2P0CA

Catalytic domain of the proto-oncogene tyrosine-protein kinase mer
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
287
structure length
249
Chain Sequence
NKLEDVVIDRNLLILGKILGEFGSVMEGNLKQEDGTSLKVAVKTMEFLSEAACMKDFSHPNVIRLLGVCIPKPMVILPFMKYGDLHTYLLYSRLETGPKHIPLQTLLKFMVDIALGMEYLSNRNFLHRDLAARNCMLRDDMTVCVADFGLPVKWIAIESLADRVYTSKSDVWAFGVTMWEIATRGMTPYPGVQNHEMYDYLLHGHRLKQPEDCLDELYEIMYSCWRTDPLDRPTFSVLRLQLEKLLESL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural insights into the inhibited states of the Mer receptor tyrosine kinase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Proto-oncogene tyrosine-protein kinase MER
total genus 75
structure length 249
sequence length 287
chains with identical sequence B
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2007-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2p0cA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2p0cA01
3TDVA 2ZMCA 2B9JA 4ZZMA 3MJ2A 4FIFA 2JD5A 4NW5A 4BFMA 3HZTA 3C4ZA 4BWXA 1U5RA 1YI6A 2W0JA 3QRTA 5I9VA 3QTRA 5IISA 5GIPE 3PG1A 3NW7A 2R3NA 3A8XA 5CEPA 5HX6A 2HZ4A 4ALVA 4JS8A 3KREA 4PWNA 3AOXA 4J8MA 2C6TA 5ITAA 4D4VA 2UZDA 5F9EA 4TYEA 3KKVA 4YUQA 4M66A 3UIBA 4A4OA 2XM9A 5A4TA 2CNUA 2PUNA 4BTMA 4ZLOA 4II5A 4XG8A 5E8TA 5I5ZA 3UVPA 3QD2B 1WBPA 5AR3A 4PMPA 3Q4UA 4QMTA 1QMZA 1ZRZA 3EN5A 4AZTA 3QZIA 4BDHA 5E8SA 4WOVA 3TDWA 2C0OA 2W1DA 4D1XA 3Q6WA 4PUZA 3PYYA 4FTNA 5DPVA 5FBNC 3LPBA 5HLNA 3HA6A 5IQAA 3AD5A 5FDPA 5IQCA 4KS8A 4YNOA 3C4CA 3FMKA 3LIJA 1H1QA 2OG8A 2QC6A 3U87A 3PSDA 1NY3A 4GG7A 3NIZA 3NPCA 3QHWA 3BYUA 4D2SA 1OIUA 1MRUA 5LWNA 2VTJA 4XG6A 4WKQA 5HTIA 2WKMA 4EZ5A 1BL7A 5LWMA 4EHVA 1PYXA 4X2FA 1G3NA 4D2VA 5DHJA 3AC1A 4MH7A 4MD8E 4MXOA 3M2WA 3QUPA 4AW2A 1OBGA 1JOWB 3MW1A 4AT3A 4BR3A 4EOQA 5IQFA 2ERKA 4EOMA 3LJ2A 1UA2A 3UP2A 3LQ3A 2A0CX 2OF4A 3FYJX 2GS2A 4HOKA 3WZJA 5EM6A 5HEZA 2W4OA 4YBJA 2YFXA 5KMMA 4IZAA 4BTKA 4F64A 4ZTRA 1ZOGA 3TCPA 5I0BA 4C02A 2VN9A 4NJDA 3VS6A 4YC3A 4F6SA 5AA9A 3DKGA 2Z7LA 1Z9XA 3HMPA 4MK0A 2YABA 4Y8DA 3G90X 2HXQA 5F4NA 2C6EA 4E26A 2GQRA 4IWDA 1Q8ZA 2XK8A 3A7FA 5CZIA 3R8ZA 4BGHA 1Y6AA 3PXFA 2BZHB 2BALA 5EI8A 3KGAA 5DRBA 3ALOA 4QMVA 4FTOA 5A14A 2I7QA 3QWJA 3VC4A 4GIIA 4MNFA 3HMNA 4UBAA 5IEVA 5H2UA 5BYLA 4J99A 2B54A 5F94A 5DMZA 4HYSA 2XNOA 2VGPA 3W2OA 4DFXE 3SVVA 4ZTQA 4NKSA 2KTYA 1NW1A 3I6WA 1GIIA 3QD3A 1R0PA 3SD0A 1YI3A 4RFMA 3CCNA 3OW3A 1LPUA 3AD6A 5GJDA 4XOZA 5I4NA 2ZV8A 4U81A 3R7VA 4C3FA 4RJ5A 3POZA 5IMEA 3PVUA 3LCKA 3LW0A 3NS9A 2CCHA 1KV2A 4YLJA 1PXOA 4M68A 3GU6A 3BEAA 3N4VA 3MJ1A 3PVWA 1Y8GA 1U5QA 4FNXA 4KBAA 2ONLC 4R5SA 5AR4A 3CD3A 4ZJIA 5T3QA 2PMLX 4A9UA 3ZUUA 1DS5A 2WFYA 2WMRA 3OZ6A 5E8WA 5HOAA 4G3CA 5FTGA 5AP7A 5KUPA 4E4MA 3EB0A 1O6YA 3ID6C 4AE9A 3OY1A 5AUVA 1JNKA 4F63A 2ZDTA 3R02A 3I60A 2R3GA 2V5QA 3CKWA 2HXLA 4JDKA 2DQ7X 3LCSA 1SM2A 3O17A 2WTKB 2PVKA 2BR1A 4LOPA 3UO5A 4P5ZA 5D12A 1MQBA 5J79A 2XNNA 1P5EA 4QP3A 3V04A 3FLSA 4ZMFA 4TYGA 4FEWA 4ZSAA 3TUBA 4XJ0A 4LUDA 5CLPA 3WIKA 3MFRA 3DNEA 1H24A 2XK7A 2XK3A 3NIEA 4OTDA 4FV0A 1VEBA 1PXKA 3UE4A 1BL6A 2REIA 2XK9A 2O8YA 4IJ9A 3CTQA 1AQ1A 4O7RA 3OY3A 1YDRE 3OP5A 3OOGA 1CTPE 5JZNA 5L2TA 4FI1A 4BZOA 3CJGA 3ZSIA 4ANNA 2XIXA 5I3RA 4GYGA 5DT4A 4EEVA 3UMWA 4ZAUA 5DOSA 3V6RA 1XH5A 3MTLA 4F0IA 2BIKB 2VO3A 2C3KA 4YLKA 2VTSA 4CQEA 4M7IA 2KULA 2FSTX 3GFEA 4EOPA 2XKEA 5BVNA 2ZM4A 3HV6A 4ZS0A 1Q8YA 3VS2A 4QMQA 3PDTA 3UOKA 1RDQE 3ORKA 2VTOA 3RCDA 3V8WA 4KD1A 2GNJA 1ZYJA 2UW7A 3KQ7A 4QP9A 4Q2AA 3LFDA 4H58A 3V51A 5LVMA 1UWHA 2C0TA 2P2IA 3FQHA 4FT5A 4RQVA 4BYIA 4FKQA 3A7IA 2J50A 2FB8A 2YEXA 2F57A 3QXPA 3RI1A 3VVHA 2BFXA 4BCGA 4DTAA 4FV9A 3GT8A 3KCFA 4OTQA 3UVQA 3VBYA 4GG5A 4IX6A 2YA9A 3GNIB 3F3TA 3QWKA 4YTHA 2B9HA 3EN4A 3HRBA 4DH5A 4EOLA 1NT2A 4AN3A 3KXXA 1W0XC 4I4FA 2JDVA 2J4ZA 2O65A 4FV4A 3RPSA 1QPDA 4AGDA 4EI4A 5KKRB 2CSNA 1S9IA 5T68A 4RIWB 2OJ9A 1OIRA 3ZBXA 4BC6A 3QAME 4G3DA 5K3YA 3SXSA 3F66A 1PXMA 3C0IA 4IAIA 2QVSE 3QA0A 4V04A 3KXHA 4O96A 4MNEB 2RSVA 2XZSA 3DKFA 3NMUF 4EH2A 3EQBA 2FO0A 5HG5A 2YM6A 2CKEA 2J7TA 2XK4A 4FF8A 4ONAA 1LEWA 4I6FA 1SZMA 3EQDA 2FSLX 4TT7A 4MXXA 3R0TA 4ITJA 3NVMB 4FTCA 1KSWA 3LCTA 4G6NA 3BLRA 2EU9A 5IUHA 4GJ2A 1Q24A 2A2AA 2UVZA 3VS7A 4CZTA 5L2QA 4K2RA 3E64A 3PJCA 3QRKA 3QYZA 3ZONA 3G15A 3HL7A 4O21A 5EYMA 4I1ZA 3NW6A 5C8NA 3MPAA 4LFIA 4NIFA 4BKYA 3ZLWA 2WIHA 3GI3A 3IW5A 4QRCA 3VUGA 3HYHA 4MVFA 5BYZA 4BCJA 4RA5A 4C4JA 1E1XA 3HV7A 3D4QA 4HCTA 4TTHB 2FSOX 4U45A 4FOCA 3BYSA 4M0ZA 3B2TA 4K11A 1DI8A 3I7BA 2QI8A 4U43A 2QG7A 3PLAE 4OT5A 4ACGA 4TYHB 4DA5A 3ODYX 3POOA 4A06A 3I0OA 4MWIA 4ZXTA 5CSWA 5BMSA 3MWUA 5CU3A 1BX6A 3PJ2A 3QZHA 3WF8A 3I79A 5ANKA 2UZBA 4XG9A 5CI6A 4EK6A 1MP8A 4DEHA 1H8FA 4IAYA 3RBWA 5CF4A 4X3JA 3P5KA 3GB2A 2RG6A 2IVSA 3EKKA 3KULA 4IBMA 5J9LA 5CSHA 4GL9A 5DNRA 1H1PA 2BRNA 1A06A 4E5AX 1LUFA 4CRLA 4I92A 2JFMA 3EOCA 4BHZA 3K5VA 2WTCA 2WTWA 1UKHA 5DVRA 4JL9A 3ANRA 5GZ9A 2J51A 4BGGA 4CRSA 1H27A 4C4EA 3BQRA 1XH7A 2VO7A 3MH3A 3ZEPA 3VF8A 3IW7A 5K0XA 4DEEA 4Z16A 1Q3WA 4XS2A 5TOZA 1FOTA 3MA3A 4GT3A 1PMEA 3Q96A 2HW6A 2ITXA 2WQMA 4CYJA 5IEYA 3PPJA 4L45A 4RVLA 3EN7A 5J5TA 5HE2A 4LGGA 5CQWA 2F7ZE 3G51A 1JWHA 5FM2A 3TZ7A 5J8IA 3F2NA 4D0WA 5JEBA 3UODA 3COKA 1PXJA 3NYOA 1Q97A 4MXYA 1WMKA 1WCCA 1O6KA 1QL6A 2OSCA 4UMUA 3COMA 2JEDA 3DU8A 4ORKA 5IUGA 4BZNA 3E87A 1V1KA 4S32A 2X2MA 4KIPA 3HMIA 5IH6A 3ATTA 3DBQA 4GK4A 3M1SA 5FWKK 4D58A 3C0GA 2PVLA 3TV6A 3W2SA 3TIZA 4EONA 2RIOA 2X6EA 4DHFA 2NPQA 2J9MA 4RFZA 4WUNA 2X6DA 4I3ZA 3RALA 4IMYA 5HE3A 3WF6A 3VO3A 3KFAA 4WNPA 3OOMA 4AP7A 4HJOA 3F88A 1STCE 5CX9A 2QCSA 4NH1A 4O6EA 3ORXA 4D2RA 4FKUA 5KMJA 3F3ZA 3C7QA 2VX1A 4OTGA 1YHWA 2QD9A 2Y4IC 4DFBA 3WYXA 4R78A 3OXTA 1IR3A 3PSBA 1O6LA 3DY7A 2ITUA 5AADA 4EQMA 2XKCA 5GZAA 3HA8A 4C0TA 4IX3A 4MHAA 1V0OA 4HGSA 2XIRA 4R6VA 1YDTE 3HAVA 2G9XA 1PF8A 1IEPA 4DG2E 2UZWE 3FYKX 3EH9A 3RWPA 5BUJA 3OCBA 5K4IA 4CKRA 3ZU7A 3I4BA 5CF5A 2VNYA 2LAVA 2PZ5A 4EH3A 5FXRA 3FC1X 3I0QA 4IB1A 3R00A 4ENYA 1YRPA 3TJCA 3DK3A 5EFQA 1BKXA 3GFWA 3FI2A 2WU7A 3R2YA 2Y7JA 4G6LA 4PX6A 5IA3A 5JRQA 3S2PA 4TRLA 3E62A 4D5HA 4DH8A 5AAEA 4N57A 5HI2A 4GRBA 4NJ3A 4FVQA 4ZJVA 2GNHA 3QZGA 4OAUC 1WBWA 3GENA 3QQGA 5E8ZA 3WOWA 3ZFXA 1XJDA 4HGEA 2BKKA 3HX4A 4MX9A 3PWDA 2IW6A 4IZ5A 2X7FA 3IS5A 4M15A 4JIKA 1FGKA 3MFTA 4J7BA 4QP6A 3RVGA 4YJUA 5AWMA 1ZARA 4FT3A 5IQHA 1XH6A 4IB5A 4YC8A 4D9TA 1J3HA 2B55A 3RHKA 4ARKA 1OMWA 4NM7A 4ZY6A 4YC6A 3VJNA 3R1NA 3A7JA 3TG1A 4YTFA 4DTBA 2VD5A 4HZRA 3QXOA 2WIPA 3LCOA 4KBKA 4QTAA 3UG1A 4O1OA 3KMMA 3KEXA 3KRLA 4JG8A 3EQCA 3EFJA 4QMUA 3LHJA 4FTJA 5LMBA 3PLSA 3UNZA 5HX8A 3EMGA 2ACXA 4IAZA 2PHKA 2V7AA 5HVJA 5FUTA 5EM5A 3CQWA 3BWJA 5A4EA 3QL8A 2B53A 2WTJA 2J6MA 3F69A 5EDPA 3NSZA 1ZOHA 3RGFA 5AFVA 4FICA 3EL8A 3U4UA 1NA7A 2CDZA 4B8MA 4QMNA 3ORMA 4EH4A 5A54A 3HECA 4U42A 5DEYA 2C5VA 5J1WA 3COIA 3R9OA 1YI4A 3ZLSA 3OD6X 5JSMA 4OTIA 1KOAA 4WBBB 5AP6A 2CHLA 2FYSA 3HMOA 3GCVA 4MCVA 5CVFA 3Q9WA 3IKAA 2FSMX 2ZB1A 2GCDA 3Q2MA 1M17A 4YZ9A 3RAKA 3FI4A 5BVFA 4ACHA 4M14A 3TTIA 4WSYA 4JDHA 3ZSGA 2ITOA 4JQ7A 4X2GA 4YJSA 3R01A 3V5JA 5EKOA 3OUNB 4BF2A 3QTQA 3WZKA 3T9TA 1ZWSA 1IA9A 3EIDA 4L68A 4NZWB 5K4JA 3A62A 1PW2A 4J97A 2BDWA 3ORZA 3KB7A 4G16A 4PL4A 3TV7A 1M2PA 4MBIA 1LEZA 2HWPA 2OF2A 4CFWA 4O0SA 4QT1A 1H28A 3FPMA 3PXZA 1JKLA 4GCJA 5AX3A 2W1IA 3N9XA 5ICPA 4JRNA 5FEDA 5H9BA 3CC6A 3TNIA 2CKQA 3PVBA 4P2KA 4FT9A 1KE6A 3UPZA 5I3OA 3MH2A 3LFNA 1OECA 4A9SA 1PJKA 4FL1A 1Z5MA 4H36A 5BMMA 1GNGA 3U51A 2X0GA 2QR8A 5DH3A 2WQOA 4I0TA 5JFWA 4FTRA 2YJRA 1M2QA 1VZOA 3GCQA 4Y5QA 3H9FA 3DXQA 1JAMA 3F2RA 4M69A 4RJ3A 3AQVA 4EWHA 5FBOA 4QYYA 4CG9A 4NCTA 5LMKC 5D7AA 1UNGA 4F7SA 3PP0A 3S00A 3UZTA 3OTUA 4KSPA 4G6OA 1F0QA 2ZYBA 3FSKA 5IMXA 3MVLA 4X6RA 3WZEA 3UQFA 4ANSA 4XHKB 2JKKA 3NUYA 2HWOA 4FZDB 4J71A 3UJGA 2XJ0A 3WI6A 1A48A 2EWAA 2C3IB 3ORNA 4ASZA 2EXEA 5KMLA 1YWRA 4FEVA 2W5BA 4X3FA 3KCKA 4O0XA 3MDYA 5E8UA 4DEBA 3SG8A 4HCVA 4QTDA 5HG9A 5IDNA 4UALA 3DXNA 5CENA 3B2WA 3ORIA 4JAJA 4WNMA 5AP4A 4DGOA 3NNUA 5T6KA 2J0LA 3NUXA 4FIJA 3AGMA 2WU6A 4QNAA 3TL8A 4D2PA 4EC8A 3V5WA 4DC2A 4BI1A 3VUDA 4DGMA 5I9XA 5J7BA 4ZIMA 4D2TA 1OVEA 3OT3A 5AJQA 2YM5A 3HP2A 3U6JA 3SKCA 1VR2A 1ZYSA 1PKGA 5B2KA 1ND4A 4PPAA 4EK3A 1ZLTA 3C5IA 3Q4CA 4FKVA 4G5PA 4L6QA 3RAHA 1H07A 3NVKI 5CAUA 2R3QA 2F4JA 4E93A 3V5LA 4PNIA 3R2BA 2IO6A 4FTMA 2PVFA 2YZLA 3NRMA 2YJSA 4FUYA 2UW3A 4M97A 5CT0A 3UZPA 3ORTA 4M84A 4FTTA 1P4FA 2IZSA 4GUBA 3RAIA 4A4XA 4CTBA 3ULZA 3FY0A 5AEPA 2VUWA 4NU1A 2ETMA 3D7ZA 3FXWA 4PRJA 4FZFB 5ANDA 5B7VA 3MFUA 5DEWA 2YAKA 4CLJA 3P4KA 3ZM4A 3GVUA 4KBCA 3QD0A 3C50A 1HCLA 2DWBA 3EZVA 3TN8A 2J5FA 2GNFA 3QCQA 2VTMA 3FHIA 5D9HA 2I0HA 4YO4A 4C57A 2VX3A 1V0PA 2ZM1A 3QGYA 4GMYA 3C0HA 3ZXTA 5M09A 3QYWA 5JMSA 3WE8A 2QR7A 1F5QA 3UYTA 5LARA 4OLIA 4H3QA 5J95A 4E8AA 3KVXA 4RX8A 1DI9A 5A46A 1PMUA 4U6RA 4W4XA 1DAYA 5AV2A 4EK8A 2WTKC 3DKCA 2I0EA 4FUXA 2XMYA 2PVRA 2BZIB 2YERA 4O1PA 3ENMA 4CKIA 1H08A 2BROA 2HOGA 2VWYA 4A9RA 1DAWA 4E7WA 1XH4A 5M51A 5ANGA 1XBCA 2XA4A 2C6KA 2YITA 3IQ7A 4YLLA 2OZAA 3F2AA 4DYMA 4X2NA 4QMYA 3I1AA 4HPUE 4IB3A 3D0EA 4RIWA 4X21A 4BYJA 4IHPA 4RJ7A 2W9ZB 3TTJA 4U80A 4XOYA 1R3CA 3TI1A 2QURA 5K0KA 4EORA 3A8WA 3F7WA 2BZKB 4MNEA 5A6NA 2Q0BA 3EL7A 4GVAA 4YHFA 5E4HA 3ORLA 4YTIA 4C33A 4FBXA 4WG5A 3VBVA 2WGJA 2XBAA 2PVHA 4LRKA 3QC9A 4FKRA 4X6QC 5L2SA 2CJMA 1F3MC 2PUPA 4QP2A 4N6YA 2YDJA 1ZMWA 4BDCA 4YPDA 3OHTA 2PUUA 3KF4A 5ETIA 4IFCA 4UXLA 3FZRA 4LOQA 4NWMA 4PP9A 3AD4A 3SW4A 4CD0A 5JZJA 5DI1A 2QO7A 4O84A 2WMWA 2WTDA 3E8CA 5HD7A 2YM3A 2XF0A 3R8LA 2ZB0A 3PXYA 4QQJA 4FV7A 4IAKA 4PMSA 4TYIA 3PUPA 4C3PA 4HVSA 1B38A 4RBLA 1FVVA 2WMBA 3W8QA 4ENXA 5IQBA 4PTEA 2IZRA 5LMAA 4ZLYA 5EOLA 4UZHA 2YCSA 1GIJA 4FSUA 4UMRA 2ITNA 4D0XA 5JGAA 3MESA 3G5DA 3ZBFA 2X39A 4LRMA 2E9NA 4O82A 2EXCX 3MTFA 4I94A 2YDIA 2YN8A 3QFVA 3JVRA 2VTQA 4PPBA 4HPTE 5EW3A 3MI9A 4AG8A 4MBJA 3R9RA 2ITWA 3F3WA 4FKPA 3ZLXA 4WG4A 4BDFA 3GCUA 4G34A 2H96A 3ZCLA 5EI6A 2BCJA 2HYYA 2UUEA 4IZYA 2VTLA 3HV4A 4N70A 2P3GX 4TWCA 4QD6A 2C5NA 3O7LD 3OROA 3EQGA 1FPUA 2UZTA 1XHAA 3AMYA 3CPCA 3FAAA 2W06A 3PG3A 3QTUA 2OIDA 3KRRA 4JX3A 3GQIA 1ZYDA 2F49A 4NM0A 4HCUA 3BU6A 1UVRA 4DBNA 1VYWA 4EOIA 2Q0NA 4FG9A 5M55A 4KNBA 4EWQA 5M53A 3D5WA 1GAGA 2QQ7A 3BEGA 4H1JA 3R7UA 4TWPA 2CNVA 1YVJA 3BV2A 2B52A 3NUUA 1YHVA 4PV0A 4FIIA 5D10A 3BX5A 4K77A 4YURA 4AZWA 4HVDA 4HVGA 4IB0A 4DT9A 3AT4A 2W4KA 3RM6A 4YO6A 1WBTA 4RVKA 5HHWA 4FTQA 2UW4A 2BZJA 2Y4IB 4HGLA 3DJ5A 1WVYA 1TQPA 5DR6A 3SQQA 3ZH8A 1OPJA 4DCEA 3DTCA 3HUCA 5CU2A 2ITYA 5KNJA 1K3AA 3TWJA 4JT3A 3H10A 2W05A 2XJ1A 3MBLA 3QTIA 5AM7A 5FP5A 3LFCA 3LFEA 4BDBA 1PMNA 3FLWA 4QOXA 5G6VA 3C1XA 5HKMA 5LVLA 2QNJA 3OVVA 5BUIA 4L8MA 4OAVB 1XWSA 1PXLA 5CEKA 3QQFA 2WQEA 1TVOA 3ACKA 3PSCA 3WF5A 2UW8A 3IDCA 5C01A 5HO6A 4GFGA 4Q9ZA 5CAPA 5AV0A 3UIMA 3UO6A 3A4OX 4FYNA 4QO9A 2OWBA 4EBWA 3Q5ZA 3RPRA 4RWKA 2B9IA 3E8NA 4C3RA 4O0YA 4C61A 2JBPA 1OKVA 4O91A 3TZ8A 3F61A 4E4XA 1JPAA 3FL4A 4F99A 2GQSA 3U4WA 1JSTA 3FC2A 4XNEA 2O5KA 3VRYA 4EH7A 4BRXA 1OL1A 3GUBA 2ESMA 2UZOA 3V6SA 4IACA 4AT5A 4PDYA 4O81A 5DR9A 2QHMA 4I6HA 3DK6A 3RTPA 2HK5A 2G1TA 4FSNA 3FWQA 3DBCA 3QQJA 4FSTA 4H05A 1MQ4A 3C13A 3E7VA 3KL8A 4YZDA 4M3QA 5KHWA 2B0QA 1UU9A 3GC8A 3RZFA 2EVAA 2PMIA 3ZS5A 2AUHA 5HNIX 2PYWA 3SLSA 3DKOA 3O7LB 1A9UA 3EFLA 3WBLA 4Q5HA 3DBEA 3LFBA 4HGTA 4IX5A 3GOKA 4JBQA 4QTCA 5DA3A 4RVTA 5IF1A 4O7WA 4CFUA 3MIAA 1PMVA 5HGIA 1KOBA 4HZSA 4AQCA 5EI2A 4E20A 4XEYA 2X7GA 4FK3A 4XBRA 4EOKA 1IAHA 1G5SA 4PL5A 2W5HA 3MN3A 3E63A 3SRVB 3VS4A 4UYNA 3V01A 1MRVA 2V0DA 5AP1A 4A7CA 3I6UA 4CFMA 1IG1A 5CXHA 3LVPA 4ANQA 4AT4A 4KIOA 1ZXEA 3HEGA 2CKOA 3NUPA 4L42A 5HO8A 3IGGA 5JN2A 3MB7A 4P4CA 3VS3A 3H4JA 1CDKA 5JFVA 3TUDA 3N4TA 3AC3A 4O7SA 4AA5A 4FL2A 2RL5A 1OUYA 2RFNA 2HIWA 2A19B 3IECA 4OBOA 4E5BA 3M11A 3PVGA 3DBDA 4FKTA 3UNJA 4FGBA 1X8BA 4KRDA 4OTWA 4IVDA 3PPKA 3DPKA 1CKIA 1JSVA 2R3LA 5ETAA 3R9DA 1ERKA 4C8BA 5AR5A 4E3CA 4D5KA 4IWQA 2Y4PA 5L2IA 3OT8A 4R5YA 2GDOA 3F3UA 4YZNA 1U59A 1ZZ2A 3ZXZA 5B2LA 1Q5KA 5EH0A 3RCJA 4O83A 2XM8A 1RE8A 5C03A 4GW8A 5HBEA 2R3HA 5DRDA 5IEXA 4JVGA 3D94A 3QQHA 4FT7A 4X7QA 5HBJA 3E88A 5JGBA 3LFQA 3OEZA 3DFAA 2XKFA 3MH0A 3BYVA 2J0JA 3QTZA 4P5QA 4RGJA 4BI0A 2OLCA 5M06A 3E3PA 3Q60A 4H39A 4QYEA 5LMKA 2VRXA 4O38A 4DEDA 4WRGA 4RPVA 2IWIA 3FQSA 4CMOA 4C62A 4PDSA 1OITA 4QTEA 4JBVA 2OJIA 4IAAA 4UWYA 5D41A 2C6OA 5C9CA 1URWA 3P7CA 3QHRA 2NO3A 5FP6A 4EK5A 3FY2A 3DCVA 3G0FA 4R3RA 4JJRA 4RG0A 4TNBA 4TYJA 1Q62A 2V22A 5HQ0A 2P0CA 4FA2A 5CALA 4FGRA 3I5NA 3ETAA 4C4HA 4X3FC 2GNGA 2PZRA 4YSJA 2HAKA 3Q9XA 5EYCA 4EHEA 1M14A 5LVNA 4P90A 3UQCA 2X8IA 3F5UA 1YWVA 1Q8UA 3KXMA 1JKSA 1YW2A 5EKNA 4DITA 1Q99A 5CU0A 3NDMA 4EH5A 4O0TA 4ZTHA 5TF9A 3LJ1A 3RPVA 4F4PA 2C3LA 3FBVA 2XCKA 5LVPA 3VW6A 1Q3DA 3NNXA 2GU8A 4QMZA 4FE2A 2WO6A 2VZ6A 3QTWA 3FZSA 4FNZA 4OBQA 4D55A 1BMKA 4FT0A 3FKLA 2UVXA 3QGWA 2WNTA 4GIHA 3VHKA 4F1OA 4JG6A 1OL2A 4I21A 1XBAA 3CP9A 2C69A 2YIWA 3F9NA 4NK9A 4QQCA 4RWIA 2GHMA 2YACA 5E8VA 5CI7A 3FEGA 2WMVA 3DTWA 2WOTA 1YDSE 1XKKA 2GPHA 3EQIA 4TY1A 5CSVA 3BYMA 3AT2A 3VHEA 4F9CA 3O50A 3RPOA 5IQEA 5JQ5A 1W8CA 3COHA 4LGDA 4TWNA 3DT1A 3EN9A 5AUWA 3KXGA 3U9NA 3P1AA 4A4LA 4O0RA 5A4CA 3DAJA 4FEUA 3QKLA 2WHBA 3SG9A 2C30A 4CFXA 3QQUA 2IZTA 3OBGA 5DG5A 2C5XA 4DN5A 4U79A 3LFFA 4I23A 2PMOX 3C51A 5AUUA 3SXFA 1BI7A 3PA4A 4O2ZA 2X9FA 3UG2A 3VBQA 4BCNA 4EOSA 3MA6A 1PXIA 3DB8A 4IM0A 3QUDA 3QRUA 2X8EA 4F09A 4HW7A 4I5MA 3UC4A 4YU2A 4XH6A 4BN1A 2JFLA 4FSRA 4LG4A 3MV5A 3R6XA 3VBXA 4AW0A 1KWPA 5J7HA 1M52A 2ITVA 2VTTA 5CY3A 5I9ZA 4UN0C 4PTGA 2XIKA 4MXZA 4R3CA 4RSSA 4IDTA 4W8DA 3FI3A 4I20A 5HG7A 3N51A 3R7GA 3Q6UA 1ZOEA 2XCHA 2C6DA 4GFMA 5L6OA 3CR0A 3GOPA 3RK5A 4DGNA 5HG8A 4UB7A 1S9JA 3RWQA 4FOBA 3UIUA 3MIYA 2UV2A 2NRUA 3GGFA 5CWZA 3VBWA 4JDJA 1T46A 3PJ1A 4IZ7A 1L8TA 4WT6A 1QPJA 2YLFA 4FNWA 2JGZA 4BL1A 4O7NA 3GC0A 2YDKA 2C6MA 2YCRA 3DGKA 4I0SA 1J7IA 2BRHA 3GU5A 3QX4A 5HLPA 4EH6A 3FI8A 3MVHA 4V01A 1Q4LA 2WQNA 4GUEA 4ZOGA 2ETRA 3DDPA 1R78A 2VX0A 3EN6A 4HYIA 3FLYA 3BHVA 4FTIA 2BFYA 4K18A 4BDKA 3NR9A 3HLLA 2I6LA 2XUUA 3PXKA 3VQUA 3PJ3A 4RJ4A 2XNBA 5IQDA 5JFSA 3OG7A 2X2KA 2GNIA 4XLIA 4BCKA 4JBOA 4IEBA 4NT4A 2OICA 3RKBA 5M4UA 4DLIA 2E9UA 2BAJA 4S30A 5AR8A 3BHUA 4F7JA 4Y95A 1HCKA 4E73A 4DT8A 3ANQA 2JAMA 3H0ZA 5EQYA 5KBQA 2UZEA 1KV1A 5EYKA 4JNWA 2C6IA 4E4NA 2GS6A 2YZAA 3W16A 3DJ6A 4RIYB 3T3UA 2C5YA 4IANA 4C59A 2XS0A 3CEKA 4V0GB 4WA9A 3FHRA 2EXMA 3TNWA 3UGCA 2R3MA 2VNWA 4ZK5A 2XBJA 4ZTMA 4LI5A 2PWLA 1XQZA 2X7OA 3AT3A 3NUSA 3PIYA 1XH9A 3MGYA 2G15A 4HYUA 2VWBA 4IIRA 4PTCA 3G9LX 1WZYA 4YZBA 3KVWA 2W96B 5KMNA 3O71A 3CLYA 3LE6A 1H4LA 5H8BA 1IA8A 2BMCA 5LXMA 5KMIA 2EB3A 2JLDA 2ERZE 3EWHA 4NFMA 2W5AA 3KK8A 4JQEA 3QLFA 4F65A 4CVAA 3IG7A 3O8TA 3JVSA 4L3PA 1H1RA 3FMHA 5EHYA 3UMXA 4L9IA 5E9EA 1Q8WA 2R2PA 1U54B 3UQGA 1OKZA 4Z3VA 4BIDA 1YXSA 2PMNX 4JR3A 4ACMA 5HBHA 2ZDUA 4D9UA 5L6PA 3Q2JA 4F70A 3CGFA 4TWOA 1Y6BA 4E6DA 5AV1A 4H3PA 4AW5A 3KF7A 2XNGA 4E4LA 3ZO3A 3P79A 4FKIA 4APCA 4E6QA 3PXQA 3ZRKA 3HV3A 4ZMEA 4NIFB 5L2WA 1B6CB 4O7YA 1SVEA 3NX8A 3ZTXA 4NM3A 4KB8A 3KN5A 4RLKA 4AGUA 5EHOA 2VWWA 3ZFYA 3H9RA 4AOTA 2Z02A 1H0WA 2WMTA 3IGOA 1ZYCA 4MKCA 4CMUA 3D2KA 3SXRA 1P4OA 4FG8A 4ZSLA 4QMSA 4FYOA 4UWCA 3F7ZA 2C47A 1CM8A 2Y6MA 4UX9A 3O8PA 4RC4A 1ZAOA 4EHGA 5J9ZA 3BQCA 4DH1A 3BLQA 3GCSA 3P9JA 4ZTNA 1JQHA 4USDA 3PP1A 2Y9QA 2J90A 3DS6A 5BYYA 5HD4A 3IOPA 2JC6A 1OKWA 4Y73A 2X2LA 2ZVAA 1Y8YA 4FTKA 4YHTA 3W55A 4D4YA 3BZ3A 2OGVA 4IJPA 1O9UA 5GIOE 4O7TA 1IRKA 3WF7A 2PPQA 2VGOA 3ACJA 5ANJA 3FZ1A 1KE5A 3BKBA 4KWPA 3RHXA 4RLLA 1XBBA 3ZHPC 4XV2A 1MUOA 5HIDA 4F6WA 1UKIA 4FV5A 2OW3A 3LAUA 3F3VA 5E91A 3LQ5A 2QONA 4WNKA 2DS1A 4BHNA 4F0FA 4ZZOA 1R0EA 2XYUA 5C26A 1QPCA 4NEUA 4JOAA 1AD5A 5I9UA 1J7UA 4GYIA 1P14A 5CVHA 4I6BA 4TYHA 3UOLA 3RP9A 3L8XA 5DGZA 3VAPA 5IA5A 4PL3A 4J53A 4YPSA 3ZLYA 1BUHA 4YJTA 4BI2A 2BPMA 4L3LA 2J2IB 3MY0A 4AS0A 4QQTA 5FTOA 1K9AA 3F82A 3BBWA 3R1YA 4FKLA 4RA4A 4TXCA 4X0MA 1URCA 4QP1A 1FVRA 3R30A 4ERWA 3AC4A 4F9WA 2IZUA 3GC7A 3L8PA 4NTTA 5ETCA 1XH8A 2YM7A 4M0YA 3SGCA 3BHTA 3FDNA 1WBSA 4CFVA 3K5UA 4QYGA 3R04A 3FMJA 3S0OA 3QQKA 4YNEA 3Q4TA 1PRYA 4IVBA 2PULA 2HY0A 1Q61A 4M8TA 3DLSA 1GZ8A 1TQIA 2CLXA 5ETFA 5HO7A 3OEFX 4IW0A 3ZMMA 3ZYAA 5HE1A 4FEQA 4LQMA 4AZEA 4BBEA 4RWLA 3VUKA 5HNGA 4APPA 1H26A 2H34A 4ZLZA 4EQUA 4YJPA 4S33A 4GKHA 4QP7A 4CT1A 2IVUA 4BWKA 2I0YA 3E3BX 4IDVA 1P2AA 4L7SA 5L3AA 3D7TB 2JDOA 2XNMA 4G1WA 4QMOA 2XEYA 3H3CA 4RZWA 3VNTA 1KE7A 2VTHA 4B99A 1W82A 2VTPA 4O7VA 3BE9A 1KUTA 5AA8A 3LXKA 1Y57A 1APME 2XEZA 4W4WA 1H0VA 4FX3A 3NYXA 2PVYA 3FLZA 3QALE 5E8YA 3TNHA 3QTXA 1H25A 1GZOA 2W17A 2X4FA 3QU0A 5AUZA 5HU3A 4G9CA 4UXQA 4JI9A 4LUEA 2JIVA 3RNYA 3KY2A 1RW8A 4KKGA 5CTPA 4Z7HA 5FG8A 4FV8A 2QLQA 2R7IA 4OTRA 2NP8A 4W4YA 3VWAA 3ERKA 3MPTA 4BIBA 4R3PA 3V3VA 2WELA 3OWPA 2XKDA 4E6AA 2B1PA 2PK9A 4RIXB 2QOQA 4FODA 3R1QA 4CT2A 3Q9ZA 3VQHA 2F2CB 2R0IA 2CLQA 4L44A 2WAJA 1B39A 3PJ8A 4M13A 3ZC6A 3TV4A 2IVVA 5IH4A 2BIYA 3RPYA 3AXWA 2UZUE 4F1MA 1PYEA 2PU8A 4PQNA 4W9WA 4U9AA 4RVMA 1Q8TA 2OFUA 5HLWA 2C3JA 4IFGA 4A9TA 1UU8A 3K3JA 5M44A 4L3JA 2EUFB 3LMHA 4AZSA 2UW0A 3C5UA 4QMLA 3W33A 3OS3A 4NCTC 4OGRA 3PE1A 4GSBA 1YOMA 4W9XA 4G2FA 1PXPA 4BBMA 4EK4A 1XO2B 3BHHA 2R3KA 3I81A 3EQRA 4JRVA 5JGDA 3E5AA 3E7OA 2P2HA 2W1ZA 4QPSA 4WD5A 5HORA 5BVDA 4M12A 3T9IA 1CMKE 2XK6A 2OJFE 3QKMA 2QKWB 3NAXA 4LOOA 3IONA 4AZVA 5D7VA 3DBFA 2RF9A 4TN6A 4BKJA 5EDQA 4FKSA 2XIYA 5C4LA 3VS5A 4O6LA 4TL0A 3L9PA 5JQ8A 3C9WA 4CCUA 4YJVA 2X81A 4I4EA 3CQEA 2OXYA 5HVKA 3U6HA 2A27A 2VTAA 3CBLA 2X8DA 4MBLA 4FR4A 4LM5A 3R83A 2JKQA 4M69B 4IVCA 2QOFA 4XP0A 5EOBA 4FV1A 3ZZEA 5HTBA 1ZZLA 4X2JA 4QMXA 1JVPP 5AR7A 4DFYA 3TNPC 3TZ9A 3OCTA 4K1BA 5E92A 3UDBA 3UVRA 4RIOA 4RWJA 4XV3A 3WE4A 4DBXA 4LL5A 3FL5A 2I40A 4WRSA 4PPCA 3EYHA 4YTCA 2CN5A 4XUFA 2OJJA 3ITZA 3CKXA 3V5TA 4MTAA 3TACA 5AMNA 5FD2A 2HCKA 5HTCA 2ITPA 2Q83A 2YCQA 3FJQE 3LFSA 2Z7RA 4CKJA 2F7EE 2GTMA 3SV0A 3WIGA 2J0MB 3LXPA 5EG3A 1XR1A 2C1AA 2CMWA 2E9PA 2CPKE 3O51A 4RX7A 2VO6A 2WEVA 3SOAA 4MEDA 2FUMA 4S31A 3PA5A 2CGVA 4C36A 5IDPA 4GVJA 1I44A 4C4FA 5KKRC 3C4FA 5HNBA 3UBDA 5ANIA 1MRYA 4GT5A 3FKNA 3PE2A 2YM4A 4NM5A 4O2PA 1KE9A 4YHJA 3V5QA 4A07A 3REPA 4ACCA 3U6IA 4D28A 3PIZA 2PSQA 2WTIA 3FMMA 5CYIA 4MYGA 2RG5A 2V7OA 1TKIA 4I5CA 5E1EA 4XCUA 4BGQA 3GCPA 4X3FB 1NVRA 1UNHA 1WAKA 4U3ZA 3HP5A 3EYGA 5BNJA 3NEWA 3E8DA 1BI8A 2GNLA 4PMTA 4CQGA 3KN6A 2NNWB 2G2IA 3NGAA 1PHKA 2EB2A 2XB7A 5ANOA 4RX9A 3SOCA 2OZOA 5DT0A 4GT4A 2VTNA 3VS1A 1IASA 3VUTA 3W10A 5DWRA 4OW8A 5KO1A 4PY1A 5BVKA 4LV8A 3AC8A 3F5GA 3PRIA 3W32A 3ZDUA 4CV9A 5A4LA 3PXRA 1ZY4A 2R3FA 3VS0A 3U55A 5AP3A 3IW6A 4YZCA 5AUXA 4CLIA 2QOHA 2ITTA 3UOJA 2WZJA 2Y8OA 4KKHA 3QKKA 5IKWA 2UZLA 4NL0A 4R1YA 2ZV2A 5FTQA 2QKRA 3BIZA 3GC9A 4E1ZA 5KZIA 3RMFA 4AAAA 3QA8A 4OR5A 4ZY5A 2QOIA 4A9YA 2W1GA 3E8EA 3ZO2A 3SC1A 5KHXA 2AYPA 2PTKA 4N4SA 3ZUTA 2W1CA 5CAOA 3Q53A 4Q9SA 3MVMA 4AGCA 2PE0A 3BU5A 3H9OA 4QMPA 1BLXA 2YCFA 3R28A 4TW9A 4Z55A 5TR6A 2Z7QA 5FEQA 2WMUA 4IXPA 5CU6A 4D2WA 1GZNA 3QRIA 5AV4A 4RJ8A 2Z60A 4UV0A 4DFLA 5IQGA 3PFQA 3ROCA 3FQEA 3QCXA 3OTVA 5CU4A 4U44A 2HZ0A 2P4IA 3NW5A 2QG5A 3L1SA 5DE2A 2WD1A 5ACKA 3V8SA 5C4KA 2OZAB 4EYMA 3NCGA 3QF9A 5HICA 3K54A 4I5HA 2WTVA 2B4SB 5EW9A 5JT2A 2YAAA 3ZM9A 3P7BA 2R4BA 4P7EA 5AAGA 3ZDIA 3AMBA 3V5PA 3BWFA 1IAJA 4F6UA 4NYEA 5L6WL 2XIZA 4RRVA 4F9AA 3VUIA 3EFWA 3KMWA 3ZRMA 5AUYA 2GFCA 5IA2A 4XRJA 3AG9A 2QLUA 3DK7A 5JFXA 4J95A 4WG3A 4JX7A 4QQ5A 2DYLA 2ZM3A 3CY2A 5L8LA 1G8SA 2RKUA 4QTBA 3CS9A 3H0YA 4PDPA 3DZOA 2QOOA 2BDFA 4USEA 3FMDA 5CEMA 3OCSA 3FUPA 3THBA 3SAYA 4FC0A 4O0VA 4CTCA 3VN9A 4IWPA 4QP8A 1OUKA 3NCZA 3ZZWA 2RFDA 4FL3A 3W8LA 4QMWA 3LM0A 4YZMA 3RK7A 3A61A 5CSXA 4BDEA 5C8KA 4D1ZA 3BU3A 4GK2A 4TNDA 4EUTA 3HNGA 4EJ7A 3FPQA 4DTKA 5M08A 4IC8A 2R3OA 2ZV7A 4NFNA 1I09A 2OU7A 4U7ZA 4ALUA 3QTSA 3P0MA 4FK6A 1U54A 5HCYA 3G0EA 4HNIA 3DV3A 3FE3A 2IG7A 3TKUA 1U4DA 3CY3A 4FVPA 4OT6A 4Y85A 4BCMA 5BVWA 3W2QA 2BDJA 2JAVA 3PA3A 5M4CA 4N6ZA 1CKJA 2PVMA 3AC5A 3IO7A 3R8UA 2VWIA 2HW7A 3WYYA 4AOIA 3L9LA 1WBVA 4W4VA 4ID7A 1OB3A 3OXIA 4O0WA 4IVAA 4CEGA 2J0IA 2I0VA 2PZYA 1LP4A 2CKPA 3D5VA 4CSVA 3QCYA 3K3IA 1WBNA 1SVGA 1Y91A 1ZMVA 4AFJA 1SYKA 1U46A 5JKGA 5GINE 3WILA 3FKOA 2R3JA 3VW8A 4EH8A 1W98A 3D5UA 2CGXA 3R7YA 4DGLC 3HKOA 5M4FA 3VULA 5KMOA 4JR7A 3DXPA 4AF3A 1OIQA 2P33A 4DINA 3ET7A 4NW6A 1FBNA 4FEXA 3OCGA 3L9MA 2DUVA 4V0GA 2OI4X 5ANEA 3CE3A 5IA4A 2BUJA 4YJQA 5M07A 3MY5A 2VWZA 4QPMA 3T8OA 4H1MA 5JK3A 4BICA 3KXNA 3DA6A 4GJ3A 3VUHA 5M4IA 4AXAA 3G33A 3ODZX 5H3QA 4L7FA 3C4WA 3U8WA 2W99B 4BDGA 2IPXA 3II5A 3E93A 5DIAA 5CEOA 3EFKA 3U54A 3FZOA 4OBPA 3BPRA 2XRUA 4F9YA 3R73A 4EZ7A 3GP0A 5J87A 4BDIA 4R1VA 3CTHA 3H30A 3SX9A 1FVTA 3D5XA 5CZHA 3B8QA 3C4XA 3FLNC 5F1ZA 4BCHA 4C7TA 5I9WA 4KIQA 4XX9A 3R22A 4WUAA 4AOJA 2PVNA 1OPKA 4FZAB 4J98A 2R3PA 1CSNA 3PZEA 2VTIA 1M7QA 5FM3A 2HZNA 4FVRA 3BYOA 2X1NA 5TE0A 1WFCA 1BYGA 3BGQA 4RC3A 5EYDA 3S3IA 4B4LA 4EKKA 3SDJA 3B8RA 1WVWA 3LXNA 4K33A 4GK3A 3TNQB 4K8AA 2XH5A 2QODA 4YJOA 4AACA 1J7LA 1YXTA 3S1HA 2XP2A 2ITQA 1M2RA 1UV5A 3KRJA 2UW6A 2QOBA 3R63A 3TUCA 3QZFA 4CGAA 4MQ1A 3UP7A 1R1WA 4N0SA 5CEQA 4GKIA 3FMNA 2W1FA 5FQDC 5HU9A 4O7ZA 3GBZA 4I22A 1OI9A 3GEQA 2F9GA 3CQUA 2ETKA 4QNYA 5DR2A 3ULIA 3ZUVA 4CNHA 4FNYA 4BCFA 4C4IA 3BBTB 5FLFA 5L8KA 3ZFMA 5AX9A 3TIYA 3UNKA 3IW4A 2C6LA 4Q5EA 5HCZA 3RINA 3JY9A 4RT7A 1L3RE 2OJGA 2QU5A 1FINA 1ZYLA 3JS2A 3KXZA 5CNNA 3R8PA 3TT0A 3R21A 1ZY5A 2BILB 4IADA 4DLJA 4PDOA 3MH1A 3FSFA 4MF0A 4PP7A 3G2FA 4FZ7A 2YIQA 4BTJA 4IQ6A 2VAGA 5J9YA 4EYJA 4YP8A 3D7TA 3NZ0A 4FKJA 3LZBA 1UU3A 2HY81 2YIXA 3ATSA 2XNPA 3FMLA 3OUKA 2CCIA 3UO4A 3UZRA 1QCFA 5EHLA 4X2KA 3ZO4A 4IAFA 4CYIA 1E9HA 4RC2A 4U41A 3TKIA 2OKRA 3UIXA 3L8SA 2HENA 3F5XA 3NWWA 4FIHA 3SRVA 4FZ6A 4UWBA 4BB4A 1KE8A 4RMZA 3UC3A 5HIBA 2GQGA 4G3GA 1H00A 2AC5A 3OF0A 2G2HA 2VTRA 3RNIA 4AGWA 3P7AA 4QMMA 3KRWA 4GU6A 2IW8A 4JBPA 1YKRA 4FSWA 3DAEA 4GV1A 4J52A 1JLUE 3EZRA 2X4ZA 4HYHA 4U97A 2ZJWA 5JH6A 4LMUA 5A9UA 1OPLA 4XMOA 3FXZA 3DQXA 2PL0A 3OWKA 2OK1A 4XG2A 3NAYA 3Q04A 4F08A 4HNFA 5HE0A 3L9NA 2WPAA 2BVAA 3GU8A 3C4EA 4FIEA 4G3FA 4LMNA 4S34A 4L46A 3CD8A 2O64A 5LJJA 4XP2A 3Q5IA 4GU9A 4XV9A 3AGLA 3PRFA 3EJ1A 3SA0A 2GMXA 3PY0A 3PTGA 5KCVA 1W84A 4FSMA 5AAFA 5LQFA 3WZDA 5CXZA 5A4QA 1M7NA 3CTJA 4WIHA 1NVQA 4I41A 1ATPE 3A60A 5C27A 4G5JA 4LGHA 2BHHA 5B0XA 5KBRA 5DBXA 1GIHA 2H9VA 2JITA 3D14A 5LOHA 1NXKA 5AP2A 2QOLA 2UZNA 4B0GA 3LXLA 3CJFA 4B7TA 3ZC5A 4EQCA 2SRCA 4L67A 3R9HA 2V62A 2C4GA 5ACBC 4DH7A 4GEOA 3MB6A 5D11A 4J8NA 4AWIA 1FGIA 1REKA 2C5OA 3AMAA 4Y83A 3TM0A 1H01A 2ZMDA 3FXXA 4KINA 4BVUA 2Z2WA 1K2PA 3PIXA 3QD4A 4YSMA 5LCJA 1JKKA 4WBOA 1H1SA 1OKYA 5LVOA 3QRJA 4O27B 5GZ8A 4EZ3A 2GFSA 3JY0A 4JIAA 5TO8A 4C58A 4CXAA 4JAIA 4FV6A 5IPJA 4L43A 5KE0A 5CF6A 1YXUA 3PY1A 2C68A 1OM1A 4ANMA 3HAMA 4NUSA 3PY3A 4G17A 4JG7A 2F7XE 3ZRLA 2BTSA 4OTHA 4ACDA 2UVYA 2Y0AA 3RK9A 5IG1A 5FRIA 5TKDA 4FMQA 1HOWA 4W8EA 3GQLA 4RIXA 4MXCA 1PXNA 4AZFA 1WBOA 2BAQA 4ZTSA 3T3VA 1VJYA 5AP0A 4EHZA 1UU7A 4AX8A 2OFVA 4DG0E 3KU2A 2YLEA 5IA1A 2X9EA 5I9YA 3S95A 4CMTA 3JUHA 4BDDA 2O2UA 3PZHA 4Z9LA 5EM7A 4L01A 2BRBA 3FZPA 2OIQA 3M42A 3R1SA 5CS6A 4BBFA 5BPYA 1VYZA 3EHAA 4RQKA 5CEIA 4D1SA 3TJDA 5BVEA 4Y46A 4EUUA 1SNXA 2W1HA 5M56A 3OFMA 5F95A 2JIIA 4F7LA 3Q4ZA 5DYJA 3LM5A 4XLVA 4XYFA 5EDRA 1OL7A 4AN2A 4XG7A 4AUAA 1W83A 2XYNA 2BAKA 2ZAZA 3OWJA 4GFOA 4NSTA 3R7IA 4BCOA 4XP3A 4D4RA 4FV3A 5C1QB 3VJOA 4UMTA 1Z57A 2OH0E 4MF1A 5HIEA 3JR1A 3DOGA 3BHYA 3FMEA 4LYNA 4G31A 4NKAA 3PWYA 2FH9A 4CV8A 2W1EA 3W18A 3BLHA 4FSYA 3O96A 4BCPA 1Q41A 2C1BA 1OL6A 3EKNA 4XV1A 1YWNA 4JDIA 2FGIA 2YWPA 4BCIA 5BVOA 1H1WA 4B8LA 3O23A 4F7NA 5KX8A 1JSUA 4U8ZA 3IK3A 3TEIA 4L00A 4AE6A 4F0GA 5L4QA 4C2VA 3OWLA 3G6HA 3QBNA 4QPAA 3LQ8A 4YJRA 1REJA 5AUTA 3FZTA 3R71A 3HRFA 3KRXA 2Z8CA 4U40A 3Q32A 3VIDA 4C38A 2AC3A 3BE2A 5E8XA 4Z7GA 2PUIA 2BRMA 2ZOQA 3ORPA 2IVTA 4DFNA 4BDJA 2WMSA 3D2IA 4CZYB 3P23A 5GNKA 3E92A 4FKOA 3W1FA 4E6CA 2HZIA 4O7LA 3IW8A 1RJBA 1AGWA 4BCQA 2R0UA 4U3YA 3RM7A 5HVYA 3NLBA 4GS6A 3FV8A 3OW4A 4KUJA 2XVDA 2W9FB 3LOKA 3KK9A 4MQ2A 1YHSA 5IA0A 5A3XA 2R5TA 4RJ6A 4R8QA 4TPTA 5AR2A 3CIKA 4ALWA 3SW7A 2H6DA 3LJ0A 2WMXA 2V55A 1YQJA 5LCKA 2GHGA 4EBVA 3N4UA 3UTOA 2GSFA 4PNKA 1LR4A 5H8GA 5CQUA 2IW9A 4LRJA 3DJ7A 3GU7A 3R9NA 3I5ZA 2HELA 2PE1A 5FGKA 4ANOA 4Y72A 5IU2A 2FVDA 1OL5A 2JDRA 4IE9A 3P08A 4RIYA 4R77A 4KAOA 4DEAA 4ITHA 3MVJA 4DGGA 3F5PA 2VU3A 5TT7A 3EQPA 5DN3A 3HDMA 5E7RA 1R39A 3G6GA 4G9RA 5A6OA 5DLSA 1RQQA 3IDBA 4ZEGA 4AW1A 3UPXA 4DG3E 5AV3A 4UZDA 4AA4A 5BQ0A 5AIKA 4UYAA 5C8MA 2BKZA 1EH4A 5EM8A 3QCSA 2YIRA 4L53A 4ASXA 4F9BA 3Q9YA 4DF3A 2PE2A 4WNOA 2ONLA 2UW5A 1YOJA 4UY9A 4XRLA 4FTUA 3RAWA 2B7AA 2QO9A 3QX2A 1GY3A 2IJMA 3EQHA 5AP5A 4DAWA 4CFNA 1JBPE 2WOUA 4S2ZA 2YHVA 4ANLA 5FXQA 1YXXA 5IUIA 2CNQA 5CASA 3ZSHA 1SMHA 2PZPA 3UOHA 3O8UA 4ZTLA 5FEEA 4QYFA 4FTAA 2XRWA 1GZKA 4R7IA 3ENHA 2C0IA 3CXWA 3JPVA 3PPZA 4UEUA 3Q52A 3IDPA 4G3EA 3BGPA 3P86A 2R64A 3ELJA 2OIBA 4MXAA 4YBKA 5CANA 5BUEA 2PVJA 3QLGA 4R7HA 4R7BA 3MY1A 4QP4A 4ZSGA 4AFEA 4BZDA 3TXOA 2O0UA 4FG7A 2RGPA 3LMGA 2PZIA 3MPMA 5E90A 4BWPA 1E1VA 3A4PA 4YMJA 2CGWA 2RFEA 2YISA 3A2CA 3G9NA 3HUBA 3IOKA 3MFSA 4Y5HA 4ANBA 1W7HA 4C2WA 4C35A 1OBDA 3DB6A 4D4SA 3D83A 3BI6A 3GXLA 3Q3BA 4IC7A 4O0UA 2RFSA 5M57A 4AN9A 4MD9E 5GHVA 2QOCA 5D1JA 1J1BA 3D9VA 4DFUA 5CF8A 2A4LA 4AU8A 2WB8A 3NYNA 4KRCA 2H8HA 4IM3A 5DFPA 4DE4A 1FQ1B 2OXXA 4KIKA 2LGCA 3W2PA 5CNOA 2QU6A 3WF9A 4GH2A 4RZVA 4LV5A 1WVXA 2JIUA 1ZMUA 2FA2A 5CT7A 4J96A 3ZEWA 5L8JA 2UZVA 3VF9A 5CAQA 3A7HA 4FSZA 4ITIA 2XJ2A 4OTPA 4V05A 2JKOA 3JYAA 1OIYA 2CGUA 4WHZA 4YGAA 5IQIA 2OO8X 2R7BA 4ASDA 2E9VA 4CZUA 4M67A 3DQWA 2GTNA 2XNEA 3BRBA 3CGOA 3QQLA 4KS7A 4CCBA 2I1MA 3DDQA 2O63A 5EW8A 3S4QA 3TKHA 5HZNA 4YJNA 4K6ZA 4IX4A 1OGUA 5H8EA 4I0RA 3U9CA 1GOLA 3GU4A 5GJGA 5EK7A 2VO0A 4B9DA 4OTFA 1TQMA 3SHEA 3RZBA 1J1CA 2W4JA 3CPBA 2ZV9A 5IZFA 2R9SA 4ZP5A 5HESA 4O86A 3TZMA 2JDSA 5J5SA 3OBJA 5HCXA 3O0GA 4IWOA 4EC9A 4MD7E 5EQEA 2VWVA 2VWUA 3IPHA 4EJNA 1DM2A 2YM8A 4WO5A 5IH5A 3R7EA 5DT3A 4NTSA 4BDAA 3HMMA 4K9YA 4I6QA 3DLZA 4U5JA 5CSPA 5K5XA 2ITZA 2JDTA 4DEGA 2YIYA 3UYSA 4DFZE 3W2RA 2Y6OA 3HDNA 5FDXA 5K9IA 4J1RA 3DFCB 3MYGA 4PF4A 5JRSA 3R7OA 3HVCA 3HGKA 2OH4A 4MAOA 4C37A 1FMOE 4EOOA 1OZ1A 3EQFA 3A7GA 3MS9A 4XG3A 4I5PA 4K0YA 1NVSA 3P78A 3QUEA 4ZSEA 4BIEA 3HRCA 3LLAA 4ZS4A 5G1XA 4FKWA 1G8AA 2R3IA 1GJOA 4KABA 2VWXA 3QC4A 4DH3A 4EKLA 2BTRA 2E2BA 4EL9A 3V8TA 3ROYA 4LL0A 3FLQA 4IH8A 3O2MA 2YWVA 3NUNA 3OC1A 3WZUA 1UNLA 3HV5A 4KIKB 2F2UA 3BGZA 2A1AB 4CFFA 1UWJA 3KULB 2CN8A 4RX5A 3KC3A 5FXSA 3WARA 4HVHA 5CAVA 2WEIA 2E9OA 3KA0A 3F6XA 3LCDA 1QPEA 1V0BA 4CG8A 3AC2A 4JQ8A 3VRZA 2IN6A 5KMKA 4BTFA 4USFA 4DCAA 4WSQA 5BX0A 4IM2A 1CKPA 4FTLA 1FMKA 1JKTA 3NYVA 4I93A 3W2CA 4ASEA 4BKZA 2R3RA 4YR8A 1SVHA 3LMIA 3NUAA 2J5EA 2WQBA 2QO2A 3OMVA 3D15A 5E1SA 4TKSA 4MWHA 4DEIA 3MSSA 2JKMA 4E5WA 2P55A 3LFAA 4HVIA 4EOJA 1SNUA 5CVGA 2PY3A 4ZSJA 4ERKA 3CSVA 4BY9E 3K2LA 2QHNA 4FKGA 4JLCA 4UMPA 5AIRA 3DZQA 3A99A 3ALNA 2VV9A 1YXVA 4OUCA 4TZRA 4C4GA 2B9FA 2BRGA 3OXZA 2QOKA 4KKEA 3VBTA 2G2FA 2WXVA 4RFYA 4XBUA 3VUMA 3KMUA 4I24A 3DAKA 4B6LA 3LKMA 4AA0A 1PY5A 1YOLA 2J0KA 1J91A 4UMQA 3NNVA 5AM6A 4JXFA 4FV2A 5EQPA 4KA3A 2O3PA 3BV3A 4O22A 4EH9A 2WMAA 3RJCA 3I7CA 4L52A 3L8VA 3JXWA 2G01A 2WMQA 2BHEA 3DNDA 1PKDA 3LLTA 5B2MA 4U0IA 3BELA 4C34A 4F1TA 5KZ0A 4FSQA 4H3BA 4FIGA 4ZY4A 3R8VA 2OBJA 4ZZNA 1T45A 5J1VA 2NRYA 2UW9A 2W7XA 4ZJJA 4KSQA 4PMMA 2OXDA 5F20A 3ZOSA 2Z7SA 3R8MA 4QYHA 4XG4A 3NNWA 2GHLA 2JBOA 3ZO1A 5K5NA 2GS7A 3BCEA 5GJFA
chains in the Genus database with same CATH superfamily
3TDVA 2ZMCA 2B9JA 4ZZMA 3MJ2A 4FIFA 2JD5A 4NW5A 4BFMA 3HZTA 3C4ZA 4BWXA 1U5RA 1YI6A 2W0JA 3QRTA 5I9VA 3QTRA 5IISA 5GIPE 3PG1A 3NW7A 2R3NA 3A8XA 5CEPA 5HX6A 2HZ4A 4ALVA 4JS8A 3KREA 4PWNA 3AOXA 4J8MA 2C6TA 5ITAA 4D4VA 2UZDA 5F9EA 4TYEA 3KKVA 4YUQA 4M66A 3UIBA 4A4OA 2XM9A 5A4TA 2CNUA 2PUNA 4BTMA 4ZLOA 4II5A 4XG8A 5E8TA 5I5ZA 3UVPA 3QD2B 1WBPA 5AR3A 4PMPA 3Q4UA 4QMTA 1QMZA 1ZRZA 3EN5A 4AZTA 3QZIA 4BDHA 5E8SA 4WOVA 3TDWA 2C0OA 2W1DA 4D1XA 3Q6WA 4PUZA 3PYYA 4FTNA 5DPVA 5FBNC 3LPBA 5HLNA 3HA6A 5IQAA 3W0OA 3AD5A 5FDPA 5IQCA 4KS8A 4YNOA 3C4CA 3FMKA 3LIJA 1H1QA 2OG8A 2QC6A 3U87A 3PSDA 1NY3A 4GG7A 3NIZA 3NPCA 3QHWA 3BYUA 4D2SA 1OIUA 1MRUA 5LWNA 4DDIA 2VTJA 4XG6A 4WKQA 5HTIA 2WKMA 4EZ5A 1BL7A 5LWMA 4EHVA 1PYXA 4X2FA 1G3NA 4D2VA 5DHJA 3AC1A 4MH7A 4MD8E 4MXOA 3M2WA 3QUPA 4AW2A 1OBGA 1JOWB 3MW1A 4AT3A 4BR3A 4EOQA 5IQFA 2ERKA 4EOMA 3LJ2A 1UA2A 3UP2A 3LQ3A 2A0CX 2OF4A 3FYJX 2GS2A 4HOKA 3WZJA 5EM6A 5HEZA 2W4OA 4YBJA 2YFXA 5KMMA 4IZAA 4BTKA 4F64A 4ZTRA 1ZOGA 3TCPA 5I0BA 4C02A 2VN9A 4NJDA 3VS6A 4YC3A 3AKJA 4F6SA 5AA9A 3DKGA 2Z7LA 1Z9XA 3HMPA 4MK0A 2YABA 4Y8DA 3G90X 2HXQA 5F4NA 2C6EA 4E26A 2GQRA 4IWDA 1Q8ZA 2XK8A 3A7FA 5CZIA 3R8ZA 4BGHA 1Y6AA 3PXFA 2BZHB 2BALA 5EI8A 3KGAA 5DRBA 3ALOA 4QMVA 4FTOA 5A14A 2I7QA 3QWJA 3VC4A 4GIIA 4MNFA 3HMNA 4UBAA 5IEVA 5H2UA 5BYLA 4J99A 2B54A 5F94A 5DMZA 4HYSA 2XNOA 2VGPA 3W2OA 4DFXE 3SVVA 4ZTQA 4NKSA 2KTYA 1NW1A 3I6WA 1GIIA 3QD3A 1R0PA 3SD0A 1YI3A 4RFMA 3CCNA 3OW3A 1LPUA 3AD6A 5GJDA 4XOZA 5I4NA 2ZV8A 4U81A 3R7VA 4C3FA 4RJ5A 3POZA 5IMEA 3PVUA 3LCKA 3LW0A 3NS9A 2CCHA 1KV2A 4YLJA 3ML1A 1PXOA 4M68A 3GU6A 3BEAA 3N4VA 3MJ1A 3PVWA 1Y8GA 1U5QA 4FNXA 4KBAA 2ONLC 4R5SA 5AR4A 3CD3A 4ZJIA 5T3QA 2PMLX 4A9UA 3ZUUA 1DS5A 2WFYA 2WMRA 3OZ6A 5E8WA 5HOAA 4G3CA 5FTGA 5AP7A 5KUPA 4E4MA 3EB0A 1O6YA 3ID6C 4AE9A 3OY1A 5AUVA 1JNKA 4F63A 2ZDTA 3R02A 3I60A 2R3GA 2V5QA 3CKWA 2HXLA 4JDKA 2DQ7X 3LCSA 1SM2A 3O17A 2WTKB 2PVKA 2BR1A 4LOPA 3UO5A 4P5ZA 5D12A 1MQBA 5J79A 2XNNA 1P5EA 4QP3A 3V04A 3FLSA 4ZMFA 4TYGA 4FEWA 4ZSAA 3TUBA 4XJ0A 4LUDA 5CLPA 3WIKA 3MFRA 3DNEA 1H24A 2XK7A 2XK3A 3NIEA 4OTDA 4FV0A 1VEBA 1PXKA 3UE4A 1BL6A 2REIA 2XK9A 2O8YA 4IJ9A 3CTQA 1AQ1A 4O7RA 3OY3A 1YDRE 3OP5A 3OOGA 1CTPE 5JZNA 5L2TA 4FI1A 4BZOA 3CJGA 3ZSIA 4ANNA 2XIXA 5I3RA 4GYGA 5DT4A 4EEVA 3UMWA 4ZAUA 5DOSA 3V6RA 1XH5A 3MTLA 4F0IA 2BIKB 4LV7A 2VO3A 2C3KA 4YLKA 2VTSA 1ST4A 4CQEA 4M7IA 2KULA 2FSTX 3GFEA 4EOPA 1TZDA 2XKEA 2ZM4A 3HV6A 4ZS0A 1Q8YA 3VS2A 4QMQA 5BVNA 3UOKA 1RDQE 3ORKA 2VTOA 3RCDA 3V8WA 4KD1A 2GNJA 1ZYJA 2UW7A 3KQ7A 4QP9A 4Q2AA 3LFDA 4H58A 3V51A 5LVMA 3UDTA 1UWHA 2C0TA 2P2IA 3FQHA 4FT5A 4RQVA 4BYIA 4FKQA 3A7IA 2J50A 2FB8A 2YEXA 2F57A 3QXPA 3RI1A 3VVHA 2BFXA 4BCGA 4DTAA 4FV9A 3GT8A 3KCFA 4OTQA 3UVQA 3VBYA 4GG5A 4IX6A 2YA9A 3GNIB 3F3TA 3QWKA 4YTHA 2B9HA 3EN4A 3HRBA 4DH5A 4EOLA 1NT2A 4AN3A 3KXXA 1W0XC 4I4FA 2JDVA 2J4ZA 2O65A 4FV4A 3RPSA 1QPDA 4AGDA 4EI4A 5KKRB 2CSNA 1S9IA 5T68A 4RIWB 2OJ9A 1OIRA 3ZBXA 4BC6A 3QAME 4G3DA 5K3YA 3SXSA 3F66A 1PXMA 3C0IA 4IAIA 2QVSE 3QA0A 4V04A 3KXHA 4O96A 4MNEB 2RSVA 2XZSA 3DKFA 3NMUF 4EH2A 3EQBA 2FO0A 5HG5A 2YM6A 2CKEA 2J7TA 3W0NA 2XK4A 4FF8A 4ONAA 1LEWA 4I6FA 1SZMA 3EQDA 2FSLX 4TT7A 4MXXA 3R0TA 4ITJA 3NVMB 4FTCA 1KSWA 3LCTA 4G6NA 3W0QA 3BLRA 2EU9A 5IUHA 4GJ2A 1Q24A 2A2AA 2UVZA 3VS7A 4CZTA 5L2QA 4K2RA 3E64A 3PJCA 3QRKA 3QYZA 3ZONA 3G15A 3HL7A 4O21A 5EYMA 4I1ZA 3NW6A 5C8NA 3MPAA 4LFIA 4NIFA 4BKYA 3ZLWA 2WIHA 3GI3A 3IW5A 4QRCA 3VUGA 3HYHA 4MVFA 5BYZA 4BCJA 4RA5A 4C4JA 1E1XA 3HV7A 3D4QA 4HCTA 4TTHB 2FSOX 4U45A 4FOCA 3BYSA 4M0ZA 3B2TA 4K11A 1DI8A 3I7BA 2QI8A 4U43A 2QG7A 3PLAE 4OT5A 4ACGA 4TYHB 4DA5A 3ODYX 3POOA 4A06A 3I0OA 4MWIA 4ZXTA 5CSWA 5BMSA 3MWUA 5CU3A 1BX6A 3PJ2A 3QZHA 3WF8A 3I79A 5ANKA 2UZBA 4XG9A 5CI6A 4EK6A 1MP8A 4DEHA 1H8FA 4IAYA 3RBWA 5CF4A 4X3JA 3P5KA 3GB2A 2RG6A 2IVSA 3EKKA 3KULA 4IBMA 5J9LA 5CSHA 4GL9A 5DNRA 1H1PA 2BRNA 1A06A 4E5AX 1LUFA 4CRLA 4I92A 2JFMA 3EOCA 3W0RA 4BHZA 3K5VA 2WTCA 2WTWA 1UKHA 5DVRA 4JL9A 3ANRA 5GZ9A 2J51A 4BGGA 4CRSA 1H27A 4C4EA 3BQRA 1XH7A 2VO7A 3MH3A 3ZEPA 3VF8A 3IW7A 5K0XA 3NFGB 4DEEA 4Z16A 1Q3WA 4XS2A 5TOZA 1FOTA 3MA3A 4GT3A 1PMEA 3Q96A 2HW6A 2ITXA 2WQMA 4CYJA 5IEYA 3PPJA 4L45A 4RVLA 3EN7A 5J5TA 5HE2A 4LGGA 5CQWA 2F7ZE 3G51A 1JWHA 5FM2A 3TZ7A 5J8IA 3F2NA 4D0WA 5JEBA 3UODA 3COKA 1PXJA 3NYOA 1Q97A 4MXYA 1WMKA 1WCCA 1O6KA 1QL6A 2OSCA 4UMUA 3COMA 2JEDA 3DU8A 4ORKA 5IUGA 4BZNA 3E87A 1V1KA 4S32A 2X2MA 4KIPA 3HMIA 5IH6A 3ATTA 3DBQA 4GK4A 3M1SA 5FWKK 4D58A 3C0GA 2PVLA 3TV6A 3W2SA 3TIZA 4EONA 2RIOA 2X6EA 4DHFA 2NPQA 2J9MA 4RFZA 4WUNA 2X6DA 4I3ZA 3RALA 4IMYA 5HE3A 3WF6A 3VO3A 3KFAA 4WNPA 3OOMA 4AP7A 4HJOA 3F88A 1STCE 5CX9A 2QCSA 4NH1A 4O6EA 3ORXA 4D2RA 4FKUA 5KMJA 3F3ZA 3C7QA 2VX1A 4OTGA 1YHWA 2QD9A 2Y4IC 4DFBA 3WYXA 4R78A 3OXTA 1IR3A 3PSBA 1O6LA 3DY7A 2ITUA 5AADA 4EQMA 2XKCA 5GZAA 2XALA 3HA8A 4C0TA 4IX3A 4MHAA 1V0OA 4HGSA 2XIRA 4R6VA 1YDTE 3HAVA 2G9XA 1PF8A 1IEPA 4DG2E 2UZWE 3FYKX 3EH9A 3RWPA 5BUJA 3OCBA 5K4IA 4CKRA 3ZU7A 3AKKA 3I4BA 5CF5A 2VNYA 2LAVA 2PZ5A 4EH3A 5FXRA 3FC1X 3I0QA 4IB1A 3R00A 4ENYA 1YRPA 3TJCA 3DK3A 5EFQA 1BKXA 3GFWA 3FI2A 2WU7A 3R2YA 2Y7JA 4G6LA 4PX6A 5IA3A 5JRQA 4AQKA 3S2PA 4TRLA 3E62A 4D5HA 4DH8A 5AAEA 4N57A 5HI2A 4GRBA 4NJ3A 4FVQA 4ZJVA 2GNHA 3QZGA 4OAUC 1WBWA 3GENA 3QQGA 5E8ZA 3WOWA 3ZFXA 1XJDA 4HGEA 2BKKA 3HX4A 4MX9A 3PWDA 2IW6A 4IZ5A 2X7FA 3IS5A 4M15A 4JIKA 1FGKA 3MFTA 4J7BA 4QP6A 3RVGA 4YJUA 5AWMA 1ZARA 4FT3A 5IQHA 1XH6A 4IB5A 4YC8A 4D9TA 1J3HA 2B55A 3RHKA 4ARKA 1OMWA 4NM7A 4ZY6A 4YC6A 3VJNA 3R1NA 3A7JA 3TG1A 4YTFA 4DTBA 2VD5A 4HZRA 3QXOA 2WIPA 3LCOA 4KBKA 4QTAA 3UG1A 4O1OA 3KMMA 3KEXA 3KRLA 4JG8A 3EQCA 3EFJA 4QMUA 3LHJA 4FTJA 5LMBA 3PLSA 3UNZA 5HX8A 3EMGA 2ACXA 4IAZA 2PHKA 2V7AA 5HVJA 5FUTA 3UDSA 5EM5A 3CQWA 3BWJA 5A4EA 3QL8A 2B53A 2WTJA 2J6MA 3F69A 5EDPA 3NSZA 1ZOHA 3RGFA 5AFVA 4FICA 3EL8A 3U4UA 1NA7A 2CDZA 4B8MA 4QMNA 3ORMA 4EH4A 5A54A 3HECA 4U42A 5DEYA 2C5VA 5J1WA 3COIA 3R9OA 1YI4A 3ZLSA 3OD6X 5JSMA 4OTIA 1KOAA 4WBBB 5AP6A 2CHLA 2FYSA 3HMOA 3GCVA 4MCVA 5CVFA 3Q9WA 3IKAA 2FSMX 2ZB1A 2GCDA 3Q2MA 1M17A 4YZ9A 3RAKA 3FI4A 5BVFA 4ACHA 4M14A 3TTIA 4WSYA 4JDHA 3ZSGA 4DHIB 2ITOA 4JQ7A 4X2GA 4YJSA 3R01A 3V5JA 5EKOA 3OUNB 4BF2A 3QTQA 3WZKA 3T9TA 1ZWSA 1IA9A 3EIDA 4L68A 4NZWB 5K4JA 2IEWA 3A62A 1PW2A 4J97A 2BDWA 3ORZA 3KB7A 4G16A 4PL4A 3TV7A 1M2PA 4MBIA 4F78A 1LEZA 2HWPA 2OF2A 4CFWA 4O0SA 4QT1A 1H28A 3FPMA 3PXZA 1JKLA 4GCJA 5AX3A 2W1IA 3N9XA 5ICPA 4JRNA 5FEDA 5H9BA 3CC6A 3TNIA 2CKQA 3PVBA 4P2KA 4FT9A 1KE6A 3UPZA 5I3OA 3MH2A 3LFNA 1OECA 4A9SA 1PJKA 4FL1A 1Z5MA 4H36A 5BMMA 2XANA 1GNGA 3U51A 3BL7A 2X0GA 2QR8A 5DH3A 2WQOA 4I0TA 5JFWA 4FTRA 2YJRA 1M2QA 1VZOA 3GCQA 4Y5QA 3H9FA 3DXQA 1JAMA 3F2RA 4M69A 4RJ3A 3AQVA 4EWHA 5FBOA 4QYYA 4CG9A 4NCTA 5LMKC 5D7AA 1UNGA 4F7SA 3PP0A 3S00A 3UZTA 3OTUA 4KSPA 4G6OA 1F0QA 2ZYBA 3FSKA 5IMXA 3MVLA 4X6RA 3WZEA 3UQFA 4ANSA 4XHKB 2JKKA 3NUYA 2HWOA 4FZDB 4J71A 3UJGA 2XJ0A 3WI6A 1A48A 2EWAA 2C3IB 3ORNA 4ASZA 2EXEA 5KMLA 1YWRA 4FEVA 2W5BA 4X3FA 3KCKA 4O0XA 3MDYA 5E8UA 4DEBA 3SG8A 4HCVA 4QTDA 5HG9A 5IDNA 4UALA 3DXNA 5CENA 3B2WA 3ORIA 4JAJA 4WNMA 5AP4A 4DGOA 3NNUA 5T6KA 2J0LA 2XARA 3NUXA 4FIJA 3AGMA 2WU6A 4QNAA 3TL8A 4D2PA 4EC8A 3V5WA 4DC2A 4BI1A 3VUDA 4DGMA 5I9XA 5J7BA 4ZIMA 4D2TA 1OVEA 3OT3A 5AJQA 2YM5A 3HP2A 3U6JA 3SKCA 1VR2A 1ZYSA 1PKGA 5B2KA 1ND4A 4PPAA 4EK3A 1ZLTA 3C5IA 3Q4CA 4FKVA 4G5PA 4L6QA 3RAHA 1H07A 1XMMA 5CAUA 3NVKI 2R3QA 2F4JA 4E93A 3V5LA 4PNIA 3R2BA 2IO6A 4FTMA 2PVFA 2YZLA 3NRMA 2YJSA 4FUYA 2UW3A 4M97A 5CT0A 3UZPA 3ORTA 4M84A 4FTTA 1P4FA 2IZSA 4GUBA 3RAIA 4A4XA 4CTBA 3ULZA 3FY0A 5AEPA 2VUWA 4NU1A 2ETMA 3D7ZA 3FXWA 4PRJA 4FZFB 5ANDA 5B7VA 3MFUA 5DEWA 2YAKA 4CLJA 3P4KA 3ZM4A 3GVUA 4KBCA 3QD0A 3C50A 1HCLA 2DWBA 3EZVA 3TN8A 2J5FA 2GNFA 3QCQA 2VTMA 3FHIA 5D9HA 2I0HA 4YO4A 4C57A 2VX3A 1V0PA 2ZM1A 3QGYA 4GMYA 3C0HA 3ZXTA 5M09A 3QYWA 5JMSA 3WE8A 2QR7A 1F5QA 3UYTA 5LARA 4OLIA 4H3QA 5J95A 4E8AA 3KVXA 4RX8A 1DI9A 5A46A 1PMUA 4U6RA 4W4XA 3TMOA 1DAYA 5AV2A 4EK8A 2WTKC 3DKCA 2I0EA 4FUXA 4AXCA 2XMYA 2PVRA 2BZIB 2YERA 4O1PA 3ENMA 4CKIA 1H08A 2BROA 2HOGA 2VWYA 4A9RA 1DAWA 4E7WA 1XH4A 5M51A 5ANGA 1XBCA 2XA4A 2C6KA 2YITA 3IQ7A 4YLLA 2OZAA 3F2AA 4DYMA 4X2NA 4QMYA 3I1AA 4HPUE 4IB3A 3D0EA 4RIWA 4X21A 4BYJA 4IHPA 4RJ7A 2W9ZB 3TTJA 4U80A 4XOYA 1R3CA 3TI1A 2QURA 5K0KA 4EORA 3A8WA 3F7WA 2BZKB 4MNEA 5A6NA 2Q0BA 3EL7A 4GVAA 4YHFA 5E4HA 3ORLA 4YTIA 4C33A 4FBXA 4WG5A 3VBVA 2WGJA 2XBAA 2PVHA 4LRKA 3QC9A 4FKRA 4X6QC 5L2SA 3W0SA 2CJMA 1F3MC 2PUPA 4QP2A 4N6YA 2YDJA 1ZMWA 4BDCA 4YPDA 3OHTA 2PUUA 3KF4A 5ETIA 4IFCA 4UXLA 3O5AA 3FZRA 4LOQA 4NWMA 4PP9A 3AD4A 3SW4A 4CD0A 5JZJA 5DI1A 2QO7A 4O84A 2WMWA 2WTDA 3E8CA 5HD7A 2YM3A 2XF0A 3R8LA 2ZB0A 3PXYA 4QQJA 4FV7A 4IAKA 4PMSA 4TYIA 3PUPA 4C3PA 4HVSA 1B38A 4RBLA 1FVVA 2WMBA 3W8QA 4ENXA 5IQBA 2XAMA 4PTEA 2IZRA 5LMAA 4ZLYA 5EOLA 4UZHA 2YCSA 1GIJA 4FSUA 4UMRA 2ITNA 4D0XA 5JGAA 3MESA 3G5DA 3ZBFA 2X39A 4LRMA 2E9NA 4O82A 2EXCX 3MTFA 4I94A 2YDIA 2YN8A 3QFVA 3JVRA 2VTQA 4PPBA 4HPTE 5EW3A 3MI9A 4AG8A 4MBJA 3R9RA 2ITWA 3F3WA 4FKPA 3ZLXA 4WG4A 4BDFA 3GCUA 4G34A 2H96A 3ZCLA 4JMQA 5EI6A 2BCJA 2HYYA 2UUEA 4IZYA 2VTLA 3HV4A 2XAOA 4N70A 2P3GX 4TWCA 4QD6A 2C5NA 3O7LD 3OROA 3EQGA 1FPUA 2UZTA 1XHAA 3AMYA 3CPCA 3FAAA 2W06A 3PG3A 3QTUA 2OIDA 3KRRA 4JX3A 3GQIA 1ZYDA 2F49A 4NM0A 4HCUA 3BU6A 1UVRA 4DBNA 1VYWA 4EOIA 2Q0NA 4FG9A 5M55A 4KNBA 4EWQA 5M53A 3D5WA 1GAGA 2QQ7A 3BEGA 4H1JA 3R7UA 4TWPA 2CNVA 1YVJA 3BV2A 2B52A 3NUUA 1YHVA 4PV0A 4FIIA 5D10A 3BX5A 4K77A 4YURA 4AZWA 4HVDA 4HVGA 4IB0A 4DT9A 3AT4A 2W4KA 3RM6A 4YO6A 1WBTA 4RVKA 5HHWA 4FTQA 2UW4A 2BZJA 2Y4IB 4HGLA 3DJ5A 1WVYA 1TQPA 5DR6A 3SQQA 3ZH8A 1OPJA 4DCEA 3DTCA 3HUCA 5CU2A 3W0PA 2ITYA 5KNJA 1K3AA 3TWJA 4JT3A 3H10A 2W05A 2XJ1A 3MBLA 3QTIA 5AM7A 5FP5A 3LFCA 3LFEA 4BDBA 1PMNA 3FLWA 4QOXA 5G6VA 3C1XA 5HKMA 5LVLA 2QNJA 3OVVA 5BUIA 4L8MA 4OAVB 1XWSA 1PXLA 5CEKA 3QQFA 2WQEA 1TVOA 3ACKA 3PSCA 3WF5A 2UW8A 3IDCA 4O4EA 5HO6A 5C01A 4GFGA 4Q9ZA 5CAPA 5AV0A 3UIMA 3UO6A 3A4OX 4FYNA 4QO9A 2OWBA 4EBWA 3Q5ZA 3RPRA 4RWKA 2B9IA 3E8NA 4C3RA 4O0YA 4C61A 2NYAA 2JBPA 1OKVA 4O91A 3TZ8A 3F61A 4E4XA 1JPAA 3FL4A 4F99A 2GQSA 3U4WA 1JSTA 3FC2A 4BJJA 4XNEA 2O5KA 3VRYA 4EH7A 4BRXA 1OL1A 3GUBA 2ESMA 2UZOA 3V6SA 4IACA 4AT5A 4PDYA 4O81A 5DR9A 2QHMA 4I6HA 3DK6A 3RTPA 2HK5A 2G1TA 4FSNA 3FWQA 3DBCA 3QQJA 4FSTA 4H05A 1MQ4A 3C13A 3E7VA 3KL8A 4YZDA 4M3QA 5KHWA 2B0QA 1UU9A 3GC8A 3RZFA 2EVAA 2PMIA 3ZS5A 2AUHA 5HNIX 2PYWA 3SLSA 3DKOA 3O7LB 1A9UA 3EFLA 3WBLA 4Q5HA 3DBEA 3LFBA 4HGTA 4IX5A 3GOKA 4JBQA 4QTCA 5DA3A 4RVTA 5IF1A 4O7WA 4CFUA 3MIAA 1PMVA 5HGIA 1KOBA 3PUFC 4HZSA 4AQCA 5EI2A 4E20A 4XEYA 2X7GA 4FK3A 4XBRA 4EOKA 1IAHA 1G5SA 4PL5A 2W5HA 3MN3A 3E63A 3SRVB 3VS4A 4UYNA 3V01A 1MRVA 2V0DA 5AP1A 4A7CA 3I6UA 4CFMA 1IG1A 5CXHA 3LVPA 4ANQA 4AT4A 2AEGA 4KIOA 1ZXEA 3HEGA 2CKOA 3NUPA 4L42A 5HO8A 3IGGA 5JN2A 3MB7A 4P4CA 3VS3A 3H4JA 1CDKA 5JFVA 3TUDA 3N4TA 3AC3A 4O7SA 4AA5A 4FL2A 2RL5A 1OUYA 2RFNA 2HIWA 2A19B 3IECA 4OBOA 4E5BA 3M11A 3PVGA 3DBDA 4FKTA 3UNJA 4FGBA 1X8BA 4KRDA 4OTWA 4IVDA 3PPKA 3DPKA 1CKIA 1JSVA 2R3LA 5ETAA 3R9DA 1ERKA 4C8BA 5AR5A 4E3CA 4D5KA 4IWQA 2Y4PA 5L2IA 3OT8A 4R5YA 2GDOA 3F3UA 4YZNA 1U59A 1ZZ2A 3ZXZA 5B2LA 1Q5KA 5EH0A 3RCJA 4O83A 2XM8A 1RE8A 5C03A 4GW8A 5HBEA 2R3HA 5DRDA 5IEXA 4JVGA 3D94A 3QQHA 4FT7A 4X7QA 5HBJA 3E88A 5JGBA 3LFQA 3OEZA 3DFAA 2XKFA 3MH0A 3BYVA 2J0JA 3QTZA 4P5QA 4RGJA 4BI0A 2OLCA 5M06A 3E3PA 3Q60A 4H39A 4QYEA 5LMKA 2VRXA 4O38A 4DEDA 4WRGA 4RPVA 1W2CA 2IWIA 3FQSA 4CMOA 4C62A 4PDSA 1OITA 4QTEA 4JBVA 2OJIA 4IAAA 4UWYA 5D41A 2C6OA 5C9CA 1URWA 3P7CA 3QHRA 2NO3A 5FP6A 4EK5A 3FY2A 3DCVA 3G0FA 4R3RA 4JJRA 4RG0A 4TNBA 4TYJA 1Q62A 2V22A 5HQ0A 2P0CA 4FA2A 5CALA 4FGRA 3I5NA 3ETAA 4C4HA 4X3FC 2GNGA 2PZRA 4YSJA 2HAKA 3Q9XA 5EYCA 4EHEA 1M14A 5LVNA 4P90A 3UQCA 2X8IA 3F5UA 1YWVA 1Q8UA 3KXMA 1JKSA 1YW2A 5EKNA 4DITA 1Q99A 5CU0A 3NDMA 4EH5A 4O0TA 4ZTHA 5TF9A 3LJ1A 3RPVA 4F4PA 2C3LA 3FBVA 2XCKA 5LVPA 3VW6A 1Q3DA 3NNXA 2GU8A 4QMZA 4FE2A 2WO6A 2VZ6A 3QTWA 3FZSA 4FNZA 4OBQA 4D55A 1BMKA 4FT0A 3FKLA 2UVXA 3QGWA 2WNTA 4GIHA 3VHKA 4F1OA 4JG6A 1OL2A 4I21A 1XBAA 3CP9A 2C69A 2YIWA 3F9NA 4NK9A 4QQCA 4RWIA 2GHMA 2YACA 5E8VA 5CI7A 3FEGA 2WMVA 3DTWA 2WOTA 1YDSE 1XKKA 2GPHA 3EQIA 4TY1A 5CSVA 3BYMA 3AT2A 3VHEA 4F9CA 3O50A 3RPOA 5IQEA 5JQ5A 1W8CA 3COHA 4LGDA 4TWNA 3DT1A 3EN9A 5AUWA 3KXGA 3U9NA 3P1AA 4A4LA 4O0RA 5A4CA 3DAJA 4FEUA 3QKLA 2WHBA 3SG9A 2C30A 4CFXA 3QQUA 2IZTA 3OBGA 5DG5A 2C5XA 4DN5A 4U79A 3LFFA 4I23A 2PMOX 3C51A 5AUUA 3SXFA 1BI7A 3PA4A 4O2ZA 2X9FA 3UG2A 3VBQA 4BCNA 4EOSA 3MA6A 1PXIA 3DB8A 4FJVA 4IM0A 3QUDA 3QRUA 2X8EA 4F09A 4HW7A 4I5MA 3UC4A 4YU2A 4XH6A 4BN1A 2JFLA 4FSRA 4LG4A 3MV5A 3R6XA 3VBXA 4AW0A 1KWPA 5J7HA 1M52A 2ITVA 2VTTA 5CY3A 5I9ZA 4UN0C 4PTGA 2XIKA 4AXDA 4MXZA 2AQXA 4R3CA 4IDTA 4RSSA 4W8DA 3FI3A 4I20A 5HG7A 3N51A 4LDTA 3R7GA 3Q6UA 1ZOEA 2XCHA 2C6DA 4GFMA 5L6OA 3CR0A 3GOPA 3RK5A 4DGNA 5HG8A 4UB7A 1S9JA 3RWQA 4FOBA 3UIUA 3MIYA 2UV2A 2NRUA 3GGFA 5CWZA 3VBWA 4JDJA 1T46A 3PJ1A 4IZ7A 1L8TA 4WT6A 1QPJA 2YLFA 4FNWA 2JGZA 4BL1A 4O7NA 3GC0A 2YDKA 4DHZA 2C6MA 2YCRA 3DGKA 4I0SA 1J7IA 2BRHA 3GU5A 3QX4A 5HLPA 4EH6A 3FI8A 3MVHA 4V01A 1Q4LA 2WQNA 4GUEA 4ZOGA 2ETRA 3DDPA 1R78A 2VX0A 3EN6A 4HYIA 3FLYA 3BHVA 4FTIA 2BFYA 4K18A 4BDKA 3NR9A 3HLLA 2I6LA 2XUUA 3PXKA 3VQUA 3PJ3A 4RJ4A 2XNBA 5IQDA 5JFSA 3OG7A 2X2KA 2GNIA 4XLIA 4BCKA 4JBOA 4O4BB 4IEBA 4NT4A 2OICA 3RKBA 5M4UA 4DLIA 2E9UA 2BAJA 4S30A 5AR8A 3BHUA 4F7JA 4Y95A 1HCKA 4E73A 4DT8A 3ANQA 2JAMA 3H0ZA 5EQYA 5KBQA 2UZEA 1KV1A 5EYKA 4JNWA 2C6IA 4E4NA 2GS6A 2YZAA 3W16A 3DJ6A 4RIYB 3T3UA 2C5YA 4IANA 4C59A 2XS0A 3CEKA 4V0GB 4WA9A 3FHRA 2EXMA 3TNWA 3UGCA 2R3MA 2VNWA 4ZK5A 2XBJA 4ZTMA 4LI5A 2PWLA 1XQZA 2X7OA 3AT3A 3NUSA 3PIYA 1XH9A 3MGYA 2G15A 4HYUA 2VWBA 4IIRA 4PTCA 3G9LX 1WZYA 4YZBA 3KVWA