2P0NA

Nmb1532 protein from neisseria meningitidis, unknown function
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
161
structure length
161
Chain Sequence
b'VTFAEPIEMLYACHGKVRRFCGQVAMLSDYIAENGCNQIVLQTIRQIAQYFNVAAPLHHEDEEENFFPLLLQYAPQAQESVDELLRQHIGLHDNWAAVSAEFAKLEADNAYVPDEEAFKRFVAGYDVHLAIEEPLFDMGNTFIPKEKLTEIGEIMAARRRK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein NMB1532
publication title X-ray crystal structure of NMB1532 protein of unknown function from Neisseria meningitidis.
rcsb
source organism Neisseria meningitidis
molecule tags Structural genomics, unknown function
total genus 65
structure length 161
sequence length 161
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01814 Hemerythrin Hemerythrin HHE cation binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.520 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) nmb1532 protein domain like 2p0nA00
2P0NA 3V5XA 3U9MA 3U9JA 3V5ZA 3CAXA 3V5YA
chains in the Genus database with same CATH superfamily
1JR8A 2M64A 2B0HA 3GEEA 4YL1A 5L0GA 5BQIA 4UDVA 4YJWA 1YDIA 3MFNA 3NDBB 4N06A 5L0HA 2CW0F 2R7QA 3WHNA 2D4UA 3GEIA 1QZXA 3K1IC 4WABA 1VK5A 2OQMA 2CNWA 3MBGA 2NUPA 3ZWIA 1ORYA 3ZVRA 5KYWA 1M56C 2LFDA 4MVZA 2I8BA 4XPWA 1C17M 5KYYB 2R7XA 3A9CA 1OKKA 2XXAA 4I1OB 3LJBA 3C8ZA 4YT5A 1OCRC 1TR2A 1VLSA 4DRHB 2Q3TA 5L0CA 1FR0A 2HMQA 3DWWA 5FZTA 1FFHA 1ZHYA 5EK0A 5B3SC 1I4ZA 4U5DE 2BC5A 5FCLA 3UMIA 5GPGB 4BJ5A 2PP4A 2GA0A 1JRAA 2XLMA 3V5XA 3ZC4A 2EIKC 2VC9A 4H4KC 3EFOB 1Z23A 1V4AA 2R03A 2J45A 3RQGA 4JCZA 5L3QA 4X0RA 2YEVA 2XLEA 2X51A 1GQAA 2Y3DA 2FGYA 1CGNA 3TJ5A 1Q0KA 4XEVA 3IEEA 4KNVA 5JUAA 1HW2A 4QI0A 3DJUB 4JJFA 2YLIA 3VF0A 4C3BA 5AC5A 5K0IA 5HSWA 1OCCC 3HLZA 1OCZC 1BBHA 2J8WA 2XLDA 4JEBA 2PF4E 4DJ9A 3RKOF 1J8MF 2P7VA 4Q7CA 3U3BA 4M63A 4NQFA 1B68A 1D1BA 1Z63A 1A7DA 3KPHA 4L6RA 3NKEA 2QUPA 2HV6A 2CGEA 2Y3GA 1Y6DA 2J9VA 1APCA 2FAPB 3N24A 4EIYA 4J7TA 4JTCB 3W2WA 4RDAA 3ASNC 4KBLA 1YA9A 3B0PA 1E2XA 3EHNA 2F22A 2P61A 5JSLA 3LESA 2A0UA 3FOOA 3L8JA 3LEVA 4ULVA 1A0BA 2Y3BA 3G50A 3RW0A 4CIPA 1PD0A 2C03A 2EPMX 4J7YA 4EBKA 4PK4A 5A6KA 1SZIA 2WL8A 1ORSC 3NMIA 3U2MA 1TQGA 3O6XA 5A6BA 3EGXB 4KI2A 1TWGA 4WGZA 4MVQA 1GS9A 1L3PA 3EQLF 5DS5A 2HSBA 4DVYP 3EGDA 1O3UA 1V74B 2L9JA 2Q00A 4YWQA 1OR3A 1K04A 1DOWA 3JSZA 4CDAA 1NBBA 2EILC 4IGGA 4EHPA 1KU2A 4XLPF 1E84A 2Q9BA 2QY9A 4DBQA 2QNLA 4YK5A 2W9YA 4W8PA 1HW1A 2LP4A 1BZ4A 3NKDA 2W4MA 4IRUA 1MMNA 3EG9B 3U8PA 2IM8A 2PX0A 3EZIA 3O55A 5KYUA 1WATA 2G3KA 1UG7A 1AVOB 3EH1A 4LLCA 5BQHA 4Z9HA 4Z9JA 3N2ZB 2G62A 2QE9A 4LLEA 2OJQA 3NG1A 3PDMP 2J0WA 1O87A 1OCOC 1A41A 3QTHA 5COGA 1OKKD 1G4US 2I15A 1VB5A 2R9RB 3QW1A 1HE1A 2OG2A 2J46A 4G7ZF 256BA 3AJMA 3JCUQ 2J0XA 2TMVP 3RIPA 1HE9A 4O7GA 1RMVA 3TD7A 1TKNA 2LQGA 4HFFB 2P0NA 5E2QA 3KKBA 3S84A 5AGFA 3NMJA 2G3VA 3RVZA 2EPLX 3AG4C 3I4UA 1EA8A 2VCBA 4NCQA 3WAQA 1OQCA 3O10A 4EWCA 4XLNF 1NU7D 2M4EA 3T6GB 2KC3A 4C7OB 1WGWA 1RKEA 2YHSA 1BR2A 2XL4A 3ATPA 1SYQA 4I44A 1LE4A 2CCYA 2DB4A 2LK4A 3I5PA 2A6EF 4I1MA 3IQCA 1T6QA 4JJGA 3C7JA 3M1CB 3DMDA 3LNRA 1JAFA 1K05A 4O6MA 5DVWA 4JZAA 3RYLA 2H8AA 2HUJA 1ZU5A 2LCHA 3E70C 4G0HA 2R7RA 4OIPF 3OWTA 3S27A 2ZXWC 3K66A 2MYSA 1D1CA 1PV3A 3KH2A 2V26A 3VM6A 4AL0A 1T9KA 4KNWA 2XLVA 3QW0A 5F5FA 2R7WA 2X0CA 2H7VC 3DJNB 1H7IA 5E3AA 3DZAA 2R7SA 3RQEA 1QQ3A 3HKKA 3G4ZA 1XZPA 3TQOA 3K6BA 4A2NB 1ZYRF 4R32A 1Z6AA 3K33A 5BQGA 1T01A 1LS1A 4O79A 4OIRF 4U5EE 2HSQA 2NUPB 4K0DA 3NYJA 2HFIA 1QSPA 2IXNA 2YLGA 3BRJA 3JT1A 4PJJA 5F5HA 4GEHA 2PNOA 3UR3C 4GQHA 3T6BA 3GODA 1D1AA 3C63A 4HEAJ 5A6BD 3ZSUA 3MX3A 2A6HF 2ZXOA 5JS5A 1YARO 2QLAA 2Y69C 3CEXA 3U9MA 4C3EA 5TJ5E 1N1CA 4JKVA 4BJ5C 1TFOB 2D5RB 3DM5A 2J9BA 1H6GA 2Q9AA 2XSEA 4MTGA 2C04A 3FAPB 3US6A 1XWJA 3ABLC 2YWAA 2YL7A 2MHRA 4PJMA 3ABKC 1OW6A 2J7PA 1LIHA 3GORA 3SXYA 4ER9A 2A1DD 1ORJA 3GWNA 2LD6A 5T3TA 4YT8A 2OOCA 3L8IA 1FFTC 2CDQA 1ZHWA 5DQZA 4CJGA 2V3CC 1KNYA 2WZLA 4OINF 4LDRA 1CGOA 5DQTA 4NTBA 4LDKA 4XPXA 1BR1A 2WVOA 3L1MA 4AE4A 3RFYA 3ZTZA 2BL2A 4XWJA 4O6YA 3W2VA 2L6HA 4XQ1A 5JLIA 3QVZA 4QI2A 2Z15A 3ITFA 4CS8A 4CIHA 4IAQA 1H9GA 5B3IA 4C7OA 4BJ6A 3DAFA 3Q6NA 2WVQA 2OCCC 3T4RA 4JTDB 3S0XA 2NSGA 2W4BA 1TWAA 2A69F 3QVYA 3HNIA 3FMSA 4HFKB 1MMAA 4PJLA 1LS4A 3GWLA 2R25A 4PFOA 3ZQVA 2AVKA 3GM3A 4WJ0A 1IW7F 3MYFA 3SXZA 2JPUA 1T5OA 2EPKX 4ULWA 3U3FA 3EJNA 3DM9B 3F47A 3EH2A 2NSFA 2AP3A 4CS9A 1L7CA 4H54A 1NFNA 5D91A 1FTSA 3RVYA 1K40A 3EGDB 4XPYA 1G5ZA 1YLMA 2EINC 4RD9A 1TFKB 4MVSA 2XM4A 2YKZA 4KC9A 4U9EA 4W8KA 4BEMJ 1V55C 3NYLA 1UFBA 3ZTMA 3NRHA 1Q0MA 1GGQA 3UGOA 3VYWA 3QMKA 4F4BA 2XS1A 2YZSA 3HNLA 1Y4CA 3IQ6A 3W8HA 1D0YA 4U5HA 3CZ6A 1E83A 1YVIA 1YA7O 2L6FA 1M2OA 5L0DA 3C8GA 4D4NA 1G4WR 5KYXA 1TWCA 1QKRA 2R02A 2CNWD 1HY5A 4E7ZA 4JC7A 3WODF 2GAQA 3Q7LA 2UUHA 1G8XA 1W2WA 5L0JA 4CSAA 1JPJA 1D0ZA 1M2VB 2IXPA 4E0HA 1LI5A 3FXHA 3LAYA 1LM3B 2KNHA 1PD1A 4MVUA 2CYDA 5JRAA 3EGXA 2ASRA 3CSKA 4CDYA 1R4TA 5AC4A 4OIOF 3PMRA 3VAYA 3ZG1A 1E86A 1RKEB 2MWQA 4PR9A 2JD3A 4Q5SF 1YJGA 3M79A 4E0IA 5E33A 1JMWA 2PFDA 1A7VA 4E18A 4J30B 4LDQA 4J32B 1EQ1A 2H7BA 1R5ID 2FFHA 3DE9A 2ZD9A 3IQTA 4E7SA 3DI5A 2OU6A 3Q6MA 3S9OA 4IAOA 4BEJA 1MMGA 4C3DA 1RJ9A 3M15A 4XTKA 3K1HA 4AL1A 5JVEA 3PHF2 4ZLCA 4G7HF 4Q4ZF 2OEXA 2R7VA 3TULA 4U5BE 2NG1A 2XLOA 4DVZA 1YAUO 1AEPA 1YYJA 3KYJA 3UMKA 2O9XA 4WGYA 2OEVA 2KQ9A 3LLIA 3DKAA 3LS1A 2Y39A 3T9OA 2W45A 3EHMA 4EUKB 3AG1C 1Z5ZA 1EKYA 4MTFA 1CPQA 1QPUA 1LPEA 2ZPAA 4AX2A 3SYNA 1Q0DA 1JOGA 3DAGA 4ZLDA 4MNDA 3K7DA 3GANA 5BUOA 2R7UA 2HV7A 4JIOA 2ZXPA 1NU9C 1A7EA 1M6TA 3LUTB 5KYWB 2UUIA 3TK0A 1VTMP 4O6NA 1LKXA 4MQ9F 1FNTc 3FAJA 2AU5A 3L0IA 4G7OF 2XXAB 2KW3C 4BPMA 4EBJA 1D0XA 3N0TA 2HKVA 3AGUA 3JYYA 2XLHA 2NPUA 1DOVA 2E87A 4IB4A 2J9WA 4IWBA 3SP1A 2DI3A 3SNHA 4DBRA 1M57C 2L7AA 4CBEA 1OW7A 3B29A 2NUTA 1FMVA 3FVYA 1SMYF 4BJ1A 1KTMA 2L6GA 2XRHA 4JW1A 1WTYA 4XEFA 4DOZA 1CGME 3EPVA 5KYNA 3U0CA 3DXJF 1Z7Qc 2ZXRA 1PCXA 1VOMA 1YZAA 1VLTA 2DYSC 2R05A 5COFA 1YZCA 3ASOC 2IOQA 1WASA 2LFFA 2LIGA 3V7OA 1QVXA 1H9TA 3C8GD 3X1OA 4AE4B 5CIVA 3VRCA 1LE2A 3B0VC 5JP7A 4YT4A 3M4BA 4CS8C 5A6AA 1JPNA 2XLWA 3BEHA 3AG2C 2KGOA 1MQVA 1NLXA 1VYKA 4BJ6C 4ONSA 3H2UA 3AOUA 3EZHA 1T6IA 1F1MA 2WZGA 5B1AC 2YRFA 3CAXA 4NTAA 1ZHTA 2L81A 5CI9A 3HNKA 1OXKA 3UMHA 3F46A 3JRTA 3K1IA 4CDVA 5A69A 2HJ3A 2XL8A 4EBBA 2BE5F 2IYLD 2XM0A 1MMDA 3AQCA 3B9QA 3JZ0A 4B6IA 5KYYA 2XL6A 2B0JA 3J06A 1VMAA 4AK9A 2VCAA 3OEOA 2XS8A 4FAPB 1TWHA 2OKUA 3HJCA 3SEOA 1C02A 1ZHZA 1LI7A 3TOLA 4ANJA 3IQ5A 1AUEA 2VASA 3A11A 1IZMA 4CS9C 2RSEB 1RKCA 1S05A 1Q0FA 2VB6A 3DE8A 4JE9A 3V5YA 4BJTA 3KL4A 5L0FA 1NSGB 1VYIA 3LLKA 2IXMA 1EI7A 3R7CA 4I3MA 3EFOA 3U9JA 1ZZPA 3IHUA 1WOLA 4GYTA 3JYHA 4YT2A 3FOPA 3B71A 3AG3C 3UGPA 3GM1A 1WWPA 1OW8A 2OJED 2HMZA 3LEOA 3HNJA 3V5ZA 2KSFA 2HJMA 3PCVA 4U5GA 4CX9A 3JTLO 1Z3IX 3NMKA 4Z9IA 4NTFA 4N4WA 4MVRA 3C18A 3RF3A 1T6UA 3C8GB 3ECSA 4YN0B 5KYUB 5KYXB 1ZW2A 1GM5A 1U6HA 1LVKA 1MNEA 4YL0A 1HMDA 1I4YA 3CQZA 3JSEO 4HE8D 1E85A 1WN0A 3AGTA 2WVNA 1BR4A 2DYRC 4LERA 4P9FA 4U9DA 3T6JA 3ZQYA 4E17A 4DRJB 2KJGA 3SZRA 4CSAC 3OA1A 3ZDLA 4OD4A 1U0BB 4MW8A 4MS2A 1FMWA 1OR2A 4U5CE 4A4AA 2EIMC 3M4CA 4K7BA 2P6VA 5A6JA 2WZFA 2AWYA 3E9VA 5L3VA 2J9UA 1RCPA 4NC3A 1BDJB 2YL1A 1I5NA 4DRIB 3SXMA 3FDQA 3U5SA 2EIJC 1SF8A 2YVKA 2IBFA 1YYXA 4OIQF 3ZIBA 1MNDA 3MYIA 3O39A 2HZ8A 4P6IC 2J7PD 4JVSA 1CPRA 5F28E 3POVA 5HV9A 2GWWA 1C03A 1V54C 2JX0A 1ZVZA 4RBNA 5T3WA 3TOMA 4JEAA 1RJ9B 2EPOA 4DXWA 3W4YA 1Q0GA 3KYIA 3I5QA 2R7TA 1NG1A 2ICWG 1ZU4A 2PX3A 2YLDA 4MVOA 4MVMA 2GFHA 4JURI 3HTKC 3EG9A 3SXKA 1ZHXA 4FX5A 4U5FE 5CI8A 3S90A 2DGJA 2KK1A 1FAPB 2VH3A 3R2PA 3UNGC 2KYHA 4CJOA 3H2VA 5DS4A 1ZW3A 3U8VA 3AQBA 5B1BC 1S7ZA 3RH3A 4XEKA 4EKWA 5L0IA 3LNMB 1M2VA 2QTVA 5DLJA 4MW3A 2Y3HA 2A0BA 3H65A 4LACB 1U89A 4OD5A 4N6HA 3QZCA 4P9TA 2ETSA 5EHHA 3C62A 2H7OA 2A68F 4NY3A 3DD7A 2VCCA 5D92A 4G78A 3RQFA 2YL0A 5DS6A 2YL3A 4IARA 5E3CA 4BG0A 3L34A 1NZEA 3KMIA 3NYMA 5T1DB 2Q4FA 3TJ6A 2GDCA 3WG7C 3LS0A 2Q9CA 1XZQA 4PJNA 3S29A 4CS7A 1SR2A 2WB7A 5IY5C 2LSEA 2IXOA 2AWCA 3IPMO 4JRZA 4JTAB 4PFPA 2EPNA 2NUTB 4D4XA 1ST6A 4JCHA 4FWVA 4N6CA 3ABMC 2RD9A 3JRMO 2PBEA 1HMOA 3GM2A 3Q7GA 4MTOA 5COMA 3S28A 1OXBA 3W8IA 2Q7RA 2HS5A 4FESA 3X2QC 1QLEC 3B0UX 5JT4A 4QDLA 1O5HA 3U2LA 4IJJA 3MLGA 2YQYA 2R7OA 1J8YF 3GEHA 2P1AA 4YL3A 4K1OA 1NFOA 5EGYA 3FHDA 1RXQA 4PACA 3G4XA
chains in the Genus database with same CATH topology
2P0NA 3V5XA 3U9MA 3U9JA 3V5ZA 3CAXA 3V5YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P0N A;  3V5X A;  3U9M A;  3U9J A;  3V5Z A;  3CAX A;  3V5Y A; 
#chains in the Genus database with same CATH topology
 1JR8 A;  2M64 A;  2B0H A;  3GEE A;  4YL1 A;  5L0G A;  5BQI A;  4UDV A;  4YJW A;  1YDI A;  3MFN A;  3NDB B;  4N06 A;  5L0H A;  2CW0 F;  2R7Q A;  3WHN A;  2D4U A;  3GEI A;  1QZX A;  3K1I C;  4WAB A;  1VK5 A;  2OQM A;  2CNW A;  3MBG A;  2NUP A;  3ZWI A;  1ORY A;  3ZVR A;  5KYW A;  1M56 C;  2LFD A;  4MVZ A;  2I8B A;  4XPW A;  1C17 M;  5KYY B;  2R7X A;  3A9C A;  1OKK A;  2XXA A;  4I1O B;  3LJB A;  3C8Z A;  4YT5 A;  1OCR C;  1TR2 A;  1VLS A;  4DRH B;  2Q3T A;  5L0C A;  1FR0 A;  2HMQ A;  3DWW A;  5FZT A;  1FFH A;  1ZHY A;  5EK0 A;  5B3S C;  1I4Z A;  4U5D E;  2BC5 A;  5FCL A;  3UMI A;  5GPG B;  4BJ5 A;  2PP4 A;  2GA0 A;  1JRA A;  2XLM A;  3V5X A;  3ZC4 A;  2EIK C;  2VC9 A;  4H4K C;  3EFO B;  1Z23 A;  1V4A A;  2R03 A;  2J45 A;  3RQG A;  4JCZ A;  5L3Q A;  4X0R A;  2YEV A;  2XLE A;  2X51 A;  1GQA A;  2Y3D A;  2FGY A;  1CGN A;  3TJ5 A;  1Q0K A;  4XEV A;  3IEE A;  4KNV A;  5JUA A;  1HW2 A;  4QI0 A;  3DJU B;  4JJF A;  2YLI A;  3VF0 A;  4C3B A;  5AC5 A;  5K0I A;  5HSW A;  1OCC C;  3HLZ A;  1OCZ C;  1BBH A;  2J8W A;  2XLD A;  4JEB A;  2PF4 E;  4DJ9 A;  3RKO F;  1J8M F;  2P7V A;  4Q7C A;  3U3B A;  4M63 A;  4NQF A;  1B68 A;  1D1B A;  1Z63 A;  1A7D A;  3KPH A;  4L6R A;  3NKE A;  2QUP A;  2HV6 A;  2CGE A;  2Y3G A;  1Y6D A;  2J9V A;  1APC A;  2FAP B;  3N24 A;  4EIY A;  4J7T A;  4JTC B;  3W2W A;  4RDA A;  3ASN C;  4KBL A;  1YA9 A;  3B0P A;  1E2X A;  3EHN A;  2F22 A;  2P61 A;  5JSL A;  3LES A;  2A0U A;  3FOO A;  3L8J A;  3LEV A;  4ULV A;  1A0B A;  2Y3B A;  3G50 A;  3RW0 A;  4CIP A;  1PD0 A;  2C03 A;  2EPM X;  4J7Y A;  4EBK A;  4PK4 A;  5A6K A;  1SZI A;  2WL8 A;  1ORS C;  3NMI A;  3U2M A;  1TQG A;  3O6X A;  5A6B A;  3EGX B;  4KI2 A;  1TWG A;  4WGZ A;  4MVQ A;  1GS9 A;  1L3P A;  3EQL F;  5DS5 A;  2HSB A;  4DVY P;  3EGD A;  1O3U A;  1V74 B;  2L9J A;  2Q00 A;  4YWQ A;  1OR3 A;  1K04 A;  1DOW A;  3JSZ A;  4CDA A;  1NBB A;  2EIL C;  4IGG A;  4EHP A;  1KU2 A;  4XLP F;  1E84 A;  2Q9B A;  2QY9 A;  4DBQ A;  2QNL A;  4YK5 A;  2W9Y A;  4W8P A;  1HW1 A;  2LP4 A;  1BZ4 A;  3NKD A;  2W4M A;  4IRU A;  1MMN A;  3EG9 B;  3U8P A;  2IM8 A;  2PX0 A;  3EZI A;  3O55 A;  5KYU A;  1WAT A;  2G3K A;  1UG7 A;  1AVO B;  3EH1 A;  4LLC A;  5BQH A;  4Z9H A;  4Z9J A;  3N2Z B;  2G62 A;  2QE9 A;  4LLE A;  2OJQ A;  3NG1 A;  3PDM P;  2J0W A;  1O87 A;  1OCO C;  1A41 A;  3QTH A;  5COG A;  1OKK D;  1G4U S;  2I15 A;  1VB5 A;  2R9R B;  3QW1 A;  1HE1 A;  2OG2 A;  2J46 A;  4G7Z F;  256B A;  3AJM A;  3JCU Q;  2J0X A;  2TMV P;  3RIP A;  1HE9 A;  4O7G A;  1RMV A;  3TD7 A;  1TKN A;  2LQG A;  4HFF B;  2P0N A;  5E2Q A;  3KKB A;  3S84 A;  5AGF A;  3NMJ A;  2G3V A;  3RVZ A;  2EPL X;  3AG4 C;  3I4U A;  1EA8 A;  2VCB A;  4NCQ A;  3WAQ A;  1OQC A;  3O10 A;  4EWC A;  4XLN F;  1NU7 D;  2M4E A;  3T6G B;  2KC3 A;  4C7O B;  1WGW A;  1RKE A;  2YHS A;  1BR2 A;  2XL4 A;  3ATP A;  1SYQ A;  4I44 A;  1LE4 A;  2CCY A;  2DB4 A;  2LK4 A;  3I5P A;  2A6E F;  4I1M A;  3IQC A;  1T6Q A;  4JJG A;  3C7J A;  3M1C B;  3DMD A;  3LNR A;  1JAF A;  1K05 A;  4O6M A;  5DVW A;  4JZA A;  3RYL A;  2H8A A;  2HUJ A;  1ZU5 A;  2LCH A;  3E70 C;  4G0H A;  2R7R A;  4OIP F;  3OWT A;  3S27 A;  2ZXW C;  3K66 A;  2MYS A;  1D1C A;  1PV3 A;  3KH2 A;  2V26 A;  3VM6 A;  4AL0 A;  1T9K A;  4KNW A;  2XLV A;  3QW0 A;  5F5F A;  2R7W A;  2X0C A;  2H7V C;  3DJN B;  1H7I A;  5E3A A;  3DZA A;  2R7S A;  3RQE A;  1QQ3 A;  3HKK A;  3G4Z A;  1XZP A;  3TQO A;  3K6B A;  4A2N B;  1ZYR F;  4R32 A;  1Z6A A;  3K33 A;  5BQG A;  1T01 A;  1LS1 A;  4O79 A;  4OIR F;  4U5E E;  2HSQ A;  2NUP B;  4K0D A;  3NYJ A;  2HFI A;  1QSP A;  2IXN A;  2YLG A;  3BRJ A;  3JT1 A;  4PJJ A;  5F5H A;  4GEH A;  2PNO A;  3UR3 C;  4GQH A;  3T6B A;  3GOD A;  1D1A A;  3C63 A;  4HEA J;  5A6B D;  3ZSU A;  3MX3 A;  2A6H F;  2ZXO A;  5JS5 A;  1YAR O;  2QLA A;  2Y69 C;  3CEX A;  3U9M A;  4C3E A;  5TJ5 E;  1N1C A;  4JKV A;  4BJ5 C;  1TFO B;  2D5R B;  3DM5 A;  2J9B A;  1H6G A;  2Q9A A;  2XSE A;  4MTG A;  2C04 A;  3FAP B;  3US6 A;  1XWJ A;  3ABL C;  2YWA A;  2YL7 A;  2MHR A;  4PJM A;  3ABK C;  1OW6 A;  2J7P A;  1LIH A;  3GOR A;  3SXY A;  4ER9 A;  2A1D D;  1ORJ A;  3GWN A;  2LD6 A;  5T3T A;  4YT8 A;  2OOC A;  3L8I A;  1FFT C;  2CDQ A;  1ZHW A;  5DQZ A;  4CJG A;  2V3C C;  1KNY A;  2WZL A;  4OIN F;  4LDR A;  1CGO A;  5DQT A;  4NTB A;  4LDK A;  4XPX A;  1BR1 A;  2WVO A;  3L1M A;  4AE4 A;  3RFY A;  3ZTZ A;  2BL2 A;  4XWJ A;  4O6Y A;  3W2V A;  2L6H A;  4XQ1 A;  5JLI A;  3QVZ A;  4QI2 A;  2Z15 A;  3ITF A;  4CS8 A;  4CIH A;  4IAQ A;  1H9G A;  5B3I A;  4C7O A;  4BJ6 A;  3DAF A;  3Q6N A;  2WVQ A;  2OCC C;  3T4R A;  4JTD B;  3S0X A;  2NSG A;  2W4B A;  1TWA A;  2A69 F;  3QVY A;  3HNI A;  3FMS A;  4HFK B;  1MMA A;  4PJL A;  1LS4 A;  3GWL A;  2R25 A;  4PFO A;  3ZQV A;  2AVK A;  3GM3 A;  4WJ0 A;  1IW7 F;  3MYF A;  3SXZ A;  2JPU A;  1T5O A;  2EPK X;  4ULW A;  3U3F A;  3EJN A;  3DM9 B;  3F47 A;  3EH2 A;  2NSF A;  2AP3 A;  4CS9 A;  1L7C A;  4H54 A;  1NFN A;  5D91 A;  1FTS A;  3RVY A;  1K40 A;  3EGD B;  4XPY A;  1G5Z A;  1YLM A;  2EIN C;  4RD9 A;  1TFK B;  4MVS A;  2XM4 A;  2YKZ A;  4KC9 A;  4U9E A;  4W8K A;  4BEM J;  1V55 C;  3NYL A;  1UFB A;  3ZTM A;  3NRH A;  1Q0M A;  1GGQ A;  3UGO A;  3VYW A;  3QMK A;  4F4B A;  2XS1 A;  2YZS A;  3HNL A;  1Y4C A;  3IQ6 A;  3W8H A;  1D0Y A;  4U5H A;  3CZ6 A;  1E83 A;  1YVI A;  1YA7 O;  2L6F A;  1M2O A;  5L0D A;  3C8G A;  4D4N A;  1G4W R;  5KYX A;  1TWC A;  1QKR A;  2R02 A;  2CNW D;  1HY5 A;  4E7Z A;  4JC7 A;  3WOD F;  2GAQ A;  3Q7L A;  2UUH A;  1G8X A;  1W2W A;  5L0J A;  4CSA A;  1JPJ A;  1D0Z A;  1M2V B;  2IXP A;  4E0H A;  1LI5 A;  3FXH A;  3LAY A;  1LM3 B;  2KNH A;  1PD1 A;  4MVU A;  2CYD A;  5JRA A;  3EGX A;  2ASR A;  3CSK A;  4CDY A;  1R4T A;  5AC4 A;  4OIO F;  3PMR A;  3VAY A;  3ZG1 A;  1E86 A;  1RKE B;  2MWQ A;  4PR9 A;  2JD3 A;  4Q5S F;  1YJG A;  3M79 A;  4E0I A;  5E33 A;  1JMW A;  2PFD A;  1A7V A;  4E18 A;  4J30 B;  4LDQ A;  4J32 B;  1EQ1 A;  2H7B A;  1R5I D;  2FFH A;  3DE9 A;  2ZD9 A;  3IQT A;  4E7S A;  3DI5 A;  2OU6 A;  3Q6M A;  3S9O A;  4IAO A;  4BEJ A;  1MMG A;  4C3D A;  1RJ9 A;  3M15 A;  4XTK A;  3K1H A;  4AL1 A;  5JVE A;  3PHF 2;  4ZLC A;  4G7H F;  4Q4Z F;  2OEX A;  2R7V A;  3TUL A;  4U5B E;  2NG1 A;  2XLO A;  4DVZ A;  1YAU O;  1AEP A;  1YYJ A;  3KYJ A;  3UMK A;  2O9X A;  4WGY A;  2OEV A;  2KQ9 A;  3LLI A;  3DKA A;  3LS1 A;  2Y39 A;  3T9O A;  2W45 A;  3EHM A;  4EUK B;  3AG1 C;  1Z5Z A;  1EKY A;  4MTF A;  1CPQ A;  1QPU A;  1LPE A;  2ZPA A;  4AX2 A;  3SYN A;  1Q0D A;  1JOG A;  3DAG A;  4ZLD A;  4MND A;  3K7D A;  3GAN A;  5BUO A;  2R7U A;  2HV7 A;  4JIO A;  2ZXP A;  1NU9 C;  1A7E A;  1M6T A;  3LUT B;  5KYW B;  2UUI A;  3TK0 A;  1VTM P;  4O6N A;  1LKX A;  4MQ9 F;  1FNT c;  3FAJ A;  2AU5 A;  3L0I A;  4G7O F;  2XXA B;  2KW3 C;  4BPM A;  4EBJ A;  1D0X A;  3N0T A;  2HKV A;  3AGU A;  3JYY A;  2XLH A;  2NPU A;  1DOV A;  2E87 A;  4IB4 A;  2J9W A;  4IWB A;  3SP1 A;  2DI3 A;  3SNH A;  4DBR A;  1M57 C;  2L7A A;  4CBE A;  1OW7 A;  3B29 A;  2NUT A;  1FMV A;  3FVY A;  1SMY F;  4BJ1 A;  1KTM A;  2L6G A;  2XRH A;  4JW1 A;  1WTY A;  4XEF A;  4DOZ A;  1CGM E;  3EPV A;  5KYN A;  3U0C A;  3DXJ F;  1Z7Q c;  2ZXR A;  1PCX A;  1VOM A;  1YZA A;  1VLT A;  2DYS C;  2R05 A;  5COF A;  1YZC A;  3ASO C;  2IOQ A;  1WAS A;  2LFF A;  2LIG A;  3V7O A;  1QVX A;  1H9T A;  3C8G D;  3X1O A;  4AE4 B;  5CIV A;  3VRC A;  1LE2 A;  3B0V C;  5JP7 A;  4YT4 A;  3M4B A;  4CS8 C;  5A6A A;  1JPN A;  2XLW A;  3BEH A;  3AG2 C;  2KGO A;  1MQV A;  1NLX A;  1VYK A;  4BJ6 C;  4ONS A;  3H2U A;  3AOU A;  3EZH A;  1T6I A;  1F1M A;  2WZG A;  5B1A C;  2YRF A;  3CAX A;  4NTA A;  1ZHT A;  2L81 A;  5CI9 A;  3HNK A;  1OXK A;  3UMH A;  3F46 A;  3JRT A;  3K1I A;  4CDV A;  5A69 A;  2HJ3 A;  2XL8 A;  4EBB A;  2BE5 F;  2IYL D;  2XM0 A;  1MMD A;  3AQC A;  3B9Q A;  3JZ0 A;  4B6I A;  5KYY A;  2XL6 A;  2B0J A;  3J06 A;  1VMA A;  4AK9 A;  2VCA A;  3OEO A;  2XS8 A;  4FAP B;  1TWH A;  2OKU A;  3HJC A;  3SEO A;  1C02 A;  1ZHZ A;  1LI7 A;  3TOL A;  4ANJ A;  3IQ5 A;  1AUE A;  2VAS A;  3A11 A;  1IZM A;  4CS9 C;  2RSE B;  1RKC A;  1S05 A;  1Q0F A;  2VB6 A;  3DE8 A;  4JE9 A;  3V5Y A;  4BJT A;  3KL4 A;  5L0F A;  1NSG B;  1VYI A;  3LLK A;  2IXM A;  1EI7 A;  3R7C A;  4I3M A;  3EFO A;  3U9J A;  1ZZP A;  3IHU A;  1WOL A;  4GYT A;  3JYH A;  4YT2 A;  3FOP A;  3B71 A;  3AG3 C;  3UGP A;  3GM1 A;  1WWP A;  1OW8 A;  2OJE D;  2HMZ A;  3LEO A;  3HNJ A;  3V5Z A;  2KSF A;  2HJM A;  3PCV A;  4U5G A;  4CX9 A;  3JTL O;  1Z3I X;  3NMK A;  4Z9I A;  4NTF A;  4N4W A;  4MVR A;  3C18 A;  3RF3 A;  1T6U A;  3C8G B;  3ECS A;  4YN0 B;  5KYU B;  5KYX B;  1ZW2 A;  1GM5 A;  1U6H A;  1LVK A;  1MNE A;  4YL0 A;  1HMD A;  1I4Y A;  3CQZ A;  3JSE O;  4HE8 D;  1E85 A;  1WN0 A;  3AGT A;  2WVN A;  1BR4 A;  2DYR C;  4LER A;  4P9F A;  4U9D A;  3T6J A;  3ZQY A;  4E17 A;  4DRJ B;  2KJG A;  3SZR A;  4CSA C;  3OA1 A;  3ZDL A;  4OD4 A;  1U0B B;  4MW8 A;  4MS2 A;  1FMW A;  1OR2 A;  4U5C E;  4A4A A;  2EIM C;  3M4C A;  4K7B A;  2P6V A;  5A6J A;  2WZF A;  2AWY A;  3E9V A;  5L3V A;  2J9U A;  1RCP A;  4NC3 A;  1BDJ B;  2YL1 A;  1I5N A;  4DRI B;  3SXM A;  3FDQ A;  3U5S A;  2EIJ C;  1SF8 A;  2YVK A;  2IBF A;  1YYX A;  4OIQ F;  3ZIB A;  1MND A;  3MYI A;  3O39 A;  2HZ8 A;  4P6I C;  2J7P D;  4JVS A;  1CPR A;  5F28 E;  3POV A;  5HV9 A;  2GWW A;  1C03 A;  1V54 C;  2JX0 A;  1ZVZ A;  4RBN A;  5T3W A;  3TOM A;  4JEA A;  1RJ9 B;  2EPO A;  4DXW A;  3W4Y A;  1Q0G A;  3KYI A;  3I5Q A;  2R7T A;  1NG1 A;  2ICW G;  1ZU4 A;  2PX3 A;  2YLD A;  4MVO A;  4MVM A;  2GFH A;  4JUR I;  3HTK C;  3EG9 A;  3SXK A;  1ZHX A;  4FX5 A;  4U5F E;  5CI8 A;  3S90 A;  2DGJ A;  2KK1 A;  1FAP B;  2VH3 A;  3R2P A;  3UNG C;  2KYH A;  4CJO A;  3H2V A;  5DS4 A;  1ZW3 A;  3U8V A;  3AQB A;  5B1B C;  1S7Z A;  3RH3 A;  4XEK A;  4EKW A;  5L0I A;  3LNM B;  1M2V A;  2QTV A;  5DLJ A;  4MW3 A;  2Y3H A;  2A0B A;  3H65 A;  4LAC B;  1U89 A;  4OD5 A;  4N6H A;  3QZC A;  4P9T A;  2ETS A;  5EHH A;  3C62 A;  2H7O A;  2A68 F;  4NY3 A;  3DD7 A;  2VCC A;  5D92 A;  4G78 A;  3RQF A;  2YL0 A;  5DS6 A;  2YL3 A;  4IAR A;  5E3C A;  4BG0 A;  3L34 A;  1NZE A;  3KMI A;  3NYM A;  5T1D B;  2Q4F A;  3TJ6 A;  2GDC A;  3WG7 C;  3LS0 A;  2Q9C A;  1XZQ A;  4PJN A;  3S29 A;  4CS7 A;  1SR2 A;  2WB7 A;  5IY5 C;  2LSE A;  2IXO A;  2AWC A;  3IPM O;  4JRZ A;  4JTA B;  4PFP A;  2EPN A;  2NUT B;  4D4X A;  1ST6 A;  4JCH A;  4FWV A;  4N6C A;  3ABM C;  2RD9 A;  3JRM O;  2PBE A;  1HMO A;  3GM2 A;  3Q7G A;  4MTO A;  5COM A;  3S28 A;  1OXB A;  3W8I A;  2Q7R A;  2HS5 A;  4FES A;  3X2Q C;  1QLE C;  3B0U X;  5JT4 A;  4QDL A;  1O5H A;  3U2L A;  4IJJ A;  3MLG A;  2YQY A;  2R7O A;  1J8Y F;  3GEH A;  2P1A A;  4YL3 A;  4K1O A;  1NFO A;  5EGY A;  3FHD A;  1RXQ A;  4PAC A;  3G4X A; 
#chains in the Genus database with same CATH homology
 2P0N A;  3V5X A;  3U9M A;  3U9J A;  3V5Z A;  3CAX A;  3V5Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...