2P0HA

Arhgap9 ph domain in complex with ins(1,3,4)p3
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
118
structure length
118
Chain Sequence
HEVEKSGLLNMTKIAQGGRKLRKNWGPSWVVLTGNSLVFYREPPPTAPSSGWGPAGSRPESSVDLRGAALAHGRHLSSRRNVLHIRTIPGHEFLLQSDHETELRAWHRALRTVIERLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Non-canonical Interaction of Phosphoinositides with Pleckstrin Homology Domains of Tiam1 and ArhGAP9.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligand binding protein
molecule keywords Rho GTPase-activating protein 9
total genus 26
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2007-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2p0hA00
4HATB 1EF1A 1PFJA 2Z0QA 4BBKA 1MIZB 5LONB 1P5TA 1KZGA 5D3WA 5HE2A 3TFMA 2E2XA 1I7AA 1WGUA 4KHAA 1FAOA 1DDVA 4ZRIA 4A5KA 4HB0B 1K5GB 4IOYX 3PSCA 2P0FA 3FSSA 4F7GA 2FJLA 1X86A 2EMTA 2UVMA 1QQGA 3N7CA 3D8EA 4HHVA 1E5WA 1BTNA 1X1GA 2MWNB 4CHJA 2QKMA 1OMWA 1NTVA 1WVHA 2RUKB 2RVBB 2YRYA 5J3TA 1WGQA 1KZ7A 2DHJA 3AU5A 4P7IA 1V5MA 1U5FA 2LOZA 4GZUA 3UZTA 2LULA 1M7EA 4K17A 3PVUA 2ELAA 4KVGB 4HAWB 3HK0A 1UNPA 4KHBB 3QWMA 1V89A 5FI0A 3DXDA 1AWEA 4L6EA 2LYDA 5HE0A 3ODXA 2X18A 3DXCA 5JHHA 4TYZA 1TXDA 1DDWA 4YONA 3V5WA 2J0MA 2ZPYA 2COCA 2I1JA 1ZC3B 3X23A 1P6SA 2LOXA 2Y7BA 4GMVA 3O96A 2ELBA 3U8ZA 1TQZA 1DBHA 3KY9A 2AEHA 3G9WA 2CY5A 4A6KA 2YVCA 1U2BA 5DHFB 1FB8A 4YL8A 2I5CA 2P0DA 3PVLA 3PVWA 2HE7A 3FEHA 2MKRA 5DI9B 2D10A 5KQ4A 5KQ1A 2D2QA 4Y94A 1OY2A 1GC7A 1U29A 5D3VA 2DFKA 2PZ1A 1J0WA 3CXBB 4H8SA 5CLLB 3KRXA 5C5BB 1ZC4B 4WJ7A 4K2PA 1MAIA 4PNKA 5L81A 1V5PA 2H7DA 4Z2MB 2EC1A 3DXEA 1Y5OA 2LG1A 1P3RA 1SGHA 2ROVA 5JLJB 5DIFB 3BJIA 2GJYA 2RGNB 3VOQA 2GCLA 1SHCA 1FOEA 3IVFA 1BTKA 1PMSA 2Z0PA 2COFA 2EJ8A 2W2XC 2RNRB 2DHKA 1ZM0A 3MDBC 1GG3A 1UEFA 4ZRJA 5D3XA 3KSYA 2XQNM 4NY0A 2YT0A 3ML4A 3MPXA 2DHIA 3VIAA 3SYXA 4Z2NA 4HAXB 4DX90 5EFXA 2K00A 3QBVB 3F0WA 1BWNA 3TVVA 1W1GA 3SNHA 4A6FA 2Q13A 2GCJA 1BAKA 2RSGA 1LW3A 3KZ1A 2BCJA 4F7HA 2R09A 1W1HA 2KGXB 2ROZB 5KCVA 1X11A 4CYEA 3WYFB 1NI2A 2M14A 2W2XD 5FI1A 1Y19B 2P8VA 2RLOA 2OTXA 3P6AA 1UPRA 2V76A 2J59M 5HE1A 4A6FB 1FGZA 4WSFA 2IFSA 1U5DA 5J3QA 4A6HA 1FGYA 1XD4A 3ZDTA 1XX0A 1QC6A 1UNQA 2DKQA 1I2HA 4HAVB 3A98B 3A8QA 4KAXB 3GYPA 2COAA 5DHAB 4DXAB 3P7ZA 5D3YA 1FHOA 2CAYA 1TJ6A 2MFQA 5C6RA 1X05A 1X1FA 1DROA 1XODA 2H7EA 5J3YA 1U5GA 2YS1A 4HAZB 1MIXA 1WJMA 3FM8C 3SV1A 3PZDA 1RJ2A 2DX1A 3ODOA 2L1CA 3T06A 2ADZA 4TKNA 2GS0A 2NZ8B 2N23A 1H10A 1U27A 1PLSA 5C79A 4GN1A 4GXBA 2D9WA 1ZVRA 3A8PA 4D0NB 2J0JA 2Y8GA 4WVFB 1DYNA 1WJ1A 2N0YA 2UZSA 5GOWB 2LKOA 2Y8FA 2VSZA 1EVHA 2DKPA 4DBBA 1V5UA 4HDQA 2M38A 4PQ0A 3HQCA 3U7DA 3OANA 3AU4A 1MK9B 2K2UA 1V88A 2UZRA 1XKEA 3ULBA 3SO6A 3PG7A 4EMOA 2J0KA 2L2IA 2YS5A 2G35A 1NTYA 1OQNA 2CY4A 2I5FA 3CIKA 4EJNA 4XWXA 5DH9B 3TCAA 2DYQA 4CHMA 1MPHA 1N3HA 3TO1A 3ODWA 3KRWA 1WI1A 4F7UP 3F5RA 3LJUX 5HE3A 1UPQA 1WG7A 2DX5A 3NSUA 2YT1A 3ULCA 4MT7A 1GC6A 1U5EA 4IAPA 1KI1B 2QKLA 4DX8A 1DDMA 1UNRA 1J19A 3ZVRA 3WA0A 2OQBA 1W1DA 4HB2B 3SUZA 4B6HA 2DN6A 5CLQB 3M1IB 2NMBA 3AJ4A 3RCPA 4IFSA 2D9XA 1EGXA 2DLWA 4C0AA 4HB3B 2D9YA 2YS3A 2DYNA 1M7RA 2JP2A 1IRSA 3BINA 4HB4B 2D11A 1FHXA 2DTCA 2R0DA 5JP4A 2CRFA 3D8FA 2IYBA 1AQCA 2D4QA 5C5BA 2D9VA 4KHOA 4K81A 1MKEA 1ZSQA 2CODA 1H4RA 2DA0A 2VKIA 2KCJA 2I1KA 2P0HA 4NSWA 3QIJA 1V61A 1NU2A 2W2WA 4GPTB 5JHGA 4HAYB 1K5DB 1LB1A 2HTHB 4EKUA 1EAZA 1XCGA 2K2JA 5D27A 2VRWB 1MK7B 3PP2A 4HDOA 4GMXB 3TW1A 1Z87A 5C16A 2AL6A 4HAUB 1ISNA 2YF0A 4ZRKA 2MDXA 5LOPB 3PEGA 2YSZA 1FHWA 1XR0B 2D9ZA 3GYOA 3D8DA 3HW2B 4K2OA 4MK0A 2EMSA 2KUPA 1RRPB 2Z0OA 1Q67A 1B55A 4MY6A
chains in the Genus database with same CATH superfamily
4HATB 1EF1A 1PFJA 2Z0QA 4BBKA 1MIZB 5LONB 1P5TA 1KZGA 5D3WA 5HE2A 3TFMA 2E2XA 1I7AA 1WGUA 4KHAA 1FAOA 1DDVA 2RRFA 4ZRIA 4A5KA 4HB0B 1K5GB 4IOYX 4QJ4B 3PSCA 2P0FA 4D6WA 3FSSA 4F7GA 2FJLA 1X86A 2EMTA 2UVMA 2KIEA 1QQGA 3N7CA 3D8EA 4HHVA 1E5WA 3NWDA 1BTNA 1X1GA 2MWNB 4CHJA 3U12A 2QKMA 1OMWA 1NTVA 1WVHA 2RUKB 2RVBB 2YRYA 5J3TA 2YT2A 1WGQA 1KZ7A 2DHJA 3AU5A 4P7IA 1V5MA 1U5FA 2LOZA 4GZUA 3UZTA 3B77A 2LULA 1M7EA 4K17A 3PVUA 4QJ5B 2ELAA 4KVGB 4HAWB 3HK0A 1UNPA 4KHBB 3QWMA 4GOUA 1V89A 5FI0A 3DXDA 1AWEA 4L6EA 2LYDA 5HE0A 3ODXA 2X18A 2FJUB 3DXCA 5JHHA 4TYZA 1TXDA 1DDWA 4HSIA 4YONA 3V5WA 2J0MA 2ZPYA 2COCA 4GNKB 2I1JA 1ZC3B 3X23A 1P6SA 2LOXA 2Y7BA 4GMVA 3O96A 2ELBA 3NW8A 3U8ZA 1TQZA 1DBHA 3KY9A 2AEHA 3G9WA 2CY5A 4A6KA 2YVCA 1U2BA 5DHFB 1FB8A 4YL8A 2I5CA 3DCXA 2P0DA 3PVLA 3PVWA 2HE7A 3FEHA 2MKRA 5DI9B 2D10A 5KQ4A 5KQ1A 2D2QA 4Y94A 1OY2A 1GC7A 1U29A 5D3VA 2DFKA 5M4YB 2K49A 2PZ1A 1J0WA 3CXBB 4H8SA 5CLLB 3KRXA 2GUMA 5C5BB 1ZC4B 4WJ7A 1MAIA 4K2PA 4PNKA 5L81A 1V5PA 2H7DA 4Z2MB 2Z59A 2EC1A 3DXEA 1Y5OA 2LG1A 1P3RA 1SGHA 2ROVA 5JLJB 5DIFB 3BJIA 2GJYA 2RGNB 3VOQA 2GCLA 1SHCA 1FOEA 3IVFA 4OT1A 1BTKA 1PMSA 2Z0PA 2COFA 2EJ8A 1ZYIA 2W2XC 2RNRB 2DHKA 1ZM0A 3MDBC 1GG3A 1UEFA 4ZRJA 5D3XA 3KSYA 2NBVA 2XQNM 4NY0A 2YT0A 3ML4A 2KUQA 3HIEA 3MPXA 2DHIA 4OSNA 3VIAA 3SYXA 4Z2NA 4HAXB 4DX90 5EFXA 2K00A 3QBVB 3F0WA 1BWNA 3TVVA 1W1GA 3SNHA 4A6FA 2Q13A 2GCJA 1BAKA 2RSGA 1LW3A 3KZ1A 2BCJA 4F7HA 2R09A 1W1HA 2KGXB 2ROZB 5KCVA 1X11A 4CYEA 3WYFB 1NI2A 2M14A 2W2XD 5FI1A 1Y19B 2P8VA 2ZKMX 2RLOA 2OTXA 3P6AA 1UPRA 3NWAA 2V76A 2J59M 5HE1A 4A6FB 4QXAB 1FGZA 4QJ3B 4WSFA 2IFSA 2Z14A 1U5DA 5J3QA 4A6HA 1FGYA 1XD4A 3ZDTA 1XX0A 1QC6A 1UNQA 2DKQA 1I2HA 4HAVB 3A98B 3A8QA 4KAXB 3GYPA 2COAA 5DHAB 4DXAB 3P7ZA 5D3YA 1FHOA 2CAYA 1TJ6A 2MFQA 5C6RA 1X05A 1X1FA 1DROA 1XODA 2H7EA 2KR0A 5J3YA 1U5GA 2YS1A 4HAZB 1MIXA 1WJMA 3FM8C 3SV1A 3PZDA 1RJ2A 2DX1A 3ODOA 2L1CA 3T06A 2ADZA 4TKNA 2GS0A 2NZ8B 2N23A 1H10A 1U27A 1PLSA 5C79A 4GN1A 4GXBA 2D9WA 1ZVRA 3A8PA 4D0NB 2J0JA 2Y8GA 4WVFB 1DYNA 2KIGA 1WJ1A 2N0YA 2UZSA 5GOWB 2LKOA 2Y8FA 2VSZA 1EVHA 2DKPA 4DBBA 1V5UA 4HDQA 2M38A 4PQ0A 3HQCA 3U7DA 3OANA 3AU4A 4KHBA 1MK9B 2K2UA 1V88A 2UZRA 1XKEA 3ULBA 3SO6A 3PG7A 4EMOA 2J0KA 2L2IA 2YS5A 2G35A 1NTYA 4DIXA 3HSAA 1OQNA 2CY4A 2I5FA 5IRSA 3CIKA 4EJNA 4XWXA 5DH9B 3TCAA 2DYQA 4CHMA 1MPHA 1N3HA 3TO1A 3ODWA 3KRWA 1WI1A 4F7UP 3A58A 3F5RA 3LJUX 5HE3A 1UPQA 1WG7A 2DX5A 3NSUA 2YT1A 3ULCA 5LG4B 4MT7A 1GC6A 1U5EA 4IAPA 1KI1B 2QKLA 4DX8A 1DDMA 1UNRA 1MI1A 1J19A 3ZVRA 3WA0A 2OQBA 1W1DA 4HB2B 3SUZA 4B6HA 2DN6A 5CLQB 3M1IB 2NMBA 3AJ4A 3NWFA 4IFSA 2D9XA 3RCPA 5I2SA 1EGXA 2DLWA 4C0AA 4HB3B 2D9YA 2YS3A 2R2YA 2DYNA 1M7RA 2JP2A 1IRSA 3BINA 4HB4B 2D11A 1FHXA 2DTCA 2R0DA 3OHMB 5JP4A 2CRFA 3D8FA 2IYBA 1AQCA 2D4QA 5C5BA 2D9VA 3FVCA 5I2MA 4KHOA 4K81A 1MKEA 2Z4DA 1ZSQA 2CODA 1H4RA 2DA0A 2VKIA 2KCJA 2I1KA 2P0HA 4NSWA 3QIJA 1V61A 1NU2A 2W2WA 4GPTB 5JHGA 4HAYB 1K5DB 1LB1A 2HTHB 1T77A 4EKUA 4CSQA 1EAZA 1XCGA 2K2JA 5D27A 2VRWB 1MK7B 3PP2A 2K8EA 4HDOA 4GMXB 3TW1A 1Z87A 5C16A 2AL6A 4HAUB 1ISNA 2YF0A 4ZRKA 2MDXA 5LOPB 3PEGA 2YSZA 1FHWA 1XR0B 2Z13A 2D9ZA 3GYOA 3D8DA 3HW2B 4K2OA 4MK0A 2EMSA 2KUPA 4L1RA 1RRPB 2Z0OA 1Q67A 1B55A 4MY6A
chains in the Genus database with same CATH topology
4HATB 1EF1A 1PFJA 2Z0QA 4BBKA 1MIZB 5LONB 1P5TA 1KZGA 5D3WA 5HE2A 3TFMA 2E2XA 1I7AA 1WGUA 4KHAA 1FAOA 1DDVA 4ZRIA 4A5KA 4HB0B 1K5GB 4IOYX 3PSCA 2P0FA 3FSSA 4F7GA 2FJLA 1X86A 2EMTA 2UVMA 1QQGA 3N7CA 3D8EA 4HHVA 1E5WA 1BTNA 1X1GA 2MWNB 4CHJA 2QKMA 1OMWA 1NTVA 1WVHA 2RUKB 2RVBB 2YRYA 5J3TA 1WGQA 1KZ7A 2DHJA 3AU5A 4P7IA 1V5MA 1U5FA 2LOZA 4GZUA 3UZTA 2LULA 1M7EA 4K17A 3PVUA 2ELAA 4KVGB 4HAWB 3HK0A 1UNPA 4KHBB 3QWMA 1V89A 5FI0A 3DXDA 1AWEA 4L6EA 2LYDA 5HE0A 3ODXA 2X18A 3DXCA 5JHHA 4TYZA 1TXDA 1DDWA 4YONA 3V5WA 2J0MA 2ZPYA 2COCA 2I1JA 1ZC3B 3X23A 1P6SA 2LOXA 2Y7BA 4GMVA 3O96A 2ELBA 3U8ZA 1TQZA 1DBHA 3KY9A 2AEHA 3G9WA 2CY5A 4A6KA 2YVCA 1U2BA 5DHFB 1FB8A 4YL8A 2I5CA 2P0DA 3PVLA 3PVWA 2HE7A 3FEHA 2MKRA 5DI9B 2D10A 5KQ4A 5KQ1A 2D2QA 4Y94A 1OY2A 1GC7A 1U29A 5D3VA 2DFKA 2PZ1A 1J0WA 3CXBB 4H8SA 5CLLB 3KRXA 5C5BB 1ZC4B 4WJ7A 4K2PA 1MAIA 4PNKA 5L81A 1V5PA 2H7DA 4Z2MB 2EC1A 3DXEA 1Y5OA 2LG1A 1P3RA 1SGHA 2ROVA 5JLJB 5DIFB 3BJIA 2GJYA 2RGNB 3VOQA 2GCLA 1SHCA 1FOEA 3IVFA 1BTKA 1PMSA 2Z0PA 2COFA 2EJ8A 2W2XC 2RNRB 2DHKA 1ZM0A 3MDBC 1GG3A 1UEFA 4ZRJA 5D3XA 3KSYA 2XQNM 4NY0A 2YT0A 3ML4A 3MPXA 2DHIA 3VIAA 3SYXA 4Z2NA 4HAXB 4DX90 5EFXA 2K00A 3QBVB 3F0WA 1BWNA 3TVVA 1W1GA 3SNHA 4A6FA 2Q13A 2GCJA 1BAKA 2RSGA 1LW3A 3KZ1A 2BCJA 4F7HA 2R09A 1W1HA 2KGXB 2ROZB 5KCVA 1X11A 4CYEA 3WYFB 1NI2A 2M14A 2W2XD 5FI1A 1Y19B 2P8VA 2RLOA 2OTXA 3P6AA 1UPRA 2V76A 2J59M 5HE1A 4A6FB 1FGZA 4WSFA 2IFSA 1U5DA 5J3QA 4A6HA 1FGYA 1XD4A 3ZDTA 1XX0A 1QC6A 1UNQA 2DKQA 1I2HA 4HAVB 3A98B 3A8QA 4KAXB 3GYPA 2COAA 5DHAB 4DXAB 3P7ZA 5D3YA 1FHOA 2CAYA 1TJ6A 2MFQA 5C6RA 1X05A 1X1FA 1DROA 1XODA 2H7EA 5J3YA 1U5GA 2YS1A 4HAZB 1MIXA 1WJMA 3FM8C 3SV1A 3PZDA 1RJ2A 2DX1A 3ODOA 2L1CA 3T06A 2ADZA 4TKNA 2GS0A 2NZ8B 2N23A 1H10A 1U27A 1PLSA 5C79A 4GN1A 4GXBA 2D9WA 1ZVRA 3A8PA 4D0NB 2J0JA 2Y8GA 4WVFB 1DYNA 1WJ1A 2N0YA 2UZSA 5GOWB 2LKOA 2Y8FA 2VSZA 1EVHA 2DKPA 4DBBA 1V5UA 4HDQA 2M38A 4PQ0A 3HQCA 3U7DA 3OANA 3AU4A 1MK9B 2K2UA 1V88A 2UZRA 1XKEA 3ULBA 3SO6A 3PG7A 4EMOA 2J0KA 2L2IA 2YS5A 2G35A 1NTYA 1OQNA 2CY4A 2I5FA 3CIKA 4EJNA 4XWXA 5DH9B 3TCAA 2DYQA 4CHMA 1MPHA 1N3HA 3TO1A 3ODWA 3KRWA 1WI1A 4F7UP 3F5RA 3LJUX 5HE3A 1UPQA 1WG7A 2DX5A 3NSUA 2YT1A 3ULCA 4MT7A 1GC6A 1U5EA 4IAPA 1KI1B 2QKLA 4DX8A 1DDMA 1UNRA 1J19A 3ZVRA 3WA0A 2OQBA 1W1DA 4HB2B 3SUZA 4B6HA 2DN6A 5CLQB 3M1IB 2NMBA 3AJ4A 3RCPA 4IFSA 2D9XA 1EGXA 2DLWA 4C0AA 4HB3B 2D9YA 2YS3A 2DYNA 1M7RA 2JP2A 1IRSA 3BINA 4HB4B 2D11A 1FHXA 2DTCA 2R0DA 5JP4A 2CRFA 3D8FA 2IYBA 1AQCA 2D4QA 5C5BA 2D9VA 4KHOA 4K81A 1MKEA 1ZSQA 2CODA 1H4RA 2DA0A 2VKIA 2KCJA 2I1KA 2P0HA 4NSWA 3QIJA 1V61A 1NU2A 2W2WA 4GPTB 5JHGA 4HAYB 1K5DB 1LB1A 2HTHB 4EKUA 1EAZA 1XCGA 2K2JA 5D27A 2VRWB 1MK7B 3PP2A 4HDOA 4GMXB 3TW1A 1Z87A 5C16A 2AL6A 4HAUB 1ISNA 2YF0A 4ZRKA 2MDXA 5LOPB 3PEGA 2YSZA 1FHWA 1XR0B 2D9ZA 3GYOA 3D8DA 3HW2B 4K2OA 4MK0A 2EMSA 2KUPA 1RRPB 2Z0OA 1Q67A 1B55A 4MY6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HAT B;  1EF1 A;  1PFJ A;  2Z0Q A;  4BBK A;  1MIZ B;  5LON B;  1P5T A;  1KZG A;  5D3W A;  5HE2 A;  3TFM A;  2E2X A;  1I7A A;  1WGU A;  4KHA A;  1FAO A;  1DDV A;  4ZRI A;  4A5K A;  4HB0 B;  1K5G B;  4IOY X;  3PSC A;  2P0F A;  3FSS A;  4F7G A;  2FJL A;  1X86 A;  2EMT A;  2UVM A;  1QQG A;  3N7C A;  3D8E A;  4HHV A;  1E5W A;  1BTN A;  1X1G A;  2MWN B;  4CHJ A;  2QKM A;  1OMW A;  1NTV A;  1WVH A;  2RUK B;  2RVB B;  2YRY A;  5J3T A;  1WGQ A;  1KZ7 A;  2DHJ A;  3AU5 A;  4P7I A;  1V5M A;  1U5F A;  2LOZ A;  4GZU A;  3UZT A;  2LUL A;  1M7E A;  4K17 A;  3PVU A;  2ELA A;  4KVG B;  4HAW B;  3HK0 A;  1UNP A;  4KHB B;  3QWM A;  1V89 A;  5FI0 A;  3DXD A;  1AWE A;  4L6E A;  2LYD A;  5HE0 A;  3ODX A;  2X18 A;  3DXC A;  5JHH A;  4TYZ A;  1TXD A;  1DDW A;  4YON A;  3V5W A;  2J0M A;  2ZPY A;  2COC A;  2I1J A;  1ZC3 B;  3X23 A;  1P6S A;  2LOX A;  2Y7B A;  4GMV A;  3O96 A;  2ELB A;  3U8Z A;  1TQZ A;  1DBH A;  3KY9 A;  2AEH A;  3G9W A;  2CY5 A;  4A6K A;  2YVC A;  1U2B A;  5DHF B;  1FB8 A;  4YL8 A;  2I5C A;  2P0D A;  3PVL A;  3PVW A;  2HE7 A;  3FEH A;  2MKR A;  5DI9 B;  2D10 A;  5KQ4 A;  5KQ1 A;  2D2Q A;  4Y94 A;  1OY2 A;  1GC7 A;  1U29 A;  5D3V A;  2DFK A;  2PZ1 A;  1J0W A;  3CXB B;  4H8S A;  5CLL B;  3KRX A;  5C5B B;  1ZC4 B;  4WJ7 A;  4K2P A;  1MAI A;  4PNK A;  5L81 A;  1V5P A;  2H7D A;  4Z2M B;  2EC1 A;  3DXE A;  1Y5O A;  2LG1 A;  1P3R A;  1SGH A;  2ROV A;  5JLJ B;  5DIF B;  3BJI A;  2GJY A;  2RGN B;  3VOQ A;  2GCL A;  1SHC A;  1FOE A;  3IVF A;  1BTK A;  1PMS A;  2Z0P A;  2COF A;  2EJ8 A;  2W2X C;  2RNR B;  2DHK A;  1ZM0 A;  3MDB C;  1GG3 A;  1UEF A;  4ZRJ A;  5D3X A;  3KSY A;  2XQN M;  4NY0 A;  2YT0 A;  3ML4 A;  3MPX A;  2DHI A;  3VIA A;  3SYX A;  4Z2N A;  4HAX B;  4DX9 0;  5EFX A;  2K00 A;  3QBV B;  3F0W A;  1BWN A;  3TVV A;  1W1G A;  3SNH A;  4A6F A;  2Q13 A;  2GCJ A;  1BAK A;  2RSG A;  1LW3 A;  3KZ1 A;  2BCJ A;  4F7H A;  2R09 A;  1W1H A;  2KGX B;  2ROZ B;  5KCV A;  1X11 A;  4CYE A;  3WYF B;  1NI2 A;  2M14 A;  2W2X D;  5FI1 A;  1Y19 B;  2P8V A;  2RLO A;  2OTX A;  3P6A A;  1UPR A;  2V76 A;  2J59 M;  5HE1 A;  4A6F B;  1FGZ A;  4WSF A;  2IFS A;  1U5D A;  5J3Q A;  4A6H A;  1FGY A;  1XD4 A;  3ZDT A;  1XX0 A;  1QC6 A;  1UNQ A;  2DKQ A;  1I2H A;  4HAV B;  3A98 B;  3A8Q A;  4KAX B;  3GYP A;  2COA A;  5DHA B;  4DXA B;  3P7Z A;  5D3Y A;  1FHO A;  2CAY A;  1TJ6 A;  2MFQ A;  5C6R A;  1X05 A;  1X1F A;  1DRO A;  1XOD A;  2H7E A;  5J3Y A;  1U5G A;  2YS1 A;  4HAZ B;  1MIX A;  1WJM A;  3FM8 C;  3SV1 A;  3PZD A;  1RJ2 A;  2DX1 A;  3ODO A;  2L1C A;  3T06 A;  2ADZ A;  4TKN A;  2GS0 A;  2NZ8 B;  2N23 A;  1H10 A;  1U27 A;  1PLS A;  5C79 A;  4GN1 A;  4GXB A;  2D9W A;  1ZVR A;  3A8P A;  4D0N B;  2J0J A;  2Y8G A;  4WVF B;  1DYN A;  1WJ1 A;  2N0Y A;  2UZS A;  5GOW B;  2LKO A;  2Y8F A;  2VSZ A;  1EVH A;  2DKP A;  4DBB A;  1V5U A;  4HDQ A;  2M38 A;  4PQ0 A;  3HQC A;  3U7D A;  3OAN A;  3AU4 A;  1MK9 B;  2K2U A;  1V88 A;  2UZR A;  1XKE A;  3ULB A;  3SO6 A;  3PG7 A;  4EMO A;  2J0K A;  2L2I A;  2YS5 A;  2G35 A;  1NTY A;  1OQN A;  2CY4 A;  2I5F A;  3CIK A;  4EJN A;  4XWX A;  5DH9 B;  3TCA A;  2DYQ A;  4CHM A;  1MPH A;  1N3H A;  3TO1 A;  3ODW A;  3KRW A;  1WI1 A;  4F7U P;  3F5R A;  3LJU X;  5HE3 A;  1UPQ A;  1WG7 A;  2DX5 A;  3NSU A;  2YT1 A;  3ULC A;  4MT7 A;  1GC6 A;  1U5E A;  4IAP A;  1KI1 B;  2QKL A;  4DX8 A;  1DDM A;  1UNR A;  1J19 A;  3ZVR A;  3WA0 A;  2OQB A;  1W1D A;  4HB2 B;  3SUZ A;  4B6H A;  2DN6 A;  5CLQ B;  3M1I B;  2NMB A;  3AJ4 A;  3RCP A;  4IFS A;  2D9X A;  1EGX A;  2DLW A;  4C0A A;  4HB3 B;  2D9Y A;  2YS3 A;  2DYN A;  1M7R A;  2JP2 A;  1IRS A;  3BIN A;  4HB4 B;  2D11 A;  1FHX A;  2DTC A;  2R0D A;  5JP4 A;  2CRF A;  3D8F A;  2IYB A;  1AQC A;  2D4Q A;  5C5B A;  2D9V A;  4KHO A;  4K81 A;  1MKE A;  1ZSQ A;  2COD A;  1H4R A;  2DA0 A;  2VKI A;  2KCJ A;  2I1K A;  2P0H A;  4NSW A;  3QIJ A;  1V61 A;  1NU2 A;  2W2W A;  4GPT B;  5JHG A;  4HAY B;  1K5D B;  1LB1 A;  2HTH B;  4EKU A;  1EAZ A;  1XCG A;  2K2J A;  5D27 A;  2VRW B;  1MK7 B;  3PP2 A;  4HDO A;  4GMX B;  3TW1 A;  1Z87 A;  5C16 A;  2AL6 A;  4HAU B;  1ISN A;  2YF0 A;  4ZRK A;  2MDX A;  5LOP B;  3PEG A;  2YSZ A;  1FHW A;  1XR0 B;  2D9Z A;  3GYO A;  3D8D A;  3HW2 B;  4K2O A;  4MK0 A;  2EMS A;  2KUP A;  1RRP B;  2Z0O A;  1Q67 A;  1B55 A;  4MY6 A; 
#chains in the Genus database with same CATH topology
 4HAT B;  1EF1 A;  1PFJ A;  2Z0Q A;  4BBK A;  1MIZ B;  5LON B;  1P5T A;  1KZG A;  5D3W A;  5HE2 A;  3TFM A;  2E2X A;  1I7A A;  1WGU A;  4KHA A;  1FAO A;  1DDV A;  2RRF A;  4ZRI A;  4A5K A;  4HB0 B;  1K5G B;  4IOY X;  4QJ4 B;  3PSC A;  2P0F A;  4D6W A;  3FSS A;  4F7G A;  2FJL A;  1X86 A;  2EMT A;  2UVM A;  2KIE A;  1QQG A;  3N7C A;  3D8E A;  4HHV A;  1E5W A;  3NWD A;  1BTN A;  1X1G A;  2MWN B;  4CHJ A;  3U12 A;  2QKM A;  1OMW A;  1NTV A;  1WVH A;  2RUK B;  2RVB B;  2YRY A;  5J3T A;  2YT2 A;  1WGQ A;  1KZ7 A;  2DHJ A;  3AU5 A;  4P7I A;  1V5M A;  1U5F A;  2LOZ A;  4GZU A;  3UZT A;  3B77 A;  2LUL A;  1M7E A;  4K17 A;  3PVU A;  4QJ5 B;  2ELA A;  4KVG B;  4HAW B;  3HK0 A;  1UNP A;  4KHB B;  3QWM A;  4GOU A;  1V89 A;  5FI0 A;  3DXD A;  1AWE A;  4L6E A;  2LYD A;  5HE0 A;  3ODX A;  2X18 A;  2FJU B;  3DXC A;  5JHH A;  4TYZ A;  1TXD A;  1DDW A;  4HSI A;  4YON A;  3V5W A;  2J0M A;  2ZPY A;  2COC A;  4GNK B;  2I1J A;  1ZC3 B;  3X23 A;  1P6S A;  2LOX A;  2Y7B A;  4GMV A;  3O96 A;  2ELB A;  3NW8 A;  3U8Z A;  1TQZ A;  1DBH A;  3KY9 A;  2AEH A;  3G9W A;  2CY5 A;  4A6K A;  2YVC A;  1U2B A;  5DHF B;  1FB8 A;  4YL8 A;  2I5C A;  3DCX A;  2P0D A;  3PVL A;  3PVW A;  2HE7 A;  3FEH A;  2MKR A;  5DI9 B;  2D10 A;  5KQ4 A;  5KQ1 A;  2D2Q A;  4Y94 A;  1OY2 A;  1GC7 A;  1U29 A;  5D3V A;  2DFK A;  5M4Y B;  2K49 A;  2PZ1 A;  1J0W A;  3CXB B;  4H8S A;  5CLL B;  3KRX A;  2GUM A;  5C5B B;  1ZC4 B;  4WJ7 A;  1MAI A;  4K2P A;  4PNK A;  5L81 A;  1V5P A;  2H7D A;  4Z2M B;  2Z59 A;  2EC1 A;  3DXE A;  1Y5O A;  2LG1 A;  1P3R A;  1SGH A;  2ROV A;  5JLJ B;  5DIF B;  3BJI A;  2GJY A;  2RGN B;  3VOQ A;  2GCL A;  1SHC A;  1FOE A;  3IVF A;  4OT1 A;  1BTK A;  1PMS A;  2Z0P A;  2COF A;  2EJ8 A;  1ZYI A;  2W2X C;  2RNR B;  2DHK A;  1ZM0 A;  3MDB C;  1GG3 A;  1UEF A;  4ZRJ A;  5D3X A;  3KSY A;  2NBV A;  2XQN M;  4NY0 A;  2YT0 A;  3ML4 A;  2KUQ A;  3HIE A;  3MPX A;  2DHI A;  4OSN A;  3VIA A;  3SYX A;  4Z2N A;  4HAX B;  4DX9 0;  5EFX A;  2K00 A;  3QBV B;  3F0W A;  1BWN A;  3TVV A;  1W1G A;  3SNH A;  4A6F A;  2Q13 A;  2GCJ A;  1BAK A;  2RSG A;  1LW3 A;  3KZ1 A;  2BCJ A;  4F7H A;  2R09 A;  1W1H A;  2KGX B;  2ROZ B;  5KCV A;  1X11 A;  4CYE A;  3WYF B;  1NI2 A;  2M14 A;  2W2X D;  5FI1 A;  1Y19 B;  2P8V A;  2ZKM X;  2RLO A;  2OTX A;  3P6A A;  1UPR A;  3NWA A;  2V76 A;  2J59 M;  5HE1 A;  4A6F B;  4QXA B;  1FGZ A;  4QJ3 B;  4WSF A;  2IFS A;  2Z14 A;  1U5D A;  5J3Q A;  4A6H A;  1FGY A;  1XD4 A;  3ZDT A;  1XX0 A;  1QC6 A;  1UNQ A;  2DKQ A;  1I2H A;  4HAV B;  3A98 B;  3A8Q A;  4KAX B;  3GYP A;  2COA A;  5DHA B;  4DXA B;  3P7Z A;  5D3Y A;  1FHO A;  2CAY A;  1TJ6 A;  2MFQ A;  5C6R A;  1X05 A;  1X1F A;  1DRO A;  1XOD A;  2H7E A;  2KR0 A;  5J3Y A;  1U5G A;  2YS1 A;  4HAZ B;  1MIX A;  1WJM A;  3FM8 C;  3SV1 A;  3PZD A;  1RJ2 A;  2DX1 A;  3ODO A;  2L1C A;  3T06 A;  2ADZ A;  4TKN A;  2GS0 A;  2NZ8 B;  2N23 A;  1H10 A;  1U27 A;  1PLS A;  5C79 A;  4GN1 A;  4GXB A;  2D9W A;  1ZVR A;  3A8P A;  4D0N B;  2J0J A;  2Y8G A;  4WVF B;  1DYN A;  2KIG A;  1WJ1 A;  2N0Y A;  2UZS A;  5GOW B;  2LKO A;  2Y8F A;  2VSZ A;  1EVH A;  2DKP A;  4DBB A;  1V5U A;  4HDQ A;  2M38 A;  4PQ0 A;  3HQC A;  3U7D A;  3OAN A;  3AU4 A;  4KHB A;  1MK9 B;  2K2U A;  1V88 A;  2UZR A;  1XKE A;  3ULB A;  3SO6 A;  3PG7 A;  4EMO A;  2J0K A;  2L2I A;  2YS5 A;  2G35 A;  1NTY A;  4DIX A;  3HSA A;  1OQN A;  2CY4 A;  2I5F A;  5IRS A;  3CIK A;  4EJN A;  4XWX A;  5DH9 B;  3TCA A;  2DYQ A;  4CHM A;  1MPH A;  1N3H A;  3TO1 A;  3ODW A;  3KRW A;  1WI1 A;  4F7U P;  3A58 A;  3F5R A;  3LJU X;  5HE3 A;  1UPQ A;  1WG7 A;  2DX5 A;  3NSU A;  2YT1 A;  3ULC A;  5LG4 B;  4MT7 A;  1GC6 A;  1U5E A;  4IAP A;  1KI1 B;  2QKL A;  4DX8 A;  1DDM A;  1UNR A;  1MI1 A;  1J19 A;  3ZVR A;  3WA0 A;  2OQB A;  1W1D A;  4HB2 B;  3SUZ A;  4B6H A;  2DN6 A;  5CLQ B;  3M1I B;  2NMB A;  3AJ4 A;  3NWF A;  4IFS A;  2D9X A;  3RCP A;  5I2S A;  1EGX A;  2DLW A;  4C0A A;  4HB3 B;  2D9Y A;  2YS3 A;  2R2Y A;  2DYN A;  1M7R A;  2JP2 A;  1IRS A;  3BIN A;  4HB4 B;  2D11 A;  1FHX A;  2DTC A;  2R0D A;  3OHM B;  5JP4 A;  2CRF A;  3D8F A;  2IYB A;  1AQC A;  2D4Q A;  5C5B A;  2D9V A;  3FVC A;  5I2M A;  4KHO A;  4K81 A;  1MKE A;  2Z4D A;  1ZSQ A;  2COD A;  1H4R A;  2DA0 A;  2VKI A;  2KCJ A;  2I1K A;  2P0H A;  4NSW A;  3QIJ A;  1V61 A;  1NU2 A;  2W2W A;  4GPT B;  5JHG A;  4HAY B;  1K5D B;  1LB1 A;  2HTH B;  1T77 A;  4EKU A;  4CSQ A;  1EAZ A;  1XCG A;  2K2J A;  5D27 A;  2VRW B;  1MK7 B;  3PP2 A;  2K8E A;  4HDO A;  4GMX B;  3TW1 A;  1Z87 A;  5C16 A;  2AL6 A;  4HAU B;  1ISN A;  2YF0 A;  4ZRK A;  2MDX A;  5LOP B;  3PEG A;  2YSZ A;  1FHW A;  1XR0 B;  2Z13 A;  2D9Z A;  3GYO A;  3D8D A;  3HW2 B;  4K2O A;  4MK0 A;  2EMS A;  2KUP A;  4L1R A;  1RRP B;  2Z0O A;  1Q67 A;  1B55 A;  4MY6 A; 
#chains in the Genus database with same CATH homology
 4HAT B;  1EF1 A;  1PFJ A;  2Z0Q A;  4BBK A;  1MIZ B;  5LON B;  1P5T A;  1KZG A;  5D3W A;  5HE2 A;  3TFM A;  2E2X A;  1I7A A;  1WGU A;  4KHA A;  1FAO A;  1DDV A;  4ZRI A;  4A5K A;  4HB0 B;  1K5G B;  4IOY X;  3PSC A;  2P0F A;  3FSS A;  4F7G A;  2FJL A;  1X86 A;  2EMT A;  2UVM A;  1QQG A;  3N7C A;  3D8E A;  4HHV A;  1E5W A;  1BTN A;  1X1G A;  2MWN B;  4CHJ A;  2QKM A;  1OMW A;  1NTV A;  1WVH A;  2RUK B;  2RVB B;  2YRY A;  5J3T A;  1WGQ A;  1KZ7 A;  2DHJ A;  3AU5 A;  4P7I A;  1V5M A;  1U5F A;  2LOZ A;  4GZU A;  3UZT A;  2LUL A;  1M7E A;  4K17 A;  3PVU A;  2ELA A;  4KVG B;  4HAW B;  3HK0 A;  1UNP A;  4KHB B;  3QWM A;  1V89 A;  5FI0 A;  3DXD A;  1AWE A;  4L6E A;  2LYD A;  5HE0 A;  3ODX A;  2X18 A;  3DXC A;  5JHH A;  4TYZ A;  1TXD A;  1DDW A;  4YON A;  3V5W A;  2J0M A;  2ZPY A;  2COC A;  2I1J A;  1ZC3 B;  3X23 A;  1P6S A;  2LOX A;  2Y7B A;  4GMV A;  3O96 A;  2ELB A;  3U8Z A;  1TQZ A;  1DBH A;  3KY9 A;  2AEH A;  3G9W A;  2CY5 A;  4A6K A;  2YVC A;  1U2B A;  5DHF B;  1FB8 A;  4YL8 A;  2I5C A;  2P0D A;  3PVL A;  3PVW A;  2HE7 A;  3FEH A;  2MKR A;  5DI9 B;  2D10 A;  5KQ4 A;  5KQ1 A;  2D2Q A;  4Y94 A;  1OY2 A;  1GC7 A;  1U29 A;  5D3V A;  2DFK A;  2PZ1 A;  1J0W A;  3CXB B;  4H8S A;  5CLL B;  3KRX A;  5C5B B;  1ZC4 B;  4WJ7 A;  4K2P A;  1MAI A;  4PNK A;  5L81 A;  1V5P A;  2H7D A;  4Z2M B;  2EC1 A;  3DXE A;  1Y5O A;  2LG1 A;  1P3R A;  1SGH A;  2ROV A;  5JLJ B;  5DIF B;  3BJI A;  2GJY A;  2RGN B;  3VOQ A;  2GCL A;  1SHC A;  1FOE A;  3IVF A;  1BTK A;  1PMS A;  2Z0P A;  2COF A;  2EJ8 A;  2W2X C;  2RNR B;  2DHK A;  1ZM0 A;  3MDB C;  1GG3 A;  1UEF A;  4ZRJ A;  5D3X A;  3KSY A;  2XQN M;  4NY0 A;  2YT0 A;  3ML4 A;  3MPX A;  2DHI A;  3VIA A;  3SYX A;  4Z2N A;  4HAX B;  4DX9 0;  5EFX A;  2K00 A;  3QBV B;  3F0W A;  1BWN A;  3TVV A;  1W1G A;  3SNH A;  4A6F A;  2Q13 A;  2GCJ A;  1BAK A;  2RSG A;  1LW3 A;  3KZ1 A;  2BCJ A;  4F7H A;  2R09 A;  1W1H A;  2KGX B;  2ROZ B;  5KCV A;  1X11 A;  4CYE A;  3WYF B;  1NI2 A;  2M14 A;  2W2X D;  5FI1 A;  1Y19 B;  2P8V A;  2RLO A;  2OTX A;  3P6A A;  1UPR A;  2V76 A;  2J59 M;  5HE1 A;  4A6F B;  1FGZ A;  4WSF A;  2IFS A;  1U5D A;  5J3Q A;  4A6H A;  1FGY A;  1XD4 A;  3ZDT A;  1XX0 A;  1QC6 A;  1UNQ A;  2DKQ A;  1I2H A;  4HAV B;  3A98 B;  3A8Q A;  4KAX B;  3GYP A;  2COA A;  5DHA B;  4DXA B;  3P7Z A;  5D3Y A;  1FHO A;  2CAY A;  1TJ6 A;  2MFQ A;  5C6R A;  1X05 A;  1X1F A;  1DRO A;  1XOD A;  2H7E A;  5J3Y A;  1U5G A;  2YS1 A;  4HAZ B;  1MIX A;  1WJM A;  3FM8 C;  3SV1 A;  3PZD A;  1RJ2 A;  2DX1 A;  3ODO A;  2L1C A;  3T06 A;  2ADZ A;  4TKN A;  2GS0 A;  2NZ8 B;  2N23 A;  1H10 A;  1U27 A;  1PLS A;  5C79 A;  4GN1 A;  4GXB A;  2D9W A;  1ZVR A;  3A8P A;  4D0N B;  2J0J A;  2Y8G A;  4WVF B;  1DYN A;  1WJ1 A;  2N0Y A;  2UZS A;  5GOW B;  2LKO A;  2Y8F A;  2VSZ A;  1EVH A;  2DKP A;  4DBB A;  1V5U A;  4HDQ A;  2M38 A;  4PQ0 A;  3HQC A;  3U7D A;  3OAN A;  3AU4 A;  1MK9 B;  2K2U A;  1V88 A;  2UZR A;  1XKE A;  3ULB A;  3SO6 A;  3PG7 A;  4EMO A;  2J0K A;  2L2I A;  2YS5 A;  2G35 A;  1NTY A;  1OQN A;  2CY4 A;  2I5F A;  3CIK A;  4EJN A;  4XWX A;  5DH9 B;  3TCA A;  2DYQ A;  4CHM A;  1MPH A;  1N3H A;  3TO1 A;  3ODW A;  3KRW A;  1WI1 A;  4F7U P;  3F5R A;  3LJU X;  5HE3 A;  1UPQ A;  1WG7 A;  2DX5 A;  3NSU A;  2YT1 A;  3ULC A;  4MT7 A;  1GC6 A;  1U5E A;  4IAP A;  1KI1 B;  2QKL A;  4DX8 A;  1DDM A;  1UNR A;  1J19 A;  3ZVR A;  3WA0 A;  2OQB A;  1W1D A;  4HB2 B;  3SUZ A;  4B6H A;  2DN6 A;  5CLQ B;  3M1I B;  2NMB A;  3AJ4 A;  3RCP A;  4IFS A;  2D9X A;  1EGX A;  2DLW A;  4C0A A;  4HB3 B;  2D9Y A;  2YS3 A;  2DYN A;  1M7R A;  2JP2 A;  1IRS A;  3BIN A;  4HB4 B;  2D11 A;  1FHX A;  2DTC A;  2R0D A;  5JP4 A;  2CRF A;  3D8F A;  2IYB A;  1AQC A;  2D4Q A;  5C5B A;  2D9V A;  4KHO A;  4K81 A;  1MKE A;  1ZSQ A;  2COD A;  1H4R A;  2DA0 A;  2VKI A;  2KCJ A;  2I1K A;  2P0H A;  4NSW A;  3QIJ A;  1V61 A;  1NU2 A;  2W2W A;  4GPT B;  5JHG A;  4HAY B;  1K5D B;  1LB1 A;  2HTH B;  4EKU A;  1EAZ A;  1XCG A;  2K2J A;  5D27 A;  2VRW B;  1MK7 B;  3PP2 A;  4HDO A;  4GMX B;  3TW1 A;  1Z87 A;  5C16 A;  2AL6 A;  4HAU B;  1ISN A;  2YF0 A;  4ZRK A;  2MDX A;  5LOP B;  3PEG A;  2YSZ A;  1FHW A;  1XR0 B;  2D9Z A;  3GYO A;  3D8D A;  3HW2 B;  4K2O A;  4MK0 A;  2EMS A;  2KUP A;  1RRP B;  2Z0O A;  1Q67 A;  1B55 A;  4MY6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...