2P0NA

Nmb1532 protein from neisseria meningitidis, unknown function
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
161
structure length
161
Chain Sequence
VTFAEPIEMLYACHGKVRRFCGQVAMLSDYIAENGCNQIVLQTIRQIAQYFNVAAPLHHEDEEENFFPLLLQYAPQAQESVDELLRQHIGLHDNWAAVSAEFAKLEADNAYVPDEEAFKRFVAGYDVHLAIEEPLFDMGNTFIPKEKLTEIGEIMAARRRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein NMB1532
publication title X-ray crystal structure of NMB1532 protein of unknown function from Neisseria meningitidis.
rcsb
source organism Neisseria meningitidis
molecule tags Structural genomics, unknown function
total genus 65
structure length 161
sequence length 161
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01814 Hemerythrin Hemerythrin HHE cation binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.520 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) nmb1532 protein domain like 2p0nA00
3U9JA 2P0NA 3V5XA 3U9MA 3V5ZA 3V5YA 3CAXA
chains in the Genus database with same CATH superfamily
1JR8A 3UMKA 1FTSA 2NPUA 2L81A 3EQLF 4Z9JA 4BJ1A 3RVZA 2ZXRA 3C8GA 2R02A 3T9OA 4AX2A 1G8XA 1UFBA 2DI3A 1YAUO 1U6HA 2EINC 5T3WA 3O55A 1OR3A 4IB4A 1ORJA 4G78A 5E2QA 1BZ4A 3SXKA 4EKWA 3I5QA 2L6GA 1TKNA 4IGGA 1MMGA 1RXQA 4CIHA 1WASA 4O6YA 3UR3C 3MLGA 3T6JA 4JZAA 4EHPA 4ZLDA 3LNMB 2IXMA 2YHSA 3AQBA 3EGXB 3HJCA 4P9FA 3V5ZA 1OKKA 4OD4A 1APCA 4U5HA 4QI2A 3LEVA 3EZHA 1HW2A 3QVYA 1H7IA 3G50A 2H8AA 4ULWA 5JSLA 1RKCA 1QKRA 5D91A 3LS1A 3PHF2 3Q6MA 1Q0GA 4E17A 1YA7O 3FAJA 2HZ8A 2QUPA 3DJUB 3QZCA 4NTAA 3RW0A 1TFOB 3L8JA 3ABMC 3NDBB 4I1OB 4FX5A 2R7UA 2IXNA 2HJ3A 3T6GB 4NTBA 3U3BA 3S90A 4OIRF 2AU5A 4JW1A 3ZTZA 1NSGB 1V55C 1T5OA 2EPKX 1NU9C 3U2LA 1OCOC 2Y3GA 4DRJB 1DOWA 4N4WA 4EBBA 3MX3A 2J8WA 4KNWA 4BJ5A 4JC7A 3EH1A 5EHHA 1KTMA 4IJJA 5A6AA 3I4UA 5DS5A 2IYLD 2EIMC 2CCYA 1ZHZA 2A6HF 5HV9A 3EJNA 3Q6NA 2R25A 3DAGA 4Q4ZF 2ASRA 3AG4C 3ASOC 1BR1A 3U9MA 2XSEA 1KU2A 1ZYRF 1TFKB 2JX0A 4MVMA 5JRAA 1E84A 3ABKC 3HNLA 3L8IA 5KYWB 4LERA 4U5DE 2OJQA 2RD9A 1RCPA 2BC5A 5BQIA 2PX3A 5FCLA 4PJNA 3SZRA 3K33A 2XXAB 3U2MA 4JTCB 1FR0A 2R7OA 1VK5A 3DE8A 4RBNA 4WABA 3M79A 1ZHTA 3EG9A 3ZG1A 2DYRC 5L0JA 2TMVP 4MVOA 3B29A 1BR2A 2XLEA 1NZEA 3Q7GA 5JVEA 4DVZA 1D0ZA 3KYIA 4LACB 4UDVA 2R7RA 5IY5C 2Y39A 1ST6A 1ZZPA 2J0XA 2KNHA 2ZPAA 3K1IA 3KL4A 4J30B 4CBEA 2R05A 4CDVA 5B3SC 1LIHA 2J9WA 1I4ZA 3X1OA 4CS9C 4EWCA 3L0IA 1XWJA 4JEAA 2OQMA 2AVKA 3C62A 5EK0A 3TOLA 3NKDA 3ZVRA 2A0BA 1VTMP 3ZWIA 2JPUA 4O7GA 4DRIB 4C7OB 3IQ6A 4Z9HA 5KYYA 1Q0FA 3DWWA 2Y3DA 4QI0A 3KPHA 5JS5A 3GEEA 4IAQA 2NUTA 4MS2A 1HE9A 1AUEA 1LI5A 2XL8A 1Y6DA 3W2WA 4BJTA 4XEKA 1HMOA 3POVA 3C8GB 3RQFA 1MQVA 2AWCA 3M4BA 1NBBA 4L6RA 1E85A 4OD5A 1I5NA 2IM8A 3RQGA 3GEIA 2C04A 2VH3A 1M57C 2HUJA 3LAYA 4HFKB 4O6NA 4XTKA 1C17M 1QVXA 2G3KA 2YKZA 4W8KA 3WODF 3B9QA 3QTHA 5F28E 3RVYA 2HMZA 4D4XA 5DVWA 3DM5A 1L7CA 3PCVA 1ZW3A 2YLGA 3GWLA 1BDJB 4JURI 3JCUQ 4FAPB 3E70C 3VF0A 2A68F 2YVKA 3GM1A 4P9TA 4ULVA 1MNEA 2YL0A 3M1CB 2IXOA 1GQAA 4YWQA 4JKVA 1SZIA 1GM5A 2VCBA 3ITFA 1HY5A 3LNRA 3FOPA 1E83A 2RSEB 3G4ZA 1M56C 1VLTA 4LDKA 4EBJA 4KI2A 2A6EF 1Y4CA 1ORSC 3FXHA 3NYJA 2L9JA 1PCXA 4W8PA 2YL1A 1CPQA 3V7OA 3TJ6A 5T3TA 1U89A 3JTLO 3MFNA 4CS8A 4DXWA 4KBLA 2H7OA 4MNDA 4N6HA 2L6HA 3HNIA 5F5FA 1MMNA 1KNYA 1I4YA 2J45A 3DD7A 1A7VA 5E33A 5L0FA 4YN0B 2WZGA 3ZQVA 1EI7A 4D4NA 2QNLA 4XLPF 2HFIA 2A0UA 3O6XA 5L0DA 1U0BB 4G0HA 2R9RB 3TJ5A 2PX0A 1D1CA 2R7VA 4XLNF 1TWHA 1JPNA 4PR9A 5DQZA 3NMJA 1O87A 3ZSUA 3T4RA 2EPLX 3ZIBA 3KYJA 4MQ9F 2W4BA 2OEVA 1Z7Qc 1NU7D 5B1BC 5CI8A 1LKXA 4C3BA 2I15A 5COGA 1TWGA 1FFHA 3JRTA 4LDRA 3CAXA 1HE1A 1OW8A 3U0CA 1LS4A 4E18A 4PJJA 2KGOA 2B0HA 2LFDA 2CW0F 2LIGA 3QMKA 2ZXOA 3AOUA 1YLMA 1Z3IX 4XPXA 3R2PA 2O9XA 1M2VA 2HSBA 4OIPF 4CDYA 3GM3A 3JRMO 2VASA 4LDQA 3EZIA 5DLJA 3SEOA 4CDAA 2M4EA 2KYHA 2NUPA 2WB7A 3DI5A 1A0BA 3EGDA 4H4KC 3S28A 4PJMA 2C03A 5EGYA 1RMVA 2CYDA 1C03A 1MMDA 1HMDA 1T6QA 2GA0A 4JJGA 4MVRA 4RD9A 1QQ3A 4EIYA 1ZVZA 2OEXA 3UMHA 3CSKA 1SF8A 3JT1A 3L1MA 1TQGA 1EA8A 1AVOB 4J7YA 2J7PD 2KK1A 2Q9BA 3GORA 4H54A 4R32A 4DVYP 3EFOA 4E7SA 3TD7A 4BJ5C 2MYSA 4E7ZA 4G7HF 2A69F 1XZQA 3NYLA 1LS1A 5L0HA 2R7SA 2XL6A 1F1MA 1A7EA 5B1AC 1C02A 1GS9A 2MHRA 1S7ZA 2LK4A 2B0JA 2QY9A 4Q7CA 4JCZA 3S29A 2Q9CA 4LLEA 2NUTB 2WL8A 5CIVA 2ETSA 4JVSA 4NQFA 3AG1C 3N2ZB 4CJOA 4IWBA 3JZ0A 3W8HA 1YYJA 3I5PA 3RKOF 3B71A 4DJ9A 2H7BA 3SXMA 2OJED 4AE4A 3JYYA 3IPMO 2Q9AA 1PV3A 4ER9A 2KJGA 5KYXA 4E0HA 3LEOA 1GGQA 3BEHA 4YT8A 1D0XA 3AGUA 1M2OA 4RDAA 2DYSC 2YL7A 4K0DA 4KNVA 3AJMA 2P7VA 5AC5A 4MVUA 4G7OF 2W45A 3X2QC 1OCZC 4I44A 5A6BD 2ICWG 3LESA 2ZXPA 1EKYA 3H2UA 1T9KA 1OR2A 3DJNB 1HW1A 1A41A 3EHMA 4QDLA 4DBQA 3C8GD 2FGYA 2EIKC 2J9VA 2QLAA 3FOOA 4YT5A 4CJGA 2LD6A 2J46A 1QZXA 1NLXA 2W9YA 3DM9B 3LUTB 4U9EA 1WWPA 3SXYA 1SR2A 2XS8A 3DAFA 1TWAA 1QPUA 4BJ6A 2VCAA 4YJWA 1G5ZA 1G4US 1RKEA 1T6UA 2EPMX 3C8ZA 1T01A 1OW7A 1D0YA 2EILC 1TWCA 4PACA 4U5FE 3O10A 1WATA 1K05A 4HFFB 1OW6A 2MWQA 4EBKA 3NMKA 2XLDA 2YLIA 3A11A 1FMVA 4K1OA 2LP4A 2J9BA 1VOMA 3SYNA 5KYNA 1OKKD 1PD0A 3ASNC 4YL3A 2L6FA 5BQGA 4EUKB 2CDQA 2HJMA 2LCHA 3QW0A 4DOZA 1OCCC 1CGME 2Q00A 4M63A 2OG2A 2BL2A 4PFOA 3VYWA 2PF4E 2XLHA 3GEHA 5FZTA 3AGTA 2KW3C 3AQCA 3HNKA 5KYUA 3W8IA 4CS7A 3UGOA 2IXPA 2CGEA 3DE9A 2R7TA 1TR2A 3WAQA 2Y69C 2P61A 1MNDA 2W4MA 1QSPA 3HTKC 3JYHA 4O79A 5JP7A 1PD1A 3SNHA 2AWYA 1WN0A 1VMAA 3UGPA 1LE2A 3NRHA 1LE4A 3S0XA 4FWVA 3CEXA 5COFA 4DRHB 4JRZA 2J7PA 1M2VB 1VYIA 1V4AA 3MYFA 2IBFA 2V26A 4XEVA 3JSZA 3MBGA 5JUAA 4CS8C 2NSFA 1R5ID 3DKAA 3ZQYA 4WGZA 2M64A 2A1DD 1K40A 4A4AA 5DS4A 5KYWA 1E86A 1YARO 4CSAA 1NFNA 3EH2A 5T1DB 2XXAA 2E87A 3CQZA 3H65A 3L34A 3FDQA 2V3CC 4BEJA 4ZLCA 4ONSA 3TQOA 1NG1A 3EFOB 3IEEA 1WGWA 3EPVA 3HKKA 3V5XA 2KSFA 2G3VA 4JCHA 5CI9A 5L3QA 4JE9A 2F22A 5BQHA 3M15A 3UNGC 3K6BA 2PFDA 3GODA 3NKEA 3RIPA 3BRJA 4GEHA 4Z9IA 3FVYA 3VM6A 1M6TA 4MTOA 2XLMA 2GAQA 3A9CA 3KKBA 1JAFA 3TOMA 3GM2A 2OCCC 5DS6A 4PK4A 3M4CA 2WZFA 2IOQA 2YLDA 3T6BA 1T6IA 4J32B 1H9GA 3MYIA 4MVQA 2OU6A 4U5EE 4C7OA 3LLIA 2CNWD 2VB6A 4AE4B 1MMAA 1ZHYA 1Q0MA 3N24A 3ZC4A 3RQEA 5L0IA 4NY3A 5KYXB 1Z63A 2JD3A 1LPEA 3SXZA 1WTYA 2XM0A 2Z15A 3ATPA 3V5YA 4E0IA 4BG0A 4WJ0A 3F46A 5TJ5E 3NG1A 3U8PA 1ZHWA 2BE5F 3U9JA 1YJGA 3PMRA 4LLCA 4U5CE 3B0VC 2R7WA 3IQCA 2XL4A 3EG9B 3C7JA 4XWJA 2Q4FA 1RJ9A 2EPOA 4B6IA 3N0TA 2EPNA 3ABLC 3AG3C 3NYMA 3U5SA 5A6JA 3H2VA 2EIJC 4X0RA 4C3DA 1FNTc 4OIQF 1A7DA 2P6VA 4XQ1A 1FMWA 2Q7RA 1J8MF 3KMIA 1YA9A 3E9VA 2PBEA 1V54C 3TULA 3SP1A 1V74B 2H7VC 3ZTMA 1Q0DA 1DOVA 2GFHA 5L0CA 2OOCA 2YWAA 2QE9A 3LS0A 2Y3HA 4YL0A 3VAYA 1RKEB 2D5RB 3DZAA 3JSEO 1L3PA 4OINF 2LSEA 2Q3TA 5KYYB 1CGOA 3IHUA 3LJBA 4BEMJ 1Q0KA 3OA1A 4HEAJ 3W2VA 2AP3A 4FESA 1YYXA 2DGJA 4N06A 1IW7F 2R7QA 5JLIA 3G4XA 3O39A 2YQYA 4IARA 4IRUA 2XRHA 5GPGB 2YZSA 2XM4A 2WVOA 1IZMA 2XLOA 2ZXWC 5KYUB 1VYKA 5D92A 4MTFA 2L7AA 4YK5A 1JRAA 2WZLA 3RFYA 3HNJA 4MTGA 3S84A 2UUHA 4MW8A 1FFTC 3J06A 1CGNA 3KH2A 1J8YF 2OKUA 2G62A 3RH3A 4Q5SF 3K1IC 2UUIA 2VC9A 4U9DA 1N1CA 3B0UX 4JEBA 4XPYA 4JTAB 4XEFA 4U5BE 2WVNA 2HKVA 5E3CA 3C63A 1OXBA 2FFHA 4BJ6C 2HS5A 5F5HA 1YZCA 3U8VA 1OXKA 3IQTA 3QVZA 3PDMP 1O3UA 3QW1A 2X0CA 4AL0A 1QLEC 5E3AA 2GDCA 3EGXA 3FMSA 1D1AA 4G7ZF 3W4YA 3LLKA 4CX9A 4CIPA 3CZ6A 1SMYF 2HSQA 3OWTA 4MVZA 1SYQA 1CPRA 1YZAA 4GQHA 5JT4A 2DB4A 4YT4A 3ZDLA 2YL3A 4J7TA 1UG7A 1XZPA 1K04A 2P0NA 4PJLA 4AK9A 4DBRA 1ZHXA 2KC3A 4KC9A 2Y3BA 3NMIA 5A6KA 1W2WA 2KQ9A 1R4TA 2CNWA 3DMDA 4NTFA 1VB5A 2XS1A 3ECSA 2D4UA 3Q7LA 1Z6AA 1VLSA 1ZW2A 2LQGA 4JJFA 3RYLA 3UMIA 5BUOA 4N6CA 5L0GA 2HV6A 5HSWA 1JMWA 2X51A 5A69A 4P6IC 4BPMA 4YL1A 4NCQA 4C3EA 2PNOA 4MW3A 3HLZA 4XPWA 4AL1A 5L3VA 3FHDA 1E2XA 4CS9A 2XLWA 1ORYA 2R03A 2YRFA 1O5HA 3C18A 4MVSA 3S9OA 1LM3B 2P1AA 2J9UA 3IQ5A 4JIOA 4F4BA 2PP4A 4YT2A 4NC3A 3RF3A 4WGYA 1H6GA 4I1MA 1JOGA 5K0IA 1OCRC 1H9TA 4CSAC 1G4WR 5AGFA 2VCCA 3TK0A 2I8BA 2NUPB 1FAPB 3EGDB 1RJ9B 2GWWA 3OEOA 1D1BA 3S27A 1LVKA 1YDIA 1BR4A 1BBHA 2J0WA 4IAOA 3U3FA 2NSGA 1YVIA 1AEPA 3DXJF 4OIOF 3GWNA 4HE8D 3R7CA 3EHNA 1LI7A 3VRCA 4A2NB 2WVQA 2R7XA 3GANA 4U5GA 2YEVA 3AG2C 1Z5ZA 3K1HA 1OQCA 2HV7A 4ANJA 4I3MA 3WHNA 4PFPA 1NFOA 1S05A 2NG1A 1ZU5A 5COMA 2QTVA 5AC4A 4JTDB 3US6A 1B68A 3FAPB 2HMQA 3K66A 4GYTA 4K7BA 1Z23A 1ZU4A 2LFFA 2ZD9A 3K7DA 3WG7C 5B3IA 5DQTA 4O6MA 2XLVA 1JPJA 1EQ1A 2FAPB 3B0PA 5A6BA 256BA 3F47A 1WOLA
chains in the Genus database with same CATH topology
3U9JA 2P0NA 3V5XA 3U9MA 3V5ZA 3V5YA 3CAXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U9J A;  2P0N A;  3V5X A;  3U9M A;  3V5Z A;  3V5Y A;  3CAX A; 
#chains in the Genus database with same CATH topology
 1JR8 A;  3UMK A;  1FTS A;  2NPU A;  2L81 A;  3EQL F;  4Z9J A;  4BJ1 A;  3RVZ A;  2ZXR A;  3C8G A;  2R02 A;  3T9O A;  4AX2 A;  1G8X A;  1UFB A;  2DI3 A;  1YAU O;  1U6H A;  2EIN C;  5T3W A;  3O55 A;  1OR3 A;  4IB4 A;  1ORJ A;  4G78 A;  5E2Q A;  1BZ4 A;  3SXK A;  4EKW A;  3I5Q A;  2L6G A;  1TKN A;  4IGG A;  1MMG A;  1RXQ A;  4CIH A;  1WAS A;  4O6Y A;  3UR3 C;  3MLG A;  3T6J A;  4JZA A;  4EHP A;  4ZLD A;  3LNM B;  2IXM A;  2YHS A;  3AQB A;  3EGX B;  3HJC A;  4P9F A;  3V5Z A;  1OKK A;  4OD4 A;  1APC A;  4U5H A;  4QI2 A;  3LEV A;  3EZH A;  1HW2 A;  3QVY A;  1H7I A;  3G50 A;  2H8A A;  4ULW A;  5JSL A;  1RKC A;  1QKR A;  5D91 A;  3LS1 A;  3PHF 2;  3Q6M A;  1Q0G A;  4E17 A;  1YA7 O;  3FAJ A;  2HZ8 A;  2QUP A;  3DJU B;  3QZC A;  4NTA A;  3RW0 A;  1TFO B;  3L8J A;  3ABM C;  3NDB B;  4I1O B;  4FX5 A;  2R7U A;  2IXN A;  2HJ3 A;  3T6G B;  4NTB A;  3U3B A;  3S90 A;  4OIR F;  2AU5 A;  4JW1 A;  3ZTZ A;  1NSG B;  1V55 C;  1T5O A;  2EPK X;  1NU9 C;  3U2L A;  1OCO C;  2Y3G A;  4DRJ B;  1DOW A;  4N4W A;  4EBB A;  3MX3 A;  2J8W A;  4KNW A;  4BJ5 A;  4JC7 A;  3EH1 A;  5EHH A;  1KTM A;  4IJJ A;  5A6A A;  3I4U A;  5DS5 A;  2IYL D;  2EIM C;  2CCY A;  1ZHZ A;  2A6H F;  5HV9 A;  3EJN A;  3Q6N A;  2R25 A;  3DAG A;  4Q4Z F;  2ASR A;  3AG4 C;  3ASO C;  1BR1 A;  3U9M A;  2XSE A;  1KU2 A;  1ZYR F;  1TFK B;  2JX0 A;  4MVM A;  5JRA A;  1E84 A;  3ABK C;  3HNL A;  3L8I A;  5KYW B;  4LER A;  4U5D E;  2OJQ A;  2RD9 A;  1RCP A;  2BC5 A;  5BQI A;  2PX3 A;  5FCL A;  4PJN A;  3SZR A;  3K33 A;  2XXA B;  3U2M A;  4JTC B;  1FR0 A;  2R7O A;  1VK5 A;  3DE8 A;  4RBN A;  4WAB A;  3M79 A;  1ZHT A;  3EG9 A;  3ZG1 A;  2DYR C;  5L0J A;  2TMV P;  4MVO A;  3B29 A;  1BR2 A;  2XLE A;  1NZE A;  3Q7G A;  5JVE A;  4DVZ A;  1D0Z A;  3KYI A;  4LAC B;  4UDV A;  2R7R A;  5IY5 C;  2Y39 A;  1ST6 A;  1ZZP A;  2J0X A;  2KNH A;  2ZPA A;  3K1I A;  3KL4 A;  4J30 B;  4CBE A;  2R05 A;  4CDV A;  5B3S C;  1LIH A;  2J9W A;  1I4Z A;  3X1O A;  4CS9 C;  4EWC A;  3L0I A;  1XWJ A;  4JEA A;  2OQM A;  2AVK A;  3C62 A;  5EK0 A;  3TOL A;  3NKD A;  3ZVR A;  2A0B A;  1VTM P;  3ZWI A;  2JPU A;  4O7G A;  4DRI B;  4C7O B;  3IQ6 A;  4Z9H A;  5KYY A;  1Q0F A;  3DWW A;  2Y3D A;  4QI0 A;  3KPH A;  5JS5 A;  3GEE A;  4IAQ A;  2NUT A;  4MS2 A;  1HE9 A;  1AUE A;  1LI5 A;  2XL8 A;  1Y6D A;  3W2W A;  4BJT A;  4XEK A;  1HMO A;  3POV A;  3C8G B;  3RQF A;  1MQV A;  2AWC A;  3M4B A;  1NBB A;  4L6R A;  1E85 A;  4OD5 A;  1I5N A;  2IM8 A;  3RQG A;  3GEI A;  2C04 A;  2VH3 A;  1M57 C;  2HUJ A;  3LAY A;  4HFK B;  4O6N A;  4XTK A;  1C17 M;  1QVX A;  2G3K A;  2YKZ A;  4W8K A;  3WOD F;  3B9Q A;  3QTH A;  5F28 E;  3RVY A;  2HMZ A;  4D4X A;  5DVW A;  3DM5 A;  1L7C A;  3PCV A;  1ZW3 A;  2YLG A;  3GWL A;  1BDJ B;  4JUR I;  3JCU Q;  4FAP B;  3E70 C;  3VF0 A;  2A68 F;  2YVK A;  3GM1 A;  4P9T A;  4ULV A;  1MNE A;  2YL0 A;  3M1C B;  2IXO A;  1GQA A;  4YWQ A;  4JKV A;  1SZI A;  1GM5 A;  2VCB A;  3ITF A;  1HY5 A;  3LNR A;  3FOP A;  1E83 A;  2RSE B;  3G4Z A;  1M56 C;  1VLT A;  4LDK A;  4EBJ A;  4KI2 A;  2A6E F;  1Y4C A;  1ORS C;  3FXH A;  3NYJ A;  2L9J A;  1PCX A;  4W8P A;  2YL1 A;  1CPQ A;  3V7O A;  3TJ6 A;  5T3T A;  1U89 A;  3JTL O;  3MFN A;  4CS8 A;  4DXW A;  4KBL A;  2H7O A;  4MND A;  4N6H A;  2L6H A;  3HNI A;  5F5F A;  1MMN A;  1KNY A;  1I4Y A;  2J45 A;  3DD7 A;  1A7V A;  5E33 A;  5L0F A;  4YN0 B;  2WZG A;  3ZQV A;  1EI7 A;  4D4N A;  2QNL A;  4XLP F;  2HFI A;  2A0U A;  3O6X A;  5L0D A;  1U0B B;  4G0H A;  2R9R B;  3TJ5 A;  2PX0 A;  1D1C A;  2R7V A;  4XLN F;  1TWH A;  1JPN A;  4PR9 A;  5DQZ A;  3NMJ A;  1O87 A;  3ZSU A;  3T4R A;  2EPL X;  3ZIB A;  3KYJ A;  4MQ9 F;  2W4B A;  2OEV A;  1Z7Q c;  1NU7 D;  5B1B C;  5CI8 A;  1LKX A;  4C3B A;  2I15 A;  5COG A;  1TWG A;  1FFH A;  3JRT A;  4LDR A;  3CAX A;  1HE1 A;  1OW8 A;  3U0C A;  1LS4 A;  4E18 A;  4PJJ A;  2KGO A;  2B0H A;  2LFD A;  2CW0 F;  2LIG A;  3QMK A;  2ZXO A;  3AOU A;  1YLM A;  1Z3I X;  4XPX A;  3R2P A;  2O9X A;  1M2V A;  2HSB A;  4OIP F;  4CDY A;  3GM3 A;  3JRM O;  2VAS A;  4LDQ A;  3EZI A;  5DLJ A;  3SEO A;  4CDA A;  2M4E A;  2KYH A;  2NUP A;  2WB7 A;  3DI5 A;  1A0B A;  3EGD A;  4H4K C;  3S28 A;  4PJM A;  2C03 A;  5EGY A;  1RMV A;  2CYD A;  1C03 A;  1MMD A;  1HMD A;  1T6Q A;  2GA0 A;  4JJG A;  4MVR A;  4RD9 A;  1QQ3 A;  4EIY A;  1ZVZ A;  2OEX A;  3UMH A;  3CSK A;  1SF8 A;  3JT1 A;  3L1M A;  1TQG A;  1EA8 A;  1AVO B;  4J7Y A;  2J7P D;  2KK1 A;  2Q9B A;  3GOR A;  4H54 A;  4R32 A;  4DVY P;  3EFO A;  4E7S A;  3TD7 A;  4BJ5 C;  2MYS A;  4E7Z A;  4G7H F;  2A69 F;  1XZQ A;  3NYL A;  1LS1 A;  5L0H A;  2R7S A;  2XL6 A;  1F1M A;  1A7E A;  5B1A C;  1C02 A;  1GS9 A;  2MHR A;  1S7Z A;  2LK4 A;  2B0J A;  2QY9 A;  4Q7C A;  4JCZ A;  3S29 A;  2Q9C A;  4LLE A;  2NUT B;  2WL8 A;  5CIV A;  2ETS A;  4JVS A;  4NQF A;  3AG1 C;  3N2Z B;  4CJO A;  4IWB A;  3JZ0 A;  3W8H A;  1YYJ A;  3I5P A;  3RKO F;  3B71 A;  4DJ9 A;  2H7B A;  3SXM A;  2OJE D;  4AE4 A;  3JYY A;  3IPM O;  2Q9A A;  1PV3 A;  4ER9 A;  2KJG A;  5KYX A;  4E0H A;  3LEO A;  1GGQ A;  3BEH A;  4YT8 A;  1D0X A;  3AGU A;  1M2O A;  4RDA A;  2DYS C;  2YL7 A;  4K0D A;  4KNV A;  3AJM A;  2P7V A;  5AC5 A;  4MVU A;  4G7O F;  2W45 A;  3X2Q C;  1OCZ C;  4I44 A;  5A6B D;  2ICW G;  3LES A;  2ZXP A;  1EKY A;  3H2U A;  1T9K A;  1OR2 A;  3DJN B;  1HW1 A;  1A41 A;  3EHM A;  4QDL A;  4DBQ A;  3C8G D;  2FGY A;  2EIK C;  2J9V A;  2QLA A;  3FOO A;  4YT5 A;  4CJG A;  2LD6 A;  2J46 A;  1QZX A;  1NLX A;  2W9Y A;  3DM9 B;  3LUT B;  4U9E A;  1WWP A;  3SXY A;  1SR2 A;  2XS8 A;  3DAF A;  1TWA A;  1QPU A;  4BJ6 A;  2VCA A;  4YJW A;  1G5Z A;  1G4U S;  1RKE A;  1T6U A;  2EPM X;  3C8Z A;  1T01 A;  1OW7 A;  1D0Y A;  2EIL C;  1TWC A;  4PAC A;  4U5F E;  3O10 A;  1WAT A;  1K05 A;  4HFF B;  1OW6 A;  2MWQ A;  4EBK A;  3NMK A;  2XLD A;  2YLI A;  3A11 A;  1FMV A;  4K1O A;  2LP4 A;  2J9B A;  1VOM A;  3SYN A;  5KYN A;  1OKK D;  1PD0 A;  3ASN C;  4YL3 A;  2L6F A;  5BQG A;  4EUK B;  2CDQ A;  2HJM A;  2LCH A;  3QW0 A;  4DOZ A;  1OCC C;  1CGM E;  2Q00 A;  4M63 A;  2OG2 A;  2BL2 A;  4PFO A;  3VYW A;  2PF4 E;  2XLH A;  3GEH A;  5FZT A;  3AGT A;  2KW3 C;  3AQC A;  3HNK A;  5KYU A;  3W8I A;  4CS7 A;  3UGO A;  2IXP A;  2CGE A;  3DE9 A;  2R7T A;  1TR2 A;  3WAQ A;  2Y69 C;  2P61 A;  1MND A;  2W4M A;  1QSP A;  3HTK C;  3JYH A;  4O79 A;  5JP7 A;  1PD1 A;  3SNH A;  2AWY A;  1WN0 A;  1VMA A;  3UGP A;  1LE2 A;  3NRH A;  1LE4 A;  3S0X A;  4FWV A;  3CEX A;  5COF A;  4DRH B;  4JRZ A;  2J7P A;  1M2V B;  1VYI A;  1V4A A;  3MYF A;  2IBF A;  2V26 A;  4XEV A;  3JSZ A;  3MBG A;  5JUA A;  4CS8 C;  2NSF A;  1R5I D;  3DKA A;  3ZQY A;  4WGZ A;  2M64 A;  2A1D D;  1K40 A;  4A4A A;  5DS4 A;  5KYW A;  1E86 A;  1YAR O;  4CSA A;  1NFN A;  3EH2 A;  5T1D B;  2XXA A;  2E87 A;  3CQZ A;  3H65 A;  3L34 A;  3FDQ A;  2V3C C;  4BEJ A;  4ZLC A;  4ONS A;  3TQO A;  1NG1 A;  3EFO B;  3IEE A;  1WGW A;  3EPV A;  3HKK A;  3V5X A;  2KSF A;  2G3V A;  4JCH A;  5CI9 A;  5L3Q A;  4JE9 A;  2F22 A;  5BQH A;  3M15 A;  3UNG C;  3K6B A;  2PFD A;  3GOD A;  3NKE A;  3RIP A;  3BRJ A;  4GEH A;  4Z9I A;  3FVY A;  3VM6 A;  1M6T A;  4MTO A;  2XLM A;  2GAQ A;  3A9C A;  3KKB A;  1JAF A;  3TOM A;  3GM2 A;  2OCC C;  5DS6 A;  4PK4 A;  3M4C A;  2WZF A;  2IOQ A;  2YLD A;  3T6B A;  1T6I A;  4J32 B;  1H9G A;  3MYI A;  4MVQ A;  2OU6 A;  4U5E E;  4C7O A;  3LLI A;  2CNW D;  2VB6 A;  4AE4 B;  1MMA A;  1ZHY A;  1Q0M A;  3N24 A;  3ZC4 A;  3RQE A;  5L0I A;  4NY3 A;  5KYX B;  1Z63 A;  2JD3 A;  1LPE A;  3SXZ A;  1WTY A;  2XM0 A;  2Z15 A;  3ATP A;  3V5Y A;  4E0I A;  4BG0 A;  4WJ0 A;  3F46 A;  5TJ5 E;  3NG1 A;  3U8P A;  1ZHW A;  2BE5 F;  3U9J A;  1YJG A;  3PMR A;  4LLC A;  4U5C E;  3B0V C;  2R7W A;  3IQC A;  2XL4 A;  3EG9 B;  3C7J A;  4XWJ A;  2Q4F A;  1RJ9 A;  2EPO A;  4B6I A;  3N0T A;  2EPN A;  3ABL C;  3AG3 C;  3NYM A;  3U5S A;  5A6J A;  3H2V A;  2EIJ C;  4X0R A;  4C3D A;  1FNT c;  4OIQ F;  1A7D A;  2P6V A;  4XQ1 A;  1FMW A;  2Q7R A;  1J8M F;  3KMI A;  1YA9 A;  3E9V A;  2PBE A;  1V54 C;  3TUL A;  3SP1 A;  1V74 B;  2H7V C;  3ZTM A;  1Q0D A;  1DOV A;  2GFH A;  5L0C A;  2OOC A;  2YWA A;  2QE9 A;  3LS0 A;  2Y3H A;  4YL0 A;  3VAY A;  1RKE B;  2D5R B;  3DZA A;  3JSE O;  1L3P A;  4OIN F;  2LSE A;  2Q3T A;  5KYY B;  1CGO A;  3IHU A;  3LJB A;  4BEM J;  1Q0K A;  3OA1 A;  4HEA J;  3W2V A;  2AP3 A;  4FES A;  1YYX A;  2DGJ A;  4N06 A;  1IW7 F;  2R7Q A;  5JLI A;  3G4X A;  3O39 A;  2YQY A;  4IAR A;  4IRU A;  2XRH A;  5GPG B;  2YZS A;  2XM4 A;  2WVO A;  1IZM A;  2XLO A;  2ZXW C;  5KYU B;  1VYK A;  5D92 A;  4MTF A;  2L7A A;  4YK5 A;  1JRA A;  2WZL A;  3RFY A;  3HNJ A;  4MTG A;  3S84 A;  2UUH A;  4MW8 A;  1FFT C;  3J06 A;  1CGN A;  3KH2 A;  1J8Y F;  2OKU A;  2G62 A;  3RH3 A;  4Q5S F;  3K1I C;  2UUI A;  2VC9 A;  4U9D A;  1N1C A;  3B0U X;  4JEB A;  4XPY A;  4JTA B;  4XEF A;  4U5B E;  2WVN A;  2HKV A;  5E3C A;  3C63 A;  1OXB A;  2FFH A;  4BJ6 C;  2HS5 A;  5F5H A;  1YZC A;  3U8V A;  1OXK A;  3IQT A;  3QVZ A;  3PDM P;  1O3U A;  3QW1 A;  2X0C A;  4AL0 A;  1QLE C;  5E3A A;  2GDC A;  3EGX A;  3FMS A;  1D1A A;  4G7Z F;  3W4Y A;  3LLK A;  4CX9 A;  4CIP A;  3CZ6 A;  1SMY F;  2HSQ A;  3OWT A;  4MVZ A;  1SYQ A;  1CPR A;  1YZA A;  4GQH A;  5JT4 A;  2DB4 A;  4YT4 A;  3ZDL A;  2YL3 A;  4J7T A;  1UG7 A;  1XZP A;  1K04 A;  2P0N A;  4PJL A;  4AK9 A;  4DBR A;  1ZHX A;  2KC3 A;  4KC9 A;  2Y3B A;  3NMI A;  5A6K A;  1W2W A;  2KQ9 A;  1R4T A;  2CNW A;  3DMD A;  4NTF A;  1VB5 A;  2XS1 A;  3ECS A;  2D4U A;  3Q7L A;  1Z6A A;  1VLS A;  1ZW2 A;  2LQG A;  4JJF A;  3RYL A;  3UMI A;  5BUO A;  4N6C A;  5L0G A;  2HV6 A;  5HSW A;  1JMW A;  2X51 A;  5A69 A;  4P6I C;  4BPM A;  4YL1 A;  4NCQ A;  4C3E A;  2PNO A;  4MW3 A;  3HLZ A;  4XPW A;  4AL1 A;  5L3V A;  3FHD A;  1E2X A;  4CS9 A;  2XLW A;  1ORY A;  2R03 A;  2YRF A;  1O5H A;  3C18 A;  4MVS A;  3S9O A;  1LM3 B;  2P1A A;  2J9U A;  3IQ5 A;  4JIO A;  4F4B A;  2PP4 A;  4YT2 A;  4NC3 A;  3RF3 A;  4WGY A;  1H6G A;  4I1M A;  1JOG A;  5K0I A;  1OCR C;  1H9T A;  4CSA C;  1G4W R;  5AGF A;  2VCC A;  3TK0 A;  2I8B A;  2NUP B;  1FAP B;  3EGD B;  1RJ9 B;  2GWW A;  3OEO A;  1D1B A;  3S27 A;  1LVK A;  1YDI A;  1BR4 A;  1BBH A;  2J0W A;  4IAO A;  3U3F A;  2NSG A;  1YVI A;  1AEP A;  3DXJ F;  4OIO F;  3GWN A;  4HE8 D;  3R7C A;  3EHN A;  1LI7 A;  3VRC A;  4A2N B;  2WVQ A;  2R7X A;  3GAN A;  4U5G A;  2YEV A;  3AG2 C;  1Z5Z A;  3K1H A;  1OQC A;  2HV7 A;  4ANJ A;  4I3M A;  3WHN A;  4PFP A;  1NFO A;  1S05 A;  2NG1 A;  1ZU5 A;  5COM A;  2QTV A;  5AC4 A;  4JTD B;  3US6 A;  1B68 A;  3FAP B;  2HMQ A;  3K66 A;  4GYT A;  4K7B A;  1Z23 A;  1ZU4 A;  2LFF A;  2ZD9 A;  3K7D A;  3WG7 C;  5B3I A;  5DQT A;  4O6M A;  2XLV A;  1JPJ A;  1EQ1 A;  2FAP B;  3B0P A;  5A6B A;  256B A;  3F47 A;  1WOL A; 
#chains in the Genus database with same CATH homology
 3U9J A;  2P0N A;  3V5X A;  3U9M A;  3V5Z A;  3V5Y A;  3CAX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...