2P0CA

Catalytic domain of the proto-oncogene tyrosine-protein kinase mer
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
287
structure length
249
Chain Sequence
NKLEDVVIDRNLLILGKILGEFGSVMEGNLKQEDGTSLKVAVKTMEFLSEAACMKDFSHPNVIRLLGVCIPKPMVILPFMKYGDLHTYLLYSRLETGPKHIPLQTLLKFMVDIALGMEYLSNRNFLHRDLAARNCMLRDDMTVCVADFGLPVKWIAIESLADRVYTSKSDVWAFGVTMWEIATRGMTPYPGVQNHEMYDYLLHGHRLKQPEDCLDELYEIMYSCWRTDPLDRPTFSVLRLQLEKLLESL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Proto-oncogene tyrosine-protein kinase MER
publication title Structural insights into the inhibited states of the Mer receptor tyrosine kinase.
pubmed doi rcsb
source organism Homo sapiens
total genus 75
structure length 249
sequence length 287
chains with identical sequence B
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2007-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2p0cA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2p0cA01
4BHNA 2WEVA 2F2UA 5IQAA 3SA0A 5CU4A 3DOGA 4AZVA 2A4LA 3QWJA 5EHOA 3LFEA 2E9NA 4CFFA 3SOAA 4FKJA 2YEXA 4FSNA 4Y95A 5TKDA 4M3QA 4RVMA 4DTAA 2YM4A 3TT0A 3RK9A 4ZTQA 1PRYA 3QWKA 1WAKA 2CKEA 2OLCA 5EG3A 5L8KA 3VF9A 1GNGA 3B8QA 4YUQA 1UA2A 2XK6A 3DBDA 2UZWE 3ORLA 3ZMMA 2BALA 3M2WA 4MEDA 3CTJA 4CFVA 1U5QA 5A4EA 2IO6A 4QP6A 4QTDA 4YPDA 3P86A 4YJNA 3Q3BA 4GT4A 5AV3A 4ACMA 2RL5A 4PPCA 1IRKA 4EH9A 1ATPE 2XM8A 5FEQA 4HOKA 3Q2MA 2G01A 5A6OA 3FL4A 2XEYA 4MQ1A 3EN4A 4FIFA 4DGLC 2PE1A 3MH1A 4EORA 2R3MA 3S4QA 2HAKA 4Y83A 2BZJA 3OXTA 3K3JA 4FR4A 2PVJA 2VO7A 2XJ1A 5BVNA 4BI1A 2RG5A 4EZ7A 1ZOGA 2OXXA 4FNYA 5E8WA 3ULIA 3UPXA 2WMAA 4EH8A 2B9HA 5KUPA 4YJSA 1OIYA 4U80A 2B4SB 4BCFA 3CIKA 4BIBA 4MXOA 2Y9QA 2PMLX 2XZSA 3KF7A 4KS8A 3EFWA 3EZRA 3M11A 4HCVA 4D5KA 4MCVA 4KA3A 3FMMA 2XUUA 3E3BX 3UZTA 2IG7A 3PVUA 4JDKA 2H8HA 3AT2A 4OTRA 3VHEA 4ARKA 2GTMA 2IVTA 4C61A 1ZMUA 3PY3A 3A60A 1MRUA 4LGDA 2CN8A 4PUZA 4GT5A 5EW9A 2YJRA 3LCKA 2XK8A 5D41A 2NP8A 3ZTXA 4MXYA 2BFXA 1OPJA 4JBPA 3G9NA 1UU3A 4CTBA 5FDXA 4IJPA 3ITZA 2VTHA 4ALVA 4H3BA 4FTTA 5CVHA 2WTJA 5EQYA 3H0ZA 4FTOA 4HGEA 3ANQA 5KBQA 3D5WA 3R9DA 4P90A 4JOAA 3RK7A 3NDMA 4K33A 4FSRA 4BVUA 2PUIA 4P5QA 4YGAA 5ETCA 5GZ8A 1CDKA 2WQMA 4NU1A 2WQOA 1VJYA 3IKAA 4FV7A 4HYIA 4N4SA 5DLSA 4KS7A 3G6GA 3TZ9A 3BLRA 4AGDA 4GUEA 1W84A 4YLKA 5B2MA 3QTWA 2YZAA 4AXAA 5LOHA 3HRCA 1OITA 5M56A 1YI3A 4L68A 4RWLA 2UZBA 5K5NA 1PMNA 2GNIA 3GCQA 1Y6AA 4ZY6A 4FMQA 5DOSA 4BGQA 3IW4A 5A4CA 1R3CA 5BYYA 4E5BA 2RSVA 5CF4A 1KOBA 4D2PA 5CAUA 4HZSA 4I0SA 2QC6A 4L42A 4XP2A 4BFMA 2YM3A 2OXDA 2P3GX 4LG4A 2J50A 2ITPA 2QOHA 2OIDA 4IDTA 4OBQA 4CFUA 2B1PA 4GT3A 5CNOA 4OTDA 1BUHA 5LXMA 3PJ8A 4IWPA 4USFA 3BYOA 1H1PA 1Q8TA 2GHGA 1JNKA 2JFLA 3AMBA 5IEYA 2ZDTA 4PQNA 1JKSA 5EYDA 1IAHA 5EW3A 3LFSA 2XBAA 1OI9A 1Y91A 3EKKA 3MFTA 4FKWA 4BDBA 2P55A 5JFSA 4B0GA 3R01A 3ZCLA 2GU8A 2OH4A 3PSDA 4X6RA 5ANDA 3LCDA 4O7RA 1B39A 4XHKB 4RIWA 4XMOA 5CT7A 3TKUA 3WE4A 4DGMA 2Q0NA 3TV4A 4QMVA 1UNGA 3OVVA 4BL1A 2C5NA 3PXQA 3R04A 5HX8A 3UO5A 3R1QA 2QD9A 4FODA 3KQ7A 3F3ZA 3BGQA 1XH6A 2X81A 3R7VA 4N6ZA 5DR6A 3VN9A 2VZ6A 3QTSA 4MX9A 4HGTA 3RNIA 2JIUA 2PVFA 4OGRA 3FZOA 4U81A 3VBWA 4EK8A 3LLAA 3HMIA 3UP7A 2ZV8A 5JQ5A 5DEWA 2KULA 3SHEA 3FXXA 3TKHA 2NNWB 3OD6X 4PMPA 4QNYA 4BCOA 3BHTA 3UE4A 1XH5A 2XK4A 3WZUA 3ZH8A 4O81A 4EUTA 5I9XA 5AV4A 3WF6A 2OO8X 3AMAA 2VD5A 4HZRA 3IOPA 3SVVA 3OEZA 1W0XC 4CFMA 3FAAA 5KCVA 5CEPA 3FYKX 4MTAA 1IAJA 3U9CA 3H9OA 1YOLA 3SRVB 4Z55A 3R71A 5FDPA 4ZLOA 3OP5A 4I0RA 4Y5HA 3BU5A 1WBOA 3EYHA 3FXZA 3ORNA 2OF2A 4C33A 5AP3A 3G15A 3BGPA 2WQEA 4G5JA 4ZTMA 2OF4A 3R63A 3HA6A 4MNEB 3KXXA 2P33A 4CRLA 4GS6A 4BYJA 2XNMA 3TUBA 3UZRA 4AOIA 1YXVA 3DK6A 4DG0E 2ITOA 5FP5A 3U54A 3GU4A 2PULA 4LGHA 1QPJA 3PPKA 3BLHA 3AXWA 2F9GA 2FGIA 4KKHA 1YOMA 5E1EA 3TNIA 2WKMA 5M55A 4C59A 4EOJA 3F82A 3MY5A 3R7UA 2YM8A 2E2BA 4O2PA 4K1BA 3UC3A 3BHUA 3CEKA 5HVKA 3OMVA 1OIRA 2IN6A 3LM5A 1KE8A 1Y57A 2JC6A 2VTPA 2BPMA 2QO9A 2XNPA 3MIAA 3OWKA 3G33A 4I4EA 2YIXA 4YBKA 3TZ8A 3PLSA 4NJ3A 2Z02A 1PY5A 4GKHA 3RZFA 3W2SA 4BCGA 3OCTA 4FSZA 4D0WA 4AX8A 4FKOA 1JKTA 2J0LA 4O91A 4YURA 2WAJA 3FPQA 3PUPA 5DBXA 4GUBA 2J5EA 3E3PA 1J91A 2OSCA 4PY1A 4UEUA 4RWJA 4KD1A 4QPAA 3V5TA 3ZUTA 4XNEA 3TJDA 3EHAA 4MD8E 5DT3A 1UKHA 3RAIA 3RALA 3ZO1A 4IBMA 4AZFA 4E4MA 4YC8A 4F09A 3ORZA 3BV3A 3NNVA 4I4FA 5AAGA 4D28A 1PXOA 1XBAA 3DFAA 3UQGA 4QO9A 1OKWA 2Y4IB 4NEUA 4UV0A 4AOTA 4HVSA 3IW5A 1LPUA 4U42A 4XLVA 5ANOA 5E8XA 3VBVA 4QP4A 1GZNA 3GC9A 3A2CA 1ZMWA 3QD0A 4ZP5A 4IVAA 2I40A 5L6WL 2BILB 1UKIA 3PA4A 5IDPA 3EH9A 2BHEA 2YN8A 3LVPA 4TYHB 1WBPA 4WSYA 1OKVA 4YSMA 5J7BA 3U55A 1IA9A 5CTPA 4C34A 2C6EA 3MS9A 3UBDA 3O8UA 1BL7A 4DG2E 3RAHA 1H1RA 3F6XA 2O64A 3MSSA 3FC2A 3IGOA 4CLJA 5FUTA 3I4BA 4W4WA 2IZRA 4K18A 2P4IA 2FO0A 4JG7A 4RLKA 2PMIA 3PVGA 3EKNA 2BKZA 5HCYA 4FNXA 3ZHPC 4EBWA 4AZEA 2ZAZA 3UNKA 5A46A 1YHWA 2VGPA 3F2AA 2QI8A 4G2FA 3TDVA 1Q61A 3IW7A 4ZSLA 4O7WA 2GFSA 3R1YA 2CPKE 4ZXTA 5IH6A 3ZUUA 2V7OA 3D83A 4AF3A 4TPTA 4FV9A 1UU7A 4ZSGA 3TL8A 2QOOA 4X2JA 3W2CA 4EKKA 5E90A 5CASA 1W7HA 5K5XA 4MBIA 2WMQA 4LUDA 4B6LA 2H6DA 2V7AA 4QNAA 4F0FA 5KMLA 2IW9A 2WU6A 2OZOA 4JT3A 4PV0A 1PXMA 3UIMA 2GQRA 3ID6C 3NX8A 3F3TA 4IX6A 4R6VA 4YZMA 4M69A 1BLXA 2BR1A 2JIVA 4Y46A 4USEA 3B2WA 4FNWA 4E5WA 2RIOA 4IVDA 5HGIA 2X7OA 2ONLC 5DGZA 5I3OA 1ZLTA 3RCDA 5M06A 4QTBA 2IVVA 2OWBA 4M8TA 4RFZA 4UALA 4WUNA 2UW5A 4ACDA 4PNKA 4GW8A 1OL7A 3QUEA 3GOPA 4C7TA 5IU2A 1PXIA 2PSQA 3NUNA 4HCUA 4PL5A 3NMUF 4H05A 3F5UA 5HKMA 4UN0C 4PDPA 3DK7A 4XX9A 4BCQA 3DJ7A 2F4JA 4V01A 4F08A 3A4OX 4QQTA 3QU0A 4V0GA 3MIYA 3MVMA 4A4XA 5L3AA 4M12A 4YO6A 4AA4A 1OL5A 4X3FC 3VW8A 2CMWA 4GFMA 1OBDA 3QF9A 4I0TA 3RHKA 1G3NA 3LXNA 3GGFA 5EDPA 1SM2A 4L01A 3QC4A 2GTNA 3C1XA 4RJ4A 2PY3A 1R0EA 4BDKA 3CPCA 3OG7A 3GOKA 4JDJA 3IG7A 4UXLA 2ERKA 4BDCA 2WFYA 4CD0A 4DLJA 4YC3A 2C0IA 4QTEA 4IWDA 3EQRA 4OAVB 1FGKA 4BB4A 5IA4A 4N70A 2F7ZE 3MPAA 5JFWA 4P2KA 4DBXA 5HD7A 3IPHA 4QYGA 3PXRA 5FGKA 1R39A 4FNZA 4S30A 4D9UA 1NY3A 4G31A 5I9UA 4BCJA 3C4CA 3V01A 5AX9A 3ZO2A 1M7NA 1STCE 1JKLA 3FQEA 2R3FA 4GG5A 3UOJA 5HX6A 4AE9A 1LEZA 4U6RA 4CZUA 2CGUA 3P23A 3CS9A 3KRRA 4QMMA 5DH3A 1M14A 2XNGA 4QTAA 4CRSA 5IUGA 3HAMA 4DH1A 3H10A 3FDNA 3V8TA 4GK4A 4K0YA 4RJ7A 2VTNA 3EL7A 3SG9A 3NYXA 3UOHA 2QU6A 3A7IA 4LRMA 4TWPA 4J99A 5EM8A 3VC4A 2W99B 2X6EA 3HDMA 4PF4A 3VS6A 4LL0A 2G15A 4IE9A 4FI1A 1FOTA 4KAOA 2R3RA 4KNBA 4MF0A 3SQQA 3QL8A 5HI2A 4NM7A 4AGWA 4GFOA 5JQ8A 3OTVA 2XA4A 4YZNA 1Y6BA 3G0FA 3AQVA 3TNQB 3IO7A 3KL8A 2QKWB 4D0XA 5HU9A 4JR3A 3L9LA 5BVEA 1QMZA 2C6TA 3R8VA 2OW3A 3LCSA 3VUTA 1U46A 4O82A 2VWWA 4MVFA 1WBSA 1SMHA 3HV4A 3VUMA 2VO0A 5IA5A 5HO7A 5EYKA 2C6KA 3UJGA 3OBJA 4TW9A 3F2NA 3GFWA 3MA6A 5CSXA 5HG7A 3TTIA 3HRFA 5JGDA 2WQNA 2DS1A 3V8WA 2H34A 2R7BA 3L9MA 4ACCA 5IQEA 4IAZA 4IWQA 2A1AB 4ACHA 1FPUA 2BHHA 1GOLA 2XRWA 2YIQA 3CY2A 4BKYA 3N4UA 4NH1A 5CT0A 3ZUVA 2W5AA 2VV9A 4QD6A 5HLWA 4YSJA 4XRLA 2A2AA 2XNEA 3DS6A 5AM7A 4RX8A 5F20A 5C1QB 2VWBA 1U4DA 3BCEA 2W7XA 3E92A 4PP7A 5J9YA 3FMNA 4O6LA 2NPQA 2R3JA 1ZMVA 2ITTA 4F9WA 2BZKB 3BHVA 4CV9A 2I0VA 3GP0A 2C5XA 4AW2A 4JVGA 4EK3A 1VYWA 2LAVA 4WUAA 2IZSA 5LJJA 4I92A 4C4JA 4I94A 4BDIA 2J7TA 4D4RA 1FVVA 3F88A 5J87A 1OPLA 4E6AA 4QT1A 3LMIA 4RJ8A 2PU8A 2YWPA 4IHPA 1TQMA 2VX1A 5GJGA 5EFQA 3V8SA 2O2UA 3OOGA 5BPYA 4MKCA 5ETFA 4TYGA 4HNIA 4BC6A 4LQMA 4O7TA 3CP9A 3BIZA 3E88A 3NIEA 4WNMA 2ITNA 5M53A 3BE9A 2BTRA 3EQHA 1OZ1A 3ENMA 3RI1A 2E9OA 4L43A 4R5YA 2J51A 5G1XA 3DK3A 4L45A 4EEVA 3HMMA 4QRCA 3UDBA 2X6DA 5T68A 3PFQA 2ZOQA 5JRQA 3I5NA 4YHTA 5BUJA 5JZJA 2W1CA 5HZNA 3CJGA 3P78A 4RSSA 4YJOA 4C4FA 2W9FB 4H58A 4J96A 3KRWA 4C2VA 3RJCA 4FUYA 4RFYA 1CM8A 1PXLA 3REPA 2GMXA 4BI2A 4CCBA 3GXLA 3BX5A 1XKKA 1Y8GA 3G6HA 4Y72A 4CKRA 2CLQA 3QQLA 2IW6A 4XV9A 5HTIA 3ROYA 4DTBA 4C38A 3C4EA 3RM7A 3OUKA 5F1ZA 3IDPA 4QYHA 4M66A 3EFLA 3P7BA 3D94A 3DBEA 4KIKB 1Q3WA 4FVQA 4UB7A 3ZC6A 2W4KA 4WO5A 3PIZA 4IZYA 4GVJA 4EQMA 2PVNA 4CV8A 2C47A 4F63A 1ZY4A 5E1SA 3OWJA 3BBWA 5DI1A 2CKPA 1UWHA 1YQJA 1V0PA 1ZZLA 3BBTB 3ZDUA 4ANOA 4AWIA 3VULA 1E1XA 3ZM9A 4QPSA 4NFMA 2UZUE 4DEDA 3FMHA 3QQUA 5CANA 4TNDA 3E7VA 4F9CA 5L2TA 5DE2A 3BEAA 3FE3A 3MFRA 4F99A 4I93A 5E8ZA 2PVKA 1GJOA 3AD4A 3EFKA 4IAAA 3P5KA 3VS7A 5LVOA 2YDJA 3NIZA 1ZOHA 2SRCA 1MRYA 3QQFA 3QRJA 4YJVA 2XKDA 4DCEA 4AW0A 3CGFA 3A7HA 3FBVA 3FI4A 3CLYA 2WTWA 4S34A 4E93A 3QCYA 1PXKA 5IISA 2YIWA 4QMXA 1QPDA 1YWRA 3PJ3A 4YNEA 3ORXA 1PXNA 1PKGA 4NW6A 2XNNA 1FVRA 3DKCA 4IX4A 2VUWA 4LMUA 4NW5A 5TF9A 5A6NA 2QNJA 1TQPA 3P08A 1OM1A 2Y6OA 3TV7A 1H24A 3QTQA 1GAGA 5HOAA 4GYGA 4BHZA 2F2CB 3K5VA 3FZSA 4JBQA 4USDA 4OBPA 4OW8A 3VUIA 2OZAA 2RF9A 3DDQA 1F5QA 2OJFE 4RIXA 4ANSA 4B9DA 2R3QA 4GFGA 2HYYA 4M0YA 3KFAA 4ZTHA 3MI9A 4FIGA 2RGPA 4BDDA 4BCIA 4MHAA 3CD3A 3GT8A 1RW8A 3H30A 3MWUA 2CJMA 1YXXA 3R21A 1GIHA 2ETMA 4FSWA 4II5A 3TN8A 5I9WA 4WRGA 4GU6A 3Q9ZA 3UMWA 3VO3A 3BYVA 3E87A 4FG7A 4A9SA 5CVGA 1Q62A 4AFJA 2CGXA 1M52A 3FLZA 5GHVA 4O7LA 4PL3A 2UW4A 3ZONA 1APME 3KXGA 5LMAA 4JI9A 4OBOA 3F3UA 5JFXA 3BV2A 5IEXA 4EK4A 4HW7A 3W10A 4EH5A 1U54B 4AP7A 3D7TB 3PWDA 4QP2A 2QLUA 4AT5A 1QPCA 4J52A 5GIPE 1JBPE 2IZTA 4DFLA 3ZZWA 2Z7SA 3CQEA 2WMTA 3MFSA 4FTRA 4QMPA 4D2TA 5AUTA 3EIDA 5HIBA 3VS0A 4O7NA 3MW1A 3AD6A 4S31A 3GCPA 4BGHA 3HUBA 4ZJVA 4R3CA 3C7QA 3ZO3A 1YW2A 4QP8A 5HORA 3EMGA 5DVRA 4GVAA 3G5DA 4FL3A 3QQGA 3ORMA 2R0UA 3E63A 3VJOA 2JBOA 3SXSA 4A7CA 4I23A 3DDPA 1GIIA 4KIPA 4WG3A 3WOWA 4ZZNA 5IEVA 2PK9A 3QTUA 4LYNA 3FMLA 3R83A 3R1SA 4OTQA 3V5LA 1JWHA 3LHJA 4XP0A 4WKQA 5AP5A 4B99A 2WMSA 2XK3A 5HESA 3WYYA 3H4JA 4FTAA 4K9YA 4CVAA 5EI2A 3IOKA 3AC3A 2J0JA 2W1EA 1QCFA 2HW6A 3HV3A 3PP1A 4LL5A 5CU2A 3RGFA 2XBJA 3TZMA 4FV4A 5IA2A 4AW5A 4RX7A 5KKRC 2ITYA 4G5PA 4A9TA 2UW7A 3W32A 5IMXA 4BTJA 2QR8A 2UZVA 2BCJA 2CGWA 3F2RA 4FEXA 3ZSGA 2HIWA 2XNBA 3QKKA 1KWPA 4RBLA 3NW5A 1KV2A 2WGJA 5CQWA 2OIQA 4U44A 2O5KA 1V0OA 3ZXZA 3TUDA 4D1XA 3C4FA 1H07A 3UVPA 3DBCA 4FKSA 3KULA 4JBVA 4O0WA 3LFFA 3QKLA 5IQCA 2XF0A 3ALNA 1REJA 3MVJA 5AP7A 4RPVA 4BCKA 3MB7A 4YHFA 5AAFA 4ERKA 4J98A 5EM6A 4RLLA 3AT4A 2X2MA 1H1WA 1IA8A 2B53A 3DAEA 4FSMA 3JVSA 3QBNA 2R2PA 4APPA 3PDTA 5JZNA 3W16A 1UWJA 4I41A 4QYYA 3ZC5A 1NT2A 3LCOA 4C8BA 2YFXA 3KXNA 5EM5A 3PY0A 4F7SA 1YRPA 4NIFB 3M42A 4O6EA 2XCKA 3LM0A 4FV5A 4NM0A 3UQFA 1UU8A 5ANGA 2WXVA 3FJQE 5JEBA 4F7NA 2V55A 3LE6A 4EZ5A 5CSHA 4J95A 5JGBA 2IVUA 4LI5A 1YI6A 2QOBA 3KGAA 3W18A 5CU6A 4G34A 3VUHA 3EJ1A 5BNJA 4YTIA 4M67A 2WB8A 3UIUA 5JGAA 4I20A 3NUAA 3R8MA 5F95A 1ZYSA 3FSFA 1BI8A 4L44A 3ZU7A 5J5SA 3FLYA 3GQLA 3AC1A 4XG4A 3C5UA 5AMNA 2OK1A 2WMBA 5AX3A 5HBHA 1MQ4A 3P9JA 4J8NA 5CS6A 5LVMA 3NGAA 4IZ5A 4A9RA 4YJRA 2VGOA 3EQCA 3MYGA 3CE3A 2RKUA 5F4NA 1Q4LA 3SD0A 2OG8A 3V3VA 4NSTA 3F9NA 4ZTLA 3I5ZA 5IQFA 3LXKA 3MVLA 4D2WA 5BVWA 1NW1A 3EOCA 3PWYA 3QRIA 2PYWA 3E7OA 2WTDA 4C4IA 4W4XA 5C4KA 1VZOA 2JLDA 5GZAA 2YERA 3MA3A 4N57A 4MXAA 3IW6A 3C4XA 4YJQA 4DH7A 4DYMA 4IC8A 3U51A 4GCJA 5K3YA 2C6IA 2JKOA 1IASA 3I6UA 3I0OA 4XS2A 3TZ7A 4WNPA 2B9JA 4GK2A 4GRBA 3ZRLA 1NVSA 5IUHA 3LQ3A 1OUYA 4O0SA 4IB3A 3Q9WA 5IZFA 1B6CB 3WIGA 5D9HA 5EKOA 2WMVA 3Q4TA 4U9AA 4F6UA 3D14A 2Z7LA 3QZFA 2ETRA 1SNUA 4G9CA 4ITJA 5CF6A 3DKFA 3OFMA 3R7OA 2E9PA 4CLIA 3TWJA 4ERWA 5LQFA 4RMZA 1GZKA 3M1SA 3NNXA 3DU8A 3S95A 4MNFA 4BZNA 2UVZA 4TY1A 5KHWA 2BMCA 4MK0A 5C8KA 1Q99A 2BDJA 3MY0A 2CNQA 5IKWA 2QQ7A 2W1DA 4OTWA 4XG8A 3R9RA 4FSTA 2F7EE 4D55A 3RCJA 4BYIA 4Q9ZA 1H28A 1R0PA 5TOZA 5C8NA 4IANA 4EK6A 3NZ0A 1BMKA 3QCXA 2W1IA 1YDRE 2VU3A 3QUPA 5EW8A 4G3FA 4XV2A 1H0WA 1OGUA 4J97A 5AUZA 1H4LA 4BF2A 2C68A 2F7XE 3A8XA 4UWCA 3FV8A 2PZ5A 4QPMA 3LFCA 4XG6A 5FTOA 5CVFA 3SG8A 2EXMA 4BZDA 2BROA 2XYNA 2LGCA 5HIDA 5JKGA 4WG5A 5IH5A 4O21A 4UWBA 3DXQA 5CYIA 3HDNA 4EQCA 4QYFA 3UIBA 4LOPA 2O65A 3F69A 3GC0A 4O0RA 4U97A 3V51A 3W2OA 5AA9A 1H00A 4DLIA 2W0JA 3PRIA 3I60A 2GPHA 4NWMA 1YI4A 4LM5A 3A61A 3GUBA 5L8JA 3WZEA 3RBWA 4RA5A 4C3FA 1J7IA 2WD1A 5AFVA 1XWSA 2X7GA 2GHMA 5HCZA 3PP0A 4IIRA 4L52A 4XV3A 2UUEA 3ZOSA 5L4QA 4FV2A 5IPJA 3W33A 3S1HA 1PMEA 3C9WA 4P7EA 2PZRA 2RFDA 2B9FA 4AS0A 4RGJA 1DI8A 2C6DA 3F66A 3C4WA 4LV8A 5IUIA 3F3VA 1WCCA 5H3QA 2IVSA 4GG7A 3LMHA 5FM2A 3UO6A 2ITUA 4FV3A 4ANNA 4XEYA 4U7ZA 3ATTA 3GCVA 3R22A 4W4YA 4EH2A 5AV1A 2YCRA 4BCPA 3SX9A 4YP8A 4OTGA 3TKIA 4RVKA 4F6SA 4BWPA 5K0XA 3RPSA 3BYUA 4TRLA 4E26A 2R3HA 2WQBA 2WHBA 4ZTRA 4F9BA 4EBVA 5BVOA 4Y73A 2B55A 3P7AA 2IJMA 2XIKA 2C0OA 4MXXA 3GI3A 2JDRA 3L1SA 4F1MA 2UW3A 3FKLA 3R1NA 1JLUE 2GHLA 4NK9A 4BBEA 2WOUA 3QC9A 4RG0A 4U79A 5B2LA 4DF3A 4JG8A 4IACA 5HVJA 3WYXA 2WU7A 4M68A 3QZGA 2HOGA 5HNBA 5E91A 4DA5A 1I09A 5FEDA 4CFNA 4RIYA 5KMKA 1BI7A 4L3PA 4M13A 4FV8A 5AIKA 4BBMA 3ZO4A 1DM2A 5KX8A 3D9VA 3SV0A 5D7VA 1QPEA 2GNHA 3U4WA 4R3PA 2OKRA 1H27A 1QL6A 2C6OA 3EQGA 2R7IA 4R8QA 5AADA 1S9JA 2WTKB 4KBAA 2BKKA 2BUJA 3QZHA 3N51A 2R3NA 3RHXA 3VBTA 4JBOA 5L8LA 1GZ8A 4HPUE 4G1WA 4GU9A 4GL9A 3NVMB 4FTMA 4DE4A 3FZTA 2EXEA 3PPZA 3QALE 4L7FA 3R8LA 5AR7A 4F9AA 1OPKA 4IH8A 5J7HA 2J4ZA 5GJDA 3KRLA 3O0GA 3NAYA 5AR3A 5GZ9A 3RWPA 3VBYA 2BFYA 3AD5A 5T6KA 4DEIA 5EDRA 5KZ0A 2BDWA 2YIRA 3PTGA 3SOCA 4C2WA 3MV5A 3AGLA 4C3PA 5M07A 3GFEA 4DGNA 4APCA 2WPAA 3BYMA 2CNVA 3ZEWA 5ETAA 4JAJA 4CZYB 4MWHA 3C0IA 4DN5A 3HRBA 2A0CX 3NYOA 1Q8YA 1X8BA 3EQIA 4XG3A 4DBNA 2ITXA 3NLBA 3JR1A 5KMMA 5KHXA 1OIUA 3O51A 4CKJA 2DWBA 4AN3A 5FM3A 2DYLA 3ACKA 1FMOE 4EOOA 3CKXA 3FI2A 3VS5A 3P0MA 2GCDA 4FL1A 3HKOA 1GIJA 1PYXA 5J95A 1NVRA 2HELA 3SW4A 3FMEA 4YHJA 5HLPA 5J9ZA 2Z60A 3ZFYA 3G51A 3JXWA 4G9RA 3VS4A 3OT8A 3Q4UA 2YAAA 4DITA 5FLFA 1S9IA 2ITQA 2YCFA 5GIOE 4ZMEA 3OHTA 4AFEA 1P4FA 4IC7A 4XCUA 3HECA 3BLQA 4HPTE 4DFBA 5IG1A 3II5A 3OTUA 3PJ1A 4ZZOA 4GJ2A 3VS3A 3U6HA 2HXLA 3VS1A 3E5AA 3FL5A 3FPMA 4D58A 2VNYA 5J1WA 2W17A 4RX9A 3IDCA 4RVTA 4HYHA 4MBJA 2IWIA 3CTQA 4IWOA 4AUAA 4D9TA 2GNFA 3PE2A 4FIHA 3R9OA 3RK5A 1WBVA 2QO2A 3QTZA 4X2FA 4BDEA 5HBJA 4ZIMA 3VIDA 2AC3A 2BIKB 3HGKA 3PZEA 5CEQA 4L67A 4Z7HA 5JSMA 2XJ0A 4RIWB 5J1VA 3RNYA 1WMKA 4UYAA 2X2LA 3U87A 3PPJA 5DG5A 3KVXA 4BR3A 4QMLA 3D2IA 2C5YA 1SVEA 2OU7A 1Q41A 4BTMA 2R3KA 3EN9A 4J7BA 2BTSA 3O7LB 5ETIA 5D1JA 5EQPA 3EYGA 3IQ7A 3FMDA 5E92A 4HNFA 3SW7A 4O83A 3K2LA 4PTCA 3QRUA 2XKFA 5DT0A 1JOWB 4G3EA 4XUFA 1OMWA 3HV5A 5AP6A 1W8CA 3MY1A 4HVIA 3PIXA 2O63A 2VWUA 2YHVA 3QLGA 5K4JA 5AP2A 3ACJA 4RZWA 5TT7A 1K9AA 2C69A 2Z7QA 3OC1A 2X1NA 5HE2A 2X9FA 5HBEA 4S33A 5BUEA 4TL0A 1M2PA 1W98A 2X4FA 2Z7RA 3COMA 4FKIA 4UY9A 5KO1A 4WRSA 4YC6A 4D2VA 3OT3A 2BAQA 4FZDB 5CEOA 3KN6A 2XIRA 3LPBA 4C35A 3RWQA 4MYGA 4Z16A 2QOLA 5AA8A 4JDHA 4JQ8A 2OJ9A 2DQ7X 1V1KA 3ERKA 4D1ZA 3VRYA 3LW0A 4YTFA 1XH4A 4D4YA 3OOMA 5DWRA 4Z3VA 3WARA 2FSOX 4LV5A 2GQGA 2IW8A 5AUXA 2EXCX 1TKIA 3MPTA 3FC1X 2J0IA 4Q9SA 1PXJA 4U3YA 3MH2A 4J8MA 3P4KA 4X2NA 4W9WA 1G5SA 2XVDA 3CR0A 3A7GA 4FTLA 3FQHA 5DEYA 2CDZA 1E1VA 3CD8A 5JK3A 2XEZA 3MJ1A 3QQKA 5IDNA 3ETAA 3FYJX 2ZDUA 3CY3A 4TZRA 3GC7A 3O50A 5EM7A 2XP2A 4U8ZA 2Y0AA 3TV6A 5IQGA 1YOJA 1ZZ2A 4BDHA 3QQHA 4E6QA 2YCSA 3H0YA 3F5PA 4W8DA 2VWZA 3NW7A 3OROA 5BVKA 3TIYA 3ZLSA 4R78A 5IQBA 3L8SA 3W2PA 4R7BA 2E9VA 5HHWA 5HE1A 3V5QA 1OIQA 1I44A 2YCQA 2FSTX 2GS7A 3FWQA 3V6RA 3UODA 5L6OA 3DAKA 5ANKA 4RWIA 5EKNA 4H1JA 5FG8A 3QRTA 5A4QA 5IQIA 3Q5IA 2QKRA 4AG8A 4AT3A 3TI1A 2HW7A 3U9NA 1YHVA 4CFXA 4EOMA 3WE8A 3HA8A 3R7GA 3R0TA 5CX9A 3D15A 5E8SA 3WF7A 4AQCA 1XBBA 1VYZA 2WZJA 2YM7A 5BUIA 4FGRA 5FWKK 5LWMA 2ZYBA 3NVKI 4QMQA 2VN9A 3Q4CA 2ESMA 1Q8ZA 2ZJWA 3LFDA 4FKTA 4ANBA 3UOLA 4CYIA 4EHEA 4JXFA 1F3MC 3U6IA 4FEVA 2OXYA 4DCAA 2J6MA 2HENA 3VF8A 3DBFA 4O7YA 4FSQA 1RQQA 4YJPA 3CGOA 3FQSA 2ONLA 2R3OA 2JDTA 1H1QA 5GJFA 1H26A 3DTWA 5J79A 3P1AA 4WOVA 5KMOA 3FI8A 2R3PA 1JAMA 3RM6A 4EJNA 5CF5A 4O2ZA 1OL2A 4AN2A 5DMZA 4TTHB 2VTQA 5I9VA 2B52A 3LJ1A 1WVYA 5CAPA 4L00A 5AR8A 1O6LA 4FV1A 4FF8A 4I6QA 4Y85A 3F3WA 4X3FA 4L9IA 4O38A 4ZJJA 2B7AA 2XJ2A 5H2UA 1XO2B 4GH2A 2EVAA 4IM2A 3Q5ZA 2BVAA 4D2RA 4UXQA 1J1CA 3BWJA 4FT7A 4EOPA 4G6LA 3EZVA 3DNEA 2PHKA 3PA5A 1PXPA 4FIEA 3QUDA 4CCUA 3DZOA 4FTUA 3DT1A 4M69B 2VRXA 4EH6A 1LEWA 2FVDA 2UZOA 5IA3A 4KSQA 2XIZA 3HV7A 2HZ4A 2YLFA 1YDTE 4E73A 2I0HA 2R4BA 3QQJA 4E4LA 5DRBA 2G2FA 1CKIA 1KOAA 2P2HA 4ALUA 1OB3A 3RMFA 5LVNA 1K2PA 5ANEA 4DFZE 5FRIA 4JQEA 3SXRA 4V0GB 3IW8A 3N9XA 4LFIA 3RINA 3KB7A 5HE0A 4BGGA 4AZSA 3KEXA 3QLFA 3I79A 4FG9A 1XR1A 4D4VA 3LMGA 5HU3A 2HY0A 4XG9A 4G3CA 5F9EA 3MDYA 4UYNA 2BZIB 3RZBA 4CT2A 5CAOA 2CLXA 5I9YA 4EONA 3QHWA 4F9YA 4FTKA 2JAMA 4MBLA 2W5HA 4JS8A 4L3JA 4ACGA 2GS6A 1M7QA 4KIQA 4M15A 4O22A 2ZV9A 4ANMA 4CMUA 2ZM1A 4M0ZA 2OIBA 1URCA 4TYJA 5HG8A 3A7FA 4GIIA 3TNPC 2VTSA 3Q9YA 5L6PA 4IZ7A 3IECA 2PVRA 5IA1A 2C3JA 1BYGA 3PZHA 3EQFA 4EHVA 1Q8UA 3KN5A 5EHLA 4UWYA 5CY3A 5TE0A 2CSNA 3UNZA 5I5ZA 4GMYA 2VWYA 1UV5A 3DQWA 4J71A 5AM6A 5AUYA 1J7LA 5ACKA 3FKNA 4FEQA 4FT3A 3PXFA 2JFMA 5HEZA 3HMOA 4N6YA 1PMVA 2JGZA 3CQUA 3ZSHA 3QRKA 4FUXA 3EN6A 3VHKA 2C3LA 4BN1A 1H1SA 4YO4A 2PZPA 3QXPA 5FXSA 3ZLYA 1ND4A 4C37A 3KRXA 5LWNA 1K3AA 3CC6A 3Q52A 3SLSA 4EOKA 3Q6UA 3U8WA 4QMNA 5CQUA 4FYNA 5CLPA 2VTAA 4YZDA 4KINA 4KKGA 4GKIA 2ZMCA 4C4EA 3GCUA 5A54A 3TUCA 2O0UA 3KF4A 2PTKA 2B54A 4BWKA 4L7SA 3V5PA 1ZOEA 1TVOA 2R9SA 3DKOA 3FMKA 2VO3A 1Z9XA 2REIA 3OCBA 5G6VA 4ITHA 2QU5A 2HWOA 5CENA 4U45A 2YA9A 3TXOA 4E7WA 3ZM4A 3GBZA 4H36A 3HMPA 4M14A 3F61A 4AT4A 3ET7A 3L9PA 1YKRA 3P7CA 3RVGA 4CQEA 4DC2A 4EHGA 5J8IA 1OUKA 5TO8A 3E93A 1XHAA 4I3ZA 2WEIA 2C30A 2RG6A 3F5GA 4EH3A 3Q60A 4XBUA 3T8OA 1SVGA 5DFPA 4YU2A 5AV2A 2EB3A 3UTOA 3LIJA 5BYZA 5DNRA 3I6WA 5LVLA 2YZLA 3DJ6A 1PHKA 4E5AX 3SDJA 1CKJA 1HCKA 2UV2A 3QGWA 2ZM3A 1BKXA 2OH0E 4P5ZA 4NYEA 4DG3E 4O0TA 3R2YA 1MRVA 4XV1A 4FOCA 4LRKA 4Z9LA 3UG1A 2PPQA 2GNGA 3LLTA 4CKIA 4BCHA 1GY3A 3IGGA 2QO7A 2J0MB 4U5JA 5CF8A 3PXYA 2FSMX 4ASEA 3T3VA 4CZTA 3C5IA 1LUFA 5EH0A 2UZLA 3VUKA 4IDVA 4OTHA 3ZLWA 4O84A 4CYJA 4O7VA 4AN9A 3ZBFA 1WVXA 4V05A 4DT9A 3UYSA 1XJDA 4FGBA 3Q2JA 5KE0A 3CPBA 5CXZA 5CNNA 4IAKA 1WBWA 5A4TA 1H8FA 3S00A 3O7LD 4IB0A 3FLSA 3KXHA 3DXPA 1KV1A 4B8MA 1PJKA 4PMMA 2Y7JA 4G3DA 3CKWA 5LMBA 1YHSA 4IW0A 4B7TA 1XH9A 4BI0A 1P4OA 1KE9A 2CGVA 4XH6A 3OCGA 4H1MA 4JX3A 4UMQA 4DFYA 2FUMA 3G2FA 3LQ8A 3HEGA 3WZDA 3UZPA 4D4SA 5DRDA 3VAPA 2WNTA 3HVCA 4GK3A 4KBKA 4F6WA 3D0EA 3OF0A 4TN6A 5AR2A 3A62A 2WMUA 1OKYA 4G16A 4ZSEA 3JVRA 4KBCA 4U40A 3UYTA 2XNOA 4IX3A 1KE6A 1LR4A 3HLLA 4JJRA 5M09A 2C6MA 3AC8A 2QG5A 3MJ2A 4ZZMA 5BMMA 3ATSA 4F64A 4NTSA 5A9UA 3FZ1A 5KMNA 2OFVA 4TKSA 4KUJA 3FLNC 4K77A 3KMMA 5EDQA 4EJ7A 1T46A 2O8YA 5I9ZA 3TG1A 4YZ9A 2PWLA 3T3UA 3O17A 4FOBA 5BVFA 3E8CA 4EOLA 4PDOA 4IADA 4ALWA 3U6JA 3BELA 2F57A 4AW1A 4E8AA 4ZY4A 5KNJA 5J9LA 2UW0A 2W1HA 3IDBA 4RC2A 2ITWA 1PW2A 3FZPA 3LZBA 3UC4A 4E20A 4CXAA 4BDFA 4NFNA 1B38A 5HLNA 1E9HA 5C03A 2J0KA 2XCHA 2WTKC 4K2RA 4DINA 3FMJA 2BRGA 2JAVA 4FTCA 4Y8DA 3R8PA 4EOQA 4NM3A 4C0TA 2X8EA 4PMTA 3W8LA 5A3XA 4W8EA 3BZ3A 4WT6A 5C4LA 2P2IA 4Y5QA 1YVJA 4CTCA 2OZAB 4RIXB 3BQCA 2CNUA 2XK7A 2I0EA 3HMNA 3QGYA 1R1WA 4QP1A 3I0QA 2JKMA 2YIYA 5FD2A 4RWKA 2ITZA 4IZAA 5JRSA 4A06A 5AUUA 2YWVA 1JKKA 1REKA 4L53A 3NS9A 3KA0A 3EQDA 1AD5A 1RE8A 2QHNA 4ITIA 2JKQA 2W5BA 2XH5A 2Y8OA 3EFJA 3G90X 4FKQA 4DGGA 1IEPA 4ZMFA 5LCKA 3OUNB 1H25A 3KCKA 4FG8A 3DB6A 3KCFA 4WNKA 2BRHA 3BHYA 4I6HA 3W1FA 2CCHA 2YLEA 3KRJA 4TT7A 2DUVA 4BWXA 3FLWA 3R30A 4S32A 4YLLA 2QG7A 3C0GA 2V22A 1RJBA 3DV3A 4I24A 4TYIA 4O0VA 3ZLXA 3I81A 4NTTA 5DN3A 3GB2A 3L8VA 4U41A 2W1ZA 4C57A 4PL4A 5FTQA 4FICA 2I6LA 4FTNA 4W9XA 3DJ5A 4XJ0A 5DIAA 5HVYA 3PXKA 3MESA 3F7WA 4RFMA 1L8TA 5LARA 3UO4A 2HXQA 2VTJA 3JYAA 4FKUA 4MWIA 2PUUA 3AMYA 3NYVA 1W83A 4X7QA 3W2RA 3HNGA 2CHLA 3BRBA 1XH7A 3G9LX 5FTGA 3EN5A 2I0YA 1SZMA 3ELJA 2YITA 4YJTA 4PDYA 4M97A 1M2QA 4V04A 2EUFB 3O71A 2VTTA 3GENA 4R7IA 2Y4IC 5EOLA 4BBFA 4GV1A 2JKKA 4BICA 4C62A 4QP7A 1BX6A 4WBBB 4EL9A 1A9UA 4OUCA 4CMTA 2FA2A 4QMOA 3O2MA 5FP6A 1ZYLA 2AYPA 2HCKA 3CXWA 5LMKC 1ZYJA 2C1BA 2XK9A 3FI3A 4UBAA 1Z57A 4OT5A 2GNJA 4DEGA 3LAUA 3CSVA 3GVUA 5D10A 3UMXA 2R0IA 3OWPA 3DXNA 4FKVA 5EYMA 4FE2A 4NM5A 2ZMDA 3HP5A 4BKZA 2HZ0A 4DEHA 2WMXA 2J2IB 2OI4X 5DA3A 5M08A 4UX9A 1H08A 2V0DA 3KXZA 3QXOA 3SRVA 1Y8YA 2CN5A 3JY9A 4N0SA 2JITA 1PF8A 2R3LA 4DH3A 4I5PA 4R77A 3VBQA 3FY0A 4EZ3A 4FKRA 2PMOX 5CZHA 4YMJA 1G8SA 1OL6A 4C4GA 3ORTA 1VR2A 4D5HA 4MNEA 3KULB 4MQ2A 4F0IA 2C5OA 3E8DA 4BCMA 2A19B 5GINE 4ZEGA 3B8RA 4FTJA 2JBPA 4QMUA 4K11A 2JIIA 4C4HA 4ZLYA 4O27B 2G9XA 3P79A 4Q5HA 1YDSE 2AC5A 3U4UA 3VJNA 4FT0A 4YTCA 1P14A 1LP4A 2XIXA 1DAYA 2W96B 4E3CA 3FEGA 4I5MA 2H9VA 3BE2A 3ODYX 1YXSA 5L2WA 4BTFA 4JIKA 4BY9E 1CSNA 4CMOA 4F1OA 3FXWA 1YXTA 5K9IA 3KREA 3ZXTA 3QD4A 3Q32A 4KRCA 4XOYA 3RAKA 4IAYA 4H3PA 4O86A 4RJ5A 4U0IA 3E8EA 3FHIA 5JFVA 1FQ1B 3MVHA 3Q6WA 1H01A 3NW6A 4R1VA 4E6CA 2XS0A 3CBLA 4GEOA 4S2ZA 3SC1A 4ZSAA 2GDOA 1G8AA 2I1MA 2YM6A 5EK7A 1DI9A 2ZM4A 4JQ7A 4BIDA 3DBQA 3COKA 3KKVA 5AUVA 4CG8A 2X7FA 2ITVA 4DH8A 2UZEA 2Y4PA 4FV6A 4X2GA 3UNJA 2RFSA 1CTPE 5C27A 3L9NA 3AC4A 1ZXEA 3C51A 5TR6A 3E64A 3DKGA 3TIZA 4DFXE 3MPMA 2YDIA 4RRVA 5B2KA 1JPAA 4TWNA 3PRFA 3ZEPA 4IMYA 3MTFA 1NVQA 4Q5EA 5AIRA 3A4PA 5LMKA 3B2TA 1O9UA 2YACA 3HUCA 3QTIA 5L2SA 3WF5A 2WO6A 2XMYA 4TYHA 4A4LA 3GEQA 1ZYDA 4IB5A 5M4UA 2X2KA 3NRMA 1OKZA 3OBGA 5AEPA 4HCTA 5EI6A 3BEGA 2PVHA 5AP1A 2O3PA 3GU7A 5FQDC 5KKRB 3K54A 3NYNA 4W4VA 5CU0A 3N4TA 3QD2B 2NO3A 3C13A 4Q2AA 4ONAA 3ZRMA 4HVDA 5E8YA 2JDSA 4O7ZA 2UZNA 1F0QA 1UNLA 3JY0A 3BGZA 4XOZA 5HCXA 5C8MA 3LFBA 2UVYA 4ANQA 4AACA 1UNHA 4M7IA 1AQ1A 1TQIA 1CMKE 1UU9A 2W9ZB 3AC2A 3CCNA 4MD9E 4X2KA 5CU3A 5FBNC 2GFCA 4F4PA 3WIKA 2WELA 2F49A 4LGGA 3PA3A 2V62A 4YNOA 3NUYA 5C01A 3S3IA 1BL6A 1YWVA 3NUPA 4FKGA 4FZAB 4FC0A 3ZFMA 4E4XA 4JRNA 2XKCA 4EH4A 4EOSA 2QR7A 3CQWA 4QOXA 4QMTA 3GC8A 3GU5A 4IM0A 4G17A 3IONA 3VRZA 4PNIA 5HTBA 5CEKA 1P2AA 1YWNA 2PUPA 4HVGA 4EUUA 4F70A 4I6FA 4JX7A 4LUEA 5HG5A 4PDSA 1PMUA 2X39A 2WOTA 3PIYA 3QA0A 4P4CA 2VWVA 4HYSA 5ICPA 5GNKA 4PMSA 4O96A 5K4IA 4O0XA 5BQ0A 2CCIA 5AAEA 2PVMA 1OECA 2OJJA 4YZBA 2JD5A 4B4LA 4RX5A 2PZIA 2X0GA 4JL9A 3PE1A 1WVWA 3V5WA 2XB7A 4HVHA 3WI6A 2PE2A 4XRJA 2YDKA 3QCSA 4QMZA 3DQXA 4IAIA 4QYEA 2AUHA 3D5XA 3UVRA 2XIYA 4DFNA 3BYSA 3OZ6A 4FEWA 2Z2WA 3ENHA 3MB6A 3NNUA 5HNIX 5A14A 1JSVA 1WFCA 3Q4ZA 5EI8A 4C3RA 3FZRA 4KKEA 3RAWA 4O0YA 2ETKA 3EB0A 4QQ5A 5M51A 5EHYA 1URWA 3OWLA 4QMSA 2X8DA 4LMNA 5A4LA 3S2PA 3VUDA 4UZDA 5H8GA 2ZV2A 3HL7A 5M57A 4E4NA 2X9EA 5EQEA 4DFUA 1H0VA 1FINA 3HAVA 1Q97A 2R3GA 4X21A 4BDAA 2VTRA 4RQKA 4AE6A 1Q24A 2YABA 4DH5A 4YLJA 3QYZA 4C36A 4CGAA 2Y6MA 2NRYA 2PE0A 3QD3A 3VW6A 1UVRA 4UMTA 3QX4A 1ZARA 2EU9A 5AR5A 4BCNA 4J1RA 4XG7A 2QOCA 4TYEA 2QHMA 4BZOA 1J7UA 5E8TA 4ENXA 1HOWA 2C1AA 2R64A 3O23A 2QOKA 2QVSE 3E8NA 3SGCA 3UQCA 2C5VA 3VUGA 3VVHA 2W4OA 2P0CA 5CSPA 2ERZE 5FXRA 3D2KA 5CSWA 4OTIA 2QOQA 2BAKA 4G6OA 4FIIA 3BHHA 1JVPP 4L46A 3WF8A 2X8IA 5AJQA 3BWFA 2VWIA 2W4JA 4U3ZA 3VS2A 5JT2A 4IFGA 4IXPA 2VX3A 3LJ2A 3OEFX 4GJ3A 5DR2A 3R7YA 3TTJA 4F65A 4ZOGA 1KSWA 3K3IA 4F1TA 2WTCA 3AGMA 5CAQA 5M4CA 3DAJA 3I7CA 4MXCA 3KC3A 4YTHA 3DCVA 3KK8A 2I7QA 3IK3A 2OGVA 4A4OA 3V6SA 5HD4A 4RIYB 3TACA 4QMWA 2OFUA 3OY1A 5CZIA 4CNHA 4I21A 4CSVA 3Q53A 3VQUA 3NNWA 2ZVAA 5FXQA 5BYLA 4XLIA 3JUHA 1ZY5A 4JNWA 2ZB0A 3CJFA 4NT4A 3R7IA 5EOBA 1DAWA 5ITAA 5FEEA 5C9CA 4PX6A 2GQSA 4NZWB 4AGCA 3DTCA 4A9UA 4G6NA 4JR7A 3HYHA 5KBRA 4RJ6A 5FBOA 4MXZA 4NUSA 3FSKA 4NKAA 5HO6A 2UZTA 4OAUC 3EQBA 1RDQE 3ZDIA 2YAKA 2B9IA 2IZUA 4FL2A 3OW4A 3WZJA 3R9NA 4FIJA 1U59A 3S0OA 3LKMA 4BRXA 1M17A 2HZIA 1ZAOA 3UVQA 3RPRA 5E7RA 3BU3A 4PTEA 2BRNA 3NSZA 3VQHA 2UW6A 2YM5A 3Q96A 3NUXA 2QCSA 5AP0A 2UW9A 2UVXA 3QKMA 2EB2A 2HK5A 3NWWA 2UW8A 3QYWA 4RC3A 4FSYA 4B8LA 4AA0A 4I1ZA 3MH0A 3QA8A 4FV0A 4C02A 4RVLA 4ZTSA 4ZLZA 1YXUA 4OTPA 2W1GA 3PLAE 4FEUA 2V5QA 3D5UA 1WBTA 5CALA 4ZSJA 1JQHA 2X4ZA 2W1FA 5HTCA 3W8QA 1ZWSA 1A48A 4LOQA 3GCSA 2HY81 4YZCA 4RA4A 3ZZEA 4EKLA 3POZA 5IA0A 4EWQA 1KUTA 4EYMA 4JLCA 2QLQA 1MUOA 4HGSA 2BDFA 3AG9A 3R28A 1JSUA 5CI6A 1MQBA 4XYFA 3LXPA 3LFQA 4EK5A 4IEBA 3L8XA 5IH4A 3UIXA 4AZWA 3QTXA 3DLZA 4J53A 4Z7GA 4E6DA 2RFNA 5L2QA 2PL0A 3LFAA 3OS3A 4PTGA 4XP3A 5ACBC 4MH7A 2GNLA 3EN7A 3RKBA 2C0TA 4KIKA 4ZS4A 3RP9A 3V5JA 5JH6A 4MD7E 3ALOA 3BPRA 5BMSA 1U5RA 2VTMA 1SNXA 4DAWA 3NCGA 2VTOA 3UPZA 1M2RA 3EQPA 3ORPA 2C3KA 2C4GA 3PVBA 4XG2A 1L3RE 3AC5A 4FKPA 3ULZA 4QQJA 4ASDA 4IJ9A 3RTPA 4TWCA 3QAME 3CTHA 3A8WA 4HGLA 1Q5KA 3ZRKA 4EI4A 2YJSA 3OXIA 4KIOA 2PVLA 3T9IA 3WF9A 3W2QA 4LRJA 3A7JA 3GNIB 5HG9A 4GSBA 5AUWA 3OXZA 4KABA 4AA5A 3PSBA 4R3RA 1VEBA 5CAVA 3TDWA 3PJ2A 1T45A 2QOFA 1KE5A 1SVHA 2HWPA 1GZOA 2OJIA 3COHA 3MGYA 5KMIA 5L2IA 4K8AA 5HICA 5AP4A 3W55A 4EHZA 3LXLA 3ORIA 3QHRA 3T9TA 2J5FA 2BRBA 4FKLA 4O1OA 5IF1A 2WTVA 4KB8A 4AGUA 1OVEA 5B7VA 2FH9A 3BU6A 1AGWA 5E9EA 3NCZA 4FZ6A 3E62A 3GU8A 4H3QA 4E1ZA 4FT5A 1J3HA 2FB8A 4K6ZA 3KK9A 4KRDA 5HQ0A 2A27A 1FGIA 2IPXA 1SYKA 5LCJA 3PXZA 4MAOA 4WHZA 2QURA 2PUNA 3UOKA 4JG6A 3ORKA 2Q0BA 4TNBA 1ZYCA 3L8PA 4BIEA 2VNWA 5D7AA 3DLSA 3D4QA 4FVPA 4O7SA 3WZKA 4PRJA 4EC8A 3DFCB 3BI6A 3ANRA 2VTLA 5M44A 4MF1A 4IVBA 3D7ZA 3TEIA 3COIA 5I0BA 1A06A 4HJOA 5IMEA 3DY7A 1Z5MA 3GU6A 5HE3A 4FYOA 4OT6A 1U54A 4EYJA 3D7TA 3R7EA 3ZSIA 3ZYAA 2EWAA 4DEBA 1Q8WA 4FTQA 4L8MA 4IM3A 4I6BA 2QOIA 4UMUA 3PJCA 1OBGA 1JSTA 3I7BA 5DHJA 3N4VA 2PVYA 4IB1A 4FK6A 4M84A 5ANIA 5F94A 2FSLX 4CEGA 1CKPA 3NUSA 5H8EA 2OBJA 1FBNA 3FHRA 1V0BA 3K5UA 3DZQA 1IR3A 3FKOA 4ZK5A 4DGOA 4X3JA 2PZYA 4TXCA 2JEDA 4EC9A 1WZYA 4FA2A 4WNOA 4TWOA 1NXKA 5M4FA 4OLIA 4NCTC 4BDGA 4XBRA 3ROCA 1DS5A 3WBLA 5HIEA 2BRMA 4BTKA 3LOKA 2WIPA 4GYIA 4JRVA 3H9FA 3DB8A 4YR8A 3QZIA 4UZHA 3H9RA 3TM0A 4QQCA 4ASZA 3OY3A 3PG3A 5ANJA 1J1BA 3RPOA 1KE7A 4YJUA 4YBJA 3NAXA 1XBCA 2VWXA 3V04A 2XM9A 4R5SA 4A07A 4FX3A 4D1SA 5JMSA 5JN2A 4NJDA 1WBNA 2WIHA 3C50A 4L6QA 2G2HA 3POOA 4DTKA 4A9YA 3C0HA 4UMPA 3KY2A 3AT3A 1OL1A 4ID7A 2G1TA 3AOXA 3OW3A 4PPAA 3KMUA 2OJGA 3ODZX 5K0KA 5T3QA 4EOIA 4PP9A 2VX0A 2J90A 4FZFB 4QMYA 4JDIA 3Q04A 2ZV7A 4G3GA 4FSUA 2UZDA 4RIOA 3HV6A 4AU8A 3MFUA 2JDOA 4I22A 1Q3DA 3LFNA 4H39A 5BX0A 4RC4A 2WMRA 3DGKA 4RZVA 3VBXA 2ACXA 4IQ6A 2B0QA 4X3FB 2C6LA 3ZS5A 3H3CA 3R2BA 3C4ZA 4DT8A 3O8TA 5AWMA 5E4HA 5HO8A 3ZFXA 5DYJA 3QTRA 3O96A 3BKBA 4F7LA 3FY2A 1W82A 4R1YA 4WG4A 3F7ZA 2VTIA 5AR4A 4ANLA 4NIFA 3R6XA 4QP3A 2VAGA 3HZTA 3KMWA 5KZIA 3NPCA 4FK3A 3R02A 4QTCA 3UGCA 4IVCA 5H9BA 5CI7A 1IG1A 2QODA 3SXFA 4O0UA 2GSFA 1XH8A 4ZS0A 2E9UA 3PG1A 3UG2A 5E8UA 3HX4A 3TCPA 2OICA 4KSPA 5IQDA 4DHFA 3PYYA 5LVPA 1FMKA 2JDVA 4FZ7A 4RJ3A 4BKJA 5M4IA 4JAIA 1ZRZA 3VNTA 1O6KA 3WILA 4ASXA 2W06A 4NCTA 3EWHA 2NRUA 4EH7A 4QP9A 3RPVA 1XQZA 2C3IB 3EL8A 3PY1A 5IQHA 4WA9A 4X0MA 2R5TA 4KWPA 3SAYA 2BZHB 3TNHA 4F0GA 4ZAUA 2CKOA 3KXMA 4C58A 2J9MA 5J5TA 4HYUA 1ERKA 3DA6A 3F5XA 3KVWA 5D12A 4JIAA 2XYUA 5I4NA 3DPKA 4I5CA 3MTLA 4FVRA 3GQIA 3JPVA 4OTFA 1O6YA 3IS5A 4D2SA 3NEWA 3FLQA 4CFWA 3QX2A 3KU2A 2H96A 3LQ5A 5E8VA 2VO6A 1P5EA 4U43A 4WD5A 2W05A 5EYCA 3HP2A 5KMJA 3TNWA 5DPVA 3QFVA 3A99A 2KTYA 3MH3A 3VWAA 3SKCA 3NR9A 4GIHA 3I1AA 4ORKA 4YPSA 1NA7A 3LCTA 2HZNA 5DR9A 4FT9A 5CEMA 4ZY5A 3MN3A 4RT7A 2WMWA 1HCLA 4PWNA 4NKSA 4AAAA 4EWHA 4L3LA 4EQUA 3UP2A 3RPYA 4AOJA 5CXHA 1FVTA 5DT4A 4LOOA 2R3IA 4DEEA 3JS2A 4RQVA 4BDJA 4IFCA 4AZTA 1R78A 4CT1A 5C26A 4DEAA 3PVWA 2Q83A 3G0EA 2YISA 3R9HA 2WTIA 4F7JA 4NL0A 2BIYA 4ZTNA 2BAJA 5B0XA 5H8BA 2XKEA 4ENYA 2CKQA 3Q9XA 3BQRA 1PYEA 3NUUA 4UMRA 3R73A 3R8ZA 4R7HA 2G2IA 3TJCA 2GS2A 3FUPA 4WSQA 3PSCA 4CG9A 4FTIA 2RFEA 3D5VA 4CQGA 4IAFA 1EH4A 5CWZA 3THBA 3DNDA 3ZBXA 2ZB1A 1PKDA 4I5HA 2FYSA 4X6QC 3R8UA 2QONA 4FBXA 4OR5A 4PPBA 3QCQA 3O8PA 5CSVA 4IX5A 3MBLA 2PMNX 2XRUA 2Z8CA 3R00A 5D11A 4O1PA 4WIHA 5CEIA 5AV0A 5HNGA 3OCSA 4ZJIA 5I3RA 1MP8A 4WBOA 5BVDA 3LJ0A
chains in the Genus database with same CATH superfamily
4BHNA 2WEVA 2F2UA 5IQAA 3SA0A 5CU4A 3DOGA 4AZVA 2A4LA 3QWJA 5EHOA 3LFEA 2E9NA 4CFFA 3SOAA 4FKJA 2YEXA 4FSNA 4Y95A 5TKDA 4M3QA 4RVMA 4DTAA 2YM4A 3TT0A 3RK9A 4ZTQA 1PRYA 3QWKA 1WAKA 2CKEA 2OLCA 5EG3A 5L8KA 3VF9A 1GNGA 3B8QA 4YUQA 1UA2A 2XK6A 3DBDA 2UZWE 3ORLA 3ZMMA 2BALA 3M2WA 4MEDA 3CTJA 4CFVA 1U5QA 5A4EA 3BL9A 2IO6A 4QP6A 4QTDA 4YPDA 3P86A 4YJNA 3Q3BA 4GT4A 5AV3A 4ACMA 2RL5A 4PPCA 1IRKA 4EH9A 1ATPE 2XM8A 5FEQA 4HOKA 3Q2MA 2G01A 5A6OA 3FL4A 2XEYA 4MQ1A 4QDEA 3EN4A 4FIFA 4DGLC 2PE1A 3MH1A 4EORA 2R3MA 3S4QA 2HAKA 4Y83A 2BZJA 3OXTA 3K3JA 4FR4A 2PVJA 2VO7A 2XJ1A 5BVNA 4BI1A 2RG5A 4EZ7A 1ZOGA 2OXXA 4FNYA 5E8WA 3ULIA 3UPXA 2WMAA 4EH8A 2B9HA 5KUPA 4YJSA 2NYAA 1OIYA 4U80A 2B4SB 4BCFA 3CIKA 4BIBA 4MXOA 2Y9QA 2PMLX 2XZSA 3KF7A 4KS8A 3EFWA 3EZRA 3M11A 4HCVA 4D5KA 4MCVA 4KA3A 3FMMA 2XUUA 3E3BX 3UZTA 3TMOA 2IG7A 3PVUA 4JDKA 2H8HA 3AT2A 4OTRA 3VHEA 2A98A 2GTMA 4ARKA 2IVTA 4C61A 1ZMUA 3PY3A 3A60A 1MRUA 4LGDA 2CN8A 4PUZA 4GT5A 5EW9A 2YJRA 3LCKA 2XK8A 5D41A 2NP8A 3ZTXA 4MXYA 2BFXA 1OPJA 4JBPA 3G9NA 1UU3A 4CTBA 5FDXA 4IJPA 3ITZA 2VTHA 4ALVA 4H3BA 4FTTA 5CVHA 2WTJA 5EQYA 3H0ZA 4FTOA 4HGEA 4AQKA 3ANQA 5KBQA 3D5WA 3R9DA 4P90A 4JOAA 3RK7A 3NDMA 4K33A 4FSRA 4BVUA 2PUIA 4P5QA 4YGAA 5ETCA 3W0NA 5GZ8A 1CDKA 2WQMA 4NU1A 2WQOA 1VJYA 3IKAA 4FV7A 4HYIA 4N4SA 5DLSA 4KS7A 3G6GA 3TZ9A 3BLRA 4AGDA 4GUEA 1W84A 4YLKA 5B2MA 3QTWA 2YZAA 4AXAA 5LOHA 3HRCA 1OITA 5M56A 1YI3A 4L68A 3PFYA 4RWLA 2UZBA 5K5NA 1PMNA 2GNIA 3GCQA 1Y6AA 4ZY6A 4FMQA 5DOSA 4BGQA 3IW4A 3W0QA 5A4CA 1R3CA 5BYYA 4E5BA 2RSVA 5CF4A 1KOBA 4D2PA 5CAUA 4HZSA 4I0SA 2QC6A 4L42A 4XP2A 4BFMA 2YM3A 2OXDA 2P3GX 4LG4A 2J50A 2ITPA 2QOHA 2OIDA 4IDTA 4OBQA 4CFUA 3UDSA 2B1PA 4GT3A 5CNOA 4OTDA 1BUHA 5LXMA 3PJ8A 4IWPA 4USFA 3BYOA 1H1PA 1Q8TA 2GHGA 1JNKA 2JFLA 3AMBA 5IEYA 2ZDTA 4PQNA 1JKSA 5EYDA 1IAHA 5EW3A 3LFSA 2XBAA 1OI9A 1Y91A 3EKKA 3MFTA 4FKWA 4BDBA 2P55A 5JFSA 4B0GA 3R01A 3ZCLA 2GU8A 2OH4A 3PSDA 4X6RA 5ANDA 3LCDA 4O7RA 1B39A 4XHKB 4RIWA 4XMOA 5CT7A 3TKUA 3WE4A 4DGMA 2Q0NA 3TV4A 4QMVA 1UNGA 3OVVA 4BL1A 2C5NA 3PXQA 3R04A 5HX8A 3UO5A 3R1QA 2QD9A 4FODA 3KQ7A 3F3ZA 3BGQA 1XH6A 2X81A 3R7VA 4N6ZA 5DR6A 3VN9A 2VZ6A 3QTSA 4MX9A 4HGTA 3RNIA 2JIUA 2PVFA 4OGRA 3FZOA 4U81A 3VBWA 4EK8A 3LLAA 3HMIA 3UP7A 2ZV8A 5JQ5A 4QEBA 5DEWA 2KULA 3SHEA 3FXXA 3TKHA 2NNWB 3OD6X 4PMPA 4QNYA 4BCOA 3BHTA 3UE4A 1XH5A 2XK4A 3WZUA 3ZH8A 4O81A 4EUTA 5I9XA 5AV4A 3WF6A 2OO8X 3AMAA 2VD5A 4HZRA 3IOPA 3SVVA 3OEZA 1W0XC 4CFMA 3FAAA 5KCVA 5CEPA 3FYKX 4MTAA 1IAJA 3U9CA 3H9OA 1YOLA 3SRVB 4Z55A 3R71A 5FDPA 4ZLOA 3OP5A 4I0RA 4Y5HA 3BU5A 1WBOA 3EYHA 3FXZA 3ORNA 2OF2A 4C33A 5AP3A 3G15A 3BGPA 2WQEA 4G5JA 4ZTMA 3UDTA 2OF4A 3R63A 3HA6A 4MNEB 3KXXA 2P33A 4CRLA 4JMQA 4GS6A 4BYJA 2XNMA 3TUBA 3UZRA 4AOIA 1YXVA 3DK6A 4DG0E 2ITOA 5FP5A 3U54A 3GU4A 2PULA 4LGHA 1QPJA 3PPKA 3BLHA 3AXWA 2F9GA 2FGIA 4KKHA 1YOMA 5E1EA 3TNIA 2WKMA 5M55A 4C59A 4EOJA 3F82A 3MY5A 4AXEA 3R7UA 2YM8A 2E2BA 4O2PA 4K1BA 3UC3A 3BHUA 3CEKA 5HVKA 3OMVA 1OIRA 2IN6A 3LM5A 1KE8A 1Y57A 2JC6A 2VTPA 2BPMA 2QO9A 2XNPA 3MIAA 3OWKA 3G33A 4I4EA 2YIXA 4YBKA 3TZ8A 3PLSA 4NJ3A 2Z02A 1PY5A 4GKHA 3RZFA 3W2SA 4BCGA 3OCTA 4FSZA 4D0WA 3UDZA 4AX8A 4FKOA 1JKTA 2J0LA 4O91A 4YURA 2WAJA 3FPQA 3PUPA 5DBXA 4GUBA 2J5EA 3E3PA 1J91A 2OSCA 4PY1A 4UEUA 4RWJA 4KD1A 4QPAA 3V5TA 3ZUTA 4XNEA 3TJDA 3EHAA 4MD8E 5DT3A 1UKHA 3RAIA 3RALA 3ZO1A 4IBMA 4DDIA 4AZFA 4E4MA 4YC8A 4F09A 3ORZA 3BV3A 3NNVA 4I4FA 5AAGA 4D28A 1PXOA 1XBAA 3DFAA 3UQGA 4QO9A 1OKWA 2Y4IB 4NEUA 4UV0A 4AOTA 4HVSA 3IW5A 1LPUA 4U42A 4XLVA 5ANOA 5E8XA 3VBVA 4QP4A 1GZNA 3GC9A 3A2CA 1ZMWA 3QD0A 4ZP5A 4IVAA 2I40A 5L6WL 2BILB 1UKIA 3PA4A 5IDPA 3EH9A 2BHEA 2YN8A 3LVPA 4TYHB 1WBPA 4WSYA 1OKVA 4YSMA 5J7BA 3U55A 1IA9A 5CTPA 4C34A 2C6EA 3MS9A 3UBDA 3O8UA 1BL7A 4DG2E 3RAHA 1H1RA 3F6XA 2O64A 3MSSA 3FC2A 3IGOA 4CLJA 5FUTA 3I4BA 4W4WA 2IZRA 4K18A 2P4IA 3AKLA 2FO0A 4JG7A 4RLKA 2PMIA 3PVGA 3EKNA 2BKZA 5HCYA 4FNXA 3ZHPC 4EBWA 4AZEA 2ZAZA 3UNKA 5A46A 1YHWA 2VGPA 3F2AA 2QI8A 4G2FA 3TDVA 1Q61A 3IW7A 4ZSLA 4O7WA 2GFSA 3R1YA 2CPKE 4ZXTA 5IH6A 3ZUUA 2V7OA 3D83A 4AF3A 4TPTA 4FV9A 1UU7A 4ZSGA 3TL8A 2QOOA 4X2JA 3W2CA 4EKKA 5E90A 5CASA 1W7HA 5K5XA 4MBIA 2WMQA 4LUDA 4B6LA 2H6DA 2V7AA 4QNAA 4F0FA 5KMLA 2IW9A 2WU6A 2OZOA 4JT3A 4PV0A 1PXMA 3UIMA 2GQRA 3ID6C 3NX8A 3F3TA 4IX6A 4R6VA 4YZMA 4M69A 1BLXA 2BR1A 2JIVA 4Y46A 4USEA 3B2WA 4FNWA 4E5WA 2RIOA 4IVDA 5HGIA 2X7OA 2ONLC 5DGZA 5I3OA 1ZLTA 3RCDA 5M06A 4QTBA 2IVVA 2OWBA 4M8TA 4RFZA 4UALA 4WUNA 2UW5A 4ACDA 4PNKA 4GW8A 1OL7A 3QUEA 3GOPA 4C7TA 5IU2A 1PXIA 2PSQA 3NUNA 4HCUA 4PL5A 3NMUF 4H05A 3F5UA 5HKMA 4UN0C 4PDPA 3DK7A 4XX9A 4BCQA 3DJ7A 2F4JA 4V01A 4F08A 3A4OX 4QQTA 3QU0A 4V0GA 3MIYA 3MVMA 4A4XA 5L3AA 4M12A 4YO6A 4AA4A 1OL5A 4X3FC 3VW8A 2CMWA 4GFMA 1OBDA 3QF9A 4I0TA 3RHKA 1G3NA 3LXNA 3GGFA 5EDPA 1SM2A 4L01A 3QC4A 2GTNA 3C1XA 4RJ4A 2PY3A 1R0EA 4BDKA 3CPCA 3OG7A 3GOKA 4JDJA 3IG7A 4UXLA 2ERKA 4BDCA 2WFYA 4CD0A 4DLJA 4YC3A 2C0IA 4QTEA 4IWDA 1XMMA 3EQRA 4OAVB 1FGKA 4BB4A 5IA4A 4N70A 2F7ZE 3MPAA 5JFWA 4P2KA 4DBXA 5HD7A 3IPHA 4QYGA 3PXRA 1TZDA 5FGKA 1R39A 4FNZA 4S30A 4D9UA 1NY3A 4G31A 5I9UA 4BCJA 3C4CA 3V01A 5AX9A 3ZO2A 1M7NA 1STCE 1JKLA 3FQEA 2R3FA 4GG5A 3UOJA 5HX6A 4AE9A 1LEZA 4U6RA 4CZUA 2CGUA 3P23A 3CS9A 3KRRA 4QMMA 5DH3A 1M14A 2XNGA 4QTAA 4CRSA 5IUGA 3HAMA 4DH1A 3H10A 3FDNA 3V8TA 4GK4A 4K0YA 4RJ7A 2VTNA 3EL7A 3SG9A 3NYXA 3UOHA 2QU6A 3A7IA 4LRMA 4TWPA 4J99A 5EM8A 3VC4A 2W99B 2X6EA 3HDMA 4PF4A 3VS6A 4LL0A 2G15A 4IE9A 4FI1A 1FOTA 4KAOA 2R3RA 4KNBA 4MF0A 3SQQA 3QL8A 5HI2A 4NM7A 4AGWA 4GFOA 5JQ8A 3OTVA 2XA4A 4YZNA 1Y6BA 3W0SA 3G0FA 3AQVA 3TNQB 3IO7A 3KL8A 2QKWB 4D0XA 5HU9A 4JR3A 3L9LA 5BVEA 1QMZA 2C6TA 3R8VA 2OW3A 3LCSA 3VUTA 1U46A 4O82A 2VWWA 4MVFA 1WBSA 1SMHA 3HV4A 3VUMA 2VO0A 5IA5A 5HO7A 5EYKA 2C6KA 3UJGA 3OBJA 4TW9A 3F2NA 3GFWA 3MA6A 5CSXA 5HG7A 3TTIA 3HRFA 5JGDA 2WQNA 2DS1A 3V8WA 2H34A 2R7BA 3L9MA 4ACCA 3NFFB 4IAZA 4IWQA 2A1AB 4ACHA 1FPUA 2BHHA 1GOLA 2XRWA 2YIQA 3CY2A 4BKYA 3N4UA 4NH1A 5CT0A 3ZUVA 2W5AA 2VV9A 4QD6A 5HLWA 4YSJA 4XRLA 2A2AA 2XNEA 3DS6A 5AM7A 4RX8A 5F20A 2X0PA 5C1QB 2VWBA 1U4DA 3BCEA 2W7XA 3E92A 4PP7A 5J9YA 3FMNA 4O6LA 2NPQA 2R3JA 1ZMVA 2ITTA 4F9WA 2BZKB 3BHVA 4CV9A 2I0VA 3GP0A 2C5XA 4AW2A 4JVGA 4EK3A 1VYWA 2LAVA 4WUAA 2IZSA 5LJJA 4I92A 4C4JA 4I94A 4BDIA 2J7TA 4D4RA 1FVVA 3F88A 5J87A 1OPLA 4E6AA 4QT1A 3LMIA 4AXFA 4RJ8A 2PU8A 2YWPA 4IHPA 1TQMA 2VX1A 5GJGA 5EFQA 3V8SA 2O2UA 3OOGA 5BPYA 4MKCA 5ETFA 4TYGA 4HNIA 4BC6A 3KIOC 4LQMA 4O7TA 3CP9A 3BIZA 3E88A 3NIEA 4WNMA 2ITNA 4DHIB 5M53A 3BE9A 2BTRA 4AAYA 3EQHA 1OZ1A 3ENMA 3RI1A 2E9OA 4L43A 4R5YA 2J51A 5G1XA 3DK3A 4L45A 4EEVA 3HMMA 4QRCA 4BJJA 3UDBA 1W2FA 2X6DA 5T68A 3PFQA 2ZOQA 5JRQA 3I5NA 4YHTA 5BUJA 5JZJA 2W1CA 5HZNA 3CJGA 3P78A 4RSSA 4YJOA 4C4FA 2W9FB 4H58A 4J96A 3KRWA 4C2VA 3RJCA 4FUYA 4RFYA 1CM8A 1PXLA 3REPA 2GMXA 4BI2A 4CCBA 3GXLA 3BX5A 1XKKA 1Y8GA 3G6HA 4Y72A 4CKRA 2CLQA 3QQLA 2IW6A 4XV9A 5HTIA 3ROYA 4DTBA 4C38A 3C4EA 3RM7A 3OUKA 5F1ZA 3IDPA 4QYHA 4M66A 2XARA 3EFLA 3P7BA 3D94A 3DBEA 4KIKB 1Q3WA 4FVQA 4UB7A 3ZC6A 2W4KA 4WO5A 3PIZA 4IZYA 4GVJA 4EQMA 2PVNA 4CV8A 2C47A 4F63A 1ZY4A 5E1SA 3W0MA 3OWJA 3BBWA 5DI1A 2CKPA 1UWHA 1YQJA 1V0PA 1ZZLA 3BBTB 3ZDUA 4ANOA 4AWIA 3VULA 1E1XA 3ZM9A 4QPSA 4NFMA 2UZUE 4DEDA 3FMHA 3QQUA 5CANA 4TNDA 3E7VA 4F9CA 5L2TA 5DE2A 3BEAA 3FE3A 4FJVA 3MFRA 4F99A 4I93A 5E8ZA 3W0RA 2PVKA 1GJOA 3AD4A 3EFKA 4IAAA 3P5KA 3VS7A 5LVOA 2YDJA 3NIZA 1ZOHA 2SRCA 1MRYA 3QQFA 3QRJA 4YJVA 2XKDA 4DCEA 4AW0A 3CGFA 3A7HA 3FBVA 3FI4A 3CLYA 2WTWA 4S34A 4E93A 3QCYA 1PXKA 5IISA 2YIWA 4QMXA 1QPDA 1YWRA 3PJ3A 4YNEA 3ORXA 1PXNA 1PKGA 4NW6A 2XNNA 1FVRA 3DKCA 4IX4A 2VUWA 4LMUA 4NW5A 5TF9A 5A6NA 2QNJA 1TQPA 3P08A 1OM1A 2Y6OA 3TV7A 1H24A 3QTQA 1GAGA 5HOAA 4GYGA 4BHZA 2F2CB 3K5VA 3FZSA 4JBQA 4USDA 4OBPA 4OW8A 3VUIA 2OZAA 2RF9A 3DDQA 1F5QA 2OJFE 4RIXA 4ANSA 4B9DA 2R3QA 4GFGA 2HYYA 4M0YA 3KFAA 4ZTHA 3MI9A 4FIGA 2RGPA 4BDDA 4BCIA 4MHAA 3CD3A 3GT8A 1RW8A 3H30A 3MWUA 2CJMA 1YXXA 3R21A 1GIHA 2ETMA 4FSWA 4II5A 3TN8A 5I9WA 4WRGA 4GU6A 3Q9ZA 3UMWA 3VO3A 3BYVA 3E87A 4FG7A 4A9SA 5CVGA 1Q62A 4AFJA 2CGXA 1M52A 3FLZA 5GHVA 4O7LA 4PL3A 2UW4A 3ZONA 1APME 3KXGA 5LMAA 4JI9A 4OBOA 3F3UA 5JFXA 3BV2A 5IEXA 4EK4A 4HW7A 3W10A 4EH5A 1U54B 4AP7A 3D7TB 3PWDA 4QP2A 2QLUA 4AT5A 1QPCA 4J52A 5GIPE 1JBPE 2IZTA 4DFLA 3ZZWA 2Z7SA 3CQEA 2WMTA 3MFSA 4FTRA 4QMPA 4D2TA 5AUTA 3EIDA 5HIBA 3VS0A 4O7NA 3MW1A 3AD6A 4S31A 3GCPA 4BGHA 3HUBA 4ZJVA 4R3CA 3C7QA 3ZO3A 1YW2A 4QP8A 5HORA 3EMGA 5DVRA 4GVAA 3G5DA 4FL3A 3QQGA 3ORMA 2R0UA 3E63A 3VJOA 2JBOA 3SXSA 4A7CA 4I23A 3DDPA 1GIIA 4KIPA 4WG3A 3WOWA 4ZZNA 5IEVA 2PK9A 3QTUA 4LYNA 3FMLA 3R83A 3R1SA 4OTQA 3V5LA 1JWHA 3LHJA 4XP0A 4WKQA 5AP5A 4B99A 2WMSA 2XK3A 5HESA 3WYYA 3H4JA 4FTAA 4K9YA 4CVAA 5EI2A 3IOKA 3AC3A 2J0JA 2W1EA 1QCFA 2HW6A 3HV3A 3PP1A 4LL5A 5CU2A 3RGFA 2XBJA 3TZMA 4FV4A 5IA2A 4AW5A 4RX7A 5KKRC 2ITYA 4G5PA 4A9TA 2UW7A 3W32A 5IMXA 4BTJA 2QR8A 2UZVA 2BCJA 2CGWA 3F2RA 4FEXA 3ZSGA 2HIWA 2XNBA 3QKKA 1KWPA 4RBLA 3NW5A 1KV2A 2WGJA 5CQWA 2OIQA 4U44A 2O5KA 1V0OA 3ZXZA 3TUDA 4D1XA 3C4FA 1H07A 3UVPA 3DBCA 4FKSA 3KULA 4JBVA 4O0WA 3LFFA 3QKLA 5IQCA 2XF0A 3ALNA 1REJA 3MVJA 5AP7A 4RPVA 4BCKA 3MB7A 4YHFA 5AAFA 4ERKA 4J98A 5EM6A 4RLLA 3AT4A 2X2MA 1H1WA 1IA8A 2B53A 3DAEA 4FSMA 3JVSA 3QBNA 2R2PA 4APPA 3PDTA 5JZNA 3W16A 1UWJA 4I41A 4QYYA 3ZC5A 1NT2A 3LCOA 4C8BA 2YFXA 3KXNA 5EM5A 3PY0A 4F7SA 1YRPA 4NIFB 3M42A 4O6EA 2XCKA 3LM0A 4FV5A 4NM0A 3UQFA 1UU8A 5ANGA 2WXVA 3FJQE 4O4DA 4F7NA 5JEBA 2V55A 4DHZA 3LE6A 4EZ5A 5CSHA 4AXDA 4J95A 5JGBA 2IVUA 4LI5A 1YI6A 2QOBA 3KGAA 3W18A 5CU6A 4G34A 3VUHA 3EJ1A 5BNJA 4YTIA 4M67A 2WB8A 3UIUA 5JGAA 4I20A 3NUAA 3R8MA 5F95A 1ZYSA 2XAOA 3FSFA 1BI8A 4L44A 4O4CA 3ZU7A 5J5SA 3FLYA 3GQLA 3AC1A 4XG4A 3C5UA 5AMNA 2OK1A 2WMBA 5AX3A 5HBHA 1MQ4A 3P9JA 4J8NA 5CS6A 5LVMA 3NGAA 4IZ5A 4A9RA 4YJRA 2VGOA 3EQCA 3MYGA 3CE3A 2RKUA 5F4NA 1Q4LA 3SD0A 2OG8A 3V3VA 4NSTA 3F9NA 4ZTLA 3I5ZA 5IQFA 3LXKA 3MVLA 4D2WA 5BVWA 1NW1A 3EOCA 3PWYA 3QRIA 2PYWA 3E7OA 2WTDA 4C4IA 4W4XA 5C4KA 1VZOA 2JLDA 5GZAA 2YERA 3MA3A 4N57A 4MXAA 3IW6A 3C4XA 4YJQA 4DH7A 4DYMA 4IC8A 3U51A 4GCJA 5K3YA 2C6IA 2JKOA 1IASA 3I6UA 3I0OA 4XS2A 3TZ7A 4WNPA 2B9JA 4GK2A 4GRBA 3ZRLA 1NVSA 5IUHA 3LQ3A 1OUYA 4O0SA 4IB3A 3Q9WA 5IZFA 1B6CB 3WIGA 5D9HA 5EKOA 2WMVA 3Q4TA 4U9AA 4F6UA 3D14A 2Z7LA 3AKKA 3QZFA 2ETRA 1SNUA 4G9CA 4ITJA 5CF6A 3DKFA 3OFMA 3R7OA 2E9PA 4CLIA 3TWJA 4ERWA 5LQFA 4RMZA 1GZKA 3M1SA 3NNXA 3DU8A 3S95A 4MNFA 4BZNA 2UVZA 4TY1A 5KHWA 2BMCA 4MK0A 5C8KA 1Q99A 2BDJA 3MY0A 2CNQA 5IKWA 2QQ7A 2W1DA 4OTWA 4XG8A 3R9RA 4FSTA 2F7EE 4D55A 3RCJA 4BYIA 4Q9ZA 1H28A 1R0PA 5TOZA 5C8NA 4IANA 4EK6A 3NZ0A 1BMKA 3QCXA 2W1IA 1YDRE 2VU3A 3QUPA 5EW8A 3BL7A 4G3FA 4XV2A 1H0WA 1OGUA 4J97A 5AUZA 1H4LA 4AXCA 4BF2A 2C68A 2F7XE 3A8XA 4UWCA 3FV8A 2PZ5A 4QPMA 3LFCA 4XG6A 5FTOA 5CVFA 3SG8A 2EXMA 4BZDA 2BROA 2XYNA 4O4BB 2LGCA 5HIDA 5JKGA 4WG5A 5IH5A 4O21A 4UWBA 3DXQA 5CYIA 3HDNA 4EQCA 4QYFA 3UIBA 4LOPA 2O65A 3F69A 3GC0A 4O0RA 4U97A 3V51A 3W2OA 5AA9A 1H00A 4DLIA 2W0JA 3PRIA 3I60A 2GPHA 4NWMA 1YI4A 4LM5A 3A61A 3GUBA 5L8JA 3WZEA 3RBWA 4RA5A 4C3FA 1J7IA 2WD1A 5AFVA 1XWSA 3O5AA 2X7GA 2GHMA 5HCZA 3PP0A 4IIRA 3ML1A 4L52A 4XV3A 2UUEA 3ZOSA 5L4QA 4FV2A 5IPJA 3W33A 3S1HA 1PMEA 3C9WA 4P7EA 2PZRA 2RFDA 2B9FA 4AS0A 4RGJA 1DI8A 2C6DA 3F66A 3C4WA 4LV8A 5IUIA 3F3VA 1WCCA 5H3QA 2IVSA 4GG7A 3LMHA 5FM2A 3UO6A 2ITUA 4FV3A 4ANNA 4XEYA 4U7ZA 3ATTA 3GCVA 3R22A 4W4YA 4EH2A 5AV1A 2YCRA 4BCPA 3SX9A 4YP8A 4OTGA 3TKIA 4RVKA 4F6SA 4BWPA 5K0XA 3RPSA 3BYUA 4TRLA 4E26A 2R3HA 2WQBA 2WHBA 4ZTRA 4F9BA 4EBVA 5BVOA 4Y73A 2B55A 3P7AA 2IJMA 2XIKA 2C0OA 4MXXA 3GI3A 2JDRA 3L1SA 4F1MA 2UW3A 3FKLA 3R1NA 1JLUE 2GHLA 4NK9A 4BBEA 1OGYA 2WOUA 3QC9A 4RG0A 4U79A 5B2LA 4DF3A 4JG8A 4IACA 5HVJA 4DDGA 3WYXA 2WU7A 4M68A 3QZGA 2HOGA 5HNBA 5E91A 4DA5A 1I09A 5FEDA 4CFNA 4RIYA 5KMKA 1BI7A 4L3PA 4M13A 4FV8A 5AIKA 4BBMA 3ZO4A 1DM2A 5KX8A 3D9VA 3SV0A 5D7VA 1QPEA 2GNHA 3U4WA 4R3PA 2OKRA 1H27A 1QL6A 2C6OA 3EQGA 2R7IA 4R8QA 5AADA 1S9JA 2WTKB 4KBAA 2BKKA 2BUJA 3QZHA 3N51A 2R3NA 3RHXA 3VBTA 4JBOA 5L8LA 1GZ8A 4HPUE 4G1WA 4GU9A 4GL9A 3NVMB 4FTMA 4DE4A 3FZTA 2EXEA 3PPZA 3QALE 4L7FA 3R8LA 5AR7A 4F9AA 1OPKA 4IH8A 5J7HA 2J4ZA 5GJDA 3KRLA 3O0GA 3NAYA 5AR3A 5GZ9A 3RWPA 3VBYA 2BFYA 3AD5A 5T6KA 4DEIA 5EDRA 5KZ0A 2BDWA 2YIRA 3PTGA 3SOCA 4C2WA 3MV5A 3AGLA 4C3PA 5M07A 3GFEA 4DGNA 4APCA 2WPAA 3BYMA 2CNVA 3ZEWA 5ETAA 4JAJA 4CZYB 4MWHA 3C0IA 4DN5A 3HRBA 2A0CX 3NYOA 1Q8YA 1X8BA 3EQIA 4XG3A 4DBNA 2ITXA 3NLBA 3JR1A 5KMMA 5KHXA 1OIUA 3O51A 4CKJA 2DWBA 4AN3A 5FM3A 2DYLA 3ACKA 1FMOE 4EOOA 3CKXA 3FI2A 3VS5A 3P0MA 2GCDA 4FL1A 3HKOA 1GIJA 1PYXA 5J95A 1NVRA 2HELA 3SW4A 3FMEA 4YHJA 5HLPA 5J9ZA 2Z60A 3W0PA 3ZFYA 3G51A 3JXWA 4G9RA 3VS4A 3OT8A 3Q4UA 2YAAA 4DITA 5FLFA 1S9IA 2ITQA 2YCFA 5GIOE 4ZMEA 3OHTA 4AFEA 1P4FA 4IC7A 4XCUA 3HECA 3BLQA 4HPTE 4DFBA 5IG1A 3II5A 3OTUA 3PJ1A 4ZZOA 4GJ2A 3VS3A 3U6HA 2HXLA 3VS1A 3E5AA 3FL5A 3FPMA 4D58A 2VNYA 5J1WA 2W17A 4RX9A 3IDCA 4RVTA 4HYHA 4MBJA 2IWIA 3CTQA 4IWOA 4AUAA 4D9TA 2GNFA 3PE2A 4FIHA 3R9OA 3RK5A 1ST4A 1WBVA 2QO2A 3QTZA 4X2FA 4BDEA 5HBJA 4ZIMA 3VIDA 2AC3A 2BIKB 3HGKA 3PZEA 5CEQA 4L67A 4Z7HA 5JSMA 2XJ0A 4RIWB 5J1VA 3RNYA 1WMKA 4UYAA 2X2LA 3U87A 3PPJA 5DG5A 3KVXA 4BR3A 4QMLA 3D2IA 2C5YA 1SVEA 2OU7A 1Q41A 4BTMA 2R3KA 3EN9A 4J7BA 2BTSA 3O7LB 1ST0A 5ETIA 5D1JA 5EQPA 3EYGA 3IQ7A 3FMDA 5E92A 4HNFA 3SW7A 4O83A 4F78A 3K2LA 4PTCA 3QRUA 2XKFA 5DT0A 1JOWB 4G3EA 4XUFA 1OMWA 3HV5A 5AP6A 1W8CA 3MY1A 4HVIA 3PIXA 2O63A 2VWUA 2YHVA 3QLGA 5K4JA 5AP2A 3ACJA 4RZWA 5TT7A 1K9AA 2C69A 2Z7QA 3OC1A 2X1NA 5HE2A 2X9FA 5HBEA 4S33A 5BUEA 4TL0A 1M2PA 1W98A 2X4FA 2Z7RA 3COMA 4FKIA 2IF8A 4UY9A 5KO1A 4WRSA 4YC6A 4D2VA 3OT3A 2BAQA 4FZDB 5CEOA 3KN6A 2XIRA 3LPBA 4C35A 3RWQA 4MYGA 4Z16A 2QOLA 5AA8A 4JDHA 4JQ8A 2OJ9A 2DQ7X 1V1KA