;  1N34 O;  3R66 A;  3L71 H;  4B3S O;  3CCJ V;  2G38 A;  5IWA O;  2P6J A;  5C93 A;  4ZI7 B;  1FKA O;  3K9A A;  5JCO C;  3ABK C;  4LF6 O;  3QO5 A;  2OIG A;  4KP4 A;  4DUY O;  3PN1 A;  1NU1 H;  3H1I H;  2QR4 A;  1XMO B;  2IJH A;  3T1H B;  1GTO A;  3LNN A;  2N74 A;  4D7S A;  3P3P A;  4YJ2 B;  1PL4 A;  3ZHT A;  4P9O A;  3W7S A;  1YTF B;  4KHP B;  4JI5 O;  4NB5 A;  3OEH G;  1K92 A;  3N2K A;  3BRC A;  3SYQ A;  4FLV A;  5EC2 C;  1K33 A;  3FB5 C;  1S3J A;  3OGI B;  1KMI Z;  2JJ1 G;  1QNM A;  2YI8 A;  3CME V;  2FB5 A;  5LGN A;  4MVU A;  4F6R A;  1OCR C;  5CB4 A;  4HNA B;  2ZNJ A;  2RQ6 A;  3JAK A;  3G4S V;  2XAG A;  1XIL A;  1QQC A;  1VQ6 V;  3OGC C;  3G6E V;  1DK1 A;  4WFH A;  1D5A A;  4X66 B;  2PF4 E;  3ZRS A;  1W0K G;  3AG4 C;  3N2G B;  1IBL O;  3CD6 V;  1GH6 A;  1R3I C;  3C90 A;  3UO2 A;  2IM9 A;  4DV0 B;  4I7Z B;  4LF8 B;  1ZL8 A;  1OCC B;  3L9D A;  3OMN B;  3JSN A;  1ROP A;  1N4C A;  2P06 A;  4FPP A;  3ZMV A;  3RT3 C;  5B66 Z;  4JI7 O;  1IDS A;  3FKS G;  2UXD B;  3ETE A;  3HR0 A;  3WG7 B;  5LP6 B;  2IU3 A;  5KMG A;  1HP8 A;  5KAI Z;  1HNZ B;  4JGS A;  3K3W A;  3CCL V;  1VF7 A;  1SQP H;  1XRE A;  3OD4 A;  2EIM C;  2VQF B;  1JCH A;  2R72 A;  5LOV B;  5C8Y B;  1P4R A;  1V55 B;  3ZRW A;  1Q5O A;  2N05 A;  3T4Z A;  4MW8 A;  5B1A B;  4MT8 A;  3OUF A;  1OV9 A;  4U3J A;  1YTF D;  3ASO C;  1PPJ H;  3RFR A;  2R70 A;  2WLH A;  1P84 F;  4HNA A;  4WFG A;  5LHI A;  4LF4 O;  3T4D A;  3T1C A;  1SZT A;  1L0L H;  4K8X A;  2HVK C;  3K08 A;  3ZED A;  4B08 A;  4K0K B;  5E79 Z;  3H9V A;  3K5N A;  4EKW A;  4ZHQ B;  2B1G A;  5L3G A;  1HNZ O;  5EC1 C;  4AQY B;  1FXV A;  1I94 O;  4DR5 O;  1XOU A;  1JOY A;  1VQ9 V;  2DN9 A;  2LP7 A;  3VQX A;  2YIA A;  1DF5 A;  1BMF G;  4GKJ O;  4DO2 A;  4XBF A;  1XL4 A;  1I94 B;  1LNQ A;  1K7D A;  3SPG A;  4NXM O;  3L75 H;  1FFX B;  1AP6 A;  4MTO A;  2D3O W;  3FAV A;  3CCS V;  1IXB A;  4DXW A;  1K4D C;  4GX2 A;  1FPO A;  2AHZ A;  4IHJ A;  4NYK A;  4LF4 B;  2XOK G;  2AXT Z;  1QU7 A;  2W6J G;  1IBL B;  5L3B A;  3DGE A;  1N0N A;  3T1Y B;  2BOB C;  5LXT B;  2ZR2 A;  4WCE V;  3G71 V;  4JI6 B;  4I4T A;  2GDS A;  1WPB A;  1EN4 A;  2DWE C;  5D5Q A;  4O4H B;  1N36 B;  1QHT A;  3M8A A;  3KZI Z;  4PV1 B;  2UXD O;  3JAR A;  4PDR A;  1XI1 A;  2F43 G;  3ZMS A;  4PDV A;  4PA9 A;  5KUM A;  1GRJ A;  5LHH A;  3JAS B;  2DWD C;  4TV9 A;  2HLD G;  2OIE A;  2QKC A;  4YHH O;  3OT7 A;  4YJ3 A;  3A8T A;  4GCZ A;  2VQE B;  3BCC H;  2EX3 A;  4Z1V A;  5JWP A;  2QWN B;  5LGT A;  3HKB B;  1AR1 B;  5B5E Z;  3B77 A;  3J80 N;  3QTC A;  1JMK C;  4D7T A;  5H9C A;  3KKY A;  4JTD B;  5JVD B;  2QJ1 A;  4GX5 A;  1Y67 A;  5EYP A;  3GVM A;  1YI2 V;  2YI9 A;  4CC6 A;  4DV1 O;  3STL C;  5KHJ A;  1H2G A;  2A79 B;  1R6T A;  5EBM C;  2UXN A;  1AVM A;  3CC4 V;  3E86 A;  4CS3 A;  4I50 B;  1Q6I A;  2R9I A;  4FLW A;  1XL6 A;  1BQZ A;  4TOI A;  2YXY A;  3SJB C;  2JVD A;  2BTQ B;  2JEX A;  3RYH A;  4ZKI A;  1Q6H A;  3BVO A;  2Q8V A;  1H2N A;  2HVJ C;  3RGB A;  4W4L A;  4N21 A;  3F5W C;  1S5J A;  4NXN B;  3OM3 B;  5BMV A;  3K57 A;  1LUV A;  4A5U B;  4YIO A;  2Z5U A;  3CSX A;  3AG1 B;  3VBB A;  1SRY A;  1N33 O;  4X20 A;  4JI8 B;  1AIL A;  1XBL A;  4J80 A;  2P22 C;  3IFX A;  2B9Z A;  4I9Q A;  3BPZ A;  4B3T B;  4PJ0 Z;  3G80 A;  5CMU A;  4RAI A;  1KEC A;  1ENV A;  1S0V A;  3AG2 C;  2EIN B;  2CGN A;  2GSM B;  4O2A B;  4MTX A;  1WP8 A;  4UUJ C;  1JFF A;  2CE4 A;  4LFC B;  3LNM B;  3JAM N;  1K97 A;  4UCR A;  4OGQ B;  1Z5V A;  5KA5 A;  2LW7 A;  2W6I G;  1B3Q A;  1X4T A;  1Z2G A;  5CBG A;  1P7B A;  4EB6 B;  4EFB A;  5LYJ A;  3W7X A;  3BAA A;  2E5L B;  2LGW A;  4FLZ A;  1R73 A;  1EFR G;  1WJZ A;  4PI0 A;  1N33 B;  1YVW A;  1K8A W;  1B04 A;  1N8R W;  4JYA O;  4PI2 A;  1XMQ B;  3B40 A;  3G6B A;  4FLU A;  4LH7 A;  3CX5 F;  5DED A;  2XAQ A;  2ITC C;  4FMT A;  4O4J A;  1XEQ A;  5B1B C;  3SPI A;  2GTS A;  2HEP A;  4R50 A;  2ZE5 A;  4QGP A;  2BSK B;  2CTW A;  3OR6 C;  2W0X A;  5IYZ A;  2X0L A;  4I5S A;  4O4I B;  3H1K H;  4GX1 A;  4JPR A;  4DV7 O;  2FTK A;  1XQ8 A;  4MVM A;  4OX9 O;  1SES A;  3JAT A;  2EZP A;  1M90 W;  1R3L C;  1SF9 A;  3CRA A;  2ILM A;  2RNB A;  1JFF B;  3ZRV A;  1TUB B;  3L73 H;  4X62 B;  2EIK B;  4LFB B;  4IT5 A;  1JJO A;  4JI2 O;  3JAW A;  3UT5 A;  4EB6 A;  3FX7 A;  5LYJ B;  1PNM A;  3E8G A;  4LF6 B;  1M57 B;  2YS8 A;  1MSD A;  4GT1 A;  3K5L A;  3W7W A;  1SQV H;  2XAS A;  4B3M B;  2DYR C;  5LHG A;  4FLT A;  3QVN A;  4NXN O;  4YJ2 A;  2QSA A;  3CWB H;  1KBH A;  3TGU H;  5B3S B;  1F51 A;  2CTR A;  5GTI Z;  1A32 A;  1TGO A;  2UUA B;  1PNL A;  2FL4 A;  2JGD B;  3JCU Z;  5KHH A;  4TV8 A;  3JD1 A;  2VRZ A;  3AK1 A;  3JAK B;  5A9G A;  4X1K B;  2IJJ A;  4LF9 B;  3AG7 A;  1F4M A;  2BSK A;  2PUS A;  1VAR A;  4BIU A;  5IYZ B;  3FD9 A;  4I55 A;  2ZCE A;  4DV4 O;  1NQT A;  3EXA A;  2P4K A;  4GUN A;  2UXC O;  3H01 A;  5IE9 A;  3KG2 A;  5LMN B;  2IW5 A;  1TA8 A;  5L3D A;  3Q4H A;  1KUQ A;  4UVC A;  4X88 A;  2WSS G;  3S3W A;  1XMQ O;  2ETN A;  1XNQ O;  3S3X A;  3K79 A;  2Y4T A;  3B09 A;  1WB8 A;  3P30 A;  1VMG A;  4K35 A;  3MHH C;  2ZNI A;  2KG7 A;  1M57 C;  4LR3 A;  2JJ2 G;  3GWK C;  2LQT A;  1JJ2 U;  1SQQ H;  1SKV A;  2AGA A;  4ZIB A;  1XMO O;  4JZ2 A;  4DR6 B;  1K5S A;  2KQX A;  2Q0A A;  2JGD A;  2Q73 A;  4LFC O;  4H37 A;  1X59 A;  5KMG B;  5JH7 A;  1RSO A;  4QE9 A;  4FLX A;  2E76 B;  4UV8 A;  3T1Y O;  4IYI A;  3WB0 A;  4G28 B;  4JI8 O;  4TSF G;  3UKM A;  1CXZ B;  1YJN V;  1WNS A;  4U3J B;  5DM6 V;  1Q43 A;  3CC7 V;  2QGN A;  1ZX3 A;  1NVP D;  4OX9 B;  2EUL A;  3T2M A;  4J7Z A;  1NTM H;  2X6B A;  3R65 A;  1D2D A;  1W2B U;  4MVZ A;  4GYC B;  1RFY A;  1AP5 A;  3OTO O;  3B8M A;  3J7A U;  1J5E O;  2MW2 B;  4RUE A;  3ZHV A;  4FJC C;  4JI4 B;  1M4U A;  4X89 A;  1KB9 F;  1U96 A;  1O9H A;  2C2A A;  4R7C A;  1Q7Y W;  3SJC C;  1EZJ A;  5HFL A;  4J7J A;  4DV3 O;  4L87 A;  3ZIA G;  4LBE C;  2PI4 A;  3J81 N;  4FLY A;  4AHC A;  3ZRX A;  4Q6G A;  4MW3 A;  4BWA A;  1JPX A;  5KAF Z;  4I9W A;  1FFX A;  2QWQ B;  3B4S A;  4FFB B;  2K9P A;  1SZX A;  3FAV B;  1S72 V;  1OJH A;  3HPL C;  1I5X A;  3ICX A;  4O4H A;  1PP9 H;  4DV4 B;  4FZ0 A;  3RYF B;  1GAX A;  1HDJ A;  3E8F A;  2X7R B;  3A0B Z;  2A9H A;  2E5L O;  3HKD B;  2DMX A;  3W7T A;  3CJH A;  2AHY A;  1Q86 W;  1OCO B;  4DRX A;  3APO A;  1AJP A;  1BCC H;  2OCH A;  2RN9 A;  5IT9 N;  3D36 C;  4IIJ A;  1EN6 A;  1HW7 A;  2RJZ A;  4JAU A;  4NTX A;  5LBQ A;  1FS0 G;  1U97 A;  3JD3 A;  3UQ8 A;  4BR6 A;  3ZHR A;  2WAM A;  1FJG B;  2LW1 A;  1VEW A;  1SS3 A;  4JTA B;  3K59 A;  3I55 V;  4YJ3 B;  2QWO B;  2ZT9 B;  2V7Q G;  3DC6 A;  2EIJ B;  3FYE B;  1Y66 A;  2F4V O;  5H5N A;  3K03 A;  2A0L A;  3C3T A;  5KUK A;  2YUA A;  2ZIN A;  4WFB V;  5DN6 G;  3IGA C;  1Z5W A;  4TV9 B;  1R3K C;  4JI0 B;  1M93 A;  2HG5 C;  1IZ3 A;  1VF5 B;  3DSQ A;  1BSM A;  5CA0 A;  1US6 A;  1COW G;  5EZY B;  4ASU G;  2Q0O C;  2OWO A;  3TK1 A;  3LSU A;  3TCU A;  1M9N A;  2R9R B;  4J9Y B;  3CRQ A;  3ABU A;  1H8E G;  3ETG A;  3HKB A;  4LF9 O;  4EEQ A;  2IJK A;  1DF4 A;  2FKX A;  4H44 B;  4NXM B;  3OMI B;  5KHI A;  3M7M X;  3HKD A;  2ZIO A;  3FB6 C;  2JEU A;  2UUB B;  2V4D A;  3BEH A;  3OTO B;  4GKJ B;  3RVY A;  1WB7 A;  1GN4 A;  2Q7H A;  3T1H O;  2ZQM A;  1QR9 A;  5BZB A;  2WA4 A;  1GN2 A;  1OZ0 A;  4OXS A;  4F4L A;  4LWS A;  1GN3 A;  4IIJ B;  1AI4 A;  3ML0 A;  1Q8I A;  5IJ9 B;  4YHH B;  1QBZ A;  1KYO F;  4PDL A;  3A0R A;  3ZMT A;  4DV6 B;  4DR1 B;  1FXK B;  2BTQ A;  4NVP A;  1OCR B;  1NS1 A;  3RYH B;  1Q90 D;  3CP1 A;  4P2Z A;  1P49 A;  3G67 A;  3ASN B;  3QNE A;  4D6T H;  1YXB A;  1KP3 A;  1K5Q A;  3L72 H;  4ZOL B;  5L3E A;  4HZ3 A;  3CRC A;  2Q9L A;  4DW0 A;  2OT5 A;  1Y74 A;  4WFE A;  4DV5 B;  1UPG A;  1NTK H;  2X6A A;  2JDI G;  3AG3 C;  1V54 C;  1FXH A;  1MSW D;  4UCU A;  4DV7 B;  4JF3 A;  1BGY H;  3OW2 U;  4GKK O;  2YXH A;  1WLE A;  3ZJZ A;  3RYC B;  2Y0P A;  2QKA A;  2EIN C;  4MTF A;  2F1M A;  4LP8 A;  5B1A C;  5EBW C;  2YIB A;  2F93 B;  5BXZ A;  3APQ A;  1GM7 A;  2FML A;  2EIM B;  1M5I A;  1ZWI C;  5JJJ B;  2H3O A;  4F6E A;  3WB1 A;  5L3F A;  1BS3 A;  3CXC U;  2EIK C;  3MDS A;  1IBK B;  5IYD O;  2XND G;  1E1Q G;  2BE3 A;  3RBZ A;  2ARH A;  5GON A;  2M7W A;  4QPK A;  2A06 H;  1KD1 W;  1P7G A;  1KKC A;  3VQV A;  4F6R B;  1LR1 A;  4P9P A;  1W59 A;  2EIL B;  1KC8 W;  2HHH B;  2P5O A;  4E2L A;  1IUR A;  4DV1 B;  4HBN A;  5KHK A;  5KLV H;  3AG4 B;  3CB2 A;  3ASN C;  5EK0 A;  3ABM B;  4CS4 A;  4XDK A;  3BAB A;  3SYC A;  4JYY A;  1YHQ V;  1YIJ V;  3PJS K;  2CH7 A;  1MAB G;  3WG7 C;  4JI0 O;  4LC1 A;  1SQX H;  1E79 G;  2OYQ A;  2NR5 A;  2BCC H;  3IJ4 A;  4MVR A;  1R3J C;  4UCT A;  1Q3E A;  1ZTE A;  3H1J H;  1TVK A;  1NT2 B;  1M56 B;  4TV8 B;  1QVG U;  3HKC B;  1NH2 B;  4DR4 O;  1DGS A;  2HFE C;  4MVS A;  2YEV A;  1VQ8 V;  5FPR A;  1HWY A;  1CPY A;  2WLM A;  1B6Q A;  4R8C A;  4JI3 B;  2OTJ V;  2YC0 A;  4FZ1 A;  5J2U A;  2PGG A;  1ZAU A;  3CE2 A;  2DW4 A;  3AK2 A;  3AG2 B;  2Y69 C;  4ZBM A;  4DV0 O;  1RP3 B;  3ZHU A;  3E89 A;  1N32 B;  1IBM B;  4BW5 A;  4CH4 A;  3SYA A;  1I5Y A;  3JAL B;  3KCX A;  4O2B A;  3CC2 V;  4LF7 B;  2GUZ B;  4MS2 A;  3MHS C;  2DOS A;  4MVQ A;  2UXC B;  3EHB B;  4R6Z A;  1IBK O;  2EIJ C;  1ARO P;  3QO7 A;  2WLI A;  1NR7 A;  2DJV A;  1N32 O;  3U0Z A;  2CH7 B;  5JQG A;  3L74 H;  2CK3 G;  2LFS A;  4FM1 A;  3RYI B;  3CRM A;  4U7N A;  4LFA B;  3BY6 A;  3ASO B;  4DV2 O;  3OMA B;  4XDJ A;  3VOU A;  4JAS A;  5D5P A;  1FJG O;  4YY3 B;  5KHG A;  4JI4 O;  3TXQ A;  4JAA A;  4ABM A;  4X1I A;  2A7W A;  2QTO A;  2ADQ B;  1MNG A;  1V55 C;  3ZBH A;  1WN7 A;  3OR7 C;  2XAJ A;  1GM8 A;  3HKC A;  3JD0 A;  5H2F Z;  3E35 A;  5JH7 B;  2UXB O;  5JJE B;  5TIS Z;  1VQ4 V;  4PHZ A;  2XAF A;  5FLX N;  1G8M A;  4IYH A;  3SPH A;  4B3S B;  4FM2 A;  1Y6X A;  1F7Y A;  3CHX A;  5LXT A;  3THO A;  4H33 A;  4CH6 A;  3ABM C;  1J95 A;  1N34 B;  5J2U B;  4JYB A;  4I4T B;  1TUE B;  1BQ0 A;  1ORQ C;  3LUT B;  3EFF K;  5B3S C;  4FIP C;  3TET A;  1HR0 O;  4JI2 B;  5IY5 B;  5EIB C;  3W7U A;  1S77 D;  4JAV A;  2Y48 A;  3K9S A;  2Q4P A;  4JZG A;  5L3C A;  1AI7 A;  4O4L A;  1D5N A;  5IDJ A;  4C7U A;  1OCZ C;  4CH5 A;  1H2M A;  2ZIM A;  5CN0 A;  1NR1 A;  3LSQ A;  3JAS A;  1M1K W;  1H38 A;  1BE3 H;  3RYI A;  3CXH F;  3SJA C;  2ZE8 A;  4DK1 A;  1W0J G;  4DV2 B;  4TT3 G;  1VQO V;  2YSU B;  2UUC O;  4X1I B;  5J2T B;  2ZDI A;  1F23 A;  5DEC A;  4RO2 A;  4DK0 A;  3ZHS A;  5LP6 A;  3CCR V;  2E3C A;  2RMK B;  2QWR B;  1NI8 A;  3F5T A;  3CCV V;  1IX9 A;  1K4C C;  2ZXW B;  3K5O A;  2PZS A;  4X65 O;  1Y4M A;  3BA9 A;  1V9P A;  4LCU C;  4G27 B;  1E1R G;  2IBZ H;  2GV9 A;  2IU0 A;  3GB7 C;  4I50 A;  2IJI A;  3X2Q C;  3CEI A;  4QPJ A;  1EM1 A;  1SET A;  2EZO A;  4WFF A;  2WLN A;  4K8Z A;  3CJH B;  3E2E A;  2JK5 C;  4DYL A;  4JI7 B;  1YCI A;  2QM7 A;  4DR7 B;  2VWJ A;  3BFR A;  4O4L B;  1CP9 A;  2QWP B;  3D8C A;  1YIT V;  2DQ3 A;  2AZ2 A;  2OCC C;  2ZE6 A;  2E75 B;  4I0X B;  4ZHQ A;  2ZXW C;  3SJQ C;  4IGG A;  4LNU B;  3LDD A;  4LF8 O;  1K73 W;  1AI6 A;  4CS2 A;  5IWA B;  4UB8 Z;  5CA0 B;  3QG5 A;  4UV9 A;  3LSS A;  4BW9 A;  1JR9 A;  2WPD G;  2UXX A;  3K0D A;  3QO8 A;  5KX5 B;  1XUQ A;  1WA8 B;  4LFB O;  4N23 A;  4YIP A;  5BR8 B;  2O57 A;  1THZ A;  4TQF A;  1YDX A;  3EVK A;  2WA3 A;  4KXR A;  4PDM A;  5LP6 C;  2YIB D;  4DV3 B;  1OCZ B;  1GO3 F;  2HKO A;  1NKD A;  4JTC B;  2Q5Z A;  4J10 A;  4LWS B;  1K9M W;  4UCS A;  4K3A A;  1RM1 B;  4CC5 A;  4WF9 V;  4RWU A;  2PYL A;  4CH3 A;  2EIL C;  4MTG A;  1QLN A;  2EBO A;  2K1E A;  4EFE A;  2DYR B;  3E8B A;  2QTS A;  1NZ6 A;  2LJ2 A;  1JVM A;  4JI1 O;  2L35 A;  4TUY B;  5ITZ B;  1G1X B;  3H1L H;  2D2C B;  1NVP B;  3K04 A;  4B3M O;  2H94 A;  4ZOL A;  3UCS C;  2X6C A;  3FB7 C;  1PNK A;  1MG1 A;  4B3R B;  2ZDI C;  4O4I A;  4RUF A;  1HR0 B;  2B5U A;  1FXK A;  5GTH Z;  3CCQ V;  4QE7 A;  3P3N A;  4X64 O;  3RYC A;  3NR7 A;  2QEX V;  1RM1 C;  4UB6 Z;  2XTA A;  4UVA A;  1H2K A;  2Y0I A;  3ZN0 A;  3CS5 A;  2L6L A;  1VP7 A;  2YID A;  3DXR B;  3ABK B;  5EYP B;  2Y4U A;  2OCC B;  3AEI A;  1T5E A;  4B3T O;  1PKX A;  4LH6 A;  1SA0 B;  1ZSP A;  4B3R O;  4ICG A;  1MMM A;  2LGQ A;  5FNV A;  1XNQ B;  5GW7 A;  1QCE A;  1HNX O;  3FFQ A;  1BHA A;  3IC7 A;  2DYS C;  5GON B;  2DYS B;  2LO1 A;  4NTY A;  4TQD A;  1I0H A;  1WPX A;  2Q68 A;  2HR3 A;  4HYO A;  4TUY A;  2WLL B;  5ITZ A;  1UJW B;  2JS5 A;  1R1B A;  2NN4 A;  3C3S A;  4MVO A;  2WLJ A;  1IBM O;  3B8N A;  2UUB O;  4X20 B;  1QLE C;  4QJF B;  1AB3 A;  5BY1 A;  4O2A A;  2YIC A;  2QA4 V;  3ABL C;  1G4Y B;  4JI5 B;  4JI3 O;  1JQ0 A;  3SPC A;  5BR8 O;  3LDE A;  1IXM A;  3N27 A;  2F95 B;  1YF2 A;  3VQW A;  1Q6U A;  1F4N A;  3RVZ A;  1NJI W;  4ZI7 A;  1TAE A;  5CBH A;  3KCY A;  4LF5 B;  2N04 A;  4UCV A;  1GN6 A;  2YDE A;  3RWR D;  2MK3 A;  1EBO A;  2KG7 B;  3CCU V;  4UVB A;  2VS0 A;  1VQK V;  4AI8 A;  3UO3 A;  4DR6 O;  3H1H H;  5FPO A;  2CAZ C;  5HFM A;  4LF5 O;  4X1Y A;  4DR3 O;  5IYC O;  2JRI A;  1FYJ A;  3N2K B;  1QR8 A;  1Q81 W;  4YXW G;  5KA6 A;  4WBN A;  2CTP A;  1TVK B;  1UFI A;  2IH1 C;  4X9Q A;  2Q6A A;  3BA8 A;  4YY3 O;  5CA1 B;  1BL8 A;  1BT8 A;  4U3F H;  3P32 A;  1WP7 A;  2YEV B;  3M99 B;  2UU9 B;  3ZN1 A;  3VQY A;  2WLL A;  4DR2 B;  1DTO A;  2ZKO A;  1BHB A;  1I08 A;  2GUZ A;  3U10 A;  3HKE B;  5JJN B;  2QE7 G;  3ZMZ A;  2Z3Y A;  1AJQ A;  2B1I A;  2Q69 A;  4JV5 O;  5JQG B;  1KP2 A;  5LMN O;  4UXN A;  1SQG A;  2QKS A;  2KSD A;  1EZV H;  5K1X A;  4LF7 O;  2F23 A;  4WFA V;  1TUB A;  2ZE7 A;  1FAF A;  2KB1 A;  1XDC A;  3JAL A;  4O2B B;  1QLE B;  3SPJ A;  3JAW B;  1PV0 A;  4JYA B;  5IJ0 B;  1GMG A;  1V54 B;  3SR2 C;  3HB3 B;  3AG3 B;  2UU9 O;  3N2G A;  3CCM V;  5B1N A;  1PD3 A;  2LFR A;  5A2Q N;  2XHB A;  2E74 B;  3WU2 Z;  3GWO A;  2UUA O;  2PI5 A;  3MD0 A;  1ZL8 B;  4FVM A;  1KQS U;  2AZ0 A;  1MA1 A;  5C8Y A;  3RW0 A;  3O65 A;  4AQY O;  4DR3 B;  2DQ0 A;  1MOF A;  2ITD C;  1N36 O;  1BZK A;  5LMU B;  4FFB A;  1SQB H;  2P67 A;  4WBN B;  5F2V O;  1K34 A;  1XHX A;  4X64 B;  2JIZ G;  4DV5 O;  1FXK C;  1QVF U;  3UM7 A;  5CA1 A;  3RN4 A;  5J9P C;  2GBO A;  4W4K A;  1WAZ A;  4X1K A;  4FFK A;  3OUS A;  3K58 A;  3IAY A;  3D3I A;  3I56 V;  1VF6 A;  1YSC A;  3A2F A;  3HKE A;  4DRX B;  4H0L B;  1XNR O;  5LOV A;  3OAA G;  3ZRW B;  4NR1 A;  3FYI B;  1I7F A;  2FYU H;  3K06 A;  3F7V C;  2XT9 A;  4RQF A;  1NH2 D;  3DTU B;  3QF7 A;  4I55 B;  4NKG B;  4AIL C;  2M6Y A;  3K0G A;  4DR1 O;  2OTL V;  4X8A A;  2VQF O;  2NLJ C;  4J7K A;  4GZR B;  3TJT A;  2UUC B;  4JI1 B;  1VQ7 V;  2ADP A;  4J41 A;  5B1B B;  1PL0 A;  1HNW O;  4J11 A;  4BIZ A;  3Q4H B;  1J5E B;  4FM0 A;  5J2T A;  2Q67 A;  3BHP A;  5IJ0 A;  3ZS8 C;  4IHJ B;  1ZUQ A;  4DUZ B;  1DLB A;  1VQL V;  2F66 C;  2CTQ A;  2GTA A;  4K0K O;  4PA4 A;  4B7E A;  1HNX B;  5EBL C;  5H6R A;  1VQM V;  4KFM A;  5EZY A;  5LGU A;  4JYC A;  3O9O A;  1NBM G;  2ZR3 A;  1XNR B;  1CEZ A;  1AJN A;  1FFT B;  1Y76 B;  2VQE O;  4OPA A;  3U11 A;  2DE0 X;  3WFV A;  4DW1 A;  4JV5 B;  3CPW U;  4TWK A;  4Z2W A;  2XAH A;  1RSO B;  1O9G A;  1N0J A;  1VF6 C;  3SGI A;  1SER A;  2UXB B;  2EJR A;  4DR2 O;  4I0X A;  1K3E A;  3B2E E;  1GK9 A;  4LNU A;  5IJ9 A;  3ZCC A;  1ZLZ A;  2YXL A;  1PM9 A;  1OCC C;  3DC5 A;  5E1A C;  1L0N H;  5IY5 C;  4DUY B;  1IVS A;  1AI5 A;  4PA3 A;  5B1O A;  4LFA O;  5K1P A;  3JAR B;  4J42 A;  2CUG A;  1NTZ H;  3ETD A;  2Q7G A;  5KX5 A;  4DV6 O;  1WA8 A;  5LA6 A;  2PY5 A;  2W0F C;  4JI6 O;  3ZX6 A;  1VQN V;  1Y74 B;  4HAM A;  2RCV A;  2P4V A;  3D3Q A;  1SQF A;  3SYP A;  3ZHQ A;  3JYC A;  4G2K A;  1B06 A;  4X62 O;  1GM9 A;  1R6N A;  1KU9 A;  4P30 A;  3F7Y C;  4XDL A;  2PTM A;  2V1D A;  2NNU A;  1Y76 A;  2QM8 A;  2ATK C;  2Q7E A;  2Y69 B;  4RQE A;  4CBC A;  3RYF A;  1VQ5 V;  4UCO A;  3OEE G;  1AR5 A;  1VIB A;  3CYO A;  3STZ C;  5JVD A;  2QM4 A;  2H8P C;  4B7K A;  5AG2 A;  5H6Q A;  1Q82 W;  4CZZ A;  5EIB D;  4GLX A;  1M56 C;  1YEW A;  4GX0 A;  3ABT A;  2CGO A;  1RPR A;  1SC5 B;  2EJ7 A;  2P90 A;  2JGU A;  4QNH B;  1YJ9 V;  1EN5 A;  2F4V B;  1R6K A;  2ZM6 O;  3X2Q B;  4U7O A;  3E22 A;  3K5M A;  2PYJ A;  5CBF A; 
#chains in the Genus database with same CATH homology
 2Q73 A;  2YXH A;  1Y6X A;  1VMG A;  2OIG A;  2Q5Z A;  2P06 A;  3C90 A;  3CRA A;  5IE9 A;  1YXB A;  3CRC A;  2Q9L A;  2Q4P A;  1YVW A;  2GTA A;  4QGP A;  2A3Q A;  2A7W A;  2OIE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...