2P0NA

Nmb1532 protein from neisseria meningitidis, unknown function
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
161
structure length
161
Chain Sequence
VTFAEPIEMLYACHGKVRRFCGQVAMLSDYIAENGCNQIVLQTIRQIAQYFNVAAPLHHEDEEENFFPLLLQYAPQAQESVDELLRQHIGLHDNWAAVSAEFAKLEADNAYVPDEEAFKRFVAGYDVHLAIEEPLFDMGNTFIPKEKLTEIGEIMAARRRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein NMB1532
publication title X-ray crystal structure of NMB1532 protein of unknown function from Neisseria meningitidis.
rcsb
source organism Neisseria meningitidis
molecule tags Structural genomics, unknown function
total genus 65
structure length 161
sequence length 161
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01814 Hemerythrin Hemerythrin HHE cation binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.520 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) nmb1532 protein domain like 2p0nA00
2P0NA 3V5YA 3CAXA 3V5ZA 3V5XA 3U9JA 3U9MA
chains in the Genus database with same CATH superfamily
2FGYA 2J46A 2W9YA 1XZPA 1Z3IX 2XLOA 2XM4A 2Y39A 4YT5A 2R7XA 3AQBA 1BDJB 2PP4A 4KNWA 3GM1A 3JYYA 2LK4A 4RD9A 4XPWA 3L34A 1FFHA 1NZEA 2A68F 3MX3A 4PJLA 3W8IA 5BQIA 4IARA 3JCUQ 3QVYA 2PX3A 4G78A 2L9JA 4CDVA 4C3EA 2MWQA 3T6JA 1ORYA 1V74B 3VRCA 3AOUA 3B9QA 3QVZA 4O6NA 2J0XA 4I3MA 1V4AA 3L8IA 3W2WA 3HNLA 2OCCC 2LIGA 4C7OA 1OW7A 2ICWG 4IAQA 5TJ5E 3KPHA 3HNIA 5F5HA 2DI3A 2Y3DA 2EIJC 2VB6A 3NKEA 4XPXA 3X2QC 2ASRA 3H2UA 1Q0KA 4I1MA 4AK9A 4CS9C 1OCRC 2A69F 1OR3A 3FHDA 3G4XA 2PF4E 1MQVA 4J30B 4Q7CA 3TJ6A 3U8VA 2GWWA 1Q0MA 3U5SA 1T9KA 3EZHA 4X0RA 2LFDA 3EHNA 1APCA 2L81A 4DBRA 5EGYA 2JD3A 1T01A 3V5ZA 2Y3BA 2RSEB 1LE4A 4W8KA 5JRAA 4CIPA 3HLZA 3GANA 4UDVA 3RYLA 2Q9CA 3NYMA 3HKKA 4WABA 1E84A 4Z9JA 3K1HA 3RQGA 3LEOA 4AE4A 3ZTZA 1CPQA 4Z9HA 4F4BA 5K0IA 1YAUO 2EPKX 1NU9C 3LESA 4MVQA 3VYWA 2IXOA 1WN0A 1B68A 4XEFA 1I4ZA 3QMKA 3LLKA 1C02A 1WATA 4CBEA 3UMKA 3LAYA 3O39A 2A0UA 1SR2A 5L0JA 1ZHTA 3ZG1A 2IYLD 2Q00A 4L6RA 4QI2A 2CCYA 4ONSA 1RCPA 1NFOA 2X0CA 2EPNA 3C62A 4WJ0A 4K7BA 2D5RB 4U9EA 5F28E 4HE8D 4DRJB 3N0TA 1AEPA 4CDYA 2Z15A 3H2VA 3CQZA 2WZLA 2R7SA 2KSFA 2I15A 5L3VA 2KW3C 5JUAA 1F1MA 3U0CA 2F22A 2YRFA 4ULVA 5JVEA 3L1MA 3UR3C 4C7OB 1D1CA 1YLMA 3C8GD 3FXHA 2L6FA 3CZ6A 2I8BA 3U9JA 4E17A 3RVYA 2WZGA 3NRHA 4EHPA 1T6UA 4G7HF 4I44A 4P9TA 1E85A 3WAQA 5EHHA 1JMWA 1TQGA 2LCHA 2YLGA 3NYLA 5T3WA 5E33A 3S28A 3AGTA 4BJ5A 5T3TA 4BJ6C 3DI5A 2LP4A 4U5CE 1ZW2A 2M4EA 3AGUA 3K1IA 1ZYRF 3MYIA 1EQ1A 2XSEA 1T6IA 2X51A 4O7GA 4LDKA 1Q0DA 3UGPA 2ZXRA 3T6GB 2A1DD 4EWCA 2GDCA 2OEXA 2YHSA 1Z5ZA 4QDLA 4DVYP 3GM3A 3H65A 4NCQA 1G5ZA 1PV3A 3S0XA 1Y4CA 1MMGA 4U5EE 1KTMA 1U89A 4PJJA 1Z63A 4BEMJ 1TWCA 2XLVA 3DXJF 2IM8A 2W45A 4MW3A 4AE4B 3QTHA 4K1OA 4OD4A 2KGOA 3Q7GA 2Q7RA 3VAYA 2R03A 2NUTA 3FDQA 2Q4FA 4FESA 1DOWA 4GEHA 1R4TA 1G8XA 4IWBA 1ZHYA 3PHF2 1SMYF 4XLNF 1K40A 1OXBA 1EI7A 1N1CA 5KYNA 1W2WA 1TR2A 3RF3A 3TOMA 3WG7C 2IOQA 1BR1A 2R05A 2QUPA 3AG4C 2YQYA 5COGA 3EGDA 5B1BC 3PMRA 4CSAC 2DYSC 2XXAB 1ZU4A 3C8ZA 2VCCA 2YL7A 3Q7LA 3U9MA 3V7OA 1RKCA 2NSGA 5KYWA 5DQZA 1D0YA 1OCCC 3JRMO 2OOCA 2L6GA 2Y69C 1I4YA 3B29A 4JE9A 3U2MA 2HV7A 1NBBA 4C3DA 4EBKA 3G50A 4JTCB 4YJWA 4E0IA 3TOLA 5GPGB 2WVOA 1ZZPA 3DE8A 4FX5A 3CEXA 2PBEA 1A7EA 2OJQA 1BR2A 2G62A 3FMSA 3LS0A 3M1CB 4JCHA 4YN0B 3FAPB 1GS9A 3OA1A 1ZW3A 3DZAA 2B0HA 3S29A 1Z6AA 4OINF 4CDAA 1LM3B 3LUTB 3B0PA 2YVKA 3Q6MA 1LIHA 1HE1A 2J7PD 4YT4A 2H8AA 3JSEO 1FFTC 2L6HA 2OQMA 3L8JA 2J9BA 4AL0A 3C63A 2FFHA 1C17M 3T9OA 3SP1A 1LPEA 1OXKA 3IPMO 2R7WA 3KYJA 3A9CA 2LQGA 4N6CA 3TJ5A 4CS9A 2G3VA 4WGYA 1J8MF 2B0JA 2QLAA 1WWPA 2YEVA 3C8GA 3R2PA 1AVOB 4JURI 1FNTc 2XLWA 4NTBA 2V26A 2ZPAA 3TK0A 4AX2A 2DB4A 2G3KA 2EPLX 1ORJA 1YA9A 2OU6A 2Q3TA 3DJUB 3PCVA 3NYJA 1OW6A 1VYIA 1VLTA 4O6YA 4P9FA 4YL1A 3V5YA 4DRIB 2VCBA 4LACB 4DVZA 2VH3A 1A7DA 2LFFA 1QLEC 5FCLA 1O87A 4J32B 4A4AA 3U3BA 1SZIA 3RVZA 1D1BA 2NUTB 3O55A 4XPYA 5E3CA 2EPOA 3RKOF 1G4US 2BC5A 4P6IC 4YWQA 1T6QA 1Y6DA 3MFNA 4DJ9A 2XLEA 4XTKA 5A69A 5D91A 2HKVA 3TD7A 1VK5A 5L0HA 4IB4A 5DLJA 4NC3A 5BUOA 5JS5A 4N4WA 1OQCA 1MMAA 2KJGA 4IAOA 2HSQA 4NTAA 3SXMA 4JCZA 3I5QA 3VM6A 4BPMA 2UUHA 3EGDB 4ULWA 2XL6A 1JPNA 1XWJA 2MYSA 1CGME 3M15A 3M4CA 2WL8A 1ST6A 3AQCA 2AP3A 2HJ3A 1CPRA 2YWAA 4U5GA 4OIRF 5IY5C 2R9RB 3MYFA 1FTSA 1HY5A 4IRUA 1TFKB 3AJMA 3IQCA 4U5BE 4Q4ZF 4NQFA 2AVKA 1PD1A 4HFFB 1JPJA 3F46A 4RDAA 1ZHZA 2KQ9A 1ORSC 1WOLA 2Y3HA 2MHRA 3K7DA 1BBHA 256BA 3E9VA 2BL2A 3ABMC 4MW8A 4E0HA 4CIHA 1ZVZA 2P1AA 1XZQA 2HMQA 4BG0A 4EUKB 1E83A 2HS5A 2AU5A 1YZCA 3WODF 3AG2C 1ZU5A 5BQGA 3JYHA 3ZVRA 2HMZA 4D4NA 3RFYA 2VC9A 2OJED 1U0BB 3JRTA 4D4XA 3JZ0A 3SXYA 2HUJA 1C03A 3F47A 4CJOA 3LNMB 2FAPB 2YL3A 3GODA 3S90A 3ASOC 4OIQF 1D1AA 2QTVA 4GYTA 4MQ9F 2YLIA 1AUEA 2ZXPA 4JW1A 4BJ6A 2OEVA 3C8GB 4AL1A 5AC5A 3DD7A 2PNOA 2A6EF 1J8YF 1QKRA 3B71A 2LSEA 3EH2A 3JSZA 3T4RA 3EGXA 4BJ1A 2CDQA 5A6BD 3NMJA 3EJNA 5B3IA 2IBFA 3OEOA 3US6A 5L0FA 1JOGA 4YK5A 2PX0A 2R7OA 3DE9A 3NKDA 4MTGA 3UMIA 4C3BA 3QZCA 2VCAA 2E87A 2P0NA 2J7PA 4KNVA 4U5HA 4YT8A 4RBNA 3NMKA 4IJJA 2OG2A 1WGWA 3SZRA 1E86A 1NG1A 4MNDA 5L3QA 4DXWA 5F5FA 1YDIA 5FZTA 1LI5A 2Y3GA 4W8PA 4G7OF 3GEEA 1O3UA 4JVSA 1MMDA 2XLHA 3DKAA 4J7TA 4KC9A 4MVZA 1TKNA 4Z9IA 4ZLCA 3ZC4A 4DRHB 1Q0GA 3S84A 2ZD9A 3ZSUA 1MMNA 1QVXA 1M2OA 1IZMA 3E70C 4CS8C 2J9UA 5DS6A 3JTLO 4K0DA 4O79A 2XL8A 4LLCA 5DS5A 2VASA 3LS1A 4BEJA 2J8WA 3W4YA 1H6GA 1RKEA 4MS2A 3N24A 4BJTA 4CSAA 3TULA 4PK4A 1A41A 2QY9A 4PFOA 3ASNC 2CYDA 1A7VA 1OKKD 1S05A 1LKXA 2UUIA 1NLXA 1YVIA 3HJCA 3DAFA 3ITFA 1G4WR 3EFOA 2J0WA 3K1IC 4HFKB 1SYQA 2TMVP 2XM0A 3U8PA 3LNRA 3R7CA 2DYRC 4YT2A 5L0CA 3HNJA 2EINC 3UNGC 4U5FE 3SXKA 1GGQA 2P7VA 3FOPA 2WB7A 3IQTA 2ETSA 1LS1A 3ZQYA 2J9WA 3GWNA 3QW0A 1RMVA 1BZ4A 2P61A 1D0XA 3T6BA 3ECSA 2EILC 3RH3A 3UMHA 4DOZA 5KYUA 1Z7Qc 3HNKA 2BE5F 3ZQVA 1CGNA 3JT1A 3IQ5A 3K6BA 4I1OB 4U9DA 4ER9A 2AWYA 3EQLF 4FWVA 3I5PA 4GQHA 1I5NA 3EGXB 2XLMA 1K05A 1FAPB 1YZAA 4Q5SF 5EK0A 2M64A 5A6KA 4JEBA 5L0IA 4G0HA 2Q9BA 2JPUA 4PACA 4OIPF 1GM5A 5L0DA 2CW0F 5JP7A 2HV6A 3GORA 2KNHA 4MVRA 4JJFA 3DJNB 4EBJA 3AG3C 4LDQA 2EIKC 3CAXA 3CSKA 3LLIA 4YL3A 3V5XA 5KYYA 2XLDA 1CGOA 2GA0A 5BQHA 1TFOB 3EPVA 5E2QA 3C18A 2NUPA 1PCXA 2YKZA 1M2VA 3POVA 2C03A 1M56C 1OW8A 3ZIBA 4XWJA 5A6JA 4NTFA 3DMDA 5A6BA 5CI8A 3RIPA 2R25A 1Q0FA 1OR2A 1T5OA 3MLGA 1YYXA 4H4KC 3K33A 1RKEB 2WZFA 1NU7D 1FR0A 1MNDA 4PJNA 4CJGA 3OWTA 4XLPF 1H9TA 4OIOF 3W8HA 1UFBA 2IXNA 3ATPA 1M6TA 4B6IA 3EFOB 1LVKA 4O6MA 2V3CC 1H7IA 2ZXOA 4EBBA 4A2NB 5HSWA 1LE2A 1NFNA 5KYWB 3GEIA 3S27A 3FOOA 4XEVA 3SXZA 5B3SC 5HV9A 3KH2A 3J06A 3W2VA 3M79A 1Z23A 1VOMA 2QNLA 2XS1A 3KYIA 1FMWA 2EIMC 3NG1A 3VF0A 1JAFA 2NPUA 2ZXWC 1HW2A 4JRZA 5KYUB 3SYNA 3NDBB 3ABLC 5E3AA 1LI7A 2WVQA 1OKKA 3EH1A 2RD9A 3GM2A 1FMVA 1OCZC 4PJMA 3M4BA 4H54A 3LJBA 4OD5A 4XEKA 1R5ID 3ZWIA 3SEOA 4KI2A 1V54C 1LS4A 4DBQA 5CIVA 2R7UA 1RJ9A 1K04A 2CNWD 3DM5A 4M63A 4ZLDA 2O9XA 2JX0A 1E2XA 5COMA 5DVWA 5COFA 3RQEA 2GAQA 1HMDA 4LERA 4JZAA 5JLIA 1MNEA 2J45A 2XXAA 2R7VA 5D92A 2HZ8A 1KNYA 1O5HA 2W4BA 3EG9A 5KYYB 3DAGA 1U6HA 2NSFA 2R7QA 3SNHA 4ANJA 2XL4A 4MVUA 1SF8A 3N2ZB 1H9GA 2A0BA 3WHNA 2XRHA 2NUPB 2GFHA 2XS8A 4MVOA 3PDMP 1M2VB 4G7ZF 4MVMA 4JIOA 3RQFA 1BR4A 3Q6NA 4LLEA 5T1DB 2Q9AA 2YZSA 5KYXA 3FVYA 4JJGA 2DGJA 3AG1C 3QW1A 2NG1A 3IQ6A 4N06A 4E7SA 3BEHA 1L3PA 4J7YA 2YL0A 4QI0A 1OCOC 1QSPA 3B0VC 4CS8A 4CX9A 1JR8A 1VB5A 1L7CA 3DWWA 3GEHA 3EZIA 3HTKC 2CGEA 4U5DE 1TWGA 4XQ1A 5B1AC 3O10A 3S9OA 5AC4A 1QZXA 2P6VA 3EHMA 4JKVA 5DQTA 4EKWA 5A6AA 2YLDA 2YL1A 3IEEA 2LD6A 3B0UX 3ABKC 4YL0A 2EPMX 2KYHA 4R32A 2C04A 1HW1A 4WGZA 1VTMP 3TQOA 4JTAB 4MVSA 2AWCA 4E18A 1M57C 1HMOA 1QQ3A 1ZHXA 3U3FA 4BJ5C 1EKYA 1DOVA 1YYJA 4JTDB 1YJGA 4LDRA 1TWHA 1YA7O 5CI9A 3K66A 3UGOA 5JT4A 2HFIA 1YARO 1V55C 2W4MA 4N6HA 2R7RA 1RXQA 3LEVA 1D0ZA 3NMIA 1VLSA 4JC7A 4HEAJ 3BRJA 3DM9B 4JEAA 4E7ZA 1NSGB 1TWAA 1A0BA 1UG7A 1PD0A 2KK1A 4PFPA 1RJ9B 5L0GA 1EA8A 1JRAA 2IXMA 3G4ZA 2KC3A 2H7BA 2J9VA 1VMAA 1ZHWA 2QE9A 1IW7F 3O6XA 3KMIA 5AGFA 2OKUA 2HJMA 4MTFA 3KL4A 2PFDA 3I4UA 3MBGA 3EG9B 3ZDLA 3RW0A 3C7JA 5DS4A 3KKBA 2R7TA 3A11A 3U2LA 4FAPB 1WASA 4EIYA 2H7VC 1KU2A 1QPUA 1VYKA 3IHUA 4CS7A 4KBLA 4NY3A 3L0IA 2WVNA 3FAJA 2H7OA 2A6HF 4IGGA 1S7ZA 3ZTMA 1WTYA 2HSBA 2L7AA 2R02A 4MTOA 3GWLA 3X1OA 5KYXB 2CNWA 5JSLA 2IXPA 2D4UA 4PR9A 1HE9A 1GQAA
chains in the Genus database with same CATH topology
2P0NA 3V5YA 3CAXA 3V5ZA 3V5XA 3U9JA 3U9MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P0N A;  3V5Y A;  3CAX A;  3V5Z A;  3V5X A;  3U9J A;  3U9M A; 
#chains in the Genus database with same CATH topology
 2FGY A;  2J46 A;  2W9Y A;  1XZP A;  1Z3I X;  2XLO A;  2XM4 A;  2Y39 A;  4YT5 A;  2R7X A;  3AQB A;  1BDJ B;  2PP4 A;  4KNW A;  3GM1 A;  3JYY A;  2LK4 A;  4RD9 A;  4XPW A;  3L34 A;  1FFH A;  1NZE A;  2A68 F;  3MX3 A;  4PJL A;  3W8I A;  5BQI A;  4IAR A;  3JCU Q;  3QVY A;  2PX3 A;  4G78 A;  2L9J A;  4CDV A;  4C3E A;  2MWQ A;  3T6J A;  1ORY A;  1V74 B;  3VRC A;  3AOU A;  3B9Q A;  3QVZ A;  4O6N A;  2J0X A;  4I3M A;  1V4A A;  3L8I A;  3W2W A;  3HNL A;  2OCC C;  2LIG A;  4C7O A;  1OW7 A;  2ICW G;  4IAQ A;  5TJ5 E;  3KPH A;  3HNI A;  5F5H A;  2DI3 A;  2Y3D A;  2EIJ C;  2VB6 A;  3NKE A;  4XPX A;  3X2Q C;  2ASR A;  3H2U A;  1Q0K A;  4I1M A;  4AK9 A;  4CS9 C;  1OCR C;  2A69 F;  1OR3 A;  3FHD A;  3G4X A;  2PF4 E;  1MQV A;  4J30 B;  4Q7C A;  3TJ6 A;  3U8V A;  2GWW A;  1Q0M A;  3U5S A;  1T9K A;  3EZH A;  4X0R A;  2LFD A;  3EHN A;  1APC A;  2L81 A;  4DBR A;  5EGY A;  2JD3 A;  1T01 A;  3V5Z A;  2Y3B A;  2RSE B;  1LE4 A;  4W8K A;  5JRA A;  4CIP A;  3HLZ A;  3GAN A;  4UDV A;  3RYL A;  2Q9C A;  3NYM A;  3HKK A;  4WAB A;  1E84 A;  4Z9J A;  3K1H A;  3RQG A;  3LEO A;  4AE4 A;  3ZTZ A;  1CPQ A;  4Z9H A;  4F4B A;  5K0I A;  1YAU O;  2EPK X;  1NU9 C;  3LES A;  4MVQ A;  3VYW A;  2IXO A;  1WN0 A;  1B68 A;  4XEF A;  1I4Z A;  3QMK A;  3LLK A;  1C02 A;  1WAT A;  4CBE A;  3UMK A;  3LAY A;  3O39 A;  2A0U A;  1SR2 A;  5L0J A;  1ZHT A;  3ZG1 A;  2IYL D;  2Q00 A;  4L6R A;  4QI2 A;  2CCY A;  4ONS A;  1RCP A;  1NFO A;  2X0C A;  2EPN A;  3C62 A;  4WJ0 A;  4K7B A;  2D5R B;  4U9E A;  5F28 E;  4HE8 D;  4DRJ B;  3N0T A;  1AEP A;  4CDY A;  2Z15 A;  3H2V A;  3CQZ A;  2WZL A;  2R7S A;  2KSF A;  2I15 A;  5L3V A;  2KW3 C;  5JUA A;  1F1M A;  3U0C A;  2F22 A;  2YRF A;  4ULV A;  5JVE A;  3L1M A;  3UR3 C;  4C7O B;  1D1C A;  1YLM A;  3C8G D;  3FXH A;  2L6F A;  3CZ6 A;  2I8B A;  3U9J A;  4E17 A;  3RVY A;  2WZG A;  3NRH A;  4EHP A;  1T6U A;  4G7H F;  4I44 A;  4P9T A;  1E85 A;  3WAQ A;  5EHH A;  1JMW A;  1TQG A;  2LCH A;  2YLG A;  3NYL A;  5T3W A;  5E33 A;  3S28 A;  3AGT A;  4BJ5 A;  5T3T A;  4BJ6 C;  3DI5 A;  2LP4 A;  4U5C E;  1ZW2 A;  2M4E A;  3AGU A;  3K1I A;  1ZYR F;  3MYI A;  1EQ1 A;  2XSE A;  1T6I A;  2X51 A;  4O7G A;  4LDK A;  1Q0D A;  3UGP A;  2ZXR A;  3T6G B;  2A1D D;  4EWC A;  2GDC A;  2OEX A;  2YHS A;  1Z5Z A;  4QDL A;  4DVY P;  3GM3 A;  3H65 A;  4NCQ A;  1G5Z A;  1PV3 A;  3S0X A;  1Y4C A;  1MMG A;  4U5E E;  1KTM A;  1U89 A;  4PJJ A;  1Z63 A;  4BEM J;  1TWC A;  2XLV A;  3DXJ F;  2IM8 A;  2W45 A;  4MW3 A;  4AE4 B;  3QTH A;  4K1O A;  4OD4 A;  2KGO A;  3Q7G A;  2Q7R A;  3VAY A;  2R03 A;  2NUT A;  3FDQ A;  2Q4F A;  4FES A;  1DOW A;  4GEH A;  1R4T A;  1G8X A;  4IWB A;  1ZHY A;  3PHF 2;  1SMY F;  4XLN F;  1K40 A;  1OXB A;  1EI7 A;  1N1C A;  5KYN A;  1W2W A;  1TR2 A;  3RF3 A;  3TOM A;  3WG7 C;  2IOQ A;  1BR1 A;  2R05 A;  2QUP A;  3AG4 C;  2YQY A;  5COG A;  3EGD A;  5B1B C;  3PMR A;  4CSA C;  2DYS C;  2XXA B;  1ZU4 A;  3C8Z A;  2VCC A;  2YL7 A;  3Q7L A;  3U9M A;  3V7O A;  1RKC A;  2NSG A;  5KYW A;  5DQZ A;  1D0Y A;  1OCC C;  3JRM O;  2OOC A;  2L6G A;  2Y69 C;  1I4Y A;  3B29 A;  4JE9 A;  3U2M A;  2HV7 A;  1NBB A;  4C3D A;  4EBK A;  3G50 A;  4JTC B;  4YJW A;  4E0I A;  3TOL A;  5GPG B;  2WVO A;  1ZZP A;  3DE8 A;  4FX5 A;  3CEX A;  2PBE A;  1A7E A;  2OJQ A;  1BR2 A;  2G62 A;  3FMS A;  3LS0 A;  3M1C B;  4JCH A;  4YN0 B;  3FAP B;  1GS9 A;  3OA1 A;  1ZW3 A;  3DZA A;  2B0H A;  3S29 A;  1Z6A A;  4OIN F;  4CDA A;  1LM3 B;  3LUT B;  3B0P A;  2YVK A;  3Q6M A;  1LIH A;  1HE1 A;  2J7P D;  4YT4 A;  2H8A A;  3JSE O;  1FFT C;  2L6H A;  2OQM A;  3L8J A;  2J9B A;  4AL0 A;  3C63 A;  2FFH A;  1C17 M;  3T9O A;  3SP1 A;  1LPE A;  1OXK A;  3IPM O;  2R7W A;  3KYJ A;  3A9C A;  2LQG A;  4N6C A;  3TJ5 A;  4CS9 A;  2G3V A;  4WGY A;  1J8M F;  2B0J A;  2QLA A;  1WWP A;  2YEV A;  3C8G A;  3R2P A;  1AVO B;  4JUR I;  1FNT c;  2XLW A;  4NTB A;  2V26 A;  2ZPA A;  3TK0 A;  4AX2 A;  2DB4 A;  2G3K A;  2EPL X;  1ORJ A;  1YA9 A;  2OU6 A;  2Q3T A;  3DJU B;  3PCV A;  3NYJ A;  1OW6 A;  1VYI A;  1VLT A;  4O6Y A;  4P9F A;  4YL1 A;  3V5Y A;  4DRI B;  2VCB A;  4LAC B;  4DVZ A;  2VH3 A;  1A7D A;  2LFF A;  1QLE C;  5FCL A;  1O87 A;  4J32 B;  4A4A A;  3U3B A;  1SZI A;  3RVZ A;  1D1B A;  2NUT B;  3O55 A;  4XPY A;  5E3C A;  2EPO A;  3RKO F;  1G4U S;  2BC5 A;  4P6I C;  4YWQ A;  1T6Q A;  1Y6D A;  3MFN A;  4DJ9 A;  2XLE A;  4XTK A;  5A69 A;  5D91 A;  2HKV A;  3TD7 A;  1VK5 A;  5L0H A;  4IB4 A;  5DLJ A;  4NC3 A;  5BUO A;  5JS5 A;  4N4W A;  1OQC A;  1MMA A;  2KJG A;  4IAO A;  2HSQ A;  4NTA A;  3SXM A;  4JCZ A;  3I5Q A;  3VM6 A;  4BPM A;  2UUH A;  3EGD B;  4ULW A;  2XL6 A;  1JPN A;  1XWJ A;  2MYS A;  1CGM E;  3M15 A;  3M4C A;  2WL8 A;  1ST6 A;  3AQC A;  2AP3 A;  2HJ3 A;  1CPR A;  2YWA A;  4U5G A;  4OIR F;  5IY5 C;  2R9R B;  3MYF A;  1FTS A;  1HY5 A;  4IRU A;  1TFK B;  3AJM A;  3IQC A;  4U5B E;  4Q4Z F;  4NQF A;  2AVK A;  1PD1 A;  4HFF B;  1JPJ A;  3F46 A;  4RDA A;  1ZHZ A;  2KQ9 A;  1ORS C;  1WOL A;  2Y3H A;  2MHR A;  3K7D A;  1BBH A;  256B A;  3E9V A;  2BL2 A;  3ABM C;  4MW8 A;  4E0H A;  4CIH A;  1ZVZ A;  2P1A A;  1XZQ A;  2HMQ A;  4BG0 A;  4EUK B;  1E83 A;  2HS5 A;  2AU5 A;  1YZC A;  3WOD F;  3AG2 C;  1ZU5 A;  5BQG A;  3JYH A;  3ZVR A;  2HMZ A;  4D4N A;  3RFY A;  2VC9 A;  2OJE D;  1U0B B;  3JRT A;  4D4X A;  3JZ0 A;  3SXY A;  2HUJ A;  1C03 A;  3F47 A;  4CJO A;  3LNM B;  2FAP B;  2YL3 A;  3GOD A;  3S90 A;  3ASO C;  4OIQ F;  1D1A A;  2QTV A;  4GYT A;  4MQ9 F;  2YLI A;  1AUE A;  2ZXP A;  4JW1 A;  4BJ6 A;  2OEV A;  3C8G B;  4AL1 A;  5AC5 A;  3DD7 A;  2PNO A;  2A6E F;  1J8Y F;  1QKR A;  3B71 A;  2LSE A;  3EH2 A;  3JSZ A;  3T4R A;  3EGX A;  4BJ1 A;  2CDQ A;  5A6B D;  3NMJ A;  3EJN A;  5B3I A;  2IBF A;  3OEO A;  3US6 A;  5L0F A;  1JOG A;  4YK5 A;  2PX0 A;  2R7O A;  3DE9 A;  3NKD A;  4MTG A;  3UMI A;  4C3B A;  3QZC A;  2VCA A;  2E87 A;  2P0N A;  2J7P A;  4KNV A;  4U5H A;  4YT8 A;  4RBN A;  3NMK A;  4IJJ A;  2OG2 A;  1WGW A;  3SZR A;  1E86 A;  1NG1 A;  4MND A;  5L3Q A;  4DXW A;  5F5F A;  1YDI A;  5FZT A;  1LI5 A;  2Y3G A;  4W8P A;  4G7O F;  3GEE A;  1O3U A;  4JVS A;  1MMD A;  2XLH A;  3DKA A;  4J7T A;  4KC9 A;  4MVZ A;  1TKN A;  4Z9I A;  4ZLC A;  3ZC4 A;  4DRH B;  1Q0G A;  3S84 A;  2ZD9 A;  3ZSU A;  1MMN A;  1QVX A;  1M2O A;  1IZM A;  3E70 C;  4CS8 C;  2J9U A;  5DS6 A;  3JTL O;  4K0D A;  4O79 A;  2XL8 A;  4LLC A;  5DS5 A;  2VAS A;  3LS1 A;  4BEJ A;  2J8W A;  3W4Y A;  1H6G A;  1RKE A;  4MS2 A;  3N24 A;  4BJT A;  4CSA A;  3TUL A;  4PK4 A;  1A41 A;  2QY9 A;  4PFO A;  3ASN C;  2CYD A;  1A7V A;  1OKK D;  1S05 A;  1LKX A;  2UUI A;  1NLX A;  1YVI A;  3HJC A;  3DAF A;  3ITF A;  1G4W R;  3EFO A;  2J0W A;  3K1I C;  4HFK B;  1SYQ A;  2TMV P;  2XM0 A;  3U8P A;  3LNR A;  3R7C A;  2DYR C;  4YT2 A;  5L0C A;  3HNJ A;  2EIN C;  3UNG C;  4U5F E;  3SXK A;  1GGQ A;  2P7V A;  3FOP A;  2WB7 A;  3IQT A;  2ETS A;  1LS1 A;  3ZQY A;  2J9W A;  3GWN A;  3QW0 A;  1RMV A;  1BZ4 A;  2P61 A;  1D0X A;  3T6B A;  3ECS A;  2EIL C;  3RH3 A;  3UMH A;  4DOZ A;  5KYU A;  1Z7Q c;  3HNK A;  2BE5 F;  3ZQV A;  1CGN A;  3JT1 A;  3IQ5 A;  3K6B A;  4I1O B;  4U9D A;  4ER9 A;  2AWY A;  3EQL F;  4FWV A;  3I5P A;  4GQH A;  1I5N A;  3EGX B;  2XLM A;  1K05 A;  1FAP B;  1YZA A;  4Q5S F;  5EK0 A;  2M64 A;  5A6K A;  4JEB A;  5L0I A;  4G0H A;  2Q9B A;  2JPU A;  4PAC A;  4OIP F;  1GM5 A;  5L0D A;  2CW0 F;  5JP7 A;  2HV6 A;  3GOR A;  2KNH A;  4MVR A;  4JJF A;  3DJN B;  4EBJ A;  3AG3 C;  4LDQ A;  2EIK C;  3CAX A;  3CSK A;  3LLI A;  4YL3 A;  3V5X A;  5KYY A;  2XLD A;  1CGO A;  2GA0 A;  5BQH A;  1TFO B;  3EPV A;  5E2Q A;  3C18 A;  2NUP A;  1PCX A;  2YKZ A;  1M2V A;  3POV A;  2C03 A;  1M56 C;  1OW8 A;  3ZIB A;  4XWJ A;  5A6J A;  4NTF A;  3DMD A;  5A6B A;  5CI8 A;  3RIP A;  2R25 A;  1Q0F A;  1OR2 A;  1T5O A;  3MLG A;  1YYX A;  4H4K C;  3K33 A;  1RKE B;  2WZF A;  1NU7 D;  1FR0 A;  1MND A;  4PJN A;  4CJG A;  3OWT A;  4XLP F;  1H9T A;  4OIO F;  3W8H A;  1UFB A;  2IXN A;  3ATP A;  1M6T A;  4B6I A;  3EFO B;  1LVK A;  4O6M A;  2V3C C;  1H7I A;  2ZXO A;  4EBB A;  4A2N B;  5HSW A;  1LE2 A;  1NFN A;  5KYW B;  3GEI A;  3S27 A;  3FOO A;  4XEV A;  3SXZ A;  5B3S C;  5HV9 A;  3KH2 A;  3J06 A;  3W2V A;  3M79 A;  1Z23 A;  1VOM A;  2QNL A;  2XS1 A;  3KYI A;  1FMW A;  2EIM C;  3NG1 A;  3VF0 A;  1JAF A;  2NPU A;  2ZXW C;  1HW2 A;  4JRZ A;  5KYU B;  3SYN A;  3NDB B;  3ABL C;  5E3A A;  1LI7 A;  2WVQ A;  1OKK A;  3EH1 A;  2RD9 A;  3GM2 A;  1FMV A;  1OCZ C;  4PJM A;  3M4B A;  4H54 A;  3LJB A;  4OD5 A;  4XEK A;  1R5I D;  3ZWI A;  3SEO A;  4KI2 A;  1V54 C;  1LS4 A;  4DBQ A;  5CIV A;  2R7U A;  1RJ9 A;  1K04 A;  2CNW D;  3DM5 A;  4M63 A;  4ZLD A;  2O9X A;  2JX0 A;  1E2X A;  5COM A;  5DVW A;  5COF A;  3RQE A;  2GAQ A;  1HMD A;  4LER A;  4JZA A;  5JLI A;  1MNE A;  2J45 A;  2XXA A;  2R7V A;  5D92 A;  2HZ8 A;  1KNY A;  1O5H A;  2W4B A;  3EG9 A;  5KYY B;  3DAG A;  1U6H A;  2NSF A;  2R7Q A;  3SNH A;  4ANJ A;  2XL4 A;  4MVU A;  1SF8 A;  3N2Z B;  1H9G A;  2A0B A;  3WHN A;  2XRH A;  2NUP B;  2GFH A;  2XS8 A;  4MVO A;  3PDM P;  1M2V B;  4G7Z F;  4MVM A;  4JIO A;  3RQF A;  1BR4 A;  3Q6N A;  4LLE A;  5T1D B;  2Q9A A;  2YZS A;  5KYX A;  3FVY A;  4JJG A;  2DGJ A;  3AG1 C;  3QW1 A;  2NG1 A;  3IQ6 A;  4N06 A;  4E7S A;  3BEH A;  1L3P A;  4J7Y A;  2YL0 A;  4QI0 A;  1OCO C;  1QSP A;  3B0V C;  4CS8 A;  4CX9 A;  1JR8 A;  1VB5 A;  1L7C A;  3DWW A;  3GEH A;  3EZI A;  3HTK C;  2CGE A;  4U5D E;  1TWG A;  4XQ1 A;  5B1A C;  3O10 A;  3S9O A;  5AC4 A;  1QZX A;  2P6V A;  3EHM A;  4JKV A;  5DQT A;  4EKW A;  5A6A A;  2YLD A;  2YL1 A;  3IEE A;  2LD6 A;  3B0U X;  3ABK C;  4YL0 A;  2EPM X;  2KYH A;  4R32 A;  2C04 A;  1HW1 A;  4WGZ A;  1VTM P;  3TQO A;  4JTA B;  4MVS A;  2AWC A;  4E18 A;  1M57 C;  1HMO A;  1QQ3 A;  1ZHX A;  3U3F A;  4BJ5 C;  1EKY A;  1DOV A;  1YYJ A;  4JTD B;  1YJG A;  4LDR A;  1TWH A;  1YA7 O;  5CI9 A;  3K66 A;  3UGO A;  5JT4 A;  2HFI A;  1YAR O;  1V55 C;  2W4M A;  4N6H A;  2R7R A;  1RXQ A;  3LEV A;  1D0Z A;  3NMI A;  1VLS A;  4JC7 A;  4HEA J;  3BRJ A;  3DM9 B;  4JEA A;  4E7Z A;  1NSG B;  1TWA A;  1A0B A;  1UG7 A;  1PD0 A;  2KK1 A;  4PFP A;  1RJ9 B;  5L0G A;  1EA8 A;  1JRA A;  2IXM A;  3G4Z A;  2KC3 A;  2H7B A;  2J9V A;  1VMA A;  1ZHW A;  2QE9 A;  1IW7 F;  3O6X A;  3KMI A;  5AGF A;  2OKU A;  2HJM A;  4MTF A;  3KL4 A;  2PFD A;  3I4U A;  3MBG A;  3EG9 B;  3ZDL A;  3RW0 A;  3C7J A;  5DS4 A;  3KKB A;  2R7T A;  3A11 A;  3U2L A;  4FAP B;  1WAS A;  4EIY A;  2H7V C;  1KU2 A;  1QPU A;  1VYK A;  3IHU A;  4CS7 A;  4KBL A;  4NY3 A;  3L0I A;  2WVN A;  3FAJ A;  2H7O A;  2A6H F;  4IGG A;  1S7Z A;  3ZTM A;  1WTY A;  2HSB A;  2L7A A;  2R02 A;  4MTO A;  3GWL A;  3X1O A;  5KYX B;  2CNW A;  5JSL A;  2IXP A;  2D4U A;  4PR9 A;  1HE9 A;  1GQA A; 
#chains in the Genus database with same CATH homology
 2P0N A;  3V5Y A;  3CAX A;  3V5Z A;  3V5X A;  3U9J A;  3U9M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...