The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
113
|
sequence length |
370
|
structure length |
353
|
Chain Sequence |
AMYGISVFLGEEITNDTIIYIKKMKALGFDGIFTSLHIPLYRQRLTDLGAIAKAEKMKIMVDISGEALKRAGFSFDELEPLIELGVTGLRMDYGITIEQMAHASHKIDIGLNASTITLEEVAELKAHQADFSRLEAWHNYYPRPETGIGTTFFNEKNRWLKELGLQVFTFVPGDGQTRGPIFAGLPTLEKHRGQNPFAAAVGLMADPYVDAVYIGDPTISERTMAQFGYYHQTNQFLLEVAPSESRYLKRILGTHTNRLDAARDVLRSELATIESEQTEARPVGTVTIDNEKYGRYMGEIQVTLVDLPKDEKVNTITRIIDKDQTILPLIKAGNQFTLVTEGTIENEFRKLNN
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
The structure of a conserved protein from locus EF_2437 in Enterococcus faecalis with an unknown function.
rcsb |
molecule tags |
Structural genomics, unknown function
|
source organism |
Enterococcus faecalis
|
molecule keywords |
Hypothetical protein DUF871
|
total genus |
113
|
structure length |
353
|
sequence length |
370
|
ec nomenclature | |
pdb deposition date | 2007-02-28 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF05913 | DUF871 | Bacterial protein of unknown function (DUF871) |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Beta | Beta Barrel | Cyclophilin | Cyclophilin-like | ||
Alpha Beta | Alpha-Beta Barrel | TIM Barrel | Aldolase class I |