2P06A

Crystal structure of a predicted coding region af_0060 from archaeoglobus fulgidus dsm 4304
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
84
structure length
84
Chain Sequence
MDYFRLAEKFLREMHAKYMKRVSRPGNTPRPWFDFSEERLLSRLFEEMDELREAVEKEDWENLRDELLDVANFCMYLWGKLSVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein AF_0060
publication title Crystal structure of a predicted coding region AF_0060 from Archaeoglobus fulgidus DSM 4304
rcsb
source organism Archaeoglobus fulgidus dsm 4304
molecule tags Structural genomics, unknown function
total genus 28
structure length 84
sequence length 84
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03819 MazG MazG nucleotide pyrophosphohydrolase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1080 Mainly Alpha Orthogonal Bundle Helix Hairpins MazG-like 2p06A00
2OIGA 1YVWA 2YXHA 4QGPA 2A7WA 3CRCA 2Q73A 3CRAA 2OIEA 2P06A 2Q4PA 5IE9A 2GTAA 1Y6XA 1YXBA 1VMGA 2A3QA 3C90A 2Q5ZA 2Q9LA
chains in the Genus database with same CATH superfamily
3JSNA 5IYBO 3ZEDA 4MVUA 1M4UA 4J10A 4BR6A 1YEWA 2HEPA 4H0LB 1SQFA 4QE9A 3R66A 5CA0A 4JI2O 5JH7A 1QR8A 2OWOA 1BT8A 1KYOF 4TV9B 3HPLC 1EM1A 1PP9H 1H2NA 2E5LB 1MMMA 2UXNA 2EINB 4DV0O 2P4VA 4DUYO 3RFRA 1FD9A 4K35A 5IJ9A 1H2SB 4UXNA 1RP3B 3E86A 1Q82W 1YJ9V 4GKKO 3TXSA 1NTKH 5KHJA 2GBOA 3FB8C 2YEVA 2ZXWC 1WPBA 2OIEA 3ZJZA 2IJJA 1TGOA 5J2TB 1RSOA 2A3QA 3AK3A 4K0KB 2Q7EA 4O4LA 1K33A 4XDJA 5DM6V 1FYJA 4FLTA 1SQGA 3B40A 1N4CA 3VQYA 1YVWA 3AG4C 3BABA 4LP8A 1TUBA 2CGOA 1XNRB 2IH1C 1N8RW 5B1BC 1H2KA 3CRRA 3B09A 4NB5A 2UUCO 1ROPA 1Z5WA 2F1MA 1NS1A 5JJNB 1IBLB 4P2ZA 4YJ2A 1VF7A 2RNBA 1Y74B 4Z2WA 4IYIA 4UV9A 1KC8W 2CK3G 4YIPA 4J7KA 1XMQB 5CMUA 4OX9O 4PDLA 1ZSPA 1L0LH 1PD3A 4TUYB 2L6LA 2IJIA 3K79A 3E8BA 2UXDB 1L1FA 2ZINA 5CA1A 1OCRB 2H8PC 3SYQA 1K5QA 1UFIA 4FLWA 3OMIB 3ZS8C 4X8AA 5AG2A 1YJNV 4JI7B 4WFHA 4YHHB 4JZ2A 4UCSA 2PYLA 2QWOB 5LL6Y 1HNWB 1HWYA 3SPIA 4DV4B 4DK1A 3N2KB 4LF6B 3F7VC 3K3WA 5BMVA 3EFFK 2R70A 2CDYA 2H94A 2NN4A 2DQ0A 2XAJA 4W4LA 2QM7A 4LF8B 3MHHC 5KHIA 2Q68A 1R6KA 3P32A 2ZM6B 2D2CB 4O2AB 2IBZH 4B08A 1M93A 2QE7G 3CSXA 4U3JA 4JI6B 5LGNA 1FPOA 1PNMA 1XL4A 4K0KO 1SQPH 3HKDA 3UO2A 3ZBHA 1K73W 1HNZB 2EILB 3K5OA 3AG3B 4I0XB 4FLVA 4FLUA 4DV6O 1VF5B 4O4HB 3WU2Z 1FXVA 2OTJV 3CXCU 4J80A 1BZKA 4FM2A 5EZYA 5IWAO 1YHQV 4EB6B 4JI8B 1XMOO 1MG1A 3HKCB 2QDOA 1YSCA 3E8FA 1JMKC 2B9ZA 1MOFA 3PN1A 3UKMA 3NXSA 3CCEV 2VQFO 1YCIA 3ASNB 3AG1B 3JAWB 3ABTA 1AROP 4JYBA 4DR3B 3RYHA 5A2QN 5BZBA 1KU9A 3UT5B 3CS5A 5HFMA 1XMQO 1YTFB 4K8ZA 3CE2A 2X6CA 2BOBC 4CH3A 2UXDO 5BR8O 1RM1B 1IXMA 1IBKO 1NJIW 5B1NA 3DTUB 2QA4V 1S77D 3H1IH 3R65A 4JI7O 3H1HH 2YIDA 4YHHO 1PKXA 2YUAA 4JZGA 2PZSA 1EN5A 2WLHA 4QNHB 4ASUG 2WLIA 2P90A 4B3RB 1ZWIC 4DV1O 2FL4A 5L3FA 4LNUB 4DV4O 5CA3A 3E22A 3ZHTA 5EBMC 2EINC 2C2AA 3CCRV 4JI4O 3W7UA 2DYRB 3CXHF 1DK1A 5KAFZ 1W2BU 1AI5A 3JD2A 3J7AU 3OT7A 4CH4A 5LMNB 2XAHA 2Q8VA 5JWPA 3CCLV 4JI6O 5BY1A 4WF9V 2JIZG 2Q69A 1OHHG 3QF7A 2PY5A 1SETA 3BHPA 4HZ3A 3L74H 3M8AA 4RQFA 4D7SA 1JJOA 3G6BA 4IHJA 1KQSU 4J41A 1M5IA 2W6JG 4X62B 2QGNA 1VQNV 2WLNA 4CS3A 2ZR3A 1H38A 2YXYA 3BCCH 3U10A 3RYCA 2X6AA 2A0LA 2A7WA 5EYPA 4JI8O 5LXTB 1P4RA 2OCCB 3CC4V 2E3CA 5J2UB 1EBOA 1E79G 5KHGA 4EFBA 5KX5B 4X20B 1XHZA 1AJPA 3WG7B 2HG5C 2ETNA 4DR7B 2YI9A 4JYYA 2Q7HA 3F5TA 3DC6A 1GN2A 3THOA 1BSMA 4QGPA 2WLMA 3CCQV 3ZRVA 1R3JC 3C3SA 2ZKOA 3MD0A 3SR2C 4TV8B 1V55B 3D3IA 1X4TA 1GM9A 1OCRC 3QO7A 5L3BA 1Q5OA 4IIJA 2CTPA 3KG2A 2EJRA 2LGQA 2QWRB 1BCCH 4I55B 3RYFA 5LHHA 3SPCA 1N0NA 2DW4A 4UVAA 2EX3A 3CCUV 2GUZB 2OTLV 1MABG 4F6RA 1TAEA 4PA3A 1Z5VA 1R3LC 2KG7A 3LSUA 2P06A 4TT3G 5BXZA 2Y48A 5IT9N 3T1HB 3QNEA 2WA3A 5H9CA 1BQZA 1G8MA 5DN6G 4AI8A 3O9OA 2QEXV 4DR6B 2ZCEA 2BSKA 2XAGA 1KP3A 1QR9A 3T4ZA 2VQEO 3K03A 1QQCA 2ITCC 4DR2B 3A0RA 1K4CC 4FLXA 3JASA 2EILC 2F66C 1WAZA 1HNXB 2X6BA 1VQMV 3AG3C 3CCMV 3K0GA 1K92A 2CGNA 1QHTA 1H2GA 4I9QA 2R9RB 1B6QA 4UVCA 3RYIA 1TA8A 1BHBA 3RT3C 2UXBO 2QWNB 4ZOLA 2LJ2A 1FS0G 4BWAA 1LNQA 4D6TH 4DR4B 4LH6A 5F2VO 1Q90D 3AG1C 3ASNC 3WB1A 3IC7A 4DV7O 2F4VB 1Y76B 3ZX6A 2A9HA 4NXMB 4HNAB 1AP5A 2JGDB 2F93B 4MSWC 4FMTA 5DEDA 4PDVA 4RWUA 1R6NA 3S3WA 4JI1B 5KMGB 4U3FH 2Q67A 1FXKA 1RM1C 4CZZA 3K08A 4OGQB 4IGGA 3X2QB 3FKSG 4JI2B 3ZMSA 1FFXB 1FJGO 1XNQO 5LA6A 4LH7A 3B77A 3CCVV 4OPAA 3K57A 2K9PA 2VRZA 4DV0B 1KMIZ 3FB6C 4X64B 5EBLC 2Q0OC 3T1CA 3ASOB 2ZR2A 3H01A 4GKKB 1SQBH 4NVPA 2DYRC 4I50A 1IBMO 4RAIA 2F95B 4JI0O 3STLC 4MW8A 1N0JA 4DR6O 1SA0B 2ZIMA 4HBNA 4DRXA 4X88A 1OCOC 2B1GA 4RUFA 1H8HG 4JTAB 5JVDA 2Z0AA 1DLBA 3QO5A 4LF9B 5H2FZ 1HNXO 3BY6A 4IYHA 5JCOA 1Q6HA 1JJ2U 4X1KA 1QLEC 3UQ8A 2CTQA 5IYZA 2IU3A 4MVMA 5J9PC 1NTMH 2UUCB 1U96A 1TUEB 4FZ0A 4RQEA 2NNUA 3EXAA 1RPRA 5FPOA 1K34A 1W0KG 1YTFD 5FPRA 4JTDB 3AG2C 5LOVA 4DR4O 2YXLA 3H9VA 3RVYA 1OCZB 2DMXA 3WG7C 2R9AA 1CXZB 2FKXA 3CEIA 1N34O 2F4VO 2XT9A 5TISZ 3G6EV 1M1KW 4MVQA 4E2LA 2E74B 4MT8A 4MW3A 4WFBV 2YDEA 2UU9B 4CH6A 2ZDIC 3N2GB 4JI1O 3WB2A 1ZL8A 1V55C 1YIJV 2Q7GA 2ZE6A 5LYJB 1WN7A 1YF2A 2N74A 4WBNB 4ICGA 1QVGU 4XDKA 4C7UA 3LDDA 2GTAA 5L3EA 4LF7B 2CH7B 1S5LZ 5LHIA 4UVBA 1GN4A 4PI2A 3JALB 3BAAA 4O4IB 1NVPB 1SERA 1NH2D 1I0HA 2LGWA 2LO1A 2WLLB 4O4JB 1XEQA 3OEHG 1SZTA 5H6RA 4X64O 1O9HA 5CB4A 4JI3B 4P9PA 4LCUC 1TVKA 4UV8A 1PPJH 1JQ0A 3SDLA 2ZD9A 3LSQA 2WPDG 4YIOA 2XTAA 4FZ1A 4X1IB 1H8EG 3K59A 2RMKB 2W0XA 2JEUA 3ABMB 3ZRSA 3SJCC 4LF9O 2WWWA 4DV6B 4DUZO 3E8HA 1H2MA 3DXRA 2JDIG 5EIBC 4ZHQB 1GMGA 5EBWC 1M90W 2MW2B 2BTQA 4Q20A 5KA6A 3FYEB 1DF4A 1AJNA 5IWAB 5IYDO 1GRJA 3G80A 3ML0A 2UUAO 1Y66A 1XMOB 3ZMVA 2NR5A 2VS0A 4I5SA 3JARB 3ETEA 4O2BA 2GDSA 2VQFB 2O57A 1VP7A 3I56V 1JVMA 2JS5A 1EZJA 5H6QA 1B04A 4W4KA 2ITDC 2UXCB 3I55V 1VARA 4LF4O 1OJHA 2LFRA 1I5XA 3RW0A 4QE7A 3Q4HA 1VQ6V 3CJHB 1J95A 2UU9O 5BR8B 3CRQA 2EZOA 3E35A 4IT5A 1NKDA 3VOUA 1IBKB 2V7QG 2CTWA 3FYIB 4I4TB 5LP6B 3GVMA 1M56B 3N27A 1IX9A 4LFBO 4GT1A 3W7WA 4PA6A 3X2QC 4DV1B 3U0ZA 3TK1A 1R3IC 4LF7O 2QM8A 1JFFA 3IFXA 3CC2V 1ZUQA 4CC6A 3ABLB 3GB7C 4JI4B 4BIOA 1BGYH 4JI3O 1IXBA 5IE9A 2IH3C 2P7TC 2JJ1G 5CA0B 5JH7B 2XUMA 1WA8A 5EIBD 4DV3O 2WLKA 4KUMA 3SPHA 2R72A 3C3TA 1PNKA 2RCVA 3MAQA 2M6YA 2JJ2G 1W59A 3SGIA 5IJ9B 5KLVH 4B7KA 1QU7A 2AGAA 1L8DA 4EKWA 3B8MA 2ZIOA 4RUEA 4DR1B 1SQQH 2YEVB 4UCUA 2FMLA 2EULA 4ZBMA 3E83A 1D5NA 3OAAG 2B1IA 5IJ0A 1RSOB 2RN9A 4K8XA 3LDCA 2QWPB 3JSLA 4O4LB 5JJJB 1WNSA 2PGGA 5LGTA 3ZCCA 1BL8A 2H3OA 4PDMA 3OMNB 4EFEA 3OR6C 1PM9A 1TUBB 3DGEA 4FVMA 3TGUH 2DWEC 2P4KA 1GTOA 1WLEA 3JD1A 2UXCO 3ZHRA 1Q86W 1HP8A 1RFYA 5KHKA 3CD6V 4YJ2B 2KSDA 3D36C 3SYOA 3OM3B 1Y67A 3CX5F 3K06A 4H37A 1WJZA 1Q8IA 1NU1H 4FFBA 2F23A 4FM0A 3P3PA 4MVZA 3L72H 2AXTZ 1MSDA 2ZE5A 1AR4A 4FFKA 5CBGA 4FPPA 5CA1B 4KFMA 3CRCA 4X9QA 3JATA 3L9DA 1N32O 5C93A 3OMAB 1KKDA 4YY3B 3OTOB 3BPZA 4NTXA 1AI6A 1SRYA 3FAVA 4ZKIA 1S5JA 1GK9A 3JD4A 1KBHA 1Y4MA 2HJDA 4JAVA 4X1YA 1G4YB 4ZI7A 1VQKV 3AK1A 1ENVA 3HB3B 3FX7A 2KKWA 1R73A 2VQEB 4L8JA 5BMVB 3QG5A 4D7TA 3SPGA 2YICA 2HKOA 4MVRA 2QJ1A 3HKBA 4PI0A 2IJKA 1K4DC 1J5EO 4DR1O 4DO2A 1EZVH 1BE3H 1PL4A 3S3XA 1G1XB 1SKVA 3GWOA 4GUNA 4FLZA 4X65O 2NLJC 4U3JB 3OGIB 3GWKC 4FJCC 3WFVA 4DV2O 2YXHA 1SZXA 2XOKG 2HP8A 3HKDB 4J9YB 1DTOA 5B66Z 1E1QG 2R9IA 2UXBB 2JS3A 1LR1A 3E8GA 1F7YA 2EIJB 4LR3A 3EHBB 4R50A 1O9GA 2Y69B 3RGBA 4QJFB 1VQ8V 3FB7C 4CC5A 1NT2B 4DV7B 1NI8A 1AI4A 5EZYB 2B5UA 2JGUA 3H1LH 2XASA 4YJ3A 3L70H 3G67A 2A79B 3ICXA 1Q6IA 3E89A 1KUQA 4PHZA 2N05A 3JAKA 3A0BZ 2DE0X 1NVPD 1R6TA 4IL6Z 5EC2C 2IJHA 4UCOA 3RYHB 2FYUH 4NTWA 4KHPO 2QR4A 2Q9LA 1BS3A 1Q6UA 1M56C 3M99B 4HAMA 1FJGB 2PI4A 1XNQB 3FD9A 5JQGA 5LHGA 4EEQA 3VQXA 1XL6A 1ZTEA 4FIPC 4X89A 2CUGA 2OYQA 1SQXH 4BAYA 5C8YA 2QWQB 3ABLC 2ODMA 4YY3O 1M57B 3OTOO 1KKCA 4LWSA 1OCCB 5DECA 1IBMB 4JF3A 1N36B 1MZFA 1MNGA 4JI0B 5L3GA 1UPGA 2WLIB 5FNVA 4B3TO 3E22B 2Z5UA 3HKEA 1AR1B 1I08A 3K5NA 3U11A 4JYAB 4R6ZA 1URFA 5LBQA 2JEXA 5CBHA 1IDSA 2M7WA 3J81N 3DC5A 4WFEA 3JCZA 2XAQA 4DV5B 1JPXA 1YJWV 1PL0A 3LDEA 1D5AA 2WA4A 1R1BA 1F23A 4IHJB 3RBZA 4WFAV 5H5NA 1SC5B 4H33A 4LF5B 5ITZA 1N34B 1QBZA 1QVFU 3RYCB 1P7GA 2WAMA 3CC7V 3D36A 5EYPB 2ZNIA 3ETDA 4GX0A 2A06H 3K5MA 3ZRWA 4FM1A 1D2DA 5GONA 1VMGA 1I7FA 1DGSA 2V4DA 1AJQA 2QKAA 1P84F 4PA7A 2UXXA 2EIKB 5B1AB 2DWDC 3IGAC 2WSSG 4L87A 4P30A 4TV9A 4DYLA 2YS8A 2VWKA 1NQTA 1NR7A 4Z1MG 3A0HZ 4IIJB 1NR1A 3RYFB 5FL7G 1B3QA 4F6RB 1N36O 3ZMUA 1GM8A 1YZBA 5J2TA 4UB6Z 3M7MX 4MVOA 2KG7B 3RN4A 5IDJA 4TSFG 1F51A 1AI7A 1W0JG 1NTZH 1HW7A 4Z1VA 5KUKA 4J11A 2W6IG 2RQ6A 3A2FA 2ZT9B 4DUZB 4PA4A 4JYAO 3H1JH 4TOIA 2BOCC 3ZMZA 5B3SB 2BSKB 2Q73A 1XUQA 3RVZA 3E2EA 2HR3A 2UUAB 2GSMB 1YXBA 3ETQA 2AHYA 3OFNG 3B2EE 4DR5B 2L35A 4DV5O 5E1AC 4MTOA 3JASB 4JAUA 1Y74A 2ZE8A 2OCCC 2EIJC 2ZE7A 4UFZA 4NYKA 1VF6C 1S72V 2Y69C 4MTGA 2PUSA 3RYIB 4LF5O 1S5HC 5EC1C 4LF4B 5D5PA 5K1PA 3SYCA 4TUYA 2HJFC 1ORQC 2BE3A 4ZOLB 2DQ3A 3B8NA 2K1EA 3ZHVA 3CB2A 3BA8A 4I9WA 5GTHZ 3A8TA 1EFRG 4NTYA 3ZHUA 2FTKA 4LFBB 4GKJB 1FAFA 1PNLA 3L73H 2QTSA 4QIWF 1XBLA 3SJQC 4LFCB 1GKFA 2AHZA 2Q0AA 3N2KA 1VQ7V 3HR0A 3JCUZ 1FXKB 4TQFA 3OUFA 4CH5A 1JR9A 2E75B 4PA9A 4JASA 3K58A 1P7BA 4X66O 1M57C 3O65A 1OCCC 4O2AA 5A9GA 4DV3B 5LA6B 4BW9A 1ZX3A 3VBBA 3VQVA 1B06A 2JK5C 1XREA 3CYOA 1YI2V 3FB5C 3AK2A 2OIGA 1QLNA 5FLXN 3RWRD 4PV1B 2BTOA 4ZIBA 4GYCB 4I0XA 4I50B 4O4HA 5KA5A 3T1YB 1VQLV 3K0DA 4MS2A 3OR7C 1BMFG 2OCHA 4DRXB 2EIMB 2DN9A 4WCEV 4EB6A 4OXSA 5JVDB 5B1OA 4DR5O 3HKCA 1COWG 1GH6A 2RDCA 4X1KB 2AZ0A 2JRIA 5IYZB 4KP4A 4Q6GA 3JAWA 4BW5A 3TJTA 2HVKC 4XBFA 1N33B 4G27B 3BA9A 3UT5A 2HVJC 3CCSV 3MHSC 1SF9A 4MTXA 5LOVB 1CEZA 3ZMTA 4JAAA 4JTCB 2HFEC 1M9NA 3F5WC 3ABKB 2AZ2A 2EIKC 2Y0IA 4B3MO 3PJSK 5B1AC 1SQVH 4JI5O 1AR5A 4JGSA 4GKJO 4GZRB 3C90A 2YC0A 1WP8A 1PV0A 3LSSA 1YDXA 4LFCO 4LNUA 1ZL8B 3T2MA 4NXNO 1N32B 2LW7A 3ZN1A 1BQ0A 1I5YA 1JX9A 3D8CA 4AHCA 1ZAUA 3NR7A 1XI1A 4LBEC 3ASOC 3SPJA 4U7OA 1HR0B 3CWBH 3CMEV 1K7DA 3AG7A 3KKYA 4YXWG 2GV9A 1OZ0A 3SJAC 1XILA 4F4LA 1LUWA 2E5LO 3CPWU 1QCEA 3APQA 2ZQMA 5CB4B 1J5EB 1TVKB 2EZPA 4H44B 2ARHA 2PTMA 4X65B 2QKCA 1V54B 5IY5B 3T1YO 1F4NA 4DV2B 1WP7A 5B3SC 1GAXA 2LFSA 1GN3A 3P30A 4R7CA 1GM7A 4FK5C 5LXTA 2X7RB 2ADQB 1Q7YW 1FKAO 5JJEB 3OEEG 3QO8A 3W7XA 5KX5A 5J2UA 1Q81W 4X20A 1S0VA 3DXRB 1VF6A 1XNRO 3L75H 1Q43A 1SS3A 3SJBC 2BTQB 1N33O 1OCZC 1F4MA 4KL1A 2PF4E 3W7SA 3VQWA 2X0LA 2JVDA 2ZDIA 1IBLO 4ABMA 4O2BB 1DF5A 4JV5B 4TV8A 5GTIZ 2CAZC 1NZ6A 3CCJV 1FFTB 3ZHQA 4KHPB 4NKGB 4I55A 3L71H 5EK0A 3ZN0A 2GUZA 3LNNA 2Q5ZA 1IURA 2DYSB 2YIAA 3Q4HB 5LMUB 4BIZA 5IYCO 2YSUB 1NBMG 1VQ5V 4WFFA 1IZ3A 5HFLA 1FXKC 3T4DA 1K8AW 2ADPA 4AQYB 1AB3A 2Y4TA 1T5EA 2P67A 2P5OA 3EVKA 1KD1W 4UCVA 1AP6A 2XNDG 3BEHA 1HR0O 3JAMN 5KHHA 3UCSC 5KUMA 4I7ZB 1HNWO 4B3TB 2MK3A 4BIUA 2EBOA 1SESA 4LF6O 1JFFB 3K9AA 1QNMA 2RJZA 5CBFA 4LF8O 1LUVA 4PDRA 1S3JA 3IJ4A 3ABMC 4DK0A 1WPXA 2ZM6O 4DW1A 3BVOA 1WA8B 4OPHA 3KCYA 3IC9A 1NH2B 3BRCA 3OE7G 1BHAA 2Y0PA 1OCOB 3FFQA 4WFGA 1U97A 1GN6A 1MZEA 2EIMC 3OW2U 2AW9A 1HNZO 4MVSA 1K9MW 1QLEB 1WB7A 2N04A 3H1KH 5JCOC 3ABUA 2UUBB 1XQ8A 2QSAA 3D3QA 5LGUA 5IJ0B 1IVSA 1OV9A 2ATKC 3STZC 3OTFA 4AILC 1V9PA 1Y76A 4PELA 4E4EA 3KZIZ 4HNAA 2IW5A 2JGDA 3AG2B 4P9OA 1VIBA 5KMGA 3UO3A 4B3SB 1Y6XA 4GLXA 4JV5O 1KECA 2GTSA 1K5SA 3ZHSA 3ABKC 4DR3O 1UJWB 5LP6C 1VEWA 4DXWA 1AILA 2ILMA 1FFXA 4DW0A 3K9SA 5LMUO 4FFBB 3OD4A 4XDLA 1Z2GA 4NR1A 1H2LA 3ZIAG 2Q6AA 4AQYO 4GX1A 3K5LA 2D3OW 1CPYA 1A32A 2E76B 1US6A 3AEIA 1ZLZA 4B3RO 1SA0A 2YI8A 3ZRXA 3UM7A 3JATB 4FLYA 2OT5A 3TXQA 3FAVB 2WLJA 2ZXWB 4GX2A 3LUTB 1S76D 1EN4A 4X1YB 2IU0A 2V1DA 4ZI7B 4B7EA 1V54C 5LMNO 5IY5C 2GHYA 2CTRA 2CE4A 2HLDG 2F43G 2YIBD 2EJ7A 5KAIZ 3OGCC 3HKBB 3AG4B 4J7ZA 2LQTA 4TQDA 5B1BB 5GW7A 4CBCA 4N21A 2UUBO 1L0NH 4LC1A 4X62O 1K3EA 3CRMA 4HYOA 5L3CA 4PJ0Z 3J80N 2Y4UA 1YITV 1P49A 1WB8A 3CMAV 3N2GA 1XHXA 1XDCA 4B3SO 2KB1A 1RPOA 5LYJA 1AVMA 2FB5A 4F6EA 5L3DA 4WBNA 4DR7O 2HHHB 1VQOV 4RO2A 4LFAB 4YJ3B 1FXHA 2LW1A 3BFRA 2DYSC 2CH7A 1I94B 3JAKB 3JALA 4H13B 4O4IA 1GO3F 2WLLA 4O4JA 4G28B 4QPKA 4X66B 4J42A 3QVNA 1CP9A 1VQ9V 1Q3EA 1MA1A 3G71V 4J9ZB 3IAYA 2QTOA 3F7YC 5JQGB 3G4SV 4R8CA 4DUYB 4X1IA 2QM4A 4UUJC 2VWJA 5C8YB 4KXRA 5K1XA 3T1HO 4LWSB 5B5EZ 2DJVA 4CS4A 1XOUA 4GX5A 5FNVB 3SYPA 4A5UB 4ZHQA 3ETGA 4UCTA 3B4SA 3I5DA 2QKSA 4CS2A 3HKEB 3QTCA 4MTFA 4DR2O 4UCRA 4N23A 4JPRA 2G38A 4K3AA 3JARA 3P3NA 3JD3A 2W0FC 1KB9F 3APOA 1VQ4V 3DSQA 3SYAA 3TCUA 2KQXA 2IM9A 2ZNJA 4J7JA 1EN6A 3JYCA 3MDSA 4GCZA 2PI5A 1KP2A 5D5QA 1G6UA 3OUSA 5CN0A 3CRAA 1JCHA 2YIBA 4U7NA 1E1RG 2Q4PA 3KCXA 3LNMB 2Z3YA 2PYJA 3CP1A 3JD0A 2XHBA 5E79Z 1THZA 3CJHA 4PD4F 4QPJA 4G2KA 2LP7A 2XAFA 4I4TA 5ITZB 5LP6A 1X59A 4B3MB 3W7TA 4JI5B 1VQPV 2P22C 2DOSA 2HHHO 4OX9B 1JOYA 1JA8A 3WB0A 4NXMO 4LFAO 3K04A 3TETA 1R3KC 1K97A 3ZRWB 2P6JA 1MSWD 4TWKA 5GONB 2BCCH 4UB8Z 4JYCA 4NXNB 3CHXA 1HDJA 1I94O
chains in the Genus database with same CATH topology
2OIGA 1YVWA 2YXHA 4QGPA 2A7WA 3CRCA 2Q73A 3CRAA 2OIEA 2P06A 2Q4PA 5IE9A 2GTAA 1Y6XA 1YXBA 1VMGA 2A3QA 3C90A 2Q5ZA 2Q9LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OIG A;  1YVW A;  2YXH A;  4QGP A;  2A7W A;  3CRC A;  2Q73 A;  3CRA A;  2OIE A;  2P06 A;  2Q4P A;  5IE9 A;  2GTA A;  1Y6X A;  1YXB A;  1VMG A;  2A3Q A;  3C90 A;  2Q5Z A;  2Q9L A; 
#chains in the Genus database with same CATH topology
 3JSN A;  5IYB O;  3ZED A;  4MVU A;  1M4U A;  4J10 A;  4BR6 A;  1YEW A;  2HEP A;  4H0L B;  1SQF A;  4QE9 A;  3R66 A;  5CA0 A;  4JI2 O;  5JH7 A;  1QR8 A;  2OWO A;  1BT8 A;  1KYO F;  4TV9 B;  3HPL C;  1EM1 A;  1PP9 H;  1H2N A;  2E5L B;  1MMM A;  2UXN A;  2EIN B;  4DV0 O;  2P4V A;  4DUY O;  3RFR A;  1FD9 A;  4K35 A;  5IJ9 A;  1H2S B;  4UXN A;  1RP3 B;  3E86 A;  1Q82 W;  1YJ9 V;  4GKK O;  3TXS A;  1NTK H;  5KHJ A;  2GBO A;  3FB8 C;  2YEV A;  2ZXW C;  1WPB A;  2OIE A;  3ZJZ A;  2IJJ A;  1TGO A;  5J2T B;  1RSO A;  2A3Q A;  3AK3 A;  4K0K B;  2Q7E A;  4O4L A;  1K33 A;  4XDJ A;  5DM6 V;  1FYJ A;  4FLT A;  1SQG A;  3B40 A;  1N4C A;  3VQY A;  1YVW A;  3AG4 C;  3BAB A;  4LP8 A;  1TUB A;  2CGO A;  1XNR B;  2IH1 C;  1N8R W;  5B1B C;  1H2K A;  3CRR A;  3B09 A;  4NB5 A;  2UUC O;  1ROP A;  1Z5W A;  2F1M A;  1NS1 A;  5JJN B;  1IBL B;  4P2Z A;  4YJ2 A;  1VF7 A;  2RNB A;  1Y74 B;  4Z2W A;  4IYI A;  4UV9 A;  1KC8 W;  2CK3 G;  4YIP A;  4J7K A;  1XMQ B;  5CMU A;  4OX9 O;  4PDL A;  1ZSP A;  1L0L H;  1PD3 A;  4TUY B;  2L6L A;  2IJI A;  3K79 A;  3E8B A;  2UXD B;  1L1F A;  2ZIN A;  5CA1 A;  1OCR B;  2H8P C;  3SYQ A;  1K5Q A;  1UFI A;  4FLW A;  3OMI B;  3ZS8 C;  4X8A A;  5AG2 A;  1YJN V;  4JI7 B;  4WFH A;  4YHH B;  4JZ2 A;  4UCS A;  2PYL A;  2QWO B;  5LL6 Y;  1HNW B;  1HWY A;  3SPI A;  4DV4 B;  4DK1 A;  3N2K B;  4LF6 B;  3F7V C;  3K3W A;  5BMV A;  3EFF K;  2R70 A;  2CDY A;  2H94 A;  2NN4 A;  2DQ0 A;  2XAJ A;  4W4L A;  2QM7 A;  4LF8 B;  3MHH C;  5KHI A;  2Q68 A;  1R6K A;  3P32 A;  2ZM6 B;  2D2C B;  4O2A B;  2IBZ H;  4B08 A;  1M93 A;  2QE7 G;  3CSX A;  4U3J A;  4JI6 B;  5LGN A;  1FPO A;  1PNM A;  1XL4 A;  4K0K O;  1SQP H;  3HKD A;  3UO2 A;  3ZBH A;  1K73 W;  1HNZ B;  2EIL B;  3K5O A;  3AG3 B;  4I0X B;  4FLV A;  4FLU A;  4DV6 O;  1VF5 B;  4O4H B;  3WU2 Z;  1FXV A;  2OTJ V;  3CXC U;  4J80 A;  1BZK A;  4FM2 A;  5EZY A;  5IWA O;  1YHQ V;  4EB6 B;  4JI8 B;  1XMO O;  1MG1 A;  3HKC B;  2QDO A;  1YSC A;  3E8F A;  1JMK C;  2B9Z A;  1MOF A;  3PN1 A;  3UKM A;  3NXS A;  3CCE V;  2VQF O;  1YCI A;  3ASN B;  3AG1 B;  3JAW B;  3ABT A;  1ARO P;  4JYB A;  4DR3 B;  3RYH A;  5A2Q N;  5BZB A;  1KU9 A;  3UT5 B;  3CS5 A;  5HFM A;  1XMQ O;  1YTF B;  4K8Z A;  3CE2 A;  2X6C A;  2BOB C;  4CH3 A;  2UXD O;  5BR8 O;  1RM1 B;  1IXM A;  1IBK O;  1NJI W;  5B1N A;  3DTU B;  2QA4 V;  1S77 D;  3H1I H;  3R65 A;  4JI7 O;  3H1H H;  2YID A;  4YHH O;  1PKX A;  2YUA A;  4JZG A;  2PZS A;  1EN5 A;  2WLH A;  4QNH B;  4ASU G;  2WLI A;  2P90 A;  4B3R B;  1ZWI C;  4DV1 O;  2FL4 A;  5L3F A;  4LNU B;  4DV4 O;  5CA3 A;  3E22 A;  3ZHT A;  5EBM C;  2EIN C;  2C2A A;  3CCR V;  4JI4 O;  3W7U A;  2DYR B;  3CXH F;  1DK1 A;  5KAF Z;  1W2B U;  1AI5 A;  3JD2 A;  3J7A U;  3OT7 A;  4CH4 A;  5LMN B;  2XAH A;  2Q8V A;  5JWP A;  3CCL V;  4JI6 O;  5BY1 A;  4WF9 V;  2JIZ G;  2Q69 A;  1OHH G;  3QF7 A;  2PY5 A;  1SET A;  3BHP A;  4HZ3 A;  3L74 H;  3M8A A;  4RQF A;  4D7S A;  1JJO A;  3G6B A;  4IHJ A;  1KQS U;  4J41 A;  1M5I A;  2W6J G;  4X62 B;  2QGN A;  1VQN V;  2WLN A;  4CS3 A;  2ZR3 A;  1H38 A;  2YXY A;  3BCC H;  3U10 A;  3RYC A;  2X6A A;  2A0L A;  2A7W A;  5EYP A;  4JI8 O;  5LXT B;  1P4R A;  2OCC B;  3CC4 V;  2E3C A;  5J2U B;  1EBO A;  1E79 G;  5KHG A;  4EFB A;  5KX5 B;  4X20 B;  1XHZ A;  1AJP A;  3WG7 B;  2HG5 C;  2ETN A;  4DR7 B;  2YI9 A;  4JYY A;  2Q7H A;  3F5T A;  3DC6 A;  1GN2 A;  3THO A;  1BSM A;  4QGP A;  2WLM A;  3CCQ V;  3ZRV A;  1R3J C;  3C3S A;  2ZKO A;  3MD0 A;  3SR2 C;  4TV8 B;  1V55 B;  3D3I A;  1X4T A;  1GM9 A;  1OCR C;  3QO7 A;  5L3B A;  1Q5O A;  4IIJ A;  2CTP A;  3KG2 A;  2EJR A;  2LGQ A;  2QWR B;  1BCC H;  4I55 B;  3RYF A;  5LHH A;  3SPC A;  1N0N A;  2DW4 A;  4UVA A;  2EX3 A;  3CCU V;  2GUZ B;  2OTL V;  1MAB G;  4F6R A;  1TAE A;  4PA3 A;  1Z5V A;  1R3L C;  2KG7 A;  3LSU A;  2P06 A;  4TT3 G;  5BXZ A;  2Y48 A;  5IT9 N;  3T1H B;  3QNE A;  2WA3 A;  5H9C A;  1BQZ A;  1G8M A;  5DN6 G;  4AI8 A;  3O9O A;  2QEX V;  4DR6 B;  2ZCE A;  2BSK A;  2XAG A;  1KP3 A;  1QR9 A;  3T4Z A;  2VQE O;  3K03 A;  1QQC A;  2ITC C;  4DR2 B;  3A0R A;  1K4C C;  4FLX A;  3JAS A;  2EIL C;  2F66 C;  1WAZ A;  1HNX B;  2X6B A;  1VQM V;  3AG3 C;  3CCM V;  3K0G A;  1K92 A;  2CGN A;  1QHT A;  1H2G A;  4I9Q A;  2R9R B;  1B6Q A;  4UVC A;  3RYI A;  1TA8 A;  1BHB A;  3RT3 C;  2UXB O;  2QWN B;  4ZOL A;  2LJ2 A;  1FS0 G;  4BWA A;  1LNQ A;  4D6T H;  4DR4 B;  4LH6 A;  5F2V O;  1Q90 D;  3AG1 C;  3ASN C;  3WB1 A;  3IC7 A;  4DV7 O;  2F4V B;  1Y76 B;  3ZX6 A;  2A9H A;  4NXM B;  4HNA B;  1AP5 A;  2JGD B;  2F93 B;  4MSW C;  4FMT A;  5DED A;  4PDV A;  4RWU A;  1R6N A;  3S3W A;  4JI1 B;  5KMG B;  4U3F H;  2Q67 A;  1FXK A;  1RM1 C;  4CZZ A;  3K08 A;  4OGQ B;  4IGG A;  3X2Q B;  3FKS G;  4JI2 B;  3ZMS A;  1FFX B;  1FJG O;  1XNQ O;  5LA6 A;  4LH7 A;  3B77 A;  3CCV V;  4OPA A;  3K57 A;  2K9P A;  2VRZ A;  4DV0 B;  1KMI Z;  3FB6 C;  4X64 B;  5EBL C;  2Q0O C;  3T1C A;  3ASO B;  2ZR2 A;  3H01 A;  4GKK B;  1SQB H;  4NVP A;  2DYR C;  4I50 A;  1IBM O;  4RAI A;  2F95 B;  4JI0 O;  3STL C;  4MW8 A;  1N0J A;  4DR6 O;  1SA0 B;  2ZIM A;  4HBN A;  4DRX A;  4X88 A;  1OCO C;  2B1G A;  4RUF A;  1H8H G;  4JTA B;  5JVD A;  2Z0A A;  1DLB A;  3QO5 A;  4LF9 B;  5H2F Z;  1HNX O;  3BY6 A;  4IYH A;  5JCO A;  1Q6H A;  1JJ2 U;  4X1K A;  1QLE C;  3UQ8 A;  2CTQ A;  5IYZ A;  2IU3 A;  4MVM A;  5J9P C;  1NTM H;  2UUC B;  1U96 A;  1TUE B;  4FZ0 A;  4RQE A;  2NNU A;  3EXA A;  1RPR A;  5FPO A;  1K34 A;  1W0K G;  1YTF D;  5FPR A;  4JTD B;  3AG2 C;  5LOV A;  4DR4 O;  2YXL A;  3H9V A;  3RVY A;  1OCZ B;  2DMX A;  3WG7 C;  2R9A A;  1CXZ B;  2FKX A;  3CEI A;  1N34 O;  2F4V O;  2XT9 A;  5TIS Z;  3G6E V;  1M1K W;  4MVQ A;  4E2L A;  2E74 B;  4MT8 A;  4MW3 A;  4WFB V;  2YDE A;  2UU9 B;  4CH6 A;  2ZDI C;  3N2G B;  4JI1 O;  3WB2 A;  1ZL8 A;  1V55 C;  1YIJ V;  2Q7G A;  2ZE6 A;  5LYJ B;  1WN7 A;  1YF2 A;  2N74 A;  4WBN B;  4ICG A;  1QVG U;  4XDK A;  4C7U A;  3LDD A;  2GTA A;  5L3E A;  4LF7 B;  2CH7 B;  1S5L Z;  5LHI A;  4UVB A;  1GN4 A;  4PI2 A;  3JAL B;  3BAA A;  4O4I B;  1NVP B;  1SER A;  1NH2 D;  1I0H A;  2LGW A;  2LO1 A;  2WLL B;  4O4J B;  1XEQ A;  3OEH G;  1SZT A;  5H6R A;  4X64 O;  1O9H A;  5CB4 A;  4JI3 B;  4P9P A;  4LCU C;  1TVK A;  4UV8 A;  1PPJ H;  1JQ0 A;  3SDL A;  2ZD9 A;  3LSQ A;  2WPD G;  4YIO A;  2XTA A;  4FZ1 A;  4X1I B;  1H8E G;  3K59 A;  2RMK B;  2W0X A;  2JEU A;  3ABM B;  3ZRS A;  3SJC C;  4LF9 O;  2WWW A;  4DV6 B;  4DUZ O;  3E8H A;  1H2M A;  3DXR A;  2JDI G;  5EIB C;  4ZHQ B;  1GMG A;  5EBW C;  1M90 W;  2MW2 B;  2BTQ A;  4Q20 A;  5KA6 A;  3FYE B;  1DF4 A;  1AJN A;  5IWA B;  5IYD O;  1GRJ A;  3G80 A;  3ML0 A;  2UUA O;  1Y66 A;  1XMO B;  3ZMV A;  2NR5 A;  2VS0 A;  4I5S A;  3JAR B;  3ETE A;  4O2B A;  2GDS A;  2VQF B;  2O57 A;  1VP7 A;  3I56 V;  1JVM A;  2JS5 A;  1EZJ A;  5H6Q A;  1B04 A;  4W4K A;  2ITD C;  2UXC B;  3I55 V;  1VAR A;  4LF4 O;  1OJH A;  2LFR A;  1I5X A;  3RW0 A;  4QE7 A;  3Q4H A;  1VQ6 V;  3CJH B;  1J95 A;  2UU9 O;  5BR8 B;  3CRQ A;  2EZO A;  3E35 A;  4IT5 A;  1NKD A;  3VOU A;  1IBK B;  2V7Q G;  2CTW A;  3FYI B;  4I4T B;  5LP6 B;  3GVM A;  1M56 B;  3N27 A;  1IX9 A;  4LFB O;  4GT1 A;  3W7W A;  4PA6 A;  3X2Q C;  4DV1 B;  3U0Z A;  3TK1 A;  1R3I C;  4LF7 O;  2QM8 A;  1JFF A;  3IFX A;  3CC2 V;  1ZUQ A;  4CC6 A;  3ABL B;  3GB7 C;  4JI4 B;  4BIO A;  1BGY H;  4JI3 O;  1IXB A;  5IE9 A;  2IH3 C;  2P7T C;  2JJ1 G;  5CA0 B;  5JH7 B;  2XUM A;  1WA8 A;  5EIB D;  4DV3 O;  2WLK A;  4KUM A;  3SPH A;  2R72 A;  3C3T A;  1PNK A;  2RCV A;  3MAQ A;  2M6Y A;  2JJ2 G;  1W59 A;  3SGI A;  5IJ9 B;  5KLV H;  4B7K A;  1QU7 A;  2AGA A;  1L8D A;  4EKW A;  3B8M A;  2ZIO A;  4RUE A;  4DR1 B;  1SQQ H;  2YEV B;  4UCU A;  2FML A;  2EUL A;  4ZBM A;  3E83 A;  1D5N A;  3OAA G;  2B1I A;  5IJ0 A;  1RSO B;  2RN9 A;  4K8X A;  3LDC A;  2QWP B;  3JSL A;  4O4L B;  5JJJ B;  1WNS A;  2PGG A;  5LGT A;  3ZCC A;  1BL8 A;  2H3O A;  4PDM A;  3OMN B;  4EFE A;  3OR6 C;  1PM9 A;  1TUB B;  3DGE A;  4FVM A;  3TGU H;  2DWE C;  2P4K A;  1GTO A;  1WLE A;  3JD1 A;  2UXC O;  3ZHR A;  1Q86 W;  1HP8 A;  1RFY A;  5KHK A;  3CD6 V;  4YJ2 B;  2KSD A;  3D36 C;  3SYO A;  3OM3 B;  1Y67 A;  3CX5 F;  3K06 A;  4H37 A;  1WJZ A;  1Q8I A;  1NU1 H;  4FFB A;  2F23 A;  4FM0 A;  3P3P A;  4MVZ A;  3L72 H;  2AXT Z;  1MSD A;  2ZE5 A;  1AR4 A;  4FFK A;  5CBG A;  4FPP A;  5CA1 B;  4KFM A;  3CRC A;  4X9Q A;  3JAT A;  3L9D A;  1N32 O;  5C93 A;  3OMA B;  1KKD A;  4YY3 B;  3OTO B;  3BPZ A;  4NTX A;  1AI6 A;  1SRY A;  3FAV A;  4ZKI A;  1S5J A;  1GK9 A;  3JD4 A;  1KBH A;  1Y4M A;  2HJD A;  4JAV A;  4X1Y A;  1G4Y B;  4ZI7 A;  1VQK V;  3AK1 A;  1ENV A;  3HB3 B;  3FX7 A;  2KKW A;  1R73 A;  2VQE B;  4L8J A;  5BMV B;  3QG5 A;  4D7T A;  3SPG A;  2YIC A;  2HKO A;  4MVR A;  2QJ1 A;  3HKB A;  4PI0 A;  2IJK A;  1K4D C;  1J5E O;  4DR1 O;  4DO2 A;  1EZV H;  1BE3 H;  1PL4 A;  3S3X A;  1G1X B;  1SKV A;  3GWO A;  4GUN A;  4FLZ A;  4X65 O;  2NLJ C;  4U3J B;  3OGI B;  3GWK C;  4FJC C;  3WFV A;  4DV2 O;  2YXH A;  1SZX A;  2XOK G;  2HP8 A;  3HKD B;  4J9Y B;  1DTO A;  5B66 Z;  1E1Q G;  2R9I A;  2UXB B;  2JS3 A;  1LR1 A;  3E8G A;  1F7Y A;  2EIJ B;  4LR3 A;  3EHB B;  4R50 A;  1O9G A;  2Y69 B;  3RGB A;  4QJF B;  1VQ8 V;  3FB7 C;  4CC5 A;  1NT2 B;  4DV7 B;  1NI8 A;  1AI4 A;  5EZY B;  2B5U A;  2JGU A;  3H1L H;  2XAS A;  4YJ3 A;  3L70 H;  3G67 A;  2A79 B;  3ICX A;  1Q6I A;  3E89 A;  1KUQ A;  4PHZ A;  2N05 A;  3JAK A;  3A0B Z;  2DE0 X;  1NVP D;  1R6T A;  4IL6 Z;  5EC2 C;  2IJH A;  4UCO A;  3RYH B;  2FYU H;  4NTW A;  4KHP O;  2QR4 A;  2Q9L A;  1BS3 A;  1Q6U A;  1M56 C;  3M99 B;  4HAM A;  1FJG B;  2PI4 A;  1XNQ B;  3FD9 A;  5JQG A;  5LHG A;  4EEQ A;  3VQX A;  1XL6 A;  1ZTE A;  4FIP C;  4X89 A;  2CUG A;  2OYQ A;  1SQX H;  4BAY A;  5C8Y A;  2QWQ B;  3ABL C;  2ODM A;  4YY3 O;  1M57 B;  3OTO O;  1KKC A;  4LWS A;  1OCC B;  5DEC A;  1IBM B;  4JF3 A;  1N36 B;  1MZF A;  1MNG A;  4JI0 B;  5L3G A;  1UPG A;  2WLI B;  5FNV A;  4B3T O;  3E22 B;  2Z5U A;  3HKE A;  1AR1 B;  1I08 A;  3K5N A;  3U11 A;  4JYA B;  4R6Z A;  1URF A;  5LBQ A;  2JEX A;  5CBH A;  1IDS A;  2M7W A;  3J81 N;  3DC5 A;  4WFE A;  3JCZ A;  2XAQ A;  4DV5 B;  1JPX A;  1YJW V;  1PL0 A;  3LDE A;  1D5A A;  2WA4 A;  1R1B A;  1F23 A;  4IHJ B;  3RBZ A;  4WFA V;  5H5N A;  1SC5 B;  4H33 A;  4LF5 B;  5ITZ A;  1N34 B;  1QBZ A;  1QVF U;  3RYC B;  1P7G A;  2WAM A;  3CC7 V;  3D36 A;  5EYP B;  2ZNI A;  3ETD A;  4GX0 A;  2A06 H;  3K5M A;  3ZRW A;  4FM1 A;  1D2D A;  5GON A;  1VMG A;  1I7F A;  1DGS A;  2V4D A;  1AJQ A;  2QKA A;  1P84 F;  4PA7 A;  2UXX A;  2EIK B;  5B1A B;  2DWD C;  3IGA C;  2WSS G;  4L87 A;  4P30 A;  4TV9 A;  4DYL A;  2YS8 A;  2VWK A;  1NQT A;  1NR7 A;  4Z1M G;  3A0H Z;  4IIJ B;  1NR1 A;  3RYF B;  5FL7 G;  1B3Q A;  4F6R B;  1N36 O;  3ZMU A;  1GM8 A;  1YZB A;  5J2T A;  4UB6 Z;  3M7M X;  4MVO A;  2KG7 B;  3RN4 A;  5IDJ A;  4TSF G;  1F51 A;  1AI7 A;  1W0J G;  1NTZ H;  1HW7 A;  4Z1V A;  5KUK A;  4J11 A;  2W6I G;  2RQ6 A;  3A2F A;  2ZT9 B;  4DUZ B;  4PA4 A;  4JYA O;  3H1J H;  4TOI A;  2BOC C;  3ZMZ A;  5B3S B;  2BSK B;  2Q73 A;  1XUQ A;  3RVZ A;  3E2E A;  2HR3 A;  2UUA B;  2GSM B;  1YXB A;  3ETQ A;  2AHY A;  3OFN G;  3B2E E;  4DR5 B;  2L35 A;  4DV5 O;  5E1A C;  4MTO A;  3JAS B;  4JAU A;  1Y74 A;  2ZE8 A;  2OCC C;  2EIJ C;  2ZE7 A;  4UFZ A;  4NYK A;  1VF6 C;  1S72 V;  2Y69 C;  4MTG A;  2PUS A;  3RYI B;  4LF5 O;  1S5H C;  5EC1 C;  4LF4 B;  5D5P A;  5K1P A;  3SYC A;  4TUY A;  2HJF C;  1ORQ C;  2BE3 A;  4ZOL B;  2DQ3 A;  3B8N A;  2K1E A;  3ZHV A;  3CB2 A;  3BA8 A;  4I9W A;  5GTH Z;  3A8T A;  1EFR G;  4NTY A;  3ZHU A;  2FTK A;  4LFB B;  4GKJ B;  1FAF A;  1PNL A;  3L73 H;  2QTS A;  4QIW F;  1XBL A;  3SJQ C;  4LFC B;  1GKF A;  2AHZ A;  2Q0A A;  3N2K A;  1VQ7 V;  3HR0 A;  3JCU Z;  1FXK B;  4TQF A;  3OUF A;  4CH5 A;  1JR9 A;  2E75 B;  4PA9 A;  4JAS A;  3K58 A;  1P7B A;  4X66 O;  1M57 C;  3O65 A;  1OCC C;  4O2A A;  5A9G A;  4DV3 B;  5LA6 B;  4BW9 A;  1ZX3 A;  3VBB A;  3VQV A;  1B06 A;  2JK5 C;  1XRE A;  3CYO A;  1YI2 V;  3FB5 C;  3AK2 A;  2OIG A;  1QLN A;  5FLX N;  3RWR D;  4PV1 B;  2BTO A;  4ZIB A;  4GYC B;  4I0X A;  4I50 B;  4O4H A;  5KA5 A;  3T1Y B;  1VQL V;  3K0D A;  4MS2 A;  3OR7 C;  1BMF G;  2OCH A;  4DRX B;  2EIM B;  2DN9 A;  4WCE V;  4EB6 A;  4OXS A;  5JVD B;  5B1O A;  4DR5 O;  3HKC A;  1COW G;  1GH6 A;  2RDC A;  4X1K B;  2AZ0 A;  2JRI A;  5IYZ B;  4KP4 A;  4Q6G A;  3JAW A;  4BW5 A;  3TJT A;  2HVK C;  4XBF A;  1N33 B;  4G27 B;  3BA9 A;  3UT5 A;  2HVJ C;  3CCS V;  3MHS C;  1SF9 A;  4MTX A;  5LOV B;  1CEZ A;  3ZMT A;  4JAA A;  4JTC B;  2HFE C;  1M9N A;  3F5W C;  3ABK B;  2AZ2 A;  2EIK C;  2Y0I A;  4B3M O;  3PJS K;  5B1A C;  1SQV H;  4JI5 O;  1AR5 A;  4JGS A;  4GKJ O;  4GZR B;  3C90 A;  2YC0 A;  1WP8 A;  1PV0 A;  3LSS A;  1YDX A;  4LFC O;  4LNU A;  1ZL8 B;  3T2M A;  4NXN O;  1N32 B;  2LW7 A;  3ZN1 A;  1BQ0 A;  1I5Y A;  1JX9 A;  3D8C A;  4AHC A;  1ZAU A;  3NR7 A;  1XI1 A;  4LBE C;  3ASO C;  3SPJ A;  4U7O A;  1HR0 B;  3CWB H;  3CME V;  1K7D A;  3AG7 A;  3KKY A;  4YXW G;  2GV9 A;  1OZ0 A;  3SJA C;  1XIL A;  4F4L A;  1LUW A;  2E5L O;  3CPW U;  1QCE A;  3APQ A;  2ZQM A;  5CB4 B;  1J5E B;  1TVK B;  2EZP A;  4H44 B;  2ARH A;  2PTM A;  4X65 B;  2QKC A;  1V54 B;  5IY5 B;  3T1Y O;  1F4N A;  4DV2 B;  1WP7 A;  5B3S C;  1GAX A;  2LFS A;  1GN3 A;  3P30 A;  4R7C A;  1GM7 A;  4FK5 C;  5LXT A;  2X7R B;  2ADQ B;  1Q7Y W;  1FKA O;  5JJE B;  3OEE G;  3QO8 A;  3W7X A;  5KX5 A;  5J2U A;  1Q81 W;  4X20 A;  1S0V A;  3DXR B;  1VF6 A;  1XNR O;  3L75 H;  1Q43 A;  1SS3 A;  3SJB C;  2BTQ B;  1N33 O;  1OCZ C;  1F4M A;  4KL1 A;  2PF4 E;  3W7S A;  3VQW A;  2X0L A;  2JVD A;  2ZDI A;  1IBL O;  4ABM A;  4O2B B;  1DF5 A;  4JV5 B;  4TV8 A;  5GTI Z;  2CAZ C;  1NZ6 A;  3CCJ V;  1FFT B;  3ZHQ A;  4KHP B;  4NKG B;  4I55 A;  3L71 H;  5EK0 A;  3ZN0 A;  2GUZ A;  3LNN A;  2Q5Z A;  1IUR A;  2DYS B;  2YIA A;  3Q4H B;  5LMU B;  4BIZ A;  5IYC O;  2YSU B;  1NBM G;  1VQ5 V;  4WFF A;  1IZ3 A;  5HFL A;  1FXK C;  3T4D A;  1K8A W;  2ADP A;  4AQY B;  1AB3 A;  2Y4T A;  1T5E A;  2P67 A;  2P5O A;  3EVK A;  1KD1 W;  4UCV A;  1AP6 A;  2XND G;  3BEH A;  1HR0 O;  3JAM N;  5KHH A;  3UCS C;  5KUM A;  4I7Z B;  1HNW O;  4B3T B;  2MK3 A;  4BIU A;  2EBO A;  1SES A;  4LF6 O;  1JFF B;  3K9A A;  1QNM A;  2RJZ A;  5CBF A;  4LF8 O;  1LUV A;  4PDR A;  1S3J A;  3IJ4 A;  3ABM C;  4DK0 A;  1WPX A;  2ZM6 O;  4DW1 A;  3BVO A;  1WA8 B;  4OPH A;  3KCY A;  3IC9 A;  1NH2 B;  3BRC A;  3OE7 G;  1BHA A;  2Y0P A;  1OCO B;  3FFQ A;  4WFG A;  1U97 A;  1GN6 A;  1MZE A;  2EIM C;  3OW2 U;  2AW9 A;  1HNZ O;  4MVS A;  1K9M W;  1QLE B;  1WB7 A;  2N04 A;  3H1K H;  5JCO C;  3ABU A;  2UUB B;  1XQ8 A;  2QSA A;  3D3Q A;  5LGU A;  5IJ0 B;  1IVS A;  1OV9 A;  2ATK C;  3STZ C;  3OTF A;  4AIL C;  1V9P A;  1Y76 A;  4PEL A;  4E4E A;  3KZI Z;  4HNA A;  2IW5 A;  2JGD A;  3AG2 B;  4P9O A;  1VIB A;  5KMG A;  3UO3 A;  4B3S B;  1Y6X A;  4GLX A;  4JV5 O;  1KEC A;  2GTS A;  1K5S A;  3ZHS A;  3ABK C;  4DR3 O;  1UJW B;  5LP6 C;  1VEW A;  4DXW A;  1AIL A;  2ILM A;  1FFX A;  4DW0 A;  3K9S A;  5LMU O;  4FFB B;  3OD4 A;  4XDL A;  1Z2G A;  4NR1 A;  1H2L A;  3ZIA G;  2Q6A A;  4AQY O;  4GX1 A;  3K5L A;  2D3O W;  1CPY A;  1A32 A;  2E76 B;  1US6 A;  3AEI A;  1ZLZ A;  4B3R O;  1SA0 A;  2YI8 A;  3ZRX A;  3UM7 A;  3JAT B;  4FLY A;  2OT5 A;  3TXQ A;  3FAV B;  2WLJ A;  2ZXW B;  4GX2 A;  3LUT B;  1S76 D;  1EN4 A;  4X1Y B;  2IU0 A;  2V1D A;  4ZI7 B;  4B7E A;  1V54 C;  5LMN O;  5IY5 C;  2GHY A;  2CTR A;  2CE4 A;  2HLD G;  2F43 G;  2YIB D;  2EJ7 A;  5KAI Z;  3OGC C;  3HKB B;  3AG4 B;  4J7Z A;  2LQT A;  4TQD A;  5B1B B;  5GW7 A;  4CBC A;  4N21 A;  2UUB O;  1L0N H;  4LC1 A;  4X62 O;  1K3E A;  3CRM A;  4HYO A;  5L3C A;  4PJ0 Z;  3J80 N;  2Y4U A;  1YIT V;  1P49 A;  1WB8 A;  3CMA V;  3N2G A;  1XHX A;  1XDC A;  4B3S O;  2KB1 A;  1RPO A;  5LYJ A;  1AVM A;  2FB5 A;  4F6E A;  5L3D A;  4WBN A;  4DR7 O;  2HHH B;  1VQO V;  4RO2 A;  4LFA B;  4YJ3 B;  1FXH A;  2LW1 A;  3BFR A;  2DYS C;  2CH7 A;  1I94 B;  3JAK B;  3JAL A;  4H13 B;  4O4I A;  1GO3 F;  2WLL A;  4O4J A;  4G28 B;  4QPK A;  4X66 B;  4J42 A;  3QVN A;  1CP9 A;  1VQ9 V;  1Q3E A;  1MA1 A;  3G71 V;  4J9Z B;  3IAY A;  2QTO A;  3F7Y C;  5JQG B;  3G4S V;  4R8C A;  4DUY B;  4X1I A;  2QM4 A;  4UUJ C;  2VWJ A;  5C8Y B;  4KXR A;  5K1X A;  3T1H O;  4LWS B;  5B5E Z;  2DJV A;  4CS4 A;  1XOU A;  4GX5 A;  5FNV B;  3SYP A;  4A5U B;  4ZHQ A;  3ETG A;  4UCT A;  3B4S A;  3I5D A;  2QKS A;  4CS2 A;  3HKE B;  3QTC A;  4MTF A;  4DR2 O;  4UCR A;  4N23 A;  4JPR A;  2G38 A;  4K3A A;  3JAR A;  3P3N A;  3JD3 A;  2W0F C;  1KB9 F;  3APO A;  1VQ4 V;  3DSQ A;  3SYA A;  3TCU A;  2KQX A;  2IM9 A;  2ZNJ A;  4J7J A;  1EN6 A;  3JYC A;  3MDS A;  4GCZ A;  2PI5 A;  1KP2 A;  5D5Q A;  1G6U A;  3OUS A;  5CN0 A;  3CRA A;  1JCH A;  2YIB A;  4U7N A;  1E1R G;  2Q4P A;  3KCX A;  3LNM B;  2Z3Y A;  2PYJ A;  3CP1 A;  3JD0 A;  2XHB A;  5E79 Z;  1THZ A;  3CJH A;  4PD4 F;  4QPJ A;  4G2K A;  2LP7 A;  2XAF A;  4I4T A;  5ITZ B;  5LP6 A;  1X59 A;  4B3M B;  3W7T A;  4JI5 B;  1VQP V;  2P22 C;  2DOS A;  2HHH O;  4OX9 B;  1JOY A;  1JA8 A;  3WB0 A;  4NXM O;  4LFA O;  3K04 A;  3TET A;  1R3K C;  1K97 A;  3ZRW B;  2P6J A;  1MSW D;  4TWK A;  5GON B;  2BCC H;  4UB8 Z;  4JYC A;  4NXN B;  3CHX A;  1HDJ A;  1I94 O; 
#chains in the Genus database with same CATH homology
 2OIG A;  1YVW A;  2YXH A;  4QGP A;  2A7W A;  3CRC A;  2Q73 A;  3CRA A;  2OIE A;  2P06 A;  2Q4P A;  5IE9 A;  2GTA A;  1Y6X A;  1YXB A;  1VMG A;  2A3Q A;  3C90 A;  2Q5Z A;  2Q9L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...