2P06A

Crystal structure of a predicted coding region af_0060 from archaeoglobus fulgidus dsm 4304
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
84
structure length
84
Chain Sequence
b'MDYFRLAEKFLREMHAKYMKRVSRPGNTPRPWFDFSEERLLSRLFEEMDELREAVEKEDWENLRDELLDVANFCMYLWGKLSVK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein AF_0060
molecule tags Structural genomics, unknown function
source organism Archaeoglobus fulgidus dsm 4304
publication title Crystal structure of a predicted coding region AF_0060 from Archaeoglobus fulgidus DSM 4304
rcsb
total genus 28
structure length 84
sequence length 84
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03819 MazG MazG nucleotide pyrophosphohydrolase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1080 Mainly Alpha Orthogonal Bundle Helix Hairpins MazG-like 2p06A00
1YVWA 2GTAA 2YXHA 1VMGA 1Y6XA 2A7WA 2Q73A 3C90A 2P06A 2A3QA 1YXBA 2OIGA 2OIEA 3CRCA 2Q5ZA 5IE9A 4QGPA 3CRAA 2Q9LA 2Q4PA
chains in the Genus database with same CATH superfamily
5CN0A 2Y0PA 1ZUQA 2A0LA 1D2DA 2E74B 3TCUA 1U96A 2BOCC 1Q8IA 1OCRC 4WFFA 2BTOA 3D36C 1AP6A 1AROP 4FMTA 3FD9A 3E83A 1N4CA 2VRZA 4ZIBA 1NT2B 1JQ0A 2IJHA 5LMUO 3W7TA 4KHPB 2W0FC 5JVDA 4BR6A 4LFAO 2ZINA 5JJJB 1F7YA 5JVDB 3CJHB 4GKKO 5LP6C 2OCHA 4X64O 1D5AA 3STZC 2N05A 1H2NA 5CB4B 4PA7A 2L6LA 3H1HH 2DQ0A 2F1MA 3CCRV 5L3CA 1EM1A 4X1YB 1ZTEA 2P06A 2N04A 3CRQA 1VQNV 1PNMA 2CE4A 4F6EA 3OUSA 4O2AA 1KBHA 1XNQB 1EFRG 2LP7A 3QO5A 2DOSA 4YY3B 1X59A 4O2AB 4BW9A 3AG2B 1YIJV 5H6QA 4K35A 5EYPB 1KMIZ 4NTYA 1VARA 4GX1A 4AI8A 4IYHA 1OJHA 3ZRVA 5J2UB 3ZCCA 2D3OW 3CMEV 3CRAA 1WP7A 3K06A 3DSQA 4PDVA 5LMUB 4DV7O 2PY5A 4KHPO 1BQ0A 1AI7A 1QVFU 1AVMA 4R7CA 1IBLB 5IY5B 2OCCB 4J7KA 4UCOA 4LF7O 3K5MA 1PD3A 2WAMA 5FPOA 2KKWA 1WLEA 1ZX3A 5B3SB 4U3JB 1RPRA 2FB5A 1GN4A 4LF9O 2QM7A 3RVZA 1MOFA 1I5XA 2YS8A 5C93A 1ENVA 4IT5A 5LGTA 3CHXA 1WAZA 4X89A 3H9VA 1FAFA 1AI4A 5KX5A 3U10A 1Q43A 2W6JG 1RSOA 3U0ZA 2HHHB 1NBMG 4GUNA 5CA1A 3WFVA 2IW5A 4DR7O 1WPBA 1JPXA 3E89A 3N2GB 2YI8A 1BHAA 2AXTZ 2V4DA 4JYCA 1AI5A 1QR8A 1PV0A 5C8YB 1M1KW 4O2BB 5TISZ 1QNMA 3L9DA 5IJ0A 4CS3A 3WG7C 1SA0B 4LWSA 3OTOB 1KECA 4NXMO 3K0GA 4OGQB 5H6RA 2N74A 4PELA 4MVOA 2P22C 5JQGA 4DR1O 4JF3A 2UXCB 2DWEC 2QKSA 3ABLB 2LFRA 3OEEG 2XHBA 1P49A 4CZZA 5BZBA 1P7BA 4I55B 3W7XA 1YTFD 3ZHUA 5KHHA 4O4LB 2AZ0A 4TOIA 2MK3A 4BWAA 2X6BA 3GB7C 4I55A 1QR9A 1HW7A 4JI7O 3JASB 3LDEA 1QU7A 1DF5A 3SJQC 2EJRA 3JATB 4GKKB 2JJ2G 3B8NA 4MVUA 2PTMA 4G28B 1URFA 4B3RO 2B1GA 3AG3B 1IXBA 1GM8A 4DW1A 3WB1A 1AB3A 5H2FZ 1LUVA 1BGYH 1G6UA 4CBCA 3ETDA 2RCVA 1K33A 5LOVA 3HPLC 2JGUA 4I4TB 1T5EA 1OCZB 5LHGA 3IJ4A 4R6ZA 4DXWA 1XNRO 5EK0A 3JARA 4R8CA 1IURA 2JGDA 5FL7G 1I7FA 2JS5A 4K8XA 1M90W 2BTQA 4YY3O 1Q82W 4QIWF 1SQPH 1N0NA 3MHSC 1R6TA 4F6RB 1F23A 1FXVA 2ZKOA 3E2EA 3RYCA 2XOKG 2ZE8A 2NLJC 1CPYA 2FKXA 2Q7EA 4I0XA 4LR3A 1V54C 2YEVA 3CRMA 4FPPA 3ABKC 5CBHA 2EBOA 3OM3B 5KX5B 3K5LA 3FFQA 1IX9A 3EFFK 4FZ0A 2PYJA 5LP6A 3H1KH 2GUZA 3VQWA 2WLLA 4RQFA 5E1AC 1S5JA 4MTXA 4TV9A 2ADPA 2Y0IA 5JWPA 5JQGB 1ROPA 4O2BA 1S5HC 4X62B 3M8AA 4JI6O 4I50B 1VQ8V 4TV8A 4FFBB 1VQKV 4FM1A 1H8HG 3B8MA 3CCEV 1NR7A 1YJ9V 3JD1A 4TSFG 3TETA 4FFBA 2WLIB 2ZT9B 1EN4A 4NTXA 4DV3O 5E79Z 1YJNV 1EZJA 2JEUA 3N2GA 2DN9A 5HFMA 2PUSA 3T4ZA 1M9NA 3OD4A 5KHJA 2JIZG 3LNNA 3JD0A 1FJGO 5IYBO 3FYEB 2ZNIA 1WA8B 5A9GA 1DLBA 1KU9A 4TUYA 4DR4B 3RYHB 4U7OA 3UKMA 3EHBB 3U11A 3ZHRA 1VF7A 3ZN0A 1EBOA 1W2BU 4OPAA 4YHHO 4H44B 2UUCB 1Q3EA 3WG7B 5IYZA 4DR6O 5K1PA 3RYCB 1OCZC 4DUZB 3ZX6A 1ZAUA 4LBEC 4J7ZA 4Q6GA 5EZYB 4O4HA 2ZE7A 4X66O 4DV3B 1EN5A 2LGQA 1MABG 3X2QB 1MA1A 3B77A 4DUYO 5DEDA 1V54B 1WP8A 3FB7C 3JCZA 2DJVA 2CTQA 3E8GA 5B66Z 4B3MO 1HNWB 2Y69B 2R9IA 3ASNC 4X1IB 1KYOF 2P4VA 1XNQO 4EB6A 4LH7A 3K9SA 3SJAC 4DV6B 3ZHVA 3D3QA 3ZEDA 2Q68A 4TQDA 4WBNB 1J5EB 1K4CC 4NXNB 2H94A 4Q20A 4DR4O 4I50A 4L87A 1U97A 4GCZA 5LXTB 1F4MA 4ZKIA 1O9HA 3E86A 3BY6A 4U3FH 2DYRB 3B2EE 4JGSA 2F4VO 3BHPA 4DV7B 1JVMA 1IDSA 3L70H 3JASA 5B1NA 2GTSA 3E22A 3E8HA 4BW5A 2PI4A 4LF7B 2AHZA 3PJSK 4IHJB 4D7TA 1Y74A 4CH3A 4D7SA 5J9PC 1BSMA 2Q6AA 4B7EA 3DXRB 1VQOV 3BAAA 4GX2A 1Q5OA 2HFEC 4LF9B 2OTLV 1D5NA 1N0JA 1Z5VA 1WB7A 1MZFA 3JARB 5CBFA 1K9MW 1XMOO 5IWAB 3MD0A 4DR5B 2UUCO 1OCOB 2HLDG 2JJ1G 4X62O 4ZHQB 3SYCA 1SERA 2ZNJA 2HVKC 3JD3A 2AHYA 3THOA 4LFCO 2UXBO 2BCCH 4TV8B 1L0LH 1FFXA 1MSWD 1VQ4V 1KUQA 5LGNA 2YUAA 3CCJV 3JAWB 4JI8B 3K08A 2E3CA 2F4VB 5J2TB 4UCRA 1ZL8A 3CS5A 1GN2A 3MDSA 1HNWO 4DV0O 4WFAV 2IH3C 1Q6IA 1IXMA 3FKSG 3QVNA 2LJ2A 2WLMA 2YC0A 4NB5A 4B08A 2DYSB 3K57A 4QE9A 2GUZB 4B3TO 4BIUA 1FXKA 1PNKA 5LMNO 4NKGB 4UB8Z 1MG1A 3G6BA 2Q9LA 1AR1B 1M56C 3FYIB 1JA8A 3OMIB 1S76D 2RN9A 4AILC 5KUMA 3TK1A 1KP2A 1R3KC 3STLC 4FLVA 2QE7G 2FTKA 2QDOA 4XDLA 2EIMC 3RGBA 2DE0X 2CK3G 2WLIA 1S77D 3ZMVA 4FM2A 5L3EA 5DM6V 2DMXA 5KMGB 1BZKA 2BSKA 5IYDO 2YXYA 4DR7B 2ZM6B 2JRIA 4CH6A 3CXCU 1KC8W 2YI9A 2DW4A 3D8CA 3AK2A 3DGEA 1K4DC 1NVPB 3JYCA 3K5OA 4LP8A 3C90A 1VQ6V 2DYRC 3UT5A 1XREA 4YJ2A 3CJHA 4PA9A 2P67A 1WB8A 2BE3A 3CX5F 4CH5A 5JJNB 1N34B 1NR1A 1V55B 1H8EG 1TUBA 5D5QA 1SZTA 1M57B 4BAYA 5LGUA 3L75H 2CH7A 3B09A 2KB1A 1TVKA 4FFKA 1SQVH 1PNLA 4PI0A 1M57C 2P6JA 4DRXB 4WCEV 3T1CA 4LF5O 1H2SB 3P3NA 2E76B 4B3TB 4OX9O 1XHXA 2JDIG 1VIBA 2UUBB 2GTAA 3JD2A 1EN6A 3RN4A 3DXRA 5LYJA 3P30A 3SPCA 5FNVB 4I9QA 4E2LA 2G38A 2WLNA 5JJEB 3ASOC 4DR5O 2RQ6A 2AGAA 1M56B 5EYPA 1JFFA 2PZSA 3ZN1A 2CTPA 3GWKC 1QVGU 5LXTA 1N34O 2NN4A 1G1XB 2ILMA 2Y4TA 1PP9H 3KCXA 1CEZA 1L1FA 2ETNA 3L71H 2EINB 1KB9F 4HYOA 5KMGA 1M4UA 1Q90D 2XAQA 1HWYA 1IBKO 5IJ9B 4IHJA 1OCCB 3S3WA 1VF6C 4UUJC 2L35A 5GTHZ 1DTOA 1DF4A 4CC5A 3K9AA 5CA3A 1ZLZA 1N36O 2UUBO 2F23A 1R6KA 4X1KA 4LF6O 3M99B 4DK1A 2UXDB 5KAIZ 3E22B 4GKJO 5KHGA 4N23A 2R9AA 1TVKB 2HEPA 2RJZA 4YJ2B 5A2QN 2EIKC 3SDLA 3FB8C 5B3SC 3DC5A 2Q7HA 1GN6A 5B1OA 1LR1A 2CDYA 2A06H 1XI1A 4DR6B 4RWUA 1FYJA 4X1IA 5GONB 4LF8O 2PF4E 5J2UA 4XBFA 2CUGA 1G4YB 2B9ZA 2AZ2A 2EX3A 2Y48A 3RYHA 4E4EA 3D3IA 1AR4A 1GMGA 3HKBB 4DV2B 1VMGA 1VQLV 2QKAA 1JMKC 4P9OA 1R1BA 5KA5A 5F2VO 1QCEA 1VQMV 3ZRWB 1JOYA 2LO1A 4D6TH 3A0BZ 4GX5A 3A0RA 4HZ3A 5GTIZ 4J10A 3CB2A 1PL4A 2A7WA 2P90A 3F7YC 4X65B 4AQYO 1QLEC 1FKAO 1TGOA 1QLEB 2EJ7A 3HR0A 3OGIB 3CD6V 4R50A 1J95A 5KAFZ 4DV1O 2QTOA 4G27B 2R72A 4EEQA 2WSSG 2QGNA 4O4JA 2QWQB 4JTDB 4TV9B 2QEXV 1XUQA 4FLXA 2EZOA 1I5YA 1VQPV 2EZPA 1E1RG 1B04A 2UUAO 2GHYA 1K97A 2EIJC 5IWAO 4F6RA 4QPKA 2X6CA 2H3OA 4AHCA 5KUKA 1R73A 3E8FA 4ZHQA 5H9CA 1XNRB 2X7RB 3ABMC 3TGUH 2WLKA 3HKEA 3QG5A 4ZI7B 1B3QA 1YVWA 4O4IB 2UXBB 4FLZA 1K3EA 4UVBA 4QNHB 3JAKA 5CBGA 2HHHO 3LDCA 1HP8A 2QWPB 4NXNO 1DGSA 4JAAA 1YEWA 3BCCH 3ZS8C 1BCCH 2DYSC 4UCTA 1Y76A 2Q0OC 4DV1B 3K5NA 4RQEA 1XL6A 4MTGA 2EULA 4JI4B 4H0LB 2HP8A 3H1LH 3ZMUA 1Y67A 3AG7A 2VWKA 3APQA 4FVMA 2JEXA 3OR6C 4LF6B 2YDEA 2P5OA 3CCVV 5AG2A 3Q4HA 1SC5B 1W0JG 4UVAA 1SS3A 4CS4A 2RNBA 2DWDC 2E5LB 1SQFA 4MSWC 1K5SA 5LA6B 2UU9O 1R3JC 4F4LA 1RFYA 2Z5UA 4JYAO 1R3IC 4O4LA 1UFIA 1UJWB 2RDCA 2IJIA 2ZCEA 1RP3B 2XAHA 1XILA 2HJFC 3JALA 3KG2A 4ICGA 1H2MA 1ZL8B 2HVJC 3JALB 3LSSA 1QBZA 1YJWV 1CP9A 4FJCC 3J80N 5IT9N 2R9RB 1YTFB 2XUMA 3OW2U 1AJNA 3K3WA 3UM7A 1H38A 5CA1B 4UCUA 4JV5O 5IY5C 1L0NH 4JI4O 3AEIA 5EC2C 1P7GA 3RFRA 3N2KA 2EIJB 3CC7V 2ODMA 3R66A 3TXSA 1NS1A 2WA3A 1K8AW 1SZXA 3SPGA 4EKWA 1I0HA 2E5LO 3DC6A 1GK9A 5ITZB 4X1KB 3B4SA 4DRXA 1OCOC 4TQFA 5ITZA 4J11A 1ORQC 3HKDB 4LF5B 3OTFA 3HKCB 5L3DA 5D5PA 1AP5A 4YJ3A 2LW7A 3CYOA 5BMVA 3VQVA 1KD1W 3SYAA 1SRYA 1HNXB 2XAGA 3K79A 3ETGA 2ZQMA 2UUAB 4PJ0Z 3OAAG 4I5SA 2NR5A 3A2FA 3ETQA 1M93A 4DV6O 2BTQB 2A79B 4J7JA 5B1BC 2R70A 4EFBA 2B5UA 4X9QA 4LF4B 2EIMB 3RT3C 2QM4A 3L72H 4RAIA 3CC2V 1S0VA 4N21A 1GTOA 1YCIA 3K04A 3QO8A 2WLLB 3RBZA 4FLTA 1A32A 3EVKA 1BL8A 2ZR2A 4FLUA 4JZ2A 4EB6B 5EIBD 1BE3H 1HNZB 2QM8A 3N27A 1VEWA 5BXZA 2HG5C 3B40A 1UPGA 3HKBA 4JI2O 2NNUA 1I94B 1Z5WA 5LA6A 5BR8O 3T1YO 2EIKB 3W7UA 4TT3G 4IIJA 1Q81W 4J9YB 1O9GA 5CA0A 5IE9A 3IFXA 5L3BA 1L8DA 4GYCB 4MT8A 1F51A 2YIAA 3SPIA 2UXDO 3SPHA 4YIOA 5EBMC 2QWOB 2YIBA 3K03A 3E35A 1GO3F 4EFEA 4HNAB 2YXHA 4JI7B 4FLYA 1Q86W 5K1XA 3DTUB 4LF8B 3ASNB 4K0KB 1XQ8A 1KP3A 1VQ7V 1K5QA 4H37A 3IC7A 1R6NA 1GH6A 3JAWA 1QQCA 5EZYA 1H2GA 2D2CB 3UO2A 2GBOA 3BA8A 4UVCA 1Y76B 4MTFA 1IVSA 3CXHF 2QSAA 3HKEB 4ZI7A 3MAQA 3R65A 3AG1B 4K3AA 4DV0B 2QKCA 1YI2V 2FL4A 3T1HB 4JV5B 4DK0A 4JPRA 4WFEA 1QHTA 2QR4A 3F7VC 4AQYB 2Z0AA 5EBLC 1FXKB 4UFZA 4TUYB 1HR0B 1XDCA 1RPOA 4X8AA 4JI5B 1SQBH 5B1AB 3HKCA 4WFHA 3A0HZ 1JJOA 3P3PA 4JAVA 3LSUA 1HNZO 3FAVB 5FLXN 4QGPA 1NI8A 2IJKA 2KG7B 3CEIA 3CCSV 2HJDA 4FLWA 1SETA 5KHIA 3ICXA 3QF7A 2C2AA 5C8YA 2O57A 3P32A 4IL6Z 3AG3C 4DW0A 4IIJB 3ABLC 1Q6HA 3ZMSA 1YF2A 3I55V 4DV2O 1XMOB 4C7UA 5IDJA 2ZE5A 4DV4O 3JAMN 4JI6B 2ZXWB 1NTKH 3ASOB 2E75B 4QPJA 3I56V 1VQ5V 1KKDA 1TA8A 4UV9A 1BHBA 1S5LZ 4MW3A 2ITCC 1M5IA 4X1YA 2AW9A 4JI8O 4GLXA 1SQXH 2FMLA 4DV5O 3JATA 1FD9A 1KQSU 4JI1B 1PM9A 2BSKB 3AK1A 3SJBC 1OCCC 2LFSA 1MNGA 3SGIA 5DN6G 1OCRB 4U3JA 1HR0O 1MZEA 3QTCA 4XDJA 4HBNA 3ABUA 1PL0A 3EXAA 1K73W 1K92A 2QTSA 3Q4HB 4XDKA 1H2KA 3G67A 1N33B 4J41A 1IBMB 1W59A 2K1EA 4ZBMA 2JGDB 2YICA 1OZ0A 1RM1C 3A8TA 4YHHB 4IYIA 4P30A 4JYBA 3VBBA 1F4NA 1Z2GA 3L73H 2HKOA 1RM1B 4I4TA 4MVZA 2Q5ZA 3FB6C 4UV8A 5HFLA 3UO3A 4HAMA 3SJCC 3CCLV 3JD4A 3VOUA 2ZM6O 1S72V 4LNUB 2VQFO 4RUEA 3OGCC 3TJTA 2X6AA 4MVRA 4YXWG 5B1BB 3TXQA 3IAYA 4RUFA 4FK5C 1YITV 1P4RA 1RSOB 3ZMZA 3AG2C 3OTOO 2LQTA 3KZIZ 4W4LA 1NU1H 2EINC 2Y4UA 2XASA 1FPOA 3FB5C 1N36B 4CS2A 1NTZH 3T4DA 1LNQA 2HR3A 4CH4A 2PI5A 1IBMO 4GZRB 2QWNB 3WB2A 4FZ1A 3T2MA 4DV5B 4DO2A 2YIDA 3BPZA 2UU9B 3HKDA 1GM7A 2KG7A 4JYAB 3JCUZ 3ZIAG 2JK5C 1MSDA 4PDRA 1FXHA 4UXNA 1YSCA 1JJ2U 4OX9B 1THZA 4I0XB 2ADQB 4LWSB 4A5UB 5JCOC 1BT8A 2XAFA 4OPHA 3RW0A 1NH2B 2VQFB 3SPJA 1G8MA 3BFRA 3S3XA 1V9PA 2UXNA 3OMNB 4JI3B 4DV4B 2OT5A 2ZDIA 2CGNA 4K8ZA 1EZVH 2KQXA 1BMFG 1N32O 4U7NA 2WPDG 4I9WA 1E79G 2A9HA 4I7ZB 5JH7B 4MS2A 1DK1A 2F43G 1BS3A 3H01A 2LW1A 4P2ZA 3CRCA 4LCUC 1XL4A 2GDSA 4JI2B 4NYKA 3ZHSA 1NJIW 4BIZA 3CCMV 3RYIB 3I5DA 1IBKB 4JI1O 1XEQA 2ZR3A 4O4HB 2QJ1A 4KUMA 3RYFB 2UXXA 1NQTA 5B1AC 2CAZC 3SR2C 1VF6A 2XTAA 4Z2WA 4O4IA 5LMNB 2ZE6A 5KHKA 4JZGA 1IZ3A 4DR1B 2UXCO 4L8JA 1TAEA 3OR7C 4B3SO 4WFBV 1WN7A 1N33O 4BIOA 4FM0A 1AJPA 5IJ9A 3SYPA 1SQGA 3OMAB 3SYQA 2WLHA 3D36A 2OCCC 5LHIA 2DQ3A 2YEVB 4JTAB 2WWWA 5LOVB 1NTMH 1B6QA 2F66C 1US6A 3F5WC 4JI0B 2EILB 2Q73A 4X64B 1HDJA 1K7DA 1NKDA 2ZD9A 4PA6A 1V55C 4W4KA 5IYZB 1JCHA 3PN1A 1ZSPA 4WBNA 5JCOA 4J9ZB 3JAKB 1XMQB 1Q6UA 4GT1A 3CC4V 2IU3A 2IH1C 1R3LC 3UQ8A 3BEHA 1FS0G 1YZBA 4X65O 1AI6A 3CSXA 3JSNA 1GKFA 3G6EV 2F95B 1W0KG 3AG4B 4HNAA 4B3SB 2XT9A 1Y74B 1KKCA 2WA4A 4PDLA 2PGGA 2Q8VA 3CCQV 1BQZA 2K9PA 3K0DA 2CTRA 1COWG 3ZBHA 2A3QA 2IM9A 1GRJA 1YHQV 3RYIA 2ATKC 1Q7YW 1NH2D 5EBWC 3RVYA 3SYOA 3ZRWA 1AJQA 4MVMA 3OEHG 3G71V 5KA6A 1XOUA 4B3MB 3G80A 4PI2A 4TWKA 4JI3O 2CTWA 4MTOA 3ZHQA 5IYCO 1XMQO 2OTJV 4B7KA 3K59A 1YDXA 3T1HO 2V7QG 4LNUA 4ZOLA 1VF5B 1N32B 1AILA 4Z1MG 2YIBD 5KLVH 4WFGA 1N8RW 3VQXA 4ZOLB 1SKVA 1J5EO 3X2QC 4UCSA 2RMKB 5LYJB 2CGOA 4PA4A 3NR7A 1AR5A 4JI5O 1OHHG 2ZIMA 3E8BA 5H5NA 2EILC 1CXZB 3J81N 4WF9V 5FPRA 3L74H 4J42A 3CRRA 3LSQA 1FJGB 1Y4MA 2XNDG 3KKYA 5BY1A 1QLNA 4JAUA 4NR1A 2OWOA 2W0XA 2GV9A 5CMUA 1HNXO 3KCYA 3M7MX 2P4KA 3H1JH 3O65A 1WA8A 5CA0B 4GKJB 2IBZH 4PD4F 5LHHA 3WU2Z 5EIBC 2QWRB 4O4JB 2XAJA 5L3GA 3CMAV 4KXRA 1GN3A 5JH7A 1XBLA 2ITDC 5BMVB 4YIPA 1FFTB 3AK3A 3QO7A 3RWRD 1SA0A 1P84F 3OFNG 4X88A 4JI0O 2ZDIC 4H33A 4B3RB 2IJJA 4DYLA 4DUZO 2F93B 2M7WA 5B5EZ 1SESA 4KL1A 4UB6Z 4OXSA 4X66B 1NVPD 2CH7B 3LNMB 4Z1VA 4G2KA 3ZRXA 1VQ9V 4GX0A 4JTCB 1B06A 3ABKB 4JYYA 4H13B 5BR8B 4RO2A 4IGGA 2MW2B 4NXMB 2OIEA 2ZXWC 3ZHTA 4CC6A 2V1DA 2JVDA 4X20B 1GM9A 2H8PC 2BOBC 2VQEB 3WB0A 3ML0A 1JR9A 5CB4A 3MHHC 2P7TC 3OUFA 4J80A 2Z3YA 2LGWA 3BRCA 3ETEA 3JSLA 4DR2B 4LH6A 3FAVA 1WPXA 3CPWU 2Y69C 1PPJH 4MVSA 3IC9A 2PYLA 3C3TA 3N2KB 2OYQA 1GAXA 3APOA 5GW7A 3ZRSA 4DR3O 4KP4A 1S3JA 2ZIOA 5IJ0B 5DECA 5LL6Y 1NZ6A 2KSDA 3QNEA 2WLJA 1WNSA 3AG4C 3BVOA 1FFXB 3ZJZA 3J7AU 4NTWA 1OV9A 2B1IA 2JS3A 4PHZA 4LFBO 3HB3B 5J2TA 4MW8A 3CP1A 3BA9A 4KFMA 4PA3A 3BABA 3ABTA 4LFCB 3W7WA 3G4SV 3NXSA 4LF4O 1X4TA 1Y6XA 3VQYA 2VQEO 2YXLA 1JFFB 1I08A 2VS0A 3FX7A 3GVMA 4ASUG 3K58A 5LP6B 2FYUH 1JX9A 2Q4PA 1FXKC 4P9PA 4PV1B 3OT7A 3RYFA 1ZWIC 5LBQA 4ABMA 3UCSC 3CWBH 1IBLO 1I94O 2YSUB 5EC1C 4QE7A 1PKXA 3T1YB 1TUEB 3C3SA 4DR3B 2W6IG 2Q67A 3GWOA 1WJZA 2IU0A 2Q0AA 5L3FA 4LC1A 1E1QG 1LUWA 3LUTB 5FNVA 3CCUV 4JASA 3UT5B 4DR2O 4X20A 2ARHA 2GSMB 4MVQA 4YJ3B 3LDDA 3AG1C 1XHZA 2Q7GA 3O9OA 3CE2A 1TUBB 4FIPC 3IGAC 4LFAB 2M6YA 4QJFB 4K0KO 1SQQH 2OIGA 2Q69A 4UCVA 3W7SA 2VWJA 3F5TA 3OE7G 4DUYB 5GONA 1MMMA 4NVPA 3H1IH 2QA4V 1Y66A 3ZMTA 1K34A 4PDMA 4LFBB 1YXBA 1VP7A 2X0LA 1H2LA 1SF9A 3ABMB
chains in the Genus database with same CATH topology
1YVWA 2GTAA 2YXHA 1VMGA 1Y6XA 2A7WA 2Q73A 3C90A 2P06A 2A3QA 1YXBA 2OIGA 2OIEA 3CRCA 2Q5ZA 5IE9A 4QGPA 3CRAA 2Q9LA 2Q4PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YVW A;  2GTA A;  2YXH A;  1VMG A;  1Y6X A;  2A7W A;  2Q73 A;  3C90 A;  2P06 A;  2A3Q A;  1YXB A;  2OIG A;  2OIE A;  3CRC A;  2Q5Z A;  5IE9 A;  4QGP A;  3CRA A;  2Q9L A;  2Q4P A; 
#chains in the Genus database with same CATH topology
 5CN0 A;  2Y0P A;  1ZUQ A;  2A0L A;  1D2D A;  2E74 B;  3TCU A;  1U96 A;  2BOC C;  1Q8I A;  1OCR C;  4WFF A;  2BTO A;  3D36 C;  1AP6 A;  1ARO P;  4FMT A;  3FD9 A;  3E83 A;  1N4C A;  2VRZ A;  4ZIB A;  1NT2 B;  1JQ0 A;  2IJH A;  5LMU O;  3W7T A;  4KHP B;  2W0F C;  5JVD A;  4BR6 A;  4LFA O;  2ZIN A;  5JJJ B;  1F7Y A;  5JVD B;  3CJH B;  4GKK O;  5LP6 C;  2OCH A;  4X64 O;  1D5A A;  3STZ C;  2N05 A;  1H2N A;  5CB4 B;  4PA7 A;  2L6L A;  3H1H H;  2DQ0 A;  2F1M A;  3CCR V;  5L3C A;  1EM1 A;  4X1Y B;  1ZTE A;  2P06 A;  2N04 A;  3CRQ A;  1VQN V;  1PNM A;  2CE4 A;  4F6E A;  3OUS A;  4O2A A;  1KBH A;  1XNQ B;  1EFR G;  2LP7 A;  3QO5 A;  2DOS A;  4YY3 B;  1X59 A;  4O2A B;  4BW9 A;  3AG2 B;  1YIJ V;  5H6Q A;  4K35 A;  5EYP B;  1KMI Z;  4NTY A;  1VAR A;  4GX1 A;  4AI8 A;  4IYH A;  1OJH A;  3ZRV A;  5J2U B;  3ZCC A;  2D3O W;  3CME V;  3CRA A;  1WP7 A;  3K06 A;  3DSQ A;  4PDV A;  5LMU B;  4DV7 O;  2PY5 A;  4KHP O;  1BQ0 A;  1AI7 A;  1QVF U;  1AVM A;  4R7C A;  1IBL B;  5IY5 B;  2OCC B;  4J7K A;  4UCO A;  4LF7 O;  3K5M A;  1PD3 A;  2WAM A;  5FPO A;  2KKW A;  1WLE A;  1ZX3 A;  5B3S B;  4U3J B;  1RPR A;  2FB5 A;  1GN4 A;  4LF9 O;  2QM7 A;  3RVZ A;  1MOF A;  1I5X A;  2YS8 A;  5C93 A;  1ENV A;  4IT5 A;  5LGT A;  3CHX A;  1WAZ A;  4X89 A;  3H9V A;  1FAF A;  1AI4 A;  5KX5 A;  3U10 A;  1Q43 A;  2W6J G;  1RSO A;  3U0Z A;  2HHH B;  1NBM G;  4GUN A;  5CA1 A;  3WFV A;  2IW5 A;  4DR7 O;  1WPB A;  1JPX A;  3E89 A;  3N2G B;  2YI8 A;  1BHA A;  2AXT Z;  2V4D A;  4JYC A;  1AI5 A;  1QR8 A;  1PV0 A;  5C8Y B;  1M1K W;  4O2B B;  5TIS Z;  1QNM A;  3L9D A;  5IJ0 A;  4CS3 A;  3WG7 C;  1SA0 B;  4LWS A;  3OTO B;  1KEC A;  4NXM O;  3K0G A;  4OGQ B;  5H6R A;  2N74 A;  4PEL A;  4MVO A;  2P22 C;  5JQG A;  4DR1 O;  4JF3 A;  2UXC B;  2DWE C;  2QKS A;  3ABL B;  2LFR A;  3OEE G;  2XHB A;  1P49 A;  4CZZ A;  5BZB A;  1P7B A;  4I55 B;  3W7X A;  1YTF D;  3ZHU A;  5KHH A;  4O4L B;  2AZ0 A;  4TOI A;  2MK3 A;  4BWA A;  2X6B A;  3GB7 C;  4I55 A;  1QR9 A;  1HW7 A;  4JI7 O;  3JAS B;  3LDE A;  1QU7 A;  1DF5 A;  3SJQ C;  2EJR A;  3JAT B;  4GKK B;  2JJ2 G;  3B8N A;  4MVU A;  2PTM A;  4G28 B;  1URF A;  4B3R O;  2B1G A;  3AG3 B;  1IXB A;  1GM8 A;  4DW1 A;  3WB1 A;  1AB3 A;  5H2F Z;  1LUV A;  1BGY H;  1G6U A;  4CBC A;  3ETD A;  2RCV A;  1K33 A;  5LOV A;  3HPL C;  2JGU A;  4I4T B;  1T5E A;  1OCZ B;  5LHG A;  3IJ4 A;  4R6Z A;  4DXW A;  1XNR O;  5EK0 A;  3JAR A;  4R8C A;  1IUR A;  2JGD A;  5FL7 G;  1I7F A;  2JS5 A;  4K8X A;  1M90 W;  2BTQ A;  4YY3 O;  1Q82 W;  4QIW F;  1SQP H;  1N0N A;  3MHS C;  1R6T A;  4F6R B;  1F23 A;  1FXV A;  2ZKO A;  3E2E A;  3RYC A;  2XOK G;  2ZE8 A;  2NLJ C;  1CPY A;  2FKX A;  2Q7E A;  4I0X A;  4LR3 A;  1V54 C;  2YEV A;  3CRM A;  4FPP A;  3ABK C;  5CBH A;  2EBO A;  3OM3 B;  5KX5 B;  3K5L A;  3FFQ A;  1IX9 A;  3EFF K;  4FZ0 A;  2PYJ A;  5LP6 A;  3H1K H;  2GUZ A;  3VQW A;  2WLL A;  4RQF A;  5E1A C;  1S5J A;  4MTX A;  4TV9 A;  2ADP A;  2Y0I A;  5JWP A;  5JQG B;  1ROP A;  4O2B A;  1S5H C;  4X62 B;  3M8A A;  4JI6 O;  4I50 B;  1VQ8 V;  4TV8 A;  4FFB B;  1VQK V;  4FM1 A;  1H8H G;  3B8M A;  3CCE V;  1NR7 A;  1YJ9 V;  3JD1 A;  4TSF G;  3TET A;  4FFB A;  2WLI B;  2ZT9 B;  1EN4 A;  4NTX A;  4DV3 O;  5E79 Z;  1YJN V;  1EZJ A;  2JEU A;  3N2G A;  2DN9 A;  5HFM A;  2PUS A;  3T4Z A;  1M9N A;  3OD4 A;  5KHJ A;  2JIZ G;  3LNN A;  3JD0 A;  1FJG O;  5IYB O;  3FYE B;  2ZNI A;  1WA8 B;  5A9G A;  1DLB A;  1KU9 A;  4TUY A;  4DR4 B;  3RYH B;  4U7O A;  3UKM A;  3EHB B;  3U11 A;  3ZHR A;  1VF7 A;  3ZN0 A;  1EBO A;  1W2B U;  4OPA A;  4YHH O;  4H44 B;  2UUC B;  1Q3E A;  3WG7 B;  5IYZ A;  4DR6 O;  5K1P A;  3RYC B;  1OCZ C;  4DUZ B;  3ZX6 A;  1ZAU A;  4LBE C;  4J7Z A;  4Q6G A;  5EZY B;  4O4H A;  2ZE7 A;  4X66 O;  4DV3 B;  1EN5 A;  2LGQ A;  1MAB G;  3X2Q B;  1MA1 A;  3B77 A;  4DUY O;  5DED A;  1V54 B;  1WP8 A;  3FB7 C;  3JCZ A;  2DJV A;  2CTQ A;  3E8G A;  5B66 Z;  4B3M O;  1HNW B;  2Y69 B;  2R9I A;  3ASN C;  4X1I B;  1KYO F;  2P4V A;  1XNQ O;  4EB6 A;  4LH7 A;  3K9S A;  3SJA C;  4DV6 B;  3ZHV A;  3D3Q A;  3ZED A;  2Q68 A;  4TQD A;  4WBN B;  1J5E B;  1K4C C;  4NXN B;  2H94 A;  4Q20 A;  4DR4 O;  4I50 A;  4L87 A;  1U97 A;  4GCZ A;  5LXT B;  1F4M A;  4ZKI A;  1O9H A;  3E86 A;  3BY6 A;  4U3F H;  2DYR B;  3B2E E;  4JGS A;  2F4V O;  3BHP A;  4DV7 B;  1JVM A;  1IDS A;  3L70 H;  3JAS A;  5B1N A;  2GTS A;  3E22 A;  3E8H A;  4BW5 A;  2PI4 A;  4LF7 B;  2AHZ A;  3PJS K;  4IHJ B;  4D7T A;  1Y74 A;  4CH3 A;  4D7S A;  5J9P C;  1BSM A;  2Q6A A;  4B7E A;  3DXR B;  1VQO V;  3BAA A;  4GX2 A;  1Q5O A;  2HFE C;  4LF9 B;  2OTL V;  1D5N A;  1N0J A;  1Z5V A;  1WB7 A;  1MZF A;  3JAR B;  5CBF A;  1K9M W;  1XMO O;  5IWA B;  3MD0 A;  4DR5 B;  2UUC O;  1OCO B;  2HLD G;  2JJ1 G;  4X62 O;  4ZHQ B;  3SYC A;  1SER A;  2ZNJ A;  2HVK C;  3JD3 A;  2AHY A;  3THO A;  4LFC O;  2UXB O;  2BCC H;  4TV8 B;  1L0L H;  1FFX A;  1MSW D;  1VQ4 V;  1KUQ A;  5LGN A;  2YUA A;  3CCJ V;  3JAW B;  4JI8 B;  3K08 A;  2E3C A;  2F4V B;  5J2T B;  4UCR A;  1ZL8 A;  3CS5 A;  1GN2 A;  3MDS A;  1HNW O;  4DV0 O;  4WFA V;  2IH3 C;  1Q6I A;  1IXM A;  3FKS G;  3QVN A;  2LJ2 A;  2WLM A;  2YC0 A;  4NB5 A;  4B08 A;  2DYS B;  3K57 A;  4QE9 A;  2GUZ B;  4B3T O;  4BIU A;  1FXK A;  1PNK A;  5LMN O;  4NKG B;  4UB8 Z;  1MG1 A;  3G6B A;  2Q9L A;  1AR1 B;  1M56 C;  3FYI B;  1JA8 A;  3OMI B;  1S76 D;  2RN9 A;  4AIL C;  5KUM A;  3TK1 A;  1KP2 A;  1R3K C;  3STL C;  4FLV A;  2QE7 G;  2FTK A;  2QDO A;  4XDL A;  2EIM C;  3RGB A;  2DE0 X;  2CK3 G;  2WLI A;  1S77 D;  3ZMV A;  4FM2 A;  5L3E A;  5DM6 V;  2DMX A;  5KMG B;  1BZK A;  2BSK A;  5IYD O;  2YXY A;  4DR7 B;  2ZM6 B;  2JRI A;  4CH6 A;  3CXC U;  1KC8 W;  2YI9 A;  2DW4 A;  3D8C A;  3AK2 A;  3DGE A;  1K4D C;  1NVP B;  3JYC A;  3K5O A;  4LP8 A;  3C90 A;  1VQ6 V;  2DYR C;  3UT5 A;  1XRE A;  4YJ2 A;  3CJH A;  4PA9 A;  2P67 A;  1WB8 A;  2BE3 A;  3CX5 F;  4CH5 A;  5JJN B;  1N34 B;  1NR1 A;  1V55 B;  1H8E G;  1TUB A;  5D5Q A;  1SZT A;  1M57 B;  4BAY A;  5LGU A;  3L75 H;  2CH7 A;  3B09 A;  2KB1 A;  1TVK A;  4FFK A;  1SQV H;  1PNL A;  4PI0 A;  1M57 C;  2P6J A;  4DRX B;  4WCE V;  3T1C A;  4LF5 O;  1H2S B;  3P3N A;  2E76 B;  4B3T B;  4OX9 O;  1XHX A;  2JDI G;  1VIB A;  2UUB B;  2GTA A;  3JD2 A;  1EN6 A;  3RN4 A;  3DXR A;  5LYJ A;  3P30 A;  3SPC A;  5FNV B;  4I9Q A;  4E2L A;  2G38 A;  2WLN A;  5JJE B;  3ASO C;  4DR5 O;  2RQ6 A;  2AGA A;  1M56 B;  5EYP A;  1JFF A;  2PZS A;  3ZN1 A;  2CTP A;  3GWK C;  1QVG U;  5LXT A;  1N34 O;  2NN4 A;  1G1X B;  2ILM A;  2Y4T A;  1PP9 H;  3KCX A;  1CEZ A;  1L1F A;  2ETN A;  3L71 H;  2EIN B;  1KB9 F;  4HYO A;  5KMG A;  1M4U A;  1Q90 D;  2XAQ A;  1HWY A;  1IBK O;  5IJ9 B;  4IHJ A;  1OCC B;  3S3W A;  1VF6 C;  4UUJ C;  2L35 A;  5GTH Z;  1DTO A;  1DF4 A;  4CC5 A;  3K9A A;  5CA3 A;  1ZLZ A;  1N36 O;  2UUB O;  2F23 A;  1R6K A;  4X1K A;  4LF6 O;  3M99 B;  4DK1 A;  2UXD B;  5KAI Z;  3E22 B;  4GKJ O;  5KHG A;  4N23 A;  2R9A A;  1TVK B;  2HEP A;  2RJZ A;  4YJ2 B;  5A2Q N;  2EIK C;  3SDL A;  3FB8 C;  5B3S C;  3DC5 A;  2Q7H A;  1GN6 A;  5B1O A;  1LR1 A;  2CDY A;  2A06 H;  1XI1 A;  4DR6 B;  4RWU A;  1FYJ A;  4X1I A;  5GON B;  4LF8 O;  2PF4 E;  5J2U A;  4XBF A;  2CUG A;  1G4Y B;  2B9Z A;  2AZ2 A;  2EX3 A;  2Y48 A;  3RYH A;  4E4E A;  3D3I A;  1AR4 A;  1GMG A;  3HKB B;  4DV2 B;  1VMG A;  1VQL V;  2QKA A;  1JMK C;  4P9O A;  1R1B A;  5KA5 A;  5F2V O;  1QCE A;  1VQM V;  3ZRW B;  1JOY A;  2LO1 A;  4D6T H;  3A0B Z;  4GX5 A;  3A0R A;  4HZ3 A;  5GTI Z;  4J10 A;  3CB2 A;  1PL4 A;  2A7W A;  2P90 A;  3F7Y C;  4X65 B;  4AQY O;  1QLE C;  1FKA O;  1TGO A;  1QLE B;  2EJ7 A;  3HR0 A;  3OGI B;  3CD6 V;  4R50 A;  1J95 A;  5KAF Z;  4DV1 O;  2QTO A;  4G27 B;  2R72 A;  4EEQ A;  2WSS G;  2QGN A;  4O4J A;  2QWQ B;  4JTD B;  4TV9 B;  2QEX V;  1XUQ A;  4FLX A;  2EZO A;  1I5Y A;  1VQP V;  2EZP A;  1E1R G;  1B04 A;  2UUA O;  2GHY A;  1K97 A;  2EIJ C;  5IWA O;  4F6R A;  4QPK A;  2X6C A;  2H3O A;  4AHC A;  5KUK A;  1R73 A;  3E8F A;  4ZHQ A;  5H9C A;  1XNR B;  2X7R B;  3ABM C;  3TGU H;  2WLK A;  3HKE A;  3QG5 A;  4ZI7 B;  1B3Q A;  1YVW A;  4O4I B;  2UXB B;  4FLZ A;  1K3E A;  4UVB A;  4QNH B;  3JAK A;  5CBG A;  2HHH O;  3LDC A;  1HP8 A;  2QWP B;  4NXN O;  1DGS A;  4JAA A;  1YEW A;  3BCC H;  3ZS8 C;  1BCC H;  2DYS C;  4UCT A;  1Y76 A;  2Q0O C;  4DV1 B;  3K5N A;  4RQE A;  1XL6 A;  4MTG A;  2EUL A;  4JI4 B;  4H0L B;  2HP8 A;  3H1L H;  3ZMU A;  1Y67 A;  3AG7 A;  2VWK A;  3APQ A;  4FVM A;  2JEX A;  3OR6 C;  4LF6 B;  2YDE A;  2P5O A;  3CCV V;  5AG2 A;  3Q4H A;  1SC5 B;  1W0J G;  4UVA A;  1SS3 A;  4CS4 A;  2RNB A;  2DWD C;  2E5L B;  1SQF A;  4MSW C;  1K5S A;  5LA6 B;  2UU9 O;  1R3J C;  4F4L A;  1RFY A;  2Z5U A;  4JYA O;  1R3I C;  4O4L A;  1UFI A;  1UJW B;  2RDC A;  2IJI A;  2ZCE A;  1RP3 B;  2XAH A;  1XIL A;  2HJF C;  3JAL A;  3KG2 A;  4ICG A;  1H2M A;  1ZL8 B;  2HVJ C;  3JAL B;  3LSS A;  1QBZ A;  1YJW V;  1CP9 A;  4FJC C;  3J80 N;  5IT9 N;  2R9R B;  1YTF B;  2XUM A;  3OW2 U;  1AJN A;  3K3W A;  3UM7 A;  1H38 A;  5CA1 B;  4UCU A;  4JV5 O;  5IY5 C;  1L0N H;  4JI4 O;  3AEI A;  5EC2 C;  1P7G A;  3RFR A;  3N2K A;  2EIJ B;  3CC7 V;  2ODM A;  3R66 A;  3TXS A;  1NS1 A;  2WA3 A;  1K8A W;  1SZX A;  3SPG A;  4EKW A;  1I0H A;  2E5L O;  3DC6 A;  1GK9 A;  5ITZ B;  4X1K B;  3B4S A;  4DRX A;  1OCO C;  4TQF A;  5ITZ A;  4J11 A;  1ORQ C;  3HKD B;  4LF5 B;  3OTF A;  3HKC B;  5L3D A;  5D5P A;  1AP5 A;  4YJ3 A;  2LW7 A;  3CYO A;  5BMV A;  3VQV A;  1KD1 W;  3SYA A;  1SRY A;  1HNX B;  2XAG A;  3K79 A;  3ETG A;  2ZQM A;  2UUA B;  4PJ0 Z;  3OAA G;  4I5S A;  2NR5 A;  3A2F A;  3ETQ A;  1M93 A;  4DV6 O;  2BTQ B;  2A79 B;  4J7J A;  5B1B C;  2R70 A;  4EFB A;  2B5U A;  4X9Q A;  4LF4 B;  2EIM B;  3RT3 C;  2QM4 A;  3L72 H;  4RAI A;  3CC2 V;  1S0V A;  4N21 A;  1GTO A;  1YCI A;  3K04 A;  3QO8 A;  2WLL B;  3RBZ A;  4FLT A;  1A32 A;  3EVK A;  1BL8 A;  2ZR2 A;  4FLU A;  4JZ2 A;  4EB6 B;  5EIB D;  1BE3 H;  1HNZ B;  2QM8 A;  3N27 A;  1VEW A;  5BXZ A;  2HG5 C;  3B40 A;  1UPG A;  3HKB A;  4JI2 O;  2NNU A;  1I94 B;  1Z5W A;  5LA6 A;  5BR8 O;  3T1Y O;  2EIK B;  3W7U A;  4TT3 G;  4IIJ A;  1Q81 W;  4J9Y B;  1O9G A;  5CA0 A;  5IE9 A;  3IFX A;  5L3B A;  1L8D A;  4GYC B;  4MT8 A;  1F51 A;  2YIA A;  3SPI A;  2UXD O;  3SPH A;  4YIO A;  5EBM C;  2QWO B;  2YIB A;  3K03 A;  3E35 A;  1GO3 F;  4EFE A;  4HNA B;  2YXH A;  4JI7 B;  4FLY A;  1Q86 W;  5K1X A;  3DTU B;  4LF8 B;  3ASN B;  4K0K B;  1XQ8 A;  1KP3 A;  1VQ7 V;  1K5Q A;  4H37 A;  3IC7 A;  1R6N A;  1GH6 A;  3JAW A;  1QQC A;  5EZY A;  1H2G A;  2D2C B;  3UO2 A;  2GBO A;  3BA8 A;  4UVC A;  1Y76 B;  4MTF A;  1IVS A;  3CXH F;  2QSA A;  3HKE B;  4ZI7 A;  3MAQ A;  3R65 A;  3AG1 B;  4K3A A;  4DV0 B;  2QKC A;  1YI2 V;  2FL4 A;  3T1H B;  4JV5 B;  4DK0 A;  4JPR A;  4WFE A;  1QHT A;  2QR4 A;  3F7V C;  4AQY B;  2Z0A A;  5EBL C;  1FXK B;  4UFZ A;  4TUY B;  1HR0 B;  1XDC A;  1RPO A;  4X8A A;  4JI5 B;  1SQB H;  5B1A B;  3HKC A;  4WFH A;  3A0H Z;  1JJO A;  3P3P A;  4JAV A;  3LSU A;  1HNZ O;  3FAV B;  5FLX N;  4QGP A;  1NI8 A;  2IJK A;  2KG7 B;  3CEI A;  3CCS V;  2HJD A;  4FLW A;  1SET A;  5KHI A;  3ICX A;  3QF7 A;  2C2A A;  5C8Y A;  2O57 A;  3P32 A;  4IL6 Z;  3AG3 C;  4DW0 A;  4IIJ B;  3ABL C;  1Q6H A;  3ZMS A;  1YF2 A;  3I55 V;  4DV2 O;  1XMO B;  4C7U A;  5IDJ A;  2ZE5 A;  4DV4 O;  3JAM N;  4JI6 B;  2ZXW B;  1NTK H;  3ASO B;  2E75 B;  4QPJ A;  3I56 V;  1VQ5 V;  1KKD A;  1TA8 A;  4UV9 A;  1BHB A;  1S5L Z;  4MW3 A;  2ITC C;  1M5I A;  4X1Y A;  2AW9 A;  4JI8 O;  4GLX A;  1SQX H;  2FML A;  4DV5 O;  3JAT A;  1FD9 A;  1KQS U;  4JI1 B;  1PM9 A;  2BSK B;  3AK1 A;  3SJB C;  1OCC C;  2LFS A;  1MNG A;  3SGI A;  5DN6 G;  1OCR B;  4U3J A;  1HR0 O;  1MZE A;  3QTC A;  4XDJ A;  4HBN A;  3ABU A;  1PL0 A;  3EXA A;  1K73 W;  1K92 A;  2QTS A;  3Q4H B;  4XDK A;  1H2K A;  3G67 A;  1N33 B;  4J41 A;  1IBM B;  1W59 A;  2K1E A;  4ZBM A;  2JGD B;  2YIC A;  1OZ0 A;  1RM1 C;  3A8T A;  4YHH B;  4IYI A;  4P30 A;  4JYB A;  3VBB A;  1F4N A;  1Z2G A;  3L73 H;  2HKO A;  1RM1 B;  4I4T A;  4MVZ A;  2Q5Z A;  3FB6 C;  4UV8 A;  5HFL A;  3UO3 A;  4HAM A;  3SJC C;  3CCL V;  3JD4 A;  3VOU A;  2ZM6 O;  1S72 V;  4LNU B;  2VQF O;  4RUE A;  3OGC C;  3TJT A;  2X6A A;  4MVR A;  4YXW G;  5B1B B;  3TXQ A;  3IAY A;  4RUF A;  4FK5 C;  1YIT V;  1P4R A;  1RSO B;  3ZMZ A;  3AG2 C;  3OTO O;  2LQT A;  3KZI Z;  4W4L A;  1NU1 H;  2EIN C;  2Y4U A;  2XAS A;  1FPO A;  3FB5 C;  1N36 B;  4CS2 A;  1NTZ H;  3T4D A;  1LNQ A;  2HR3 A;  4CH4 A;  2PI5 A;  1IBM O;  4GZR B;  2QWN B;  3WB2 A;  4FZ1 A;  3T2M A;  4DV5 B;  4DO2 A;  2YID A;  3BPZ A;  2UU9 B;  3HKD A;  1GM7 A;  2KG7 A;  4JYA B;  3JCU Z;  3ZIA G;  2JK5 C;  1MSD A;  4PDR A;  1FXH A;  4UXN A;  1YSC A;  1JJ2 U;  4OX9 B;  1THZ A;  4I0X B;  2ADQ B;  4LWS B;  4A5U B;  5JCO C;  1BT8 A;  2XAF A;  4OPH A;  3RW0 A;  1NH2 B;  2VQF B;  3SPJ A;  1G8M A;  3BFR A;  3S3X A;  1V9P A;  2UXN A;  3OMN B;  4JI3 B;  4DV4 B;  2OT5 A;  2ZDI A;  2CGN A;  4K8Z A;  1EZV H;  2KQX A;  1BMF G;  1N32 O;  4U7N A;  2WPD G;  4I9W A;  1E79 G;  2A9H A;  4I7Z B;  5JH7 B;  4MS2 A;  1DK1 A;  2F43 G;  1BS3 A;  3H01 A;  2LW1 A;  4P2Z A;  3CRC A;  4LCU C;  1XL4 A;  2GDS A;  4JI2 B;  4NYK A;  3ZHS A;  1NJI W;  4BIZ A;  3CCM V;  3RYI B;  3I5D A;  1IBK B;  4JI1 O;  1XEQ A;  2ZR3 A;  4O4H B;  2QJ1 A;  4KUM A;  3RYF B;  2UXX A;  1NQT A;  5B1A C;  2CAZ C;  3SR2 C;  1VF6 A;  2XTA A;  4Z2W A;  4O4I A;  5LMN B;  2ZE6 A;  5KHK A;  4JZG A;  1IZ3 A;  4DR1 B;  2UXC O;  4L8J A;  1TAE A;  3OR7 C;  4B3S O;  4WFB V;  1WN7 A;  1N33 O;  4BIO A;  4FM0 A;  1AJP A;  5IJ9 A;  3SYP A;  1SQG A;  3OMA B;  3SYQ A;  2WLH A;  3D36 A;  2OCC C;  5LHI A;  2DQ3 A;  2YEV B;  4JTA B;  2WWW A;  5LOV B;  1NTM H;  1B6Q A;  2F66 C;  1US6 A;  3F5W C;  4JI0 B;  2EIL B;  2Q73 A;  4X64 B;  1HDJ A;  1K7D A;  1NKD A;  2ZD9 A;  4PA6 A;  1V55 C;  4W4K A;  5IYZ B;  1JCH A;  3PN1 A;  1ZSP A;  4WBN A;  5JCO A;  4J9Z B;  3JAK B;  1XMQ B;  1Q6U A;  4GT1 A;  3CC4 V;  2IU3 A;  2IH1 C;  1R3L C;  3UQ8 A;  3BEH A;  1FS0 G;  1YZB A;  4X65 O;  1AI6 A;  3CSX A;  3JSN A;  1GKF A;  3G6E V;  2F95 B;  1W0K G;  3AG4 B;  4HNA A;  4B3S B;  2XT9 A;  1Y74 B;  1KKC A;  2WA4 A;  4PDL A;  2PGG A;  2Q8V A;  3CCQ V;  1BQZ A;  2K9P A;  3K0D A;  2CTR A;  1COW G;  3ZBH A;  2A3Q A;  2IM9 A;  1GRJ A;  1YHQ V;  3RYI A;  2ATK C;  1Q7Y W;  1NH2 D;  5EBW C;  3RVY A;  3SYO A;  3ZRW A;  1AJQ A;  4MVM A;  3OEH G;  3G71 V;  5KA6 A;  1XOU A;  4B3M B;  3G80 A;  4PI2 A;  4TWK A;  4JI3 O;  2CTW A;  4MTO A;  3ZHQ A;  5IYC O;  1XMQ O;  2OTJ V;  4B7K A;  3K59 A;  1YDX A;  3T1H O;  2V7Q G;  4LNU A;  4ZOL A;  1VF5 B;  1N32 B;  1AIL A;  4Z1M G;  2YIB D;  5KLV H;  4WFG A;  1N8R W;  3VQX A;  4ZOL B;  1SKV A;  1J5E O;  3X2Q C;  4UCS A;  2RMK B;  5LYJ B;  2CGO A;  4PA4 A;  3NR7 A;  1AR5 A;  4JI5 O;  1OHH G;  2ZIM A;  3E8B A;  5H5N A;  2EIL C;  1CXZ B;  3J81 N;  4WF9 V;  5FPR A;  3L74 H;  4J42 A;  3CRR A;  3LSQ A;  1FJG B;  1Y4M A;  2XND G;  3KKY A;  5BY1 A;  1QLN A;  4JAU A;  4NR1 A;  2OWO A;  2W0X A;  2GV9 A;  5CMU A;  1HNX O;  3KCY A;  3M7M X;  2P4K A;  3H1J H;  3O65 A;  1WA8 A;  5CA0 B;  4GKJ B;  2IBZ H;  4PD4 F;  5LHH A;  3WU2 Z;  5EIB C;  2QWR B;  4O4J B;  2XAJ A;  5L3G A;  3CMA V;  4KXR A;  1GN3 A;  5JH7 A;  1XBL A;  2ITD C;  5BMV B;  4YIP A;  1FFT B;  3AK3 A;  3QO7 A;  3RWR D;  1SA0 A;  1P84 F;  3OFN G;  4X88 A;  4JI0 O;  2ZDI C;  4H33 A;  4B3R B;  2IJJ A;  4DYL A;  4DUZ O;  2F93 B;  2M7W A;  5B5E Z;  1SES A;  4KL1 A;  4UB6 Z;  4OXS A;  4X66 B;  1NVP D;  2CH7 B;  3LNM B;  4Z1V A;  4G2K A;  3ZRX A;  1VQ9 V;  4GX0 A;  4JTC B;  1B06 A;  3ABK B;  4JYY A;  4H13 B;  5BR8 B;  4RO2 A;  4IGG A;  2MW2 B;  4NXM B;  2OIE A;  2ZXW C;  3ZHT A;  4CC6 A;  2V1D A;  2JVD A;  4X20 B;  1GM9 A;  2H8P C;  2BOB C;  2VQE B;  3WB0 A;  3ML0 A;  1JR9 A;  5CB4 A;  3MHH C;  2P7T C;  3OUF A;  4J80 A;  2Z3Y A;  2LGW A;  3BRC A;  3ETE A;  3JSL A;  4DR2 B;  4LH6 A;  3FAV A;  1WPX A;  3CPW U;  2Y69 C;  1PPJ H;  4MVS A;  3IC9 A;  2PYL A;  3C3T A;  3N2K B;  2OYQ A;  1GAX A;  3APO A;  5GW7 A;  3ZRS A;  4DR3 O;  4KP4 A;  1S3J A;  2ZIO A;  5IJ0 B;  5DEC A;  5LL6 Y;  1NZ6 A;  2KSD A;  3QNE A;  2WLJ A;  1WNS A;  3AG4 C;  3BVO A;  1FFX B;  3ZJZ A;  3J7A U;  4NTW A;  1OV9 A;  2B1I A;  2JS3 A;  4PHZ A;  4LFB O;  3HB3 B;  5J2T A;  4MW8 A;  3CP1 A;  3BA9 A;  4KFM A;  4PA3 A;  3BAB A;  3ABT A;  4LFC B;  3W7W A;  3G4S V;  3NXS A;  4LF4 O;  1X4T A;  1Y6X A;  3VQY A;  2VQE O;  2YXL A;  1JFF B;  1I08 A;  2VS0 A;  3FX7 A;  3GVM A;  4ASU G;  3K58 A;  5LP6 B;  2FYU H;  1JX9 A;  2Q4P A;  1FXK C;  4P9P A;  4PV1 B;  3OT7 A;  3RYF A;  1ZWI C;  5LBQ A;  4ABM A;  3UCS C;  3CWB H;  1IBL O;  1I94 O;  2YSU B;  5EC1 C;  4QE7 A;  1PKX A;  3T1Y B;  1TUE B;  3C3S A;  4DR3 B;  2W6I G;  2Q67 A;  3GWO A;  1WJZ A;  2IU0 A;  2Q0A A;  5L3F A;  4LC1 A;  1E1Q G;  1LUW A;  3LUT B;  5FNV A;  3CCU V;  4JAS A;  3UT5 B;  4DR2 O;  4X20 A;  2ARH A;  2GSM B;  4MVQ A;  4YJ3 B;  3LDD A;  3AG1 C;  1XHZ A;  2Q7G A;  3O9O A;  3CE2 A;  1TUB B;  4FIP C;  3IGA C;  4LFA B;  2M6Y A;  4QJF B;  4K0K O;  1SQQ H;  2OIG A;  2Q69 A;  4UCV A;  3W7S A;  2VWJ A;  3F5T A;  3OE7 G;  4DUY B;  5GON A;  1MMM A;  4NVP A;  3H1I H;  2QA4 V;  1Y66 A;  3ZMT A;  1K34 A;  4PDM A;  4LFB B;  1YXB A;  1VP7 A;  2X0L A;  1H2L A;  1SF9 A;  3ABM B; 
#chains in the Genus database with same CATH homology
 1YVW A;  2GTA A;  2YXH A;  1VMG A;  1Y6X A;  2A7W A;  2Q73 A;  3C90 A;  2P06 A;  2A3Q A;  1YXB A;  2OIG A;  2OIE A;  3CRC A;  2Q5Z A;  5IE9 A;  4QGP A;  3CRA A;  2Q9L A;  2Q4P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...