2P0HA

Arhgap9 ph domain in complex with ins(1,3,4)p3
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
118
structure length
118
Chain Sequence
HEVEKSGLLNMTKIAQGGRKLRKNWGPSWVVLTGNSLVFYREPPPTAPSSGWGPAGSRPESSVDLRGAALAHGRHLSSRRNVLHIRTIPGHEFLLQSDHETELRAWHRALRTVIERLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Rho GTPase-activating protein 9
publication title Non-canonical Interaction of Phosphoinositides with Pleckstrin Homology Domains of Tiam1 and ArhGAP9.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligand binding protein
total genus 26
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2007-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2p0hA00
5J3QA 2CY4A 2M38A 3NSUA 3PVUA 4KHAA 1EF1A 4CHJA 4GMVA 5J3TA 4HAWB 1WG7A 3FEHA 5DHFB 2COFA 1U5GA 2LG1A 1WJ1A 2YF0A 1GG3A 3SUZA 3G9WA 2RSGA 5C5BB 4MK0A 3PG7A 4IAPA 3AU4A 1W1DA 3QIJA 1FAOA 2ROZB 4ZRIA 2GJYA 1H4RA 2MWNB 5FI0A 3IVFA 5KQ1A 1Y5OA 3GYPA 1XR0B 3HW2B 1ZM0A 1KZGA 1Z87A 1Y19B 1MK7B 2DLWA 2KGXB 1U29A 2DN6A 1OQNA 5EFXA 4BBKA 2Z0OA 5CLQB 1IRSA 2Y8FA 1V61A 3GYOA 4A6FB 1ZVRA 3BJIA 5LOPB 4HAYB 2QKMA 1LW3A 2DTCA 3ML4A 2MFQA 1EVHA 1MIZB 2RGNB 5HE3A 2I1JA 2V76A 1AQCA 1I2HA 2NMBA 1XCGA 2ELAA 2AL6A 2E2XA 4YL8A 1E5WA 3F5RA 3DXDA 3KRWA 2D9YA 2YRYA 3P6AA 3FSSA 4DX8A 1TJ6A 1V5PA 2DX5A 1DYNA 2D10A 1V5MA 1WI1A 2GS0A 2CY5A 2DKQA 2FJLA 4EJNA 3AJ4A 3U8ZA 1X11A 2DHIA 4PNKA 5DHAB 2EMTA 4WSFA 2EJ8A 3SNHA 1NTYA 4A6HA 4KAXB 2I1KA 2ADZA 1KI1B 2RVBB 2HTHB 1BTNA 1WGUA 1PMSA 4F7GA 2DYQA 5D3YA 4A5KA 1MK9B 4A6KA 1U27A 4YONA 2YS3A 1I7AA 4XWXA 5CLLB 1X1FA 2J59M 3A98B 4IOYX 4K17A 5D3WA 2IYBA 4TYZA 3D8EA 2DKPA 1KZ7A 4GN1A 1FHWA 4GZUA 5HE0A 3ZVRA 1K5DB 5JP4A 5FI1A 4WVFB 2D9WA 1P3RA 4H8SA 1X1GA 3UZTA 1P6SA 4D0NB 4P7IA 1XD4A 2YS5A 4Y94A 2P8VA 2UVMA 4DBBA 3TCAA 1FGYA 4A6FA 1XODA 2HE7A 2XQNM 1U5DA 3PZDA 2L1CA 3WA0A 1U5EA 4DX90 1ZC3B 2M14A 3V5WA 1DDWA 2D9XA 2YT0A 2DFKA 5DI9B 2L2IA 4IFSA 2N23A 4L6EA 2DX1A 2QKLA 1FOEA 1P5TA 3PVWA 5HE2A 3MDBC 1DDMA 4CYEA 2P0FA 1DROA 5DH9B 1U5FA 3D8FA 1V88A 1FHOA 1WGQA 2R09A 2H7DA 2LOZA 1OMWA 2YVCA 3PSCA 4KVGB 2CAYA 1XKEA 4HATB 2W2XD 2BCJA 4NSWA 4F7UP 2NZ8B 2VSZA 1RRPB 2K00A 3ULBA 4Z2MB 2D9VA 2PZ1A 2LULA 5D3XA 2J0MA 2R0DA 2EMSA 5LONB 5JHHA 2I5FA 2K2UA 3BINA 2RLOA 2D11A 4TKNA 5J3YA 3HK0A 3PP2A 2YS1A 1SGHA 2KCJA 2GCJA 3VIAA 3CXBB 4EMOA 2CODA 5HE1A 2W2WA 2H7EA 1BTKA 1FHXA 3M1IB 5D27A 4CHMA 3SV1A 2K2JA 2YT1A 5L81A 2J0JA 1UNPA 2GCLA 2P0HA 4MT7A 3ULCA 3X23A 4HAXB 2Z0QA 3DXCA 1V5UA 4HDQA 4C0AA 1EGXA 1X05A 1SHCA 4DXAB 1NU2A 3A8PA 4GXBA 1FB8A 2D9ZA 4K2PA 2ROVA 5KQ4A 1K5GB 3OANA 5GOWB 1UNRA 3AU5A 1PLSA 1FGZA 3D8DA 4HDOA 1AWEA 1BWNA 2KUPA 4HAUB 2Q13A 3ZDTA 2Z0PA 2LYDA 4EKUA 1ISNA 2COCA 2IFSA 3MPXA 2ELBA 4ZRJA 2VRWB 2X18A 4HHVA 2UZRA 2RUKB 1LB1A 4KHBB 1UEFA 1W1GA 2Y8GA 2JP2A 3TW1A 1WJMA 2DHKA 4F7HA 2ZPYA 3ODOA 5JLJB 3TVVA 2MDXA 3DXEA 3ODWA 3TO1A 1W1HA 2RNRB 2I5CA 1QC6A 4KHOA 3P7ZA 4K81A 5C6RA 1MIXA 3TFMA 2VKIA 1X86A 1RJ2A 1UPQA 1XX0A 2LKOA 1QQGA 3SYXA 2N0YA 3KSYA 4HB4B 1V89A 4GPTB 3PVLA 3WYFB 4WJ7A 2J0KA 3U7DA 2W2XC 1EAZA 2Y7BA 2D4QA 1ZSQA 3PEGA 3KY9A 1NTVA 2D2QA 3QWMA 4HB3B 4B6HA 1WVHA 4MY6A 3O96A 2AEHA 3HQCA 4NY0A 4ZRKA 3QBVB 4HB2B 1DBHA 3FM8C 3RCPA 3VOQA 1BAKA 2G35A 1MPHA 1NI2A 2DYNA 4HB0B 3KRXA 5C79A 3CIKA 2OTXA 2EC1A 3LJUX 2UZSA 3N7CA 1GC7A 2COAA 1GC6A 1MKEA 1ZC4B 2LOXA 5DIFB 1B55A 2YSZA 1OY2A 4K2OA 5D3VA 3F0WA 2CRFA 1J0WA 2MKRA 5KCVA 1MAIA 1U2BA 1UPRA 1M7EA 3T06A 2DHJA 4GMXB 1Q67A 2DA0A 1M7RA 1TQZA 3A8QA 2OQBA 5JHGA 4Z2NA 3KZ1A 4HAZB 2P0DA 1TXDA 1UNQA 3SO6A 1J19A 3ODXA 5C5BA 4PQ0A 1DDVA 1N3HA 5C16A 1H10A 1PFJA 4HAVB
chains in the Genus database with same CATH superfamily
5J3QA 2CY4A 2M38A 4QXAB 3NSUA 3PVUA 4KHAA 1EF1A 2Z14A 4GMVA 4CHJA 5J3TA 4HAWB 1WG7A 3FEHA 5DHFB 2KR0A 2COFA 1U5GA 2FJUB 2LG1A 1WJ1A 2YF0A 1GG3A 3SUZA 3G9WA 3DCXA 2RSGA 5C5BB 4MK0A 3PG7A 4IAPA 3AU4A 1W1DA 3QIJA 3HSAA 1FAOA 2ROZB 4ZRIA 3B77A 2GJYA 1H4RA 2MWNB 5FI0A 3IVFA 5KQ1A 1Y5OA 3GYPA 1XR0B 3HW2B 1ZM0A 1KZGA 1Z87A 1Y19B 1MK7B 2DLWA 2KGXB 1U29A 2DN6A 1OQNA 5EFXA 4BBKA 2Z0OA 5CLQB 1IRSA 1ZYIA 2Y8FA 1V61A 3GYOA 4A6FB 1ZVRA 3BJIA 5LOPB 4HAYB 2QKMA 1LW3A 2DTCA 3ML4A 2MFQA 1EVHA 1MIZB 2RGNB 5HE3A 2I1JA 2V76A 1AQCA 1I2HA 2NMBA 1XCGA 2ELAA 2AL6A 2E2XA 4YL8A 1E5WA 3F5RA 3DXDA 3KRWA 2D9YA 2YRYA 3P6AA 3FSSA 4DX8A 1TJ6A 1V5PA 2DX5A 1DYNA 2D10A 1V5MA 1WI1A 4QJ4B 2GS0A 4OT1A 2CY5A 3NWFA 2DKQA 2FJLA 4EJNA 3AJ4A 3U8ZA 1X11A 2DHIA 4PNKA 5DHAB 2EMTA 4WSFA 2EJ8A 3SNHA 1NTYA 4A6HA 4KAXB 4HSIA 3NWDA 2I1KA 2ADZA 3U12A 1KI1B 2RVBB 4DIXA 2YT2A 2HTHB 1BTNA 4QJ3B 1WGUA 5M4YB 1PMSA 4F7GA 2DYQA 5D3YA 4A5KA 1MK9B 4A6KA 1U27A 4YONA 2YS3A 1I7AA 4XWXA 5CLLB 1X1FA 2J59M 3A98B 3FVCA 4IOYX 4K17A 5D3WA 2IYBA 4TYZA 3D8EA 2DKPA 1KZ7A 4GN1A 1FHWA 4GZUA 5HE0A 3ZVRA 1K5DB 5JP4A 5FI1A 4WVFB 2D9WA 1P3RA 5I2SA 4H8SA 1X1GA 3HIEA 3UZTA 1P6SA 4D0NB 4P7IA 1XD4A 2YS5A 4Y94A 2P8VA 2UVMA 4DBBA 3TCAA 1FGYA 4A6FA 1XODA 2HE7A 2XQNM 1U5DA 3PZDA 2L1CA 3WA0A 1U5EA 4DX90 1ZC3B 2M14A 3V5WA 1DDWA 2D9XA 2YT0A 2DFKA 5DI9B 2L2IA 4IFSA 2N23A 4L6EA 2DX1A 2QKLA 1FOEA 1P5TA 3PVWA 5HE2A 3MDBC 1DDMA 4CYEA 2P0FA 1DROA 5DH9B 1U5FA 3D8FA 4L1RA 1V88A 1FHOA 1WGQA 2R09A 2H7DA 2LOZA 1OMWA 2YVCA 3PSCA 4KVGB 2CAYA 1XKEA 4HATB 2ZKMX 2KIGA 2W2XD 2BCJA 4NSWA 4F7UP 2GUMA 2NZ8B 2VSZA 1RRPB 2K00A 3ULBA 4Z2MB 2D9VA 2PZ1A 2LULA 5D3XA 2J0MA 2R0DA 2EMSA 5LONB 5JHHA 2I5FA 2K2UA 2Z4DA 3BINA 2RLOA 2D11A 4TKNA 3A58A 5J3YA 3HK0A 3PP2A 2YS1A 1SGHA 2KCJA 2GCJA 3VIAA 3CXBB 4EMOA 2CODA 5HE1A 2W2WA 2H7EA 1BTKA 1FHXA 3M1IB 5D27A 4CHMA 3SV1A 4GOUA 2K2JA 2YT1A 5L81A 2J0JA 1UNPA 2GCLA 2P0HA 4MT7A 3ULCA 3X23A 4HAXB 2Z0QA 3DXCA 1V5UA 4HDQA 4C0AA 1EGXA 2KIEA 1X05A 1SHCA 4DXAB 1NU2A 3A8PA 4GXBA 1FB8A 2D9ZA 4K2PA 2ROVA 5KQ4A 1K5GB 3OANA 5GOWB 1UNRA 3AU5A 1PLSA 1FGZA 3D8DA 4HDOA 4KHBA 1AWEA 1BWNA 2KUPA 4HAUB 2Q13A 3ZDTA 2Z0PA 2LYDA 4EKUA 1ISNA 2COCA 2K49A 2IFSA 3MPXA 2R2YA 2ELBA 4ZRJA 2VRWB 2X18A 4HHVA 2UZRA 2RUKB 1LB1A 4KHBB 1UEFA 1W1GA 2Y8GA 2K8EA 2JP2A 3TW1A 1WJMA 2DHKA 4F7HA 2ZPYA 3ODOA 5JLJB 3TVVA 2MDXA 3DXEA 3ODWA 3TO1A 1W1HA 4D6WA 2RNRB 2I5CA 1QC6A 4KHOA 3P7ZA 4K81A 5IRSA 5C6RA 1MIXA 3TFMA 2VKIA 1X86A 1RJ2A 1UPQA 1XX0A 2LKOA 1QQGA 3SYXA 2KUQA 2N0YA 3KSYA 4HB4B 1V89A 3OHMB 4GPTB 3PVLA 3WYFB 4WJ7A 2J0KA 3U7DA 2W2XC 1EAZA 2Y7BA 2D4QA 1ZSQA 3PEGA 3KY9A 1NTVA 2D2QA 3QWMA 4HB3B 4B6HA 1WVHA 4MY6A 3O96A 2Z13A 2AEHA 3HQCA 4NY0A 4ZRKA 4QJ5B 3QBVB 4HB2B 1DBHA 3FM8C 3RCPA 3VOQA 1BAKA 2G35A 1MPHA 1NI2A 2Z59A 2DYNA 1T77A 4HB0B 3KRXA 5C79A 3CIKA 2OTXA 2EC1A 3LJUX 2UZSA 3N7CA 1GC7A 2COAA 1GC6A 4OSNA 1MKEA 4GNKB 1ZC4B 2LOXA 4CSQA 5DIFB 1B55A 2YSZA 1OY2A 4K2OA 3NW8A 2NBVA 5D3VA 2RRFA 3F0WA 2CRFA 1J0WA 2MKRA 5KCVA 1MAIA 1U2BA 1UPRA 1M7EA 3NWAA 3T06A 2DHJA 4GMXB 1Q67A 2DA0A 1M7RA 1TQZA 3A8QA 2OQBA 5JHGA 1MI1A 4Z2NA 3KZ1A 4HAZB 2P0DA 1TXDA 1UNQA 3SO6A 1J19A 5LG4B 3ODXA 5I2MA 5C5BA 4PQ0A 1DDVA 1N3HA 5C16A 1H10A 1PFJA 4HAVB
chains in the Genus database with same CATH topology
5J3QA 2CY4A 2M38A 3NSUA 3PVUA 4KHAA 1EF1A 4CHJA 4GMVA 5J3TA 4HAWB 1WG7A 3FEHA 5DHFB 2COFA 1U5GA 2LG1A 1WJ1A 2YF0A 1GG3A 3SUZA 3G9WA 2RSGA 5C5BB 4MK0A 3PG7A 4IAPA 3AU4A 1W1DA 3QIJA 1FAOA 2ROZB 4ZRIA 2GJYA 1H4RA 2MWNB 5FI0A 3IVFA 5KQ1A 1Y5OA 3GYPA 1XR0B 3HW2B 1ZM0A 1KZGA 1Z87A 1Y19B 1MK7B 2DLWA 2KGXB 1U29A 2DN6A 1OQNA 5EFXA 4BBKA 2Z0OA 5CLQB 1IRSA 2Y8FA 1V61A 3GYOA 4A6FB 1ZVRA 3BJIA 5LOPB 4HAYB 2QKMA 1LW3A 2DTCA 3ML4A 2MFQA 1EVHA 1MIZB 2RGNB 5HE3A 2I1JA 2V76A 1AQCA 1I2HA 2NMBA 1XCGA 2ELAA 2AL6A 2E2XA 4YL8A 1E5WA 3F5RA 3DXDA 3KRWA 2D9YA 2YRYA 3P6AA 3FSSA 4DX8A 1TJ6A 1V5PA 2DX5A 1DYNA 2D10A 1V5MA 1WI1A 2GS0A 2CY5A 2DKQA 2FJLA 4EJNA 3AJ4A 3U8ZA 1X11A 2DHIA 4PNKA 5DHAB 2EMTA 4WSFA 2EJ8A 3SNHA 1NTYA 4A6HA 4KAXB 2I1KA 2ADZA 1KI1B 2RVBB 2HTHB 1BTNA 1WGUA 1PMSA 4F7GA 2DYQA 5D3YA 4A5KA 1MK9B 4A6KA 1U27A 4YONA 2YS3A 1I7AA 4XWXA 5CLLB 1X1FA 2J59M 3A98B 4IOYX 4K17A 5D3WA 2IYBA 4TYZA 3D8EA 2DKPA 1KZ7A 4GN1A 1FHWA 4GZUA 5HE0A 3ZVRA 1K5DB 5JP4A 5FI1A 4WVFB 2D9WA 1P3RA 4H8SA 1X1GA 3UZTA 1P6SA 4D0NB 4P7IA 1XD4A 2YS5A 4Y94A 2P8VA 2UVMA 4DBBA 3TCAA 1FGYA 4A6FA 1XODA 2HE7A 2XQNM 1U5DA 3PZDA 2L1CA 3WA0A 1U5EA 4DX90 1ZC3B 2M14A 3V5WA 1DDWA 2D9XA 2YT0A 2DFKA 5DI9B 2L2IA 4IFSA 2N23A 4L6EA 2DX1A 2QKLA 1FOEA 1P5TA 3PVWA 5HE2A 3MDBC 1DDMA 4CYEA 2P0FA 1DROA 5DH9B 1U5FA 3D8FA 1V88A 1FHOA 1WGQA 2R09A 2H7DA 2LOZA 1OMWA 2YVCA 3PSCA 4KVGB 2CAYA 1XKEA 4HATB 2W2XD 2BCJA 4NSWA 4F7UP 2NZ8B 2VSZA 1RRPB 2K00A 3ULBA 4Z2MB 2D9VA 2PZ1A 2LULA 5D3XA 2J0MA 2R0DA 2EMSA 5LONB 5JHHA 2I5FA 2K2UA 3BINA 2RLOA 2D11A 4TKNA 5J3YA 3HK0A 3PP2A 2YS1A 1SGHA 2KCJA 2GCJA 3VIAA 3CXBB 4EMOA 2CODA 5HE1A 2W2WA 2H7EA 1BTKA 1FHXA 3M1IB 5D27A 4CHMA 3SV1A 2K2JA 2YT1A 5L81A 2J0JA 1UNPA 2GCLA 2P0HA 4MT7A 3ULCA 3X23A 4HAXB 2Z0QA 3DXCA 1V5UA 4HDQA 4C0AA 1EGXA 1X05A 1SHCA 4DXAB 1NU2A 3A8PA 4GXBA 1FB8A 2D9ZA 4K2PA 2ROVA 5KQ4A 1K5GB 3OANA 5GOWB 1UNRA 3AU5A 1PLSA 1FGZA 3D8DA 4HDOA 1AWEA 1BWNA 2KUPA 4HAUB 2Q13A 3ZDTA 2Z0PA 2LYDA 4EKUA 1ISNA 2COCA 2IFSA 3MPXA 2ELBA 4ZRJA 2VRWB 2X18A 4HHVA 2UZRA 2RUKB 1LB1A 4KHBB 1UEFA 1W1GA 2Y8GA 2JP2A 3TW1A 1WJMA 2DHKA 4F7HA 2ZPYA 3ODOA 5JLJB 3TVVA 2MDXA 3DXEA 3ODWA 3TO1A 1W1HA 2RNRB 2I5CA 1QC6A 4KHOA 3P7ZA 4K81A 5C6RA 1MIXA 3TFMA 2VKIA 1X86A 1RJ2A 1UPQA 1XX0A 2LKOA 1QQGA 3SYXA 2N0YA 3KSYA 4HB4B 1V89A 4GPTB 3PVLA 3WYFB 4WJ7A 2J0KA 3U7DA 2W2XC 1EAZA 2Y7BA 2D4QA 1ZSQA 3PEGA 3KY9A 1NTVA 2D2QA 3QWMA 4HB3B 4B6HA 1WVHA 4MY6A 3O96A 2AEHA 3HQCA 4NY0A 4ZRKA 3QBVB 4HB2B 1DBHA 3FM8C 3RCPA 3VOQA 1BAKA 2G35A 1MPHA 1NI2A 2DYNA 4HB0B 3KRXA 5C79A 3CIKA 2OTXA 2EC1A 3LJUX 2UZSA 3N7CA 1GC7A 2COAA 1GC6A 1MKEA 1ZC4B 2LOXA 5DIFB 1B55A 2YSZA 1OY2A 4K2OA 5D3VA 3F0WA 2CRFA 1J0WA 2MKRA 5KCVA 1MAIA 1U2BA 1UPRA 1M7EA 3T06A 2DHJA 4GMXB 1Q67A 2DA0A 1M7RA 1TQZA 3A8QA 2OQBA 5JHGA 4Z2NA 3KZ1A 4HAZB 2P0DA 1TXDA 1UNQA 3SO6A 1J19A 3ODXA 5C5BA 4PQ0A 1DDVA 1N3HA 5C16A 1H10A 1PFJA 4HAVB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5J3Q A;  2CY4 A;  2M38 A;  3NSU A;  3PVU A;  4KHA A;  1EF1 A;  4CHJ A;  4GMV A;  5J3T A;  4HAW B;  1WG7 A;  3FEH A;  5DHF B;  2COF A;  1U5G A;  2LG1 A;  1WJ1 A;  2YF0 A;  1GG3 A;  3SUZ A;  3G9W A;  2RSG A;  5C5B B;  4MK0 A;  3PG7 A;  4IAP A;  3AU4 A;  1W1D A;  3QIJ A;  1FAO A;  2ROZ B;  4ZRI A;  2GJY A;  1H4R A;  2MWN B;  5FI0 A;  3IVF A;  5KQ1 A;  1Y5O A;  3GYP A;  1XR0 B;  3HW2 B;  1ZM0 A;  1KZG A;  1Z87 A;  1Y19 B;  1MK7 B;  2DLW A;  2KGX B;  1U29 A;  2DN6 A;  1OQN A;  5EFX A;  4BBK A;  2Z0O A;  5CLQ B;  1IRS A;  2Y8F A;  1V61 A;  3GYO A;  4A6F B;  1ZVR A;  3BJI A;  5LOP B;  4HAY B;  2QKM A;  1LW3 A;  2DTC A;  3ML4 A;  2MFQ A;  1EVH A;  1MIZ B;  2RGN B;  5HE3 A;  2I1J A;  2V76 A;  1AQC A;  1I2H A;  2NMB A;  1XCG A;  2ELA A;  2AL6 A;  2E2X A;  4YL8 A;  1E5W A;  3F5R A;  3DXD A;  3KRW A;  2D9Y A;  2YRY A;  3P6A A;  3FSS A;  4DX8 A;  1TJ6 A;  1V5P A;  2DX5 A;  1DYN A;  2D10 A;  1V5M A;  1WI1 A;  2GS0 A;  2CY5 A;  2DKQ A;  2FJL A;  4EJN A;  3AJ4 A;  3U8Z A;  1X11 A;  2DHI A;  4PNK A;  5DHA B;  2EMT A;  4WSF A;  2EJ8 A;  3SNH A;  1NTY A;  4A6H A;  4KAX B;  2I1K A;  2ADZ A;  1KI1 B;  2RVB B;  2HTH B;  1BTN A;  1WGU A;  1PMS A;  4F7G A;  2DYQ A;  5D3Y A;  4A5K A;  1MK9 B;  4A6K A;  1U27 A;  4YON A;  2YS3 A;  1I7A A;  4XWX A;  5CLL B;  1X1F A;  2J59 M;  3A98 B;  4IOY X;  4K17 A;  5D3W A;  2IYB A;  4TYZ A;  3D8E A;  2DKP A;  1KZ7 A;  4GN1 A;  1FHW A;  4GZU A;  5HE0 A;  3ZVR A;  1K5D B;  5JP4 A;  5FI1 A;  4WVF B;  2D9W A;  1P3R A;  4H8S A;  1X1G A;  3UZT A;  1P6S A;  4D0N B;  4P7I A;  1XD4 A;  2YS5 A;  4Y94 A;  2P8V A;  2UVM A;  4DBB A;  3TCA A;  1FGY A;  4A6F A;  1XOD A;  2HE7 A;  2XQN M;  1U5D A;  3PZD A;  2L1C A;  3WA0 A;  1U5E A;  4DX9 0;  1ZC3 B;  2M14 A;  3V5W A;  1DDW A;  2D9X A;  2YT0 A;  2DFK A;  5DI9 B;  2L2I A;  4IFS A;  2N23 A;  4L6E A;  2DX1 A;  2QKL A;  1FOE A;  1P5T A;  3PVW A;  5HE2 A;  3MDB C;  1DDM A;  4CYE A;  2P0F A;  1DRO A;  5DH9 B;  1U5F A;  3D8F A;  1V88 A;  1FHO A;  1WGQ A;  2R09 A;  2H7D A;  2LOZ A;  1OMW A;  2YVC A;  3PSC A;  4KVG B;  2CAY A;  1XKE A;  4HAT B;  2W2X D;  2BCJ A;  4NSW A;  4F7U P;  2NZ8 B;  2VSZ A;  1RRP B;  2K00 A;  3ULB A;  4Z2M B;  2D9V A;  2PZ1 A;  2LUL A;  5D3X A;  2J0M A;  2R0D A;  2EMS A;  5LON B;  5JHH A;  2I5F A;  2K2U A;  3BIN A;  2RLO A;  2D11 A;  4TKN A;  5J3Y A;  3HK0 A;  3PP2 A;  2YS1 A;  1SGH A;  2KCJ A;  2GCJ A;  3VIA A;  3CXB B;  4EMO A;  2COD A;  5HE1 A;  2W2W A;  2H7E A;  1BTK A;  1FHX A;  3M1I B;  5D27 A;  4CHM A;  3SV1 A;  2K2J A;  2YT1 A;  5L81 A;  2J0J A;  1UNP A;  2GCL A;  2P0H A;  4MT7 A;  3ULC A;  3X23 A;  4HAX B;  2Z0Q A;  3DXC A;  1V5U A;  4HDQ A;  4C0A A;  1EGX A;  1X05 A;  1SHC A;  4DXA B;  1NU2 A;  3A8P A;  4GXB A;  1FB8 A;  2D9Z A;  4K2P A;  2ROV A;  5KQ4 A;  1K5G B;  3OAN A;  5GOW B;  1UNR A;  3AU5 A;  1PLS A;  1FGZ A;  3D8D A;  4HDO A;  1AWE A;  1BWN A;  2KUP A;  4HAU B;  2Q13 A;  3ZDT A;  2Z0P A;  2LYD A;  4EKU A;  1ISN A;  2COC A;  2IFS A;  3MPX A;  2ELB A;  4ZRJ A;  2VRW B;  2X18 A;  4HHV A;  2UZR A;  2RUK B;  1LB1 A;  4KHB B;  1UEF A;  1W1G A;  2Y8G A;  2JP2 A;  3TW1 A;  1WJM A;  2DHK A;  4F7H A;  2ZPY A;  3ODO A;  5JLJ B;  3TVV A;  2MDX A;  3DXE A;  3ODW A;  3TO1 A;  1W1H A;  2RNR B;  2I5C A;  1QC6 A;  4KHO A;  3P7Z A;  4K81 A;  5C6R A;  1MIX A;  3TFM A;  2VKI A;  1X86 A;  1RJ2 A;  1UPQ A;  1XX0 A;  2LKO A;  1QQG A;  3SYX A;  2N0Y A;  3KSY A;  4HB4 B;  1V89 A;  4GPT B;  3PVL A;  3WYF B;  4WJ7 A;  2J0K A;  3U7D A;  2W2X C;  1EAZ A;  2Y7B A;  2D4Q A;  1ZSQ A;  3PEG A;  3KY9 A;  1NTV A;  2D2Q A;  3QWM A;  4HB3 B;  4B6H A;  1WVH A;  4MY6 A;  3O96 A;  2AEH A;  3HQC A;  4NY0 A;  4ZRK A;  3QBV B;  4HB2 B;  1DBH A;  3FM8 C;  3RCP A;  3VOQ A;  1BAK A;  2G35 A;  1MPH A;  1NI2 A;  2DYN A;  4HB0 B;  3KRX A;  5C79 A;  3CIK A;  2OTX A;  2EC1 A;  3LJU X;  2UZS A;  3N7C A;  1GC7 A;  2COA A;  1GC6 A;  1MKE A;  1ZC4 B;  2LOX A;  5DIF B;  1B55 A;  2YSZ A;  1OY2 A;  4K2O A;  5D3V A;  3F0W A;  2CRF A;  1J0W A;  2MKR A;  5KCV A;  1MAI A;  1U2B A;  1UPR A;  1M7E A;  3T06 A;  2DHJ A;  4GMX B;  1Q67 A;  2DA0 A;  1M7R A;  1TQZ A;  3A8Q A;  2OQB A;  5JHG A;  4Z2N A;  3KZ1 A;  4HAZ B;  2P0D A;  1TXD A;  1UNQ A;  3SO6 A;  1J19 A;  3ODX A;  5C5B A;  4PQ0 A;  1DDV A;  1N3H A;  5C16 A;  1H10 A;  1PFJ A;  4HAV B; 
#chains in the Genus database with same CATH topology
 5J3Q A;  2CY4 A;  2M38 A;  4QXA B;  3NSU A;  3PVU A;  4KHA A;  1EF1 A;  2Z14 A;  4GMV A;  4CHJ A;  5J3T A;  4HAW B;  1WG7 A;  3FEH A;  5DHF B;  2KR0 A;  2COF A;  1U5G A;  2FJU B;  2LG1 A;  1WJ1 A;  2YF0 A;  1GG3 A;  3SUZ A;  3G9W A;  3DCX A;  2RSG A;  5C5B B;  4MK0 A;  3PG7 A;  4IAP A;  3AU4 A;  1W1D A;  3QIJ A;  3HSA A;  1FAO A;  2ROZ B;  4ZRI A;  3B77 A;  2GJY A;  1H4R A;  2MWN B;  5FI0 A;  3IVF A;  5KQ1 A;  1Y5O A;  3GYP A;  1XR0 B;  3HW2 B;  1ZM0 A;  1KZG A;  1Z87 A;  1Y19 B;  1MK7 B;  2DLW A;  2KGX B;  1U29 A;  2DN6 A;  1OQN A;  5EFX A;  4BBK A;  2Z0O A;  5CLQ B;  1IRS A;  1ZYI A;  2Y8F A;  1V61 A;  3GYO A;  4A6F B;  1ZVR A;  3BJI A;  5LOP B;  4HAY B;  2QKM A;  1LW3 A;  2DTC A;  3ML4 A;  2MFQ A;  1EVH A;  1MIZ B;  2RGN B;  5HE3 A;  2I1J A;  2V76 A;  1AQC A;  1I2H A;  2NMB A;  1XCG A;  2ELA A;  2AL6 A;  2E2X A;  4YL8 A;  1E5W A;  3F5R A;  3DXD A;  3KRW A;  2D9Y A;  2YRY A;  3P6A A;  3FSS A;  4DX8 A;  1TJ6 A;  1V5P A;  2DX5 A;  1DYN A;  2D10 A;  1V5M A;  1WI1 A;  4QJ4 B;  2GS0 A;  4OT1 A;  2CY5 A;  3NWF A;  2DKQ A;  2FJL A;  4EJN A;  3AJ4 A;  3U8Z A;  1X11 A;  2DHI A;  4PNK A;  5DHA B;  2EMT A;  4WSF A;  2EJ8 A;  3SNH A;  1NTY A;  4A6H A;  4KAX B;  4HSI A;  3NWD A;  2I1K A;  2ADZ A;  3U12 A;  1KI1 B;  2RVB B;  4DIX A;  2YT2 A;  2HTH B;  1BTN A;  4QJ3 B;  1WGU A;  5M4Y B;  1PMS A;  4F7G A;  2DYQ A;  5D3Y A;  4A5K A;  1MK9 B;  4A6K A;  1U27 A;  4YON A;  2YS3 A;  1I7A A;  4XWX A;  5CLL B;  1X1F A;  2J59 M;  3A98 B;  3FVC A;  4IOY X;  4K17 A;  5D3W A;  2IYB A;  4TYZ A;  3D8E A;  2DKP A;  1KZ7 A;  4GN1 A;  1FHW A;  4GZU A;  5HE0 A;  3ZVR A;  1K5D B;  5JP4 A;  5FI1 A;  4WVF B;  2D9W A;  1P3R A;  5I2S A;  4H8S A;  1X1G A;  3HIE A;  3UZT A;  1P6S A;  4D0N B;  4P7I A;  1XD4 A;  2YS5 A;  4Y94 A;  2P8V A;  2UVM A;  4DBB A;  3TCA A;  1FGY A;  4A6F A;  1XOD A;  2HE7 A;  2XQN M;  1U5D A;  3PZD A;  2L1C A;  3WA0 A;  1U5E A;  4DX9 0;  1ZC3 B;  2M14 A;  3V5W A;  1DDW A;  2D9X A;  2YT0 A;  2DFK A;  5DI9 B;  2L2I A;  4IFS A;  2N23 A;  4L6E A;  2DX1 A;  2QKL A;  1FOE A;  1P5T A;  3PVW A;  5HE2 A;  3MDB C;  1DDM A;  4CYE A;  2P0F A;  1DRO A;  5DH9 B;  1U5F A;  3D8F A;  4L1R A;  1V88 A;  1FHO A;  1WGQ A;  2R09 A;  2H7D A;  2LOZ A;  1OMW A;  2YVC A;  3PSC A;  4KVG B;  2CAY A;  1XKE A;  4HAT B;  2ZKM X;  2KIG A;  2W2X D;  2BCJ A;  4NSW A;  4F7U P;  2GUM A;  2NZ8 B;  2VSZ A;  1RRP B;  2K00 A;  3ULB A;  4Z2M B;  2D9V A;  2PZ1 A;  2LUL A;  5D3X A;  2J0M A;  2R0D A;  2EMS A;  5LON B;  5JHH A;  2I5F A;  2K2U A;  2Z4D A;  3BIN A;  2RLO A;  2D11 A;  4TKN A;  3A58 A;  5J3Y A;  3HK0 A;  3PP2 A;  2YS1 A;  1SGH A;  2KCJ A;  2GCJ A;  3VIA A;  3CXB B;  4EMO A;  2COD A;  5HE1 A;  2W2W A;  2H7E A;  1BTK A;  1FHX A;  3M1I B;  5D27 A;  4CHM A;  3SV1 A;  4GOU A;  2K2J A;  2YT1 A;  5L81 A;  2J0J A;  1UNP A;  2GCL A;  2P0H A;  4MT7 A;  3ULC A;  3X23 A;  4HAX B;  2Z0Q A;  3DXC A;  1V5U A;  4HDQ A;  4C0A A;  1EGX A;  2KIE A;  1X05 A;  1SHC A;  4DXA B;  1NU2 A;  3A8P A;  4GXB A;  1FB8 A;  2D9Z A;  4K2P A;  2ROV A;  5KQ4 A;  1K5G B;  3OAN A;  5GOW B;  1UNR A;  3AU5 A;  1PLS A;  1FGZ A;  3D8D A;  4HDO A;  4KHB A;  1AWE A;  1BWN A;  2KUP A;  4HAU B;  2Q13 A;  3ZDT A;  2Z0P A;  2LYD A;  4EKU A;  1ISN A;  2COC A;  2K49 A;  2IFS A;  3MPX A;  2R2Y A;  2ELB A;  4ZRJ A;  2VRW B;  2X18 A;  4HHV A;  2UZR A;  2RUK B;  1LB1 A;  4KHB B;  1UEF A;  1W1G A;  2Y8G A;  2K8E A;  2JP2 A;  3TW1 A;  1WJM A;  2DHK A;  4F7H A;  2ZPY A;  3ODO A;  5JLJ B;  3TVV A;  2MDX A;  3DXE A;  3ODW A;  3TO1 A;  1W1H A;  4D6W A;  2RNR B;  2I5C A;  1QC6 A;  4KHO A;  3P7Z A;  4K81 A;  5IRS A;  5C6R A;  1MIX A;  3TFM A;  2VKI A;  1X86 A;  1RJ2 A;  1UPQ A;  1XX0 A;  2LKO A;  1QQG A;  3SYX A;  2KUQ A;  2N0Y A;  3KSY A;  4HB4 B;  1V89 A;  3OHM B;  4GPT B;  3PVL A;  3WYF B;  4WJ7 A;  2J0K A;  3U7D A;  2W2X C;  1EAZ A;  2Y7B A;  2D4Q A;  1ZSQ A;  3PEG A;  3KY9 A;  1NTV A;  2D2Q A;  3QWM A;  4HB3 B;  4B6H A;  1WVH A;  4MY6 A;  3O96 A;  2Z13 A;  2AEH A;  3HQC A;  4NY0 A;  4ZRK A;  4QJ5 B;  3QBV B;  4HB2 B;  1DBH A;  3FM8 C;  3RCP A;  3VOQ A;  1BAK A;  2G35 A;  1MPH A;  1NI2 A;  2Z59 A;  2DYN A;  1T77 A;  4HB0 B;  3KRX A;  5C79 A;  3CIK A;  2OTX A;  2EC1 A;  3LJU X;  2UZS A;  3N7C A;  1GC7 A;  2COA A;  1GC6 A;  4OSN A;  1MKE A;  4GNK B;  1ZC4 B;  2LOX A;  4CSQ A;  5DIF B;  1B55 A;  2YSZ A;  1OY2 A;  4K2O A;  3NW8 A;  2NBV A;  5D3V A;  2RRF A;  3F0W A;  2CRF A;  1J0W A;  2MKR A;  5KCV A;  1MAI A;  1U2B A;  1UPR A;  1M7E A;  3NWA A;  3T06 A;  2DHJ A;  4GMX B;  1Q67 A;  2DA0 A;  1M7R A;  1TQZ A;  3A8Q A;  2OQB A;  5JHG A;  1MI1 A;  4Z2N A;  3KZ1 A;  4HAZ B;  2P0D A;  1TXD A;  1UNQ A;  3SO6 A;  1J19 A;  5LG4 B;  3ODX A;  5I2M A;  5C5B A;  4PQ0 A;  1DDV A;  1N3H A;  5C16 A;  1H10 A;  1PFJ A;  4HAV B; 
#chains in the Genus database with same CATH homology
 5J3Q A;  2CY4 A;  2M38 A;  3NSU A;  3PVU A;  4KHA A;  1EF1 A;  4CHJ A;  4GMV A;  5J3T A;  4HAW B;  1WG7 A;  3FEH A;  5DHF B;  2COF A;  1U5G A;  2LG1 A;  1WJ1 A;  2YF0 A;  1GG3 A;  3SUZ A;  3G9W A;  2RSG A;  5C5B B;  4MK0 A;  3PG7 A;  4IAP A;  3AU4 A;  1W1D A;  3QIJ A;  1FAO A;  2ROZ B;  4ZRI A;  2GJY A;  1H4R A;  2MWN B;  5FI0 A;  3IVF A;  5KQ1 A;  1Y5O A;  3GYP A;  1XR0 B;  3HW2 B;  1ZM0 A;  1KZG A;  1Z87 A;  1Y19 B;  1MK7 B;  2DLW A;  2KGX B;  1U29 A;  2DN6 A;  1OQN A;  5EFX A;  4BBK A;  2Z0O A;  5CLQ B;  1IRS A;  2Y8F A;  1V61 A;  3GYO A;  4A6F B;  1ZVR A;  3BJI A;  5LOP B;  4HAY B;  2QKM A;  1LW3 A;  2DTC A;  3ML4 A;  2MFQ A;  1EVH A;  1MIZ B;  2RGN B;  5HE3 A;  2I1J A;  2V76 A;  1AQC A;  1I2H A;  2NMB A;  1XCG A;  2ELA A;  2AL6 A;  2E2X A;  4YL8 A;  1E5W A;  3F5R A;  3DXD A;  3KRW A;  2D9Y A;  2YRY A;  3P6A A;  3FSS A;  4DX8 A;  1TJ6 A;  1V5P A;  2DX5 A;  1DYN A;  2D10 A;  1V5M A;  1WI1 A;  2GS0 A;  2CY5 A;  2DKQ A;  2FJL A;  4EJN A;  3AJ4 A;  3U8Z A;  1X11 A;  2DHI A;  4PNK A;  5DHA B;  2EMT A;  4WSF A;  2EJ8 A;  3SNH A;  1NTY A;  4A6H A;  4KAX B;  2I1K A;  2ADZ A;  1KI1 B;  2RVB B;  2HTH B;  1BTN A;  1WGU A;  1PMS A;  4F7G A;  2DYQ A;  5D3Y A;  4A5K A;  1MK9 B;  4A6K A;  1U27 A;  4YON A;  2YS3 A;  1I7A A;  4XWX A;  5CLL B;  1X1F A;  2J59 M;  3A98 B;  4IOY X;  4K17 A;  5D3W A;  2IYB A;  4TYZ A;  3D8E A;  2DKP A;  1KZ7 A;  4GN1 A;  1FHW A;  4GZU A;  5HE0 A;  3ZVR A;  1K5D B;  5JP4 A;  5FI1 A;  4WVF B;  2D9W A;  1P3R A;  4H8S A;  1X1G A;  3UZT A;  1P6S A;  4D0N B;  4P7I A;  1XD4 A;  2YS5 A;  4Y94 A;  2P8V A;  2UVM A;  4DBB A;  3TCA A;  1FGY A;  4A6F A;  1XOD A;  2HE7 A;  2XQN M;  1U5D A;  3PZD A;  2L1C A;  3WA0 A;  1U5E A;  4DX9 0;  1ZC3 B;  2M14 A;  3V5W A;  1DDW A;  2D9X A;  2YT0 A;  2DFK A;  5DI9 B;  2L2I A;  4IFS A;  2N23 A;  4L6E A;  2DX1 A;  2QKL A;  1FOE A;  1P5T A;  3PVW A;  5HE2 A;  3MDB C;  1DDM A;  4CYE A;  2P0F A;  1DRO A;  5DH9 B;  1U5F A;  3D8F A;  1V88 A;  1FHO A;  1WGQ A;  2R09 A;  2H7D A;  2LOZ A;  1OMW A;  2YVC A;  3PSC A;  4KVG B;  2CAY A;  1XKE A;  4HAT B;  2W2X D;  2BCJ A;  4NSW A;  4F7U P;  2NZ8 B;  2VSZ A;  1RRP B;  2K00 A;  3ULB A;  4Z2M B;  2D9V A;  2PZ1 A;  2LUL A;  5D3X A;  2J0M A;  2R0D A;  2EMS A;  5LON B;  5JHH A;  2I5F A;  2K2U A;  3BIN A;  2RLO A;  2D11 A;  4TKN A;  5J3Y A;  3HK0 A;  3PP2 A;  2YS1 A;  1SGH A;  2KCJ A;  2GCJ A;  3VIA A;  3CXB B;  4EMO A;  2COD A;  5HE1 A;  2W2W A;  2H7E A;  1BTK A;  1FHX A;  3M1I B;  5D27 A;  4CHM A;  3SV1 A;  2K2J A;  2YT1 A;  5L81 A;  2J0J A;  1UNP A;  2GCL A;  2P0H A;  4MT7 A;  3ULC A;  3X23 A;  4HAX B;  2Z0Q A;  3DXC A;  1V5U A;  4HDQ A;  4C0A A;  1EGX A;  1X05 A;  1SHC A;  4DXA B;  1NU2 A;  3A8P A;  4GXB A;  1FB8 A;  2D9Z A;  4K2P A;  2ROV A;  5KQ4 A;  1K5G B;  3OAN A;  5GOW B;  1UNR A;  3AU5 A;  1PLS A;  1FGZ A;  3D8D A;  4HDO A;  1AWE A;  1BWN A;  2KUP A;  4HAU B;  2Q13 A;  3ZDT A;  2Z0P A;  2LYD A;  4EKU A;  1ISN A;  2COC A;  2IFS A;  3MPX A;  2ELB A;  4ZRJ A;  2VRW B;  2X18 A;  4HHV A;  2UZR A;  2RUK B;  1LB1 A;  4KHB B;  1UEF A;  1W1G A;  2Y8G A;  2JP2 A;  3TW1 A;  1WJM A;  2DHK A;  4F7H A;  2ZPY A;  3ODO A;  5JLJ B;  3TVV A;  2MDX A;  3DXE A;  3ODW A;  3TO1 A;  1W1H A;  2RNR B;  2I5C A;  1QC6 A;  4KHO A;  3P7Z A;  4K81 A;  5C6R A;  1MIX A;  3TFM A;  2VKI A;  1X86 A;  1RJ2 A;  1UPQ A;  1XX0 A;  2LKO A;  1QQG A;  3SYX A;  2N0Y A;  3KSY A;  4HB4 B;  1V89 A;  4GPT B;  3PVL A;  3WYF B;  4WJ7 A;  2J0K A;  3U7D A;  2W2X C;  1EAZ A;  2Y7B A;  2D4Q A;  1ZSQ A;  3PEG A;  3KY9 A;  1NTV A;  2D2Q A;  3QWM A;  4HB3 B;  4B6H A;  1WVH A;  4MY6 A;  3O96 A;  2AEH A;  3HQC A;  4NY0 A;  4ZRK A;  3QBV B;  4HB2 B;  1DBH A;  3FM8 C;  3RCP A;  3VOQ A;  1BAK A;  2G35 A;  1MPH A;  1NI2 A;  2DYN A;  4HB0 B;  3KRX A;  5C79 A;  3CIK A;  2OTX A;  2EC1 A;  3LJU X;  2UZS A;  3N7C A;  1GC7 A;  2COA A;  1GC6 A;  1MKE A;  1ZC4 B;  2LOX A;  5DIF B;  1B55 A;  2YSZ A;  1OY2 A;  4K2O A;  5D3V A;  3F0W A;  2CRF A;  1J0W A;  2MKR A;  5KCV A;  1MAI A;  1U2B A;  1UPR A;  1M7E A;  3T06 A;  2DHJ A;  4GMX B;  1Q67 A;  2DA0 A;  1M7R A;  1TQZ A;  3A8Q A;  2OQB A;  5JHG A;  4Z2N A;  3KZ1 A;  4HAZ B;  2P0D A;  1TXD A;  1UNQ A;  3SO6 A;  1J19 A;  3ODX A;  5C5B A;  4PQ0 A;  1DDV A;  1N3H A;  5C16 A;  1H10 A;  1PFJ A;  4HAV B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...