2P06A

Crystal structure of a predicted coding region af_0060 from archaeoglobus fulgidus dsm 4304
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
84
structure length
84
Chain Sequence
MDYFRLAEKFLREMHAKYMKRVSRPGNTPRPWFDFSEERLLSRLFEEMDELREAVEKEDWENLRDELLDVANFCMYLWGKLSVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein AF_0060
publication title Crystal structure of a predicted coding region AF_0060 from Archaeoglobus fulgidus DSM 4304
rcsb
source organism Archaeoglobus fulgidus dsm 4304
molecule tags Structural genomics, unknown function
total genus 28
structure length 84
sequence length 84
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03819 MazG MazG nucleotide pyrophosphohydrolase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1080 Mainly Alpha Orthogonal Bundle Helix Hairpins MazG-like 2p06A00
3CRAA 2YXHA 2GTAA 1Y6XA 2OIGA 2OIEA 2Q9LA 3C90A 2P06A 4QGPA 5IE9A 2A7WA 3CRCA 2Q5ZA 2A3QA 2Q73A 1VMGA 2Q4PA 1YXBA 1YVWA
chains in the Genus database with same CATH superfamily
2W0FC 3Q4HB 4HZ3A 1Y74B 2OTJV 4BIUA 4X1IA 4K0KB 2CUGA 4DYLA 2ADQB 4DRXB 3TCUA 2QWRB 1GM8A 4PJ0Z 1KKDA 3CXHF 4LFAB 3K04A 5FL7G 3RVZA 4UV8A 3OMNB 2UUBO 1JMKC 2KB1A 1M1KW 4TV8B 1IBLO 3E22B 3JAKB 2Y0IA 4B3TB 2JGDA 1VQ4V 4MTFA 1Q86W 5B1BB 2W6JG 4LF7O 3CS5A 4AILC 4I55B 4BWAA 2PZSA 5FNVB 2FB5A 3JALA 2LW1A 2YI8A 5IDJA 1HNZO 4ZOLB 1YCIA 3BRCA 3DTUB 2ZT9B 5B5EZ 5JWPA 4TQFA 3ZN0A 5LA6B 5KAFZ 2E5LB 5JJEB 3W7XA 4JV5O 3BPZA 1Y76A 5GW7A 2UUCB 3UQ8A 2UXNA 2Q7GA 4DV6B 1NT2B 4X89A 4DV5O 1N34B 1PV0A 1D2DA 4FMTA 3E8GA 1KP2A 2RMKB 4I4TA 3LUTB 3J80N 2JJ2G 1GN6A 2XASA 1EN6A 3SR2C 4B3MB 4LNUA 4JI0B 1K33A 4UCOA 2DN9A 2YDEA 1VF6C 2R9AA 5CA0A 4CS4A 2QA4V 4EKWA 3SYPA 1XMOO 2P5OA 1RSOA 1COWG 3ZHSA 4DW1A 1V55B 2FL4A 2QKAA 4DV0O 1YJWV 4PA6A 2VWKA 1JJOA 2IW5A 2PY5A 3K79A 4MVZA 1PPJH 5L3CA 1ZL8B 1PD3A 3RWRD 4FPPA 3SYAA 4Z1VA 2A9HA 2Y69B 4LFBB 1I7FA 1BZKA 1AROP 4OX9O 1WA8B 2QTOA 3LDCA 4PELA 5CMUA 3OGIB 4FM0A 3CE2A 3T1CA 4DV3B 2AHYA 2CTPA 1KYOF 4FFBA 4MVUA 1QQCA 4D6TH 1URFA 1ZTEA 3CCLV 3AG2B 3K57A 1OV9A 5DEDA 2W0XA 1NTKH 2ZE5A 2FKXA 4O4HB 3TETA 5IYBO 2ZM6O 1AI6A 3H1HH 2YEVA 3B40A 2HHHB 2H3OA 1MSDA 3EHBB 2P67A 2YIBD 4DUZB 2GV9A 4DUYB 2Y4TA 5CB4B 1LNQA 3UM7A 4FLXA 1XI1A 2EZOA 1WN7A 1FJGB 4G2KA 2BE3A 2CGNA 2XUMA 1JVMA 2UXCB 1G6UA 4GKJO 1WB7A 1SS3A 3E8FA 3IFXA 2DW4A 4DV7O 4EB6B 3CX5F 1MA1A 4IHJB 5LGNA 3EFFK 1OCCC 1MSWD 2FYUH 1HNXB 3H1KH 1EBOA 4YJ3B 4FLYA 2FMLA 5GONB 4JI2B 3F7YC 1MZFA 4CH6A 5L3GA 1R3JC 5LXTA 2AW9A 2QR4A 3OM3B 3VQVA 2Q8VA 5KX5A 4YJ2A 3OR6C 5KHHA 4FJCC 5IYZA 4N21A 4KL1A 1G1XB 3R66A 2WAMA 3ABUA 4GZRB 2HVJC 3SJAC 1S72V 1NVPB 5ITZA 1NVPD 3JATA 2RNBA 2GUZA 2WLLB 3JAWB 5BY1A 4WFHA 3QG5A 2MK3A 1I0HA 1TVKA 2WSSG 3N2GB 4X66B 2Q0AA 4ZHQA 4JYYA 4H44B 3FD9A 5LGTA 1S77D 3HR0A 4X1KB 3CCSV 1MOFA 2V1DA 4FLZA 1Q5OA 4L8JA 1GAXA 2ILMA 4CH5A 5EYPB 4LCUC 4X62B 1Q6HA 3E83A 1K9MW 3C3TA 5LGUA 3CC7V 4CS2A 5JH7B 3LNNA 4EEQA 5IWAO 3ZHQA 3ZHRA 4ZKIA 4LF5O 1VF7A 3UT5A 3G67A 1UJWB 5KHGA 4I50B 1B3QA 3LSSA 4NR1A 2HFEC 2Q9LA 1JCHA 1YITV 1Z5VA 4MTOA 5KA6A 3K58A 3O65A 1KB9F 3G6BA 2EILC 4XDJA 5BMVB 4TT3G 3A0RA 2UXDO 2QM4A 2N05A 4J11A 3KZIZ 2BCCH 3DXRA 1V9PA 3RVYA 3FFQA 4NVPA 2PTMA 3ZHVA 3VQWA 2EIKC 2EZPA 1RFYA 2IU3A 3L75H 1YIJV 3O9OA 4ZIBA 1W0JG 3GB7C 3PJSK 3UO3A 4JYAB 3RYFA 1BQ0A 3F7VC 1R1BA 2F93B 1PNKA 4LWSB 2YXLA 4Q20A 3ABMC 1FXKC 4GCZA 4NXMO 3AEIA 1DK1A 3C90A 3OMAB 1QVFU 4PA7A 3B2EE 3ZMSA 3JAMN 2ZINA 5EZYA 2Z5UA 1XDCA 5C8YB 2ARHA 1SQGA 2R70A 5LHHA 1RP3B 1QR8A 3H1JH 2LFRA 1IBMB 2AHZA 4ABMA 4DR6O 4X1YB 2ZXWC 4UVBA 5LMNB 4CC6A 2OWOA 3KKYA 1SZTA 3ABTA 5J2UB 2ITCC 4RO2A 1IDSA 4K0KO 3X2QC 1OCCB 3KCYA 1Q7YW 1K4CC 1IBKB 4LFAO 2DYRC 4O4LB 3Q4HA 1R73A 1ZUQA 2OTLV 2WLKA 3H1LH 4B3TO 3ABLC 4LF6B 3CWBH 1VQLV 2HVKC 5IJ0A 3E22A 4K8XA 3A8TA 2P6JA 2M7WA 4WBNB 3I56V 5JVDB 1MABG 4FLTA 4B7KA 3ZHUA 5L3FA 2IH3C 4JZGA 5LBQA 4JTCB 1SQXH 1GN4A 3QO8A 2EJRA 4J80A 4RWUA 1HWYA 2CH7A 3CXCU 1SQBH 2QSAA 3CB2A 4TV9B 1GN3A 3SYCA 5LOVA 4DR4O 3K9SA 1XILA 5LA6A 2UUCO 3MAQA 1G4YB 2IBZH 1W2BU 2A7WA 4DK1A 1R3LC 2Q0OC 4DV6O 4U3JA 1VQNV 1ZWIC 4J42A 1N34O 4FM2A 1S5JA 2VS0A 3JCZA 3L9DA 4TWKA 4UCVA 3MDSA 1PL0A 3NR7A 1RPOA 2E74B 3OD4A 2P06A 3JARB 5E79Z 4JI0O 2JGUA 5IY5B 4UUJC 3B4SA 2X6BA 4K35A 1GKFA 2V7QG 2WLHA 3OTOB 1FD9A 3BEHA 4LH7A 3D36C 2HJFC 4XDLA 1QNMA 3L72H 4JYCA 2UXBB 3K5OA 1QLEC 4UB8Z 4LFBO 1IXMA 2LGWA 1WNSA 4JI4B 1JQ0A 1KBHA 4DV3O 3CCQV 3U11A 2HKOA 4CH3A 4I9QA 1GRJA 4IYIA 1OCRC 3ZS8C 5LP6A 2WLIA 5EIBC 4QIWF 2EULA 1I08A 4PD4F 3ZN1A 3OFNG 2IJKA 4TUYB 1SQVH 2ZE7A 4WFAV 1JX9A 2DJVA 4JGSA 5JCOC 5FPRA 1TUBA 4X65O 1I94B 4UCSA 2HHHO 4ASUG 1BL8A 4I5SA 5KAIZ 1SA0A 4DUZO 4DUYO 4DR2B 3QO7A 1FJGO 1IX9A 1FXKB 4YIOA 5FPOA 4KXRA 1R6NA 2GBOA 4KP4A 3SYQA 4BR6A 1SQPH 3FB7C 1BMFG 2X0LA 1JA8A 1AR1B 3CJHA 1FXHA 1E79G 1T5EA 1XL4A 2Y0PA 3RGBA 3OEEG 2GTAA 3N27A 5KMGB 1PP9H 1VF5B 4DV2B 1GM7A 2A06H 4P9PA 1HNXO 5EK0A 2QM7A 4EB6A 3RN4A 4JZ2A 4J41A 4JI2O 5TISZ 3X2QB 2YICA 4LH6A 1AJPA 4YJ3A 4OPAA 2Y4UA 4PV1B 5IYCO 1M93A 1Q90D 4HYOA 1YDXA 1KC8W 3LDDA 4O4IB 2RN9A 4R50A 4A5UB 4AHCA 2LW7A 2KG7A 3ABLB 2G38A 2OCHA 3RYIB 3FKSG 4O2BA 2F95B 3C3SA 2R72A 2ZCEA 3CC2V 5B1AC 5J2TB 2ZIOA 3HKBB 3ZRWB 3JASB 5A9GA 2EIMC 1AP5A 4LF4B 3EVKA 4X66O 3MHHC 4YHHB 2JK5C 1GMGA 4WFGA 5DECA 2DE0X 1FS0G 1TGOA 3DC6A 3SJCC 2F43G 3IAYA 3L70H 4X62O 2BTQB 5EBLC 2ZDIA 1KP3A 1OJHA 3STLC 5BZBA 4KHPB 4CZZA 4NB5A 3IJ4A 5EYPA 1B04A 2A0LA 3RYCB 2OCCC 5LL6Y 4UCRA 1LUVA 4JI5B 1YEWA 3KG2A 4FM1A 4O2AB 4EFBA 3D3QA 1K5SA 2HJDA 3K0DA 3G4SV 3T2MA 3CCVV 1VQ5V 2IH1C 4RQEA 1AI7A 1CXZB 1K8AW 1DF4A 3APQA 4MVMA 3CCEV 4E4EA 2P22C 4H33A 2OYQA 1QLEB 4X64B 4J10A 2QJ1A 4U3FH 4OPHA 4DXWA 1QCEA 2Q69A 3E2EA 4DR3B 3K59A 1BHAA 3CHXA 1HR0B 4R7CA 2P4KA 4LF8B 3SYOA 2QWQB 3IC7A 4B3RB 2CDYA 1OCRB 2CGOA 5IYDO 3W7SA 1SESA 2Q5ZA 2UUAO 4IL6Z 2F66C 5DM6V 4X20B 5CA1A 3SJQC 3STZC 5JQGA 5EC2C 3CD6V 4JYAO 1Q3EA 3B8NA 2Z0AA 3VQXA 1QLNA 1AR4A 2QEXV 1W59A 3S3WA 4ZI7B 1WLEA 4JI8B 4UVCA 1DLBA 3F5TA 3AK2A 3FB5C 3JD3A 1N36B 4QE9A 3K0GA 2HG5C 1RM1B 1M4UA 3L73H 1IBMO 5JJNB 4DR7B 4X1IB 4R8CA 4FK5C 5LMNO 4DR5O 3GVMA 3T4DA 3I55V 4DV1O 4IGGA 1DF5A 2GSMB 2GTSA 1FFXA 5L3BA 4PA3A 2Q6AA 2JGDB 2P90A 1MNGA 1R3IC 1SQFA 1XL6A 1FAFA 4FVMA 1ENVA 2WA4A 1S5LZ 4RUEA 5IJ9A 4MVQA 2WPDG 1R3KC 2IJIA 4LF6O 3I5DA 4JAUA 3BABA 4PDLA 2WWWA 3JALB 1CP9A 1AJNA 2X7RB 3SPHA 5GTIZ 3T1YB 1R6TA 2L35A 4MVSA 3HB3B 2B1GA 1LUWA 2ZIMA 1CPYA 2ZQMA 2DMXA 4GX5A 4QPJA 2LQTA 1Y76B 1IXBA 5B1AB 2Q68A 4KFMA 3K5MA 1K97A 2EIMB 2ZNJA 3JD2A 4F6RA 2PGGA 2EX3A 4RAIA 4MS2A 2IU0A 2UU9O 3CPWU 3K3WA 1JFFA 1S3JA 1M90W 4I0XB 4LNUB 3SGIA 2K9PA 5CA0B 3P3PA 2R9RB 1P49A 1Z5WA 3FYEB 4FFKA 2OCCB 3JARA 3K5NA 3OTOO 3OW2U 3OAAG 1NU1H 4ZBMA 3ASNC 3W7UA 2QWOB 4AI8A 1NTZH 2UXBO 1BGYH 2OT5A 3QF7A 4C7UA 1XMQB 4JI4O 2P7TC 4F4LA 2PI4A 2JJ1G 1FYJA 3RYHA 4FFBB 5K1PA 2NR5A 1KQSU 4LR3A 3HKCA 2BTOA 1N0JA 3FB6C 2D3OW 4YY3B 3UCSC 1NJIW 2F4VB 2DOSA 4DW0A 1KU9A 3CRRA 1EZVH 2JRIA 3HKEB 5EBMC 2YEVB 4X9QA 1TA8A 3AG1C 2YXHA 2AXTZ 5CBFA 3FAVA 4LBEC 3QVNA 4QE7A 3CRQA 3DSQA 3AK1A 4IIJA 3WB2A 1I94O 4QNHB 4JAAA 1IZ3A 1E1RG 4J7ZA 1OCZC 2CK3G 2ITDC 4UFZA 3UO2A 1ZLZA 4IT5A 3N2KA 4DR2O 4PHZA 2O57A 2LGQA 4HNAA 3BFRA 1Y66A 1PKXA 4DR1B 1Z2GA 4H0LB 1XEQA 1F4MA 1L1FA 4GKJB 3B8MA 1GN2A 5KHIA 5H9CA 5IE9A 2H8PC 4MSWC 1F4NA 2DWDC 3ML0A 1O9GA 2CE4A 5LHIA 1UFIA 5H6QA 4DV2O 1Y74A 4QPKA 1WPBA 2N74A 3H1IH 1NH2B 2X6AA 4DRXA 5LXTB 1NH2D 4YJ2B 5KX5B 5LMUB 1JJ2U 1NKDA 4JAVA 5AG2A 1EM1A 3OUSA 2VQFB 3BCCH 1YTFB 1XHXA 4TV8A 1YTFD 1D5NA 5IYZB 3JAKA 3ZJZA 3ZIAG 3JSNA 1NBMG 3ZMUA 1KECA 5B1BC 1VQ9V 1VQKV 2VQEB 5F2VO 4DK0A 4WFBV 4UB6Z 3WG7C 1DTOA 1YF2A 3FYIB 1THZA 5ITZB 4I55A 3JATB 3CMAV 2GUZB 2E5LO 5FNVA 2XHBA 1EN4A 1SKVA 1TUEB 4W4LA 5CBGA 3G6EV 2RJZA 4ZOLA 5DN6G 1TVKB 1H2MA 3RFRA 4BW9A 4ZHQB 1WP7A 3AG3C 4LF4O 2ZE6A 1ROPA 1FKAO 1W0KG 1F23A 5H6RA 3ZMTA 4YHHO 1NR1A 3JASA 5H2FZ 4DR6B 4JYBA 3RW0A 3T4ZA 3H9VA 2XOKG 1U96A 3GWKC 1VQPV 4LP8A 4GX0A 1XBLA 5E1AC 4B3MO 1OHHG 4KUMA 4WFEA 2KQXA 4KHPO 2W6IG 2JS5A 1EFRG 3K5LA 5IWAB 3UT5B 2QKSA 4Z1MG 1V55C 4JI5O 4OXSA 1SZXA 1NZ6A 1HNWB 1AR5A 3MD0A 3TGUH 2JS3A 4TQDA 1XUQA 2YSUB 1ZL8A 4O2AA 2CAZC 3B77A 3W7WA 1Q43A 4X64O 2GDSA 1SERA 5L3EA 3TJTA 1WA8A 5B1OA 1BQZA 2EILB 5LP6C 3ZRXA 1XNQB 2XTAA 3DXRB 3ASOC 4DR3O 2VWJA 1VIBA 1F51A 1N0NA 3B09A 1HR0O 2C2AA 4LF8O 2XAQA 2QDOA 3OUFA 4ICGA 2EIKB 4I9WA 3T1HB 2RDCA 2AZ2A 1RPRA 1D5AA 2N04A 1F7YA 1K5QA 3QNEA 2E75B 4O4HA 1X4TA 5KUMA 3AG1B 4D7SA 4F6EA 3ZCCA 4RQFA 3ABMB 1GK9A 3H01A 3OR7C 1M57C 2YIBA 2Q4PA 1YJ9V 1VARA 2UXCO 1WPXA 4O4JB 1OCZB 4JI8O 4NTWA 4WCEV 5CB4A 1N33B 3ETEA 5EZYB 3OTFA 1Q6IA 1ZX3A 3TK1A 3VQYA 1N36O 3OGCC 2OIEA 4JI6B 4AQYB 3M99B 4P2ZA 4JI3B 4NYKA 3SDLA 4UV9A 3GWOA 2PUSA 3ZMVA 5B66Z 3TXQA 1S5HC 4DR7O 2X6CA 2ZXWB 4IHJA 4JTAB 1H2LA 4B08A 4E2LA 3E8BA 4UVAA 5B1NA 4DO2A 1L8DA 3CP1A 2AGAA 4LF9B 2F23A 2DYRB 2B9ZA 1H8EG 4GX1A 5GONA 3ZRVA 1YI2V 2PI5A 3ZEDA 2JDIG 1QR9A 5IJ0B 5KA5A 3KCXA 1R6KA 3JD0A 3IC9A 5KHKA 1YXBA 4Q6GA 4GKKB 5EBWC 2B5UA 2K1EA 1N32B 2YIDA 3ETDA 1VQ8V 3T1YO 1J5EB 2NNUA 4XDKA 5GTHZ 3WG7B 2WA3A 2CTRA 2MW2B 3OMIB 1Y6XA 2D2CB 1IVSA 2ZR2A 4B3SB 3UKMA 2H94A 2CH7B 3K08A 4HBNA 2JVDA 2WLLA 3JAWA 4I7ZB 5LOVB 4FLWA 2JIZG 4LFCB 1DGSA 4JTDB 3RT3C 3BHPA 3CCMV 5CA3A 3CSXA 3N2GA 3AG4C 4U3JB 1VQ7V 3AG3B 4DR4B 1YSCA 4GLXA 4JI1B 4NKGB 2ZDIC 4X1KA 4D7TA 3A0HZ 3TXSA 3E89A 4NXNB 2XAGA 1FFTB 1TAEA 5B3SC 1NI8A 2XNDG 1H2SB 5JH7A 3R65A 2QWNB 4I0XA 3W7TA 4MTGA 1XNRB 4R6ZA 4JI7B 4J7KA 2DQ3A 1VF6A 5BR8B 1K73W 5K1XA 1H8HG 4FZ0A 3M7MX 5BXZA 1QHTA 2YIAA 4I50A 1E1QG 2EINC 1YJNV 3SPJA 1QVGU 1WAZA 2BSKB 3ZBHA 2NN4A 1XMQO 3CYOA 1M56C 3U10A 2QWPB 1JR9A 3CMEV 3HPLC 5BMVA 2ZE8A 1SQQH 5LP6B 4QJFB 2WLIB 4CBCA 3HKDB 5A2QN 5KHJA 2BOCC 3FB8C 3ASOB 2P4VA 4UXNA 2PF4E 1HDJA 3A2FA 4YY3O 4NTYA 5EIBD 2F4VO 3K9AA 3D3IA 1NTMH 2Z3YA 1P7GA 3CCJV 1TUBB 2XAHA 4BIOA 4DV4B 1Q8IA 1SA0B 3HKEA 3THOA 3SPGA 2A3QA 2Q73A 4X65B 3BAAA 4LWSA 1SETA 1MG1A 4UCUA 1JOYA 5J9PC 3S3XA 3APOA 4U7NA 4GX2A 3SJBC 1M57B 1N4CA 5LYJB 1VQOV 1Q81W 3MHSC 4DR1O 3CJHB 5H5NA 4JF3A 3PN1A 2E76B 3QO5A 2HR3A 2ZNIA 3F5WC 5C8YA 1KKCA 1K92A 3CC4V 4PI0A 2F1MA 1IBKO 1L0LH 4X1YA 5J2UA 1O9HA 2UUBB 5HFLA 3JCUZ 2EBOA 1AP6A 1IBLB 2AZ0A 5LMUO 2XT9A 4O4LA 1SC5B 3L71H 1VQMV 2VQFO 3CEIA 4K3AA 2QTSA 2RCVA 4YXWG 2DYSC 1KD1W 1WB8A 3SPIA 2KG7B 1K34A 2PYJA 4LF7B 4MW3A 1H2KA 4L87A 3P32A 4O2BB 2YS8A 5HFMA 2VQEO 1ZAUA 5FLXN 3WFVA 3ABKC 1HNZB 4MW8A 2A79B 1V54C 1K7DA 4WBNA 5JVDA 4HAMA 5IT9N 3ZMZA 2ZD9A 4JV5B 2ZR3A 2EIJC 1FPOA 1PM9A 3AG7A 3JD1A 3NXSA 4TV9A 3JYCA 4I4TB 3J7AU 4DV5B 4JPRA 1H2NA 3AG4B 3OE7G 1S0VA 4IYHA 2XAJA 1Y67A 2HLDG 3CRCA 1PNLA 1JPXA 1VMGA 4FZ1A 1RSOB 1OCOC 4MTXA 2ZKOA 1J95A 4NTXA 3DC5A 3LSQA 4X88A 1YVWA 3QTCA 4B7EA 3ZRSA 3CRAA 5IY5C 1LR1A 3JSLA 4LC1A 5D5PA 5B3SB 1XMOB 4XBFA 1BS3A 4CS3A 2OIGA 2QM8A 4DV0B 2LJ2A 1KMIZ 3WB0A 2RQ6A 1VEWA 4MVRA 1HNWO 1G8MA 5C93A 2BOBC 2ODMA 2CTQA 2ADPA 3BVOA 4MVOA 4P9OA 4OX9B 4J9YB 4MT8A 1I5XA 2EINB 1NR7A 4J7JA 3ETQA 1XOUA 1XNQO 1M56B 3VBBA 1HW7A 1MZEA 1SRYA 5EC1C 1GO3F 4CH4A 4G27B 2YC0A 3OEHG 3T1HO 2QGNA 1XHZA 4Z2WA 4U7OA 4PI2A 1ORQC 5CA1B 1S76D 3JD4A 1QBZA 1ZSPA 1WP8A 5JQGB 1P84F 2UUAB 4BAYA 4TUYA 1VQ6V 2DWEC 3IGAC 2ZM6B 4K8ZA 2JEXA 2GHYA 5KLVH 3K06A 4WF9V 3ICXA 3L74H 5D5QA 3ZX6A 2CTWA 3FX7A 3E86A 1P7BA 2HEPA 2YUAA 4J9ZB 4PDMA 1AILA 3SPCA 1N33O 1FXKA 4QGPA 5KUKA 4O4JA 1YZBA 1PL4A 5JJJB 2IJHA 3ZHTA 2EJ7A 4DV7B 4AQYO 4JI6O 1NS1A 3EXAA 4JI3O 2VRZA 3VOUA 3WB1A 3LSUA 5KMGA 1P4RA 3OT7A 3ETGA 4TSFG 4FLVA 1FFXB 4DR5B 2LP7A 2E3CA 3LNMB 4LF9O 1I5YA 1N8RW 4DV1B 4H37A 2B1IA 3J81N 5IJ9B 4FIPC 2L6LA 2QKCA 1BE3H 4JASA 1SF9A 3CCUV 2WLJA 3BY6A 2DYSB 2Q7HA 3A0BZ 1H38A 1EN5A 3G71V 4GKKO 4O4IA 1QU7A 1N32O 3CRMA 1XREA 1K4DC 3RYIA 2YXYA 1J5EO 2IM9A 4W4KA 1BSMA 3ABKB 3BA9A 3E8HA 1BT8A 4B3SO 1V54B 5J2TA 3HKBA 3ZRWA 1AVMA 2Q67A 1X59A 4LFCO 1VP7A 2DQ0A 4F6RB 3M8AA 2EIJB 1AB3A 1M5IA 1M9NA 4PDVA 2KSDA 4JI1O 1JFFB 4G28B 1A32A 1CEZA 2IJJA 4NXNO 2UU9B 4CC5A 3RBZA 2JEUA 4OGQB 2BTQA 2NLJC 1AI4A 1OCOB 2LO1A 2V4DA 4LF5B 1MMMA 4EFEA 2R9IA 5CN0A 3WU2Z 1PNMA 2Y48A 3RYCA 1XNRO 1L0NH 1GH6A 4JI7O 4P30A 3K03A 2WLNA 1GTOA 5BR8O 2HP8A 2Y69C 3E35A 1BCCH 3D8CA 1Q82W 3ASNB 4TOIA 5CBHA 3G80A 1EZJA 3CCRV 2QE7G 4RUFA 1US6A 4PA9A 1UPGA 3D36A 2ETNA 1AJQA 1XQ8A 1BHBA 1WJZA 3RYHB 4BW5A 1NQTA 1KUQA 2UXDB 5L3DA 3HKCB 2BSKA 2KKWA 4WFFA 4B3RO 4PA4A 3AG2C 1U97A 1HP8A 3LDEA 3P30A 4PDRA 2LFSA 2WLMA 1B6QA 3RYFB 1OZ0A 3HKDA 4FLUA 1B06A 5LHGA 2XAFA 1IURA 3P3NA 3FAVB 2PYLA 4GT1A 2FTKA 4IIJB 3DGEA 4N23A 4X20A 2Q7EA 4DV4O 2UXXA 3BA8A 4GUNA 2YI9A 1GM9A 1H2GA 3N2KB 4NXMB 1FXVA 5JCOA 4HNAB 4BIZA 4ZI7A 3AK3A 3U0ZA 1Q6UA 4X8AA 2M6YA 4YIPA 4H13B 4GYCB 1Y4MA 1AI5A 2ATKC 5LYJA 1RM1C 1K3EA 4UCTA 1YHQV
chains in the Genus database with same CATH topology
3CRAA 2YXHA 2GTAA 1Y6XA 2OIGA 2OIEA 2Q9LA 3C90A 2P06A 4QGPA 5IE9A 2A7WA 3CRCA 2Q5ZA 2A3QA 2Q73A 1VMGA 2Q4PA 1YXBA 1YVWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CRA A;  2YXH A;  2GTA A;  1Y6X A;  2OIG A;  2OIE A;  2Q9L A;  3C90 A;  2P06 A;  4QGP A;  5IE9 A;  2A7W A;  3CRC A;  2Q5Z A;  2A3Q A;  2Q73 A;  1VMG A;  2Q4P A;  1YXB A;  1YVW A; 
#chains in the Genus database with same CATH topology
 2W0F C;  3Q4H B;  4HZ3 A;  1Y74 B;  2OTJ V;  4BIU A;  4X1I A;  4K0K B;  2CUG A;  4DYL A;  2ADQ B;  4DRX B;  3TCU A;  2QWR B;  1GM8 A;  4PJ0 Z;  1KKD A;  3CXH F;  4LFA B;  3K04 A;  5FL7 G;  3RVZ A;  4UV8 A;  3OMN B;  2UUB O;  1JMK C;  2KB1 A;  1M1K W;  4TV8 B;  1IBL O;  3E22 B;  3JAK B;  2Y0I A;  4B3T B;  2JGD A;  1VQ4 V;  4MTF A;  1Q86 W;  5B1B B;  2W6J G;  4LF7 O;  3CS5 A;  4AIL C;  4I55 B;  4BWA A;  2PZS A;  5FNV B;  2FB5 A;  3JAL A;  2LW1 A;  2YI8 A;  5IDJ A;  1HNZ O;  4ZOL B;  1YCI A;  3BRC A;  3DTU B;  2ZT9 B;  5B5E Z;  5JWP A;  4TQF A;  3ZN0 A;  5LA6 B;  5KAF Z;  2E5L B;  5JJE B;  3W7X A;  4JV5 O;  3BPZ A;  1Y76 A;  5GW7 A;  2UUC B;  3UQ8 A;  2UXN A;  2Q7G A;  4DV6 B;  1NT2 B;  4X89 A;  4DV5 O;  1N34 B;  1PV0 A;  1D2D A;  4FMT A;  3E8G A;  1KP2 A;  2RMK B;  4I4T A;  3LUT B;  3J80 N;  2JJ2 G;  1GN6 A;  2XAS A;  1EN6 A;  3SR2 C;  4B3M B;  4LNU A;  4JI0 B;  1K33 A;  4UCO A;  2DN9 A;  2YDE A;  1VF6 C;  2R9A A;  5CA0 A;  4CS4 A;  2QA4 V;  4EKW A;  3SYP A;  1XMO O;  2P5O A;  1RSO A;  1COW G;  3ZHS A;  4DW1 A;  1V55 B;  2FL4 A;  2QKA A;  4DV0 O;  1YJW V;  4PA6 A;  2VWK A;  1JJO A;  2IW5 A;  2PY5 A;  3K79 A;  4MVZ A;  1PPJ H;  5L3C A;  1ZL8 B;  1PD3 A;  3RWR D;  4FPP A;  3SYA A;  4Z1V A;  2A9H A;  2Y69 B;  4LFB B;  1I7F A;  1BZK A;  1ARO P;  4OX9 O;  1WA8 B;  2QTO A;  3LDC A;  4PEL A;  5CMU A;  3OGI B;  4FM0 A;  3CE2 A;  3T1C A;  4DV3 B;  2AHY A;  2CTP A;  1KYO F;  4FFB A;  4MVU A;  1QQC A;  4D6T H;  1URF A;  1ZTE A;  3CCL V;  3AG2 B;  3K57 A;  1OV9 A;  5DED A;  2W0X A;  1NTK H;  2ZE5 A;  2FKX A;  4O4H B;  3TET A;  5IYB O;  2ZM6 O;  1AI6 A;  3H1H H;  2YEV A;  3B40 A;  2HHH B;  2H3O A;  1MSD A;  3EHB B;  2P67 A;  2YIB D;  4DUZ B;  2GV9 A;  4DUY B;  2Y4T A;  5CB4 B;  1LNQ A;  3UM7 A;  4FLX A;  1XI1 A;  2EZO A;  1WN7 A;  1FJG B;  4G2K A;  2BE3 A;  2CGN A;  2XUM A;  1JVM A;  2UXC B;  1G6U A;  4GKJ O;  1WB7 A;  1SS3 A;  3E8F A;  3IFX A;  2DW4 A;  4DV7 O;  4EB6 B;  3CX5 F;  1MA1 A;  4IHJ B;  5LGN A;  3EFF K;  1OCC C;  1MSW D;  2FYU H;  1HNX B;  3H1K H;  1EBO A;  4YJ3 B;  4FLY A;  2FML A;  5GON B;  4JI2 B;  3F7Y C;  1MZF A;  4CH6 A;  5L3G A;  1R3J C;  5LXT A;  2AW9 A;  2QR4 A;  3OM3 B;  3VQV A;  2Q8V A;  5KX5 A;  4YJ2 A;  3OR6 C;  5KHH A;  4FJC C;  5IYZ A;  4N21 A;  4KL1 A;  1G1X B;  3R66 A;  2WAM A;  3ABU A;  4GZR B;  2HVJ C;  3SJA C;  1S72 V;  1NVP B;  5ITZ A;  1NVP D;  3JAT A;  2RNB A;  2GUZ A;  2WLL B;  3JAW B;  5BY1 A;  4WFH A;  3QG5 A;  2MK3 A;  1I0H A;  1TVK A;  2WSS G;  3N2G B;  4X66 B;  2Q0A A;  4ZHQ A;  4JYY A;  4H44 B;  3FD9 A;  5LGT A;  1S77 D;  3HR0 A;  4X1K B;  3CCS V;  1MOF A;  2V1D A;  4FLZ A;  1Q5O A;  4L8J A;  1GAX A;  2ILM A;  4CH5 A;  5EYP B;  4LCU C;  4X62 B;  1Q6H A;  3E83 A;  1K9M W;  3C3T A;  5LGU A;  3CC7 V;  4CS2 A;  5JH7 B;  3LNN A;  4EEQ A;  5IWA O;  3ZHQ A;  3ZHR A;  4ZKI A;  4LF5 O;  1VF7 A;  3UT5 A;  3G67 A;  1UJW B;  5KHG A;  4I50 B;  1B3Q A;  3LSS A;  4NR1 A;  2HFE C;  2Q9L A;  1JCH A;  1YIT V;  1Z5V A;  4MTO A;  5KA6 A;  3K58 A;  3O65 A;  1KB9 F;  3G6B A;  2EIL C;  4XDJ A;  5BMV B;  4TT3 G;  3A0R A;  2UXD O;  2QM4 A;  2N05 A;  4J11 A;  3KZI Z;  2BCC H;  3DXR A;  1V9P A;  3RVY A;  3FFQ A;  4NVP A;  2PTM A;  3ZHV A;  3VQW A;  2EIK C;  2EZP A;  1RFY A;  2IU3 A;  3L75 H;  1YIJ V;  3O9O A;  4ZIB A;  1W0J G;  3GB7 C;  3PJS K;  3UO3 A;  4JYA B;  3RYF A;  1BQ0 A;  3F7V C;  1R1B A;  2F93 B;  1PNK A;  4LWS B;  2YXL A;  4Q20 A;  3ABM C;  1FXK C;  4GCZ A;  4NXM O;  3AEI A;  1DK1 A;  3C90 A;  3OMA B;  1QVF U;  4PA7 A;  3B2E E;  3ZMS A;  3JAM N;  2ZIN A;  5EZY A;  2Z5U A;  1XDC A;  5C8Y B;  2ARH A;  1SQG A;  2R70 A;  5LHH A;  1RP3 B;  1QR8 A;  3H1J H;  2LFR A;  1IBM B;  2AHZ A;  4ABM A;  4DR6 O;  4X1Y B;  2ZXW C;  4UVB A;  5LMN B;  4CC6 A;  2OWO A;  3KKY A;  1SZT A;  3ABT A;  5J2U B;  2ITC C;  4RO2 A;  1IDS A;  4K0K O;  3X2Q C;  1OCC B;  3KCY A;  1Q7Y W;  1K4C C;  1IBK B;  4LFA O;  2DYR C;  4O4L B;  3Q4H A;  1R73 A;  1ZUQ A;  2OTL V;  2WLK A;  3H1L H;  4B3T O;  3ABL C;  4LF6 B;  3CWB H;  1VQL V;  2HVK C;  5IJ0 A;  3E22 A;  4K8X A;  3A8T A;  2P6J A;  2M7W A;  4WBN B;  3I56 V;  5JVD B;  1MAB G;  4FLT A;  4B7K A;  3ZHU A;  5L3F A;  2IH3 C;  4JZG A;  5LBQ A;  4JTC B;  1SQX H;  1GN4 A;  3QO8 A;  2EJR A;  4J80 A;  4RWU A;  1HWY A;  2CH7 A;  3CXC U;  1SQB H;  2QSA A;  3CB2 A;  4TV9 B;  1GN3 A;  3SYC A;  5LOV A;  4DR4 O;  3K9S A;  1XIL A;  5LA6 A;  2UUC O;  3MAQ A;  1G4Y B;  2IBZ H;  1W2B U;  2A7W A;  4DK1 A;  1R3L C;  2Q0O C;  4DV6 O;  4U3J A;  1VQN V;  1ZWI C;  4J42 A;  1N34 O;  4FM2 A;  1S5J A;  2VS0 A;  3JCZ A;  3L9D A;  4TWK A;  4UCV A;  3MDS A;  1PL0 A;  3NR7 A;  1RPO A;  2E74 B;  3OD4 A;  2P06 A;  3JAR B;  5E79 Z;  4JI0 O;  2JGU A;  5IY5 B;  4UUJ C;  3B4S A;  2X6B A;  4K35 A;  1GKF A;  2V7Q G;  2WLH A;  3OTO B;  1FD9 A;  3BEH A;  4LH7 A;  3D36 C;  2HJF C;  4XDL A;  1QNM A;  3L72 H;  4JYC A;  2UXB B;  3K5O A;  1QLE C;  4UB8 Z;  4LFB O;  1IXM A;  2LGW A;  1WNS A;  4JI4 B;  1JQ0 A;  1KBH A;  4DV3 O;  3CCQ V;  3U11 A;  2HKO A;  4CH3 A;  4I9Q A;  1GRJ A;  4IYI A;  1OCR C;  3ZS8 C;  5LP6 A;  2WLI A;  5EIB C;  4QIW F;  2EUL A;  1I08 A;  4PD4 F;  3ZN1 A;  3OFN G;  2IJK A;  4TUY B;  1SQV H;  2ZE7 A;  4WFA V;  1JX9 A;  2DJV A;  4JGS A;  5JCO C;  5FPR A;  1TUB A;  4X65 O;  1I94 B;  4UCS A;  2HHH O;  4ASU G;  1BL8 A;  4I5S A;  5KAI Z;  1SA0 A;  4DUZ O;  4DUY O;  4DR2 B;  3QO7 A;  1FJG O;  1IX9 A;  1FXK B;  4YIO A;  5FPO A;  4KXR A;  1R6N A;  2GBO A;  4KP4 A;  3SYQ A;  4BR6 A;  1SQP H;  3FB7 C;  1BMF G;  2X0L A;  1JA8 A;  1AR1 B;  3CJH A;  1FXH A;  1E79 G;  1T5E A;  1XL4 A;  2Y0P A;  3RGB A;  3OEE G;  2GTA A;  3N27 A;  5KMG B;  1PP9 H;  1VF5 B;  4DV2 B;  1GM7 A;  2A06 H;  4P9P A;  1HNX O;  5EK0 A;  2QM7 A;  4EB6 A;  3RN4 A;  4JZ2 A;  4J41 A;  4JI2 O;  5TIS Z;  3X2Q B;  2YIC A;  4LH6 A;  1AJP A;  4YJ3 A;  4OPA A;  2Y4U A;  4PV1 B;  5IYC O;  1M93 A;  1Q90 D;  4HYO A;  1YDX A;  1KC8 W;  3LDD A;  4O4I B;  2RN9 A;  4R50 A;  4A5U B;  4AHC A;  2LW7 A;  2KG7 A;  3ABL B;  2G38 A;  2OCH A;  3RYI B;  3FKS G;  4O2B A;  2F95 B;  3C3S A;  2R72 A;  2ZCE A;  3CC2 V;  5B1A C;  5J2T B;  2ZIO A;  3HKB B;  3ZRW B;  3JAS B;  5A9G A;  2EIM C;  1AP5 A;  4LF4 B;  3EVK A;  4X66 O;  3MHH C;  4YHH B;  2JK5 C;  1GMG A;  4WFG A;  5DEC A;  2DE0 X;  1FS0 G;  1TGO A;  3DC6 A;  3SJC C;  2F43 G;  3IAY A;  3L70 H;  4X62 O;  2BTQ B;  5EBL C;  2ZDI A;  1KP3 A;  1OJH A;  3STL C;  5BZB A;  4KHP B;  4CZZ A;  4NB5 A;  3IJ4 A;  5EYP A;  1B04 A;  2A0L A;  3RYC B;  2OCC C;  5LL6 Y;  4UCR A;  1LUV A;  4JI5 B;  1YEW A;  3KG2 A;  4FM1 A;  4O2A B;  4EFB A;  3D3Q A;  1K5S A;  2HJD A;  3K0D A;  3G4S V;  3T2M A;  3CCV V;  1VQ5 V;  2IH1 C;  4RQE A;  1AI7 A;  1CXZ B;  1K8A W;  1DF4 A;  3APQ A;  4MVM A;  3CCE V;  4E4E A;  2P22 C;  4H33 A;  2OYQ A;  1QLE B;  4X64 B;  4J10 A;  2QJ1 A;  4U3F H;  4OPH A;  4DXW A;  1QCE A;  2Q69 A;  3E2E A;  4DR3 B;  3K59 A;  1BHA A;  3CHX A;  1HR0 B;  4R7C A;  2P4K A;  4LF8 B;  3SYO A;  2QWQ B;  3IC7 A;  4B3R B;  2CDY A;  1OCR B;  2CGO A;  5IYD O;  3W7S A;  1SES A;  2Q5Z A;  2UUA O;  4IL6 Z;  2F66 C;  5DM6 V;  4X20 B;  5CA1 A;  3SJQ C;  3STZ C;  5JQG A;  5EC2 C;  3CD6 V;  4JYA O;  1Q3E A;  3B8N A;  2Z0A A;  3VQX A;  1QLN A;  1AR4 A;  2QEX V;  1W59 A;  3S3W A;  4ZI7 B;  1WLE A;  4JI8 B;  4UVC A;  1DLB A;  3F5T A;  3AK2 A;  3FB5 C;  3JD3 A;  1N36 B;  4QE9 A;  3K0G A;  2HG5 C;  1RM1 B;  1M4U A;  3L73 H;  1IBM O;  5JJN B;  4DR7 B;  4X1I B;  4R8C A;  4FK5 C;  5LMN O;  4DR5 O;  3GVM A;  3T4D A;  3I55 V;  4DV1 O;  4IGG A;  1DF5 A;  2GSM B;  2GTS A;  1FFX A;  5L3B A;  4PA3 A;  2Q6A A;  2JGD B;  2P90 A;  1MNG A;  1R3I C;  1SQF A;  1XL6 A;  1FAF A;  4FVM A;  1ENV A;  2WA4 A;  1S5L Z;  4RUE A;  5IJ9 A;  4MVQ A;  2WPD G;  1R3K C;  2IJI A;  4LF6 O;  3I5D A;  4JAU A;  3BAB A;  4PDL A;  2WWW A;  3JAL B;  1CP9 A;  1AJN A;  2X7R B;  3SPH A;  5GTI Z;  3T1Y B;  1R6T A;  2L35 A;  4MVS A;  3HB3 B;  2B1G A;  1LUW A;  2ZIM A;  1CPY A;  2ZQM A;  2DMX A;  4GX5 A;  4QPJ A;  2LQT A;  1Y76 B;  1IXB A;  5B1A B;  2Q68 A;  4KFM A;  3K5M A;  1K97 A;  2EIM B;  2ZNJ A;  3JD2 A;  4F6R A;  2PGG A;  2EX3 A;  4RAI A;  4MS2 A;  2IU0 A;  2UU9 O;  3CPW U;  3K3W A;  1JFF A;  1S3J A;  1M90 W;  4I0X B;  4LNU B;  3SGI A;  2K9P A;  5CA0 B;  3P3P A;  2R9R B;  1P49 A;  1Z5W A;  3FYE B;  4FFK A;  2OCC B;  3JAR A;  3K5N A;  3OTO O;  3OW2 U;  3OAA G;  1NU1 H;  4ZBM A;  3ASN C;  3W7U A;  2QWO B;  4AI8 A;  1NTZ H;  2UXB O;  1BGY H;  2OT5 A;  3QF7 A;  4C7U A;  1XMQ B;  4JI4 O;  2P7T C;  4F4L A;  2PI4 A;  2JJ1 G;  1FYJ A;  3RYH A;  4FFB B;  5K1P A;  2NR5 A;  1KQS U;  4LR3 A;  3HKC A;  2BTO A;  1N0J A;  3FB6 C;  2D3O W;  4YY3 B;  3UCS C;  1NJI W;  2F4V B;  2DOS A;  4DW0 A;  1KU9 A;  3CRR A;  1EZV H;  2JRI A;  3HKE B;  5EBM C;  2YEV B;  4X9Q A;  1TA8 A;  3AG1 C;  2YXH A;  2AXT Z;  5CBF A;  3FAV A;  4LBE C;  3QVN A;  4QE7 A;  3CRQ A;  3DSQ A;  3AK1 A;  4IIJ A;  3WB2 A;  1I94 O;  4QNH B;  4JAA A;  1IZ3 A;  1E1R G;  4J7Z A;  1OCZ C;  2CK3 G;  2ITD C;  4UFZ A;  3UO2 A;  1ZLZ A;  4IT5 A;  3N2K A;  4DR2 O;  4PHZ A;  2O57 A;  2LGQ A;  4HNA A;  3BFR A;  1Y66 A;  1PKX A;  4DR1 B;  1Z2G A;  4H0L B;  1XEQ A;  1F4M A;  1L1F A;  4GKJ B;  3B8M A;  1GN2 A;  5KHI A;  5H9C A;  5IE9 A;  2H8P C;  4MSW C;  1F4N A;  2DWD C;  3ML0 A;  1O9G A;  2CE4 A;  5LHI A;  1UFI A;  5H6Q A;  4DV2 O;  1Y74 A;  4QPK A;  1WPB A;  2N74 A;  3H1I H;  1NH2 B;  2X6A A;  4DRX A;  5LXT B;  1NH2 D;  4YJ2 B;  5KX5 B;  5LMU B;  1JJ2 U;  1NKD A;  4JAV A;  5AG2 A;  1EM1 A;  3OUS A;  2VQF B;  3BCC H;  1YTF B;  1XHX A;  4TV8 A;  1YTF D;  1D5N A;  5IYZ B;  3JAK A;  3ZJZ A;  3ZIA G;  3JSN A;  1NBM G;  3ZMU A;  1KEC A;  5B1B C;  1VQ9 V;  1VQK V;  2VQE B;  5F2V O;  4DK0 A;  4WFB V;  4UB6 Z;  3WG7 C;  1DTO A;  1YF2 A;  3FYI B;  1THZ A;  5ITZ B;  4I55 A;  3JAT B;  3CMA V;  2GUZ B;  2E5L O;  5FNV A;  2XHB A;  1EN4 A;  1SKV A;  1TUE B;  4W4L A;  5CBG A;  3G6E V;  2RJZ A;  4ZOL A;  5DN6 G;  1TVK B;  1H2M A;  3RFR A;  4BW9 A;  4ZHQ B;  1WP7 A;  3AG3 C;  4LF4 O;  2ZE6 A;  1ROP A;  1FKA O;  1W0K G;  1F23 A;  5H6R A;  3ZMT A;  4YHH O;  1NR1 A;  3JAS A;  5H2F Z;  4DR6 B;  4JYB A;  3RW0 A;  3T4Z A;  3H9V A;  2XOK G;  1U96 A;  3GWK C;  1VQP V;  4LP8 A;  4GX0 A;  1XBL A;  5E1A C;  4B3M O;  1OHH G;  4KUM A;  4WFE A;  2KQX A;  4KHP O;  2W6I G;  2JS5 A;  1EFR G;  3K5L A;  5IWA B;  3UT5 B;  2QKS A;  4Z1M G;  1V55 C;  4JI5 O;  4OXS A;  1SZX A;  1NZ6 A;  1HNW B;  1AR5 A;  3MD0 A;  3TGU H;  2JS3 A;  4TQD A;  1XUQ A;  2YSU B;  1ZL8 A;  4O2A A;  2CAZ C;  3B77 A;  3W7W A;  1Q43 A;  4X64 O;  2GDS A;  1SER A;  5L3E A;  3TJT A;  1WA8 A;  5B1O A;  1BQZ A;  2EIL B;  5LP6 C;  3ZRX A;  1XNQ B;  2XTA A;  3DXR B;  3ASO C;  4DR3 O;  2VWJ A;  1VIB A;  1F51 A;  1N0N A;  3B09 A;  1HR0 O;  2C2A A;  4LF8 O;  2XAQ A;  2QDO A;  3OUF A;  4ICG A;  2EIK B;  4I9W A;  3T1H B;  2RDC A;  2AZ2 A;  1RPR A;  1D5A A;  2N04 A;  1F7Y A;  1K5Q A;  3QNE A;  2E75 B;  4O4H A;  1X4T A;  5KUM A;  3AG1 B;  4D7S A;  4F6E A;  3ZCC A;  4RQF A;  3ABM B;  1GK9 A;  3H01 A;  3OR7 C;  1M57 C;  2YIB A;  2Q4P A;  1YJ9 V;  1VAR A;  2UXC O;  1WPX A;  4O4J B;  1OCZ B;  4JI8 O;  4NTW A;  4WCE V;  5CB4 A;  1N33 B;  3ETE A;  5EZY B;  3OTF A;  1Q6I A;  1ZX3 A;  3TK1 A;  3VQY A;  1N36 O;  3OGC C;  2OIE A;  4JI6 B;  4AQY B;  3M99 B;  4P2Z A;  4JI3 B;  4NYK A;  3SDL A;  4UV9 A;  3GWO A;  2PUS A;  3ZMV A;  5B66 Z;  3TXQ A;  1S5H C;  4DR7 O;  2X6C A;  2ZXW B;  4IHJ A;  4JTA B;  1H2L A;  4B08 A;  4E2L A;  3E8B A;  4UVA A;  5B1N A;  4DO2 A;  1L8D A;  3CP1 A;  2AGA A;  4LF9 B;  2F23 A;  2DYR B;  2B9Z A;  1H8E G;  4GX1 A;  5GON A;  3ZRV A;  1YI2 V;  2PI5 A;  3ZED A;  2JDI G;  1QR9 A;  5IJ0 B;  5KA5 A;  3KCX A;  1R6K A;  3JD0 A;  3IC9 A;  5KHK A;  1YXB A;  4Q6G A;  4GKK B;  5EBW C;  2B5U A;  2K1E A;  1N32 B;  2YID A;  3ETD A;  1VQ8 V;  3T1Y O;  1J5E B;  2NNU A;  4XDK A;  5GTH Z;  3WG7 B;  2WA3 A;  2CTR A;  2MW2 B;  3OMI B;  1Y6X A;  2D2C B;  1IVS A;  2ZR2 A;  4B3S B;  3UKM A;  2H94 A;  2CH7 B;  3K08 A;  4HBN A;  2JVD A;  2WLL A;  3JAW A;  4I7Z B;  5LOV B;  4FLW A;  2JIZ G;  4LFC B;  1DGS A;  4JTD B;  3RT3 C;  3BHP A;  3CCM V;  5CA3 A;  3CSX A;  3N2G A;  3AG4 C;  4U3J B;  1VQ7 V;  3AG3 B;  4DR4 B;  1YSC A;  4GLX A;  4JI1 B;  4NKG B;  2ZDI C;  4X1K A;  4D7T A;  3A0H Z;  3TXS A;  3E89 A;  4NXN B;  2XAG A;  1FFT B;  1TAE A;  5B3S C;  1NI8 A;  2XND G;  1H2S B;  5JH7 A;  3R65 A;  2QWN B;  4I0X A;  3W7T A;  4MTG A;  1XNR B;  4R6Z A;  4JI7 B;  4J7K A;  2DQ3 A;  1VF6 A;  5BR8 B;  1K73 W;  5K1X A;  1H8H G;  4FZ0 A;  3M7M X;  5BXZ A;  1QHT A;  2YIA A;  4I50 A;  1E1Q G;  2EIN C;  1YJN V;  3SPJ A;  1QVG U;  1WAZ A;  2BSK B;  3ZBH A;  2NN4 A;  1XMQ O;  3CYO A;  1M56 C;  3U10 A;  2QWP B;  1JR9 A;  3CME V;  3HPL C;  5BMV A;  2ZE8 A;  1SQQ H;  5LP6 B;  4QJF B;  2WLI B;  4CBC A;  3HKD B;  5A2Q N;  5KHJ A;  2BOC C;  3FB8 C;  3ASO B;  2P4V A;  4UXN A;  2PF4 E;  1HDJ A;  3A2F A;  4YY3 O;  4NTY A;  5EIB D;  2F4V O;  3K9A A;  3D3I A;  1NTM H;  2Z3Y A;  1P7G A;  3CCJ V;  1TUB B;  2XAH A;  4BIO A;  4DV4 B;  1Q8I A;  1SA0 B;  3HKE A;  3THO A;  3SPG A;  2A3Q A;  2Q73 A;  4X65 B;  3BAA A;  4LWS A;  1SET A;  1MG1 A;  4UCU A;  1JOY A;  5J9P C;  3S3X A;  3APO A;  4U7N A;  4GX2 A;  3SJB C;  1M57 B;  1N4C A;  5LYJ B;  1VQO V;  1Q81 W;  3MHS C;  4DR1 O;  3CJH B;  5H5N A;  4JF3 A;  3PN1 A;  2E76 B;  3QO5 A;  2HR3 A;  2ZNI A;  3F5W C;  5C8Y A;  1KKC A;  1K92 A;  3CC4 V;  4PI0 A;  2F1M A;  1IBK O;  1L0L H;  4X1Y A;  5J2U A;  1O9H A;  2UUB B;  5HFL A;  3JCU Z;  2EBO A;  1AP6 A;  1IBL B;  2AZ0 A;  5LMU O;  2XT9 A;  4O4L A;  1SC5 B;  3L71 H;  1VQM V;  2VQF O;  3CEI A;  4K3A A;  2QTS A;  2RCV A;  4YXW G;  2DYS C;  1KD1 W;  1WB8 A;  3SPI A;  2KG7 B;  1K34 A;  2PYJ A;  4LF7 B;  4MW3 A;  1H2K A;  4L87 A;  3P32 A;  4O2B B;  2YS8 A;  5HFM A;  2VQE O;  1ZAU A;  5FLX N;  3WFV A;  3ABK C;  1HNZ B;  4MW8 A;  2A79 B;  1V54 C;  1K7D A;  4WBN A;  5JVD A;  4HAM A;  5IT9 N;  3ZMZ A;  2ZD9 A;  4JV5 B;  2ZR3 A;  2EIJ C;  1FPO A;  1PM9 A;  3AG7 A;  3JD1 A;  3NXS A;  4TV9 A;  3JYC A;  4I4T B;  3J7A U;  4DV5 B;  4JPR A;  1H2N A;  3AG4 B;  3OE7 G;  1S0V A;  4IYH A;  2XAJ A;  1Y67 A;  2HLD G;  3CRC A;  1PNL A;  1JPX A;  1VMG A;  4FZ1 A;  1RSO B;  1OCO C;  4MTX A;  2ZKO A;  1J95 A;  4NTX A;  3DC5 A;  3LSQ A;  4X88 A;  1YVW A;  3QTC A;  4B7E A;  3ZRS A;  3CRA A;  5IY5 C;  1LR1 A;  3JSL A;  4LC1 A;  5D5P A;  5B3S B;  1XMO B;  4XBF A;  1BS3 A;  4CS3 A;  2OIG A;  2QM8 A;  4DV0 B;  2LJ2 A;  1KMI Z;  3WB0 A;  2RQ6 A;  1VEW A;  4MVR A;  1HNW O;  1G8M A;  5C93 A;  2BOB C;  2ODM A;  2CTQ A;  2ADP A;  3BVO A;  4MVO A;  4P9O A;  4OX9 B;  4J9Y B;  4MT8 A;  1I5X A;  2EIN B;  1NR7 A;  4J7J A;  3ETQ A;  1XOU A;  1XNQ O;  1M56 B;  3VBB A;  1HW7 A;  1MZE A;  1SRY A;  5EC1 C;  1GO3 F;  4CH4 A;  4G27 B;  2YC0 A;  3OEH G;  3T1H O;  2QGN A;  1XHZ A;  4Z2W A;  4U7O A;  4PI2 A;  1ORQ C;  5CA1 B;  1S76 D;  3JD4 A;  1QBZ A;  1ZSP A;  1WP8 A;  5JQG B;  1P84 F;  2UUA B;  4BAY A;  4TUY A;  1VQ6 V;  2DWE C;  3IGA C;  2ZM6 B;  4K8Z A;  2JEX A;  2GHY A;  5KLV H;  3K06 A;  4WF9 V;  3ICX A;  3L74 H;  5D5Q A;  3ZX6 A;  2CTW A;  3FX7 A;  3E86 A;  1P7B A;  2HEP A;  2YUA A;  4J9Z B;  4PDM A;  1AIL A;  3SPC A;  1N33 O;  1FXK A;  4QGP A;  5KUK A;  4O4J A;  1YZB A;  1PL4 A;  5JJJ B;  2IJH A;  3ZHT A;  2EJ7 A;  4DV7 B;  4AQY O;  4JI6 O;  1NS1 A;  3EXA A;  4JI3 O;  2VRZ A;  3VOU A;  3WB1 A;  3LSU A;  5KMG A;  1P4R A;  3OT7 A;  3ETG A;  4TSF G;  4FLV A;  1FFX B;  4DR5 B;  2LP7 A;  2E3C A;  3LNM B;  4LF9 O;  1I5Y A;  1N8R W;  4DV1 B;  4H37 A;  2B1I A;  3J81 N;  5IJ9 B;  4FIP C;  2L6L A;  2QKC A;  1BE3 H;  4JAS A;  1SF9 A;  3CCU V;  2WLJ A;  3BY6 A;  2DYS B;  2Q7H A;  3A0B Z;  1H38 A;  1EN5 A;  3G71 V;  4GKK O;  4O4I A;  1QU7 A;  1N32 O;  3CRM A;  1XRE A;  1K4D C;  3RYI A;  2YXY A;  1J5E O;  2IM9 A;  4W4K A;  1BSM A;  3ABK B;  3BA9 A;  3E8H A;  1BT8 A;  4B3S O;  1V54 B;  5J2T A;  3HKB A;  3ZRW A;  1AVM A;  2Q67 A;  1X59 A;  4LFC O;  1VP7 A;  2DQ0 A;  4F6R B;  3M8A A;  2EIJ B;  1AB3 A;  1M5I A;  1M9N A;  4PDV A;  2KSD A;  4JI1 O;  1JFF B;  4G28 B;  1A32 A;  1CEZ A;  2IJJ A;  4NXN O;  2UU9 B;  4CC5 A;  3RBZ A;  2JEU A;  4OGQ B;  2BTQ A;  2NLJ C;  1AI4 A;  1OCO B;  2LO1 A;  2V4D A;  4LF5 B;  1MMM A;  4EFE A;  2R9I A;  5CN0 A;  3WU2 Z;  1PNM A;  2Y48 A;  3RYC A;  1XNR O;  1L0N H;  1GH6 A;  4JI7 O;  4P30 A;  3K03 A;  2WLN A;  1GTO A;  5BR8 O;  2HP8 A;  2Y69 C;  3E35 A;  1BCC H;  3D8C A;  1Q82 W;  3ASN B;  4TOI A;  5CBH A;  3G80 A;  1EZJ A;  3CCR V;  2QE7 G;  4RUF A;  1US6 A;  4PA9 A;  1UPG A;  3D36 A;  2ETN A;  1AJQ A;  1XQ8 A;  1BHB A;  1WJZ A;  3RYH B;  4BW5 A;  1NQT A;  1KUQ A;  2UXD B;  5L3D A;  3HKC B;  2BSK A;  2KKW A;  4WFF A;  4B3R O;  4PA4 A;  3AG2 C;  1U97 A;  1HP8 A;  3LDE A;  3P30 A;  4PDR A;  2LFS A;  2WLM A;  1B6Q A;  3RYF B;  1OZ0 A;  3HKD A;  4FLU A;  1B06 A;  5LHG A;  2XAF A;  1IUR A;  3P3N A;  3FAV B;  2PYL A;  4GT1 A;  2FTK A;  4IIJ B;  3DGE A;  4N23 A;  4X20 A;  2Q7E A;  4DV4 O;  2UXX A;  3BA8 A;  4GUN A;  2YI9 A;  1GM9 A;  1H2G A;  3N2K B;  4NXM B;  1FXV A;  5JCO A;  4HNA B;  4BIZ A;  4ZI7 A;  3AK3 A;  3U0Z A;  1Q6U A;  4X8A A;  2M6Y A;  4YIP A;  4H13 B;  4GYC B;  1Y4M A;  1AI5 A;  2ATK C;  5LYJ A;  1RM1 C;  1K3E A;  4UCT A;  1YHQ V; 
#chains in the Genus database with same CATH homology
 3CRA A;  2YXH A;  2GTA A;  1Y6X A;  2OIG A;  2OIE A;  2Q9L A;  3C90 A;  2P06 A;  4QGP A;  5IE9 A;  2A7W A;  3CRC A;  2Q5Z A;  2A3Q A;  2Q73 A;  1VMG A;  2Q4P A;  1YXB A;  1YVW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...